5B31D

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.1.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
93
structure length
93
Chain Sequence
b'SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 38
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b31D00
3AZNA 4AWLB 3C1CD 3X1VA 3B6GB 2AROC 4KGCD 1P3MC 3AYWC 1P3FB 5DNND 3AV2D 1M1AB 2BYMA 4XZQC 2CV5D 5B0YB 4QLCD 3B0DC 5B33C 1F66B 2CWEA 4XUJC 1P3GA 3UTAA 5B1MA 1N1JA 2BYKB 5AV8A 5AV6B 5B32G 4E44A 4YM6A 3X1SC 4HGAC 1ZLAD 5GT0A 2YFVA 3X1TB 3MGSB 5CPJB 5B32B 4KHAA 4KUDA 3C1BC 4H9RA 1M1AC 4J8WD 2F8NA 1P3OC 5CPKD 1JFIB 1AOIB 3AFAB 4LD9B 4ZUXA 5B40D 3NQJB 5B2IB 3AZHA 3AN2A 3AZMD 4ZBJB 1KU5A 5AV9C 5C3IC 3AV1C 3REIC 3X1TC 5JRGD 5F99D 5G49A 5B32C 1KX4A 3KWQD 4WZSB 4H9NB 3C1CB 1ULYA 5AV5B 3UT9C 3REKB 4KGCB 4Z66A 4H9SC 1HQ3D 5DNNB 4LD9C 4YS3D 3UTBD 2CV5B 1P3BA 5E5AD 3A6ND 2HIOA 3LELD 5GT3A 4WU9C 4ZBJC 5BS7C 3LJAA 4R8PC 3WAAC 5B2JA 3MGRD 4JJNA 5KDMA 2PYOA 3R45B 4J8VA 1HTAA 4J8UA 5AV5C 3REKC 5DNMA 3B0BA 3AZFC 5GXQA 5DNNC 3MNNA 3REHD 3W97B 1BH8B 3B6GA 2AROD 1U35A 2CV5C 2JSSA 1P3MD 3AYWD 5CPKB 5AVCC 3WA9A 4CAYB 3AZEC 3O62A 4XZQD 1KX5A 1M18A 4Z5TA 3LZ1A 1P3KA 5B40B 3KUYB 5FUGA 1TZYA 5AVBB 3AZMB 1P34C 2BYKA 1BH9A 5JRGB 4E45A 3W97C 3X1SD 5BT1C 3KWQB 4NE3A 3AZIB 5JA4A 5B31A 5CPJA 3C1BD 1M1AD 1P3OD 3UTBB 4YS3B 3KUYC 3A6NB 3LELB 1M19A 5AVBC 3V9RB 5BO0A 3AFAA 4M6BA 1P3AA 3AZNC 3MGPB 5JRGC 3MGRB 3NQUB 4X23B 2F8NG 4H9QA 3MGQA 5AV9D 3X1TD 3REID 3AZIC 3AV1D 3RELA 3AZGA 5B32D 3X1UC 2NZDA 4H9NA 1B67A 3REHB 3UT9D 3AYWB 3W96B 4LD9D 3AV2A 4XZQB 3MGPC 4H9OA 4X23C 4WU9D 4QLCA 1WWSA 4WNNA 5AY8C 4NE6A 4R8PD 3WAAD 2FJ7A 2RVQC 3R45A 3REHC 3X1SB 4HGAB 5AV5D 2HUEB 3REKD 3AZFD 1ZLAA 5BNVB 3W96C 5BNXA 1BH8A 3C1BB 4J8WA 1P3OB 1TAFB 4WU8C 5CPKA 3W99B 5AVCD 3MVDB 3KSYA 1KX3C 4NE5A 3WTPB 3AZED 5B40A 2F8NK 1P34D 4EO5C 2HUEC 2YFWB 5C3IB 5AV9B 3AV1B 3REIB 3WKJA 1P3LA 5F99A 3W97D 4J8XC 5BT1D 3AZLA 1EQZA 3W99C 4H9PA 3MVDC 3UT9B 3WTPC 4JJNC 1HQ3A 3TU4C 5B24B 3UTBA 3KUYD 4J8VC 2NQBC 5E5AA 3LELA 5AVBD 4WU9B 5B0ZB 3VH5A 4G91C 1Q9CA 3AZND 5B31G 3AZJB 4R8PB 3WAAB 4UUZA 3MGRA 3NQUA 5B1LC 5GSUA 3AZKA 1P3IA 3AZID 3B0CT 4CSRA 3O62C 3X1UD 3AZFB 1M18C 3VH6A 4Z5TC 1P3KC 5CP6A 5B24C 2AROA 3KXBB 1P3MA 3AYWA 5AVCB 5B0ZC 3AZEB 3B6FA 3MGPD 4XZQA 3AZJC 4X23D 1ID3C 5B31C 5B33A 5AY8D 4XUJA 1S32A 1P34B 2F8ND 2RVQD 1P3PB 3X1SA 3KXBC 5CPIB 5BNVA 1P3FA 3W98B 3W96D 3LZ0C 1P3AC 1BFMA 1M1AA 1P3OA 4WU8D 3MGQC 5B0YA 1KX3D 3AZGC 1F66A 1H3OB 3REJB 3AZNB 3X1VB 1P3PC 5AV6A 2YFWA 5CPIC 3AV1A 3MGSA 3X1TA 3W98C 2BYMB 5B32A 3X1UB 4J8XD 3W99D 3MVDD 1JFIA 3WTPD 3UT9A 4JJND 1AOIA 1P3GB 4H9SA 2FJ7C 5B1MB 3REJC 3TU4D 4LD9A 4J8VD 2NQBD 3NQJA 5AV8B 5B2IA 4YM6B 3X1VC 4Z2MH 4WU9A 5BS7A 5AY8B 4KHAB 3WAAA 4KUDB 5B1LD 4H9RB 1U35D 2F8NB 3C1CA 3O62D 5AV5A 1M18D 3REKA 4KGCA 4Z5TD 4ZUXB 1P3GC 1P3KD 5DNNA 3UTAC 5B1MC 5B24D 3AZHB 3AN2B 2CV5A 5AV8C 4YM6C 4WU8B 5AVCA 1KX3B 5GT0C 3B0CW 5B0ZD 1B6WA 3AZEA 1P3LC 3AZJD 4KUDC 3VH5T 1ID3D 3AZLC 1EQZC 5B31D 4EO5B 3REJA 4ZUXC 4J8XB 3W97A 1P3BB 3KXBD 5GT3B 3AZHC 3AN2C 1M19D 3LZ0D 1P3AD 5CHLB 4CAYA 3LJAB 5B2JB 4JJNB 1WWIA 5KDMB 1KX4C 3MGQD 3TU4B 3AZKC 1P3IC 2IO5C 3KUYA 4J8VB 2NQBB 3RELD 3AZGD 5AVBA 3AZMA 1H3OA 4G91B 4Z66C 5GXQB 5CP6C 3MNNB 1P3PD 5JRGA 5B1LB 1U35B 1P3BC 2HIOC 5GT3C 3KWQA 3AZIA 5CPID 3WA9B 3W98D 3O62B 3B6FC 1KX5B 3X1UA 1M18B 3LJAC 5B2JC 4Z5TB 3LZ1B 1P3KB 2PYOC 5FUGB 4NFTA 4YS3A 1TZYB 3A6NA 1S32C 4J8UC 3V9RA 2FJ7D 3REJD 5DNMC 1BH9B 5GXQC 3MGPA 3MNNC 4AWLC 3X1VD 3B6GC 4X23A 1U35C 1ID3B 5JA4B 5B31B 1P3FC 3WA9C 5AY8A 1KX5C 3LZ1C 5B0YC 3REHA 1TZYC 1M19B 1F66C 5BO0B 1P3GD 3W96A 3LZ0B 1P3AB 3UTAD 5B1MD 5AV8D 4YM6D 5AV6C 4H9QB 4WU8A 3MGQB 4DRAA 4G92B 5GT0D 1KX3A 3MGSC 3RELB 3AZGB 3WKJD 1P3LD 5CPJC 4KUDD 2NZDB 3AZLD 1EQZD 1M19C 1AOIC 1R4VA 4ZUXD 3AFAC 3AV2B 4J8XA 3C1BA 5B2IC 4H9OB 3AZHD 3VH5W 3AN2D 1TAFA 4QLCB 3W99A 4G92C 3MVDA 4DRBA 4WNNB 3WTPA 3RELC 5GSUD 1KX4D 2FJ7B 3AZKD 3TU4A 1F1EA 1P3ID 2NZDC 2NQBA 3C1CC 3VH6W 2L5AA 1ZLAB 4KGCC 5AV9A 4Z66D 5CP6D 3REIA 5BNXB 3AV2C 5B1LA 1P3BD 4J8WB 2HIOD 5GT3D 4QLCC 3B6FD 3LJAD 5B2JD 2F8NH 2PYOD 3UTAB 1N1JB 5B24A 5B33D 4XUJD 1S32D 4J8UD 3WTPE 5GT0B 5DNMD 2YFVB 5B0ZA 1ZLAC 3WKJB 5GXQD 1P3LB 3MNND 5F99B 3AZJA 4R8PA 3B6GD 1ID3A 4J8WC 3AZLB 1EQZB 1P3FD 5CPKC 4H9PB 3WA9D 1KX5D 4WV4B 3AZFA 1HQ3B 3LZ1D 5B0YD 5B40C 2LY8A 5E5AB 1TZYD 3KXBA 1F66D 3AZMC 3LZ0A 3WKJC 4UUZB 5G49B 5GSUB 5F99C 5AV6D 1KX4B 3AZKB 1P3IB 3KWQC 2IO5B 3MGSD 5CPJD 4CSRB 1P34A 4Z2MG 4Z66B 5CP6B 1HQ3C 1A7WA 4YS3C 3UTBC 1P3PA 2AROB 2HIOB 5E5AC 3A6NC 3LELC 1P3MB 3VH6T 1AOID 3AFAD 5CPIA 3W98A 3B6FB 5B2ID 3MGRC 5GSUC 2PYOB 3B0DB 5B33B 4XUJB 1S32B 4J8UB 5DNMB 2NZDD
chains in the Genus database with same CATH superfamily
3AZNA 4AWLB 3C1CD 3X1VA 3B6GB 2AROC 4KGCD 1P3MC 3AYWC 1P3FB 5DNND 3AV2D 1M1AB 2BYMA 4XZQC 2CV5D 3H0MC 5B0YB 4QLCD 3B0DC 5B33C 1F66B 2CWEA 4XUJC 4DQYB 1P3GA 2Y2QA 5B1MA 3UTAA 1N1JA 2BYKB 5AV8A 5AV6B 5B32G 4E44A 4YM6A 3X1SC 4HGAC 1ZLAD 5GT0A 2YFVA 3X1TB 3MGSB 5CPJB 5B32B 4KHAA 4KUDA 3C1BC 4H9RA 1M1AC 4J8WD 2F8NA 1P3OC 5CPKD 1JFIB 2BG1A 1AOIB 3AFAB 4LD9B 4ZUXA 5B40D 3FDDA 2Y2JA 3NQJB 5B2IB 3AZHA 3AN2A 3AZMD 4ZBJB 1KU5A 5AV9C 5C3IC 3AV1C 3REIC 3X1TC 5JRGD 5F99D 5G49A 5B32C 1KX4A 2RIQA 3KWQD 4WZSB 4H9NB 1W2EA 3C1CB 1ULYA 5AV5B 3UT9C 2ZM5A 3REKB 4KGCB 4Z66A 4H9SC 1HQ3D 5DNNB 4LD9C 4YS3D 3UTBD 2CV5B 1P3BA 5E5AD 3A6ND 2HIOA 3LELD 5GT3A 4WU9C 4ZBJC 5BS7C 3LJAA 4R8PC 3WAAC 5B2JA 3MGRD 4JJNA 5KDMA 2PYOA 3R45B 4J8VA 1HTAA 4J8UA 5AV5C 3REKC 5DNMA 3B0BA 3AZFC 5GXQA 5DNNC 3MNNA 3REHD 3W97B 1BH8B 3B6GA 2AROD 1U35A 2CV5C 2JSSA 1P3MD 3AYWD 5CPKB 5AVCC 3WA9A 4CAYB 3AZEC 3O62A 4XZQD 1KX5A 1M18A 4Z5TA 3LZ1A 1P3KA 5B40B 3KUYB 5FUGA 1TZYA 5AVBB 3AZMB 1P34C 1T3UA 2BYKA 1BH9A 5JRGB 4E45A 3W97C 3X1SD 5BT1C 3KWQB 4NE3A 3AZIB 5JA4A 5B31A 5CPJA 3C1BD 1M1AD 1P3OD 2VQRA 3UTBB 4YS3B 3KUYC 3A6NB 3LELB 1M19A 5AVBC 3V9RB 5BO0A 3AFAA 4M6BA 1P3AA 3AZNC 3MGPB 5JRGC 3MGRB 3NQUB 4X23B 2F8NG 4H9QA 3MGQA 3IP4C 5AV9D 3X1TD 3REID 3AZIC 3EPKA 3AV1D 3RELA 3AZGA 5B32D 3X1UC 2NZDA 4H9NA 1B67A 3REHB 3UT9D 3AYWB 3W96B 4LD9D 3AV2A 4XZQB 3MGPC 4H9OA 4X23C 4WU9D 4QLCA 1WWSA 4WNNA 5AY8C 4NE6A 4R8PD 3WAAD 2UWXA 2FJ7A 2RVQC 3R45A 3REHC 3X1SB 4HGAB 5AV5D 2HUEB 3REKD 3AZFD 1ZLAA 5BNVB 3W96C 5BNXA 1BH8A 3C1BB 3A1KA 4J8WA 1P3OB 1TAFB 4WU8C 5CPKA 3W99B 5AVCD 3MVDB 3KSYA 1KX3C 4NE5A 3WTPB 3AZED 3AL0C 5B40A 2F8NK 1P34D 4EO5C 2HUEC 2YFWB 5C3IB 2FFFB 5AV9B 3REIB 3AV1B 3WKJA 1P3LA 5F99A 3W97D 4J8XC 5BT1D 3AZLA 1EQZA 3W99C 4H9PA 3MVDC 3UT9B 2Y2HA 3WTPC 4JJNC 1HQ3A 3TU4C 5B24B 3UTBA 3KUYD 4J8VC 2NQBC 5E5AA 3LELA 2DQNC 5AVBD 2Y2IA 4WU9B 5B0ZB 3VH5A 4G91C 1Q9CA 3AZND 5B31G 3AZJB 4R8PB 3WAAB 4UUZA 3MGRA 3NQUA 5B1LC 5GSUA 3AZKA 3EG5B 1P3IA 3AZID 3B0CT 4CSRA 3O62C 3X1UD 3AZFB 1M18C 2Y2PA 3VH6A 4Z5TC 1P3KC 5CP6A 2G5IC 5B24C 2AROA 3KXBB 1P3MA 3AYWA 5AVCB 5B0ZC 3AZEB 3B6FA 1Z2CB 4XZQA 3MGPD 2ZY5A 3AZJC 2ZY2A 4X23D 1ID3C 5B31C 5B33A 5AY8D 4XUJA 1S32A 1P34B 2F8ND 2RVQD 1P3PB 3X1SA 3KXBC 5CPIB 5BNVA 2F2AC 1P3FA 3W98B 3W96D 3LZ0C 1P3AC 1BFMA 1M1AA 3F6TA 1P3OA 4WU8D 3MGQC 5B0YA 1KX3D 3AZGC 1F66A 1H3OB 4WJ3C 3REJB 3AZNB 3X1VB 1P3PC 2G5HC 5AV6A 2Y2MA 2YFWA 5CPIC 3AV1A 3MGSA 3X1TA 3W98C 2BYMB 5B32A 3X1UB 4J8XD 3W99D 3MVDD 1JFIA 3WTPD 3UT9A 4JJND 1AOIA 1P3GB 4H9SA 2Y2KA 2FJ7C 5B1MB 3REJC 3TU4D 4LD9A 4J8VD 2NQBD 3NQJA 5AV8B 5B2IA 4YM6B 3X1VC 4Z2MH 4WU9A 5BS7A 5AY8B 4KHAB 3WAAA 4KUDB 2ZY4A 5B1LD 2J8PA 4H9RB 1U35D 2F8NB 3C1CA 3O62D 5AV5A 1M18D 3REKA 4KGCA 4Z5TD 4ZUXB 1P3GC 1P3KD 5DNNA 3UTAC 5B1MC 5B24D 3AZHB 3AN2B 2CV5A 5AV8C 4YM6C 4WU8B 3KFUG 5AVCA 1KX3B 5GT0C 3B0CW 5B0ZD 1B6WA 3AZEA 3H0RC 1P3LC 3AZJD 4KUDC 3VH5T 1ID3D 3AZLC 1EQZC 5B31D 4EO5B 3REJA 4ZUXC 4J8XB 3W97A 1P3BB 3KXBD 5GT3B 3AZHC 3AN2C 1M19D 3LZ0D 1P3AD 5CHLB 4CAYA 3LJAB 5B2JB 4JJNB 1WWIA 5KDMB 1KX4C 3MGQD 3TU4B 3EPJA 3AZKC 1P3IC 2IO5C 3KUYA 4J8VB 2NQBB 3RELD 3AZGD 5AVBA 3AZMA 1H3OA 2DF4C 4G91B 2Y2NA 4Z66C 5GXQB 5CP6C 3MNNB 1P3PD 5JRGA 5B1LB 1U35B 1P3BC 2HIOC 5GT3C 3KWQA 3AZIA 5CPID 3WA9B 3P5JB 3W98D 3O62B 3B6FC 1KX5B 3X1UA 2JE5A 1M18B 3LJAC 5B2JC 4Z5TB 3LZ1B 1P3KB 2PYOC 5FUGB 4NFTA 4YS3A 1TZYB 4UPKA 3EPHA 3A6NA 1S32C 4J8UC 3V9RA 2FJ7D 3REJD 5DNMC 1BH9B 5GXQC 3MGPA 3MNNC 4AWLC 3X1VD 3B6GC 4X23A 1U35C 1PZRA 1ID3B 2W8SA 5JA4B 5B31B 1P3FC 3WA9C 5AY8A 1KX5C 2Y2GA 3LZ1C 5B0YC 3REHA 1TZYC 1M19B 1F66C 5BO0B 1P3GD 3W96A 3LZ0B 1P3AB 3UTAD 5B1MD 3EPLA 5AV8D 4YM6D 5AV6C 4H9QB 4WU8A 3MGQB 4DRAA 4G92B 5GT0D 1KX3A 3MGSC 3RELB 3AZGB 3WKJD 2JCHA 1P3LD 5CPJC 4KUDD 2NZDB 3AZLD 1EQZD 1M19C 1AOIC 1R4VA 4ZUXD 3AFAC 3H0LC 3AV2B 4J8XA 3C1BA 5B2IC 4H9OB 3AZHD 3VH5W 3AN2D 3A1IA 1TAFA 4QLCB 3W99A 4G92C 3MVDA 4DRBA 4WNNB 3WTPA 3RELC 5GSUD 1KX4D 2FJ7B 3AZKD 3TU4A 1F1EA 1P3ID 2NZDC 2NQBA 3C1CC 3VH6W 2L5AA 1ZLAB 4KGCC 5AV9A 4Z66D 5CP6D 3REIA 5BNXB 3AV2C 2XD1A 5B1LA 1P3BD 4J8WB 2HIOD 5GT3D 4QLCC 3B6FD 3LJAD 5B2JD 2F8NH 2PYOD 3UTAB 1N1JB 5B24A 2Y2OA 5B33D 4XUJD 1S32D 4J8UD 3WTPE 5GT0B 5DNMD 2YFVB 5B0ZA 1ZLAC 3WKJB 5GXQD 1P3LB 3MNND 5F99B 3AZJA 4R8PA 3B6GD 1ID3A 4J8WC 3AZLB 1EQZB 1P3FD 5CPKC 4H9PB 3WA9D 1KX5D 4WV4B 3AZFA 1HQ3B 3LZ1D 5B0YD 5B40C 2LY8A 5E5AB 1TZYD 3KXBA 1F66D 3AZMC 3LZ0A 3WKJC 4UUZB 2Y2LA 5G49B 5GSUB 5F99C 5AV6D 1KX4B 3AZKB 1P3IB 3KWQC 2IO5B 3MGSD 2ZY3A 5CPJD 4CSRB 1P34A 4Z2MG 4Z66B 5CP6B 1HQ3C 1A7WA 4YS3C 3UTBC 1P3PA 2AROB 2HIOB 5E5AC 3A6NC 3LELC 1P3MB 3VH6T 1AOID 3AFAD 5CPIA 3W98A 3B6FB 5B2ID 2XD5A 3MGRC 5GSUC 2PYOB 3B0DB 5B33B 4XUJB 1S32B 4J8UB 5DNMB 2NZDD
chains in the Genus database with same CATH topology
3AZNA 4AWLB 3C1CD 3X1VA 3B6GB 2AROC 4KGCD 1P3MC 3AYWC 1P3FB 5DNND 3AV2D 1M1AB 2BYMA 4XZQC 2CV5D 3H0MC 5B0YB 4QLCD 3B0DC 5B33C 1F66B 2CWEA 4XUJC 4DQYB 1P3GA 2Y2QA 5B1MA 3UTAA 1N1JA 2BYKB 5AV8A 5AV6B 5B32G 4E44A 4YM6A 3X1SC 4HGAC 1ZLAD 5GT0A 2YFVA 3X1TB 3MGSB 5CPJB 5B32B 4KHAA 4KUDA 3C1BC 4H9RA 1M1AC 4J8WD 2F8NA 1P3OC 5CPKD 1JFIB 2BG1A 1AOIB 3AFAB 4LD9B 4ZUXA 5B40D 3FDDA 2Y2JA 3NQJB 5B2IB 3AZHA 3AN2A 3AZMD 4ZBJB 1KU5A 5AV9C 5C3IC 3AV1C 3REIC 3X1TC 5JRGD 5F99D 5G49A 5B32C 1KX4A 2RIQA 3KWQD 4WZSB 4H9NB 1W2EA 3C1CB 1ULYA 5AV5B 3UT9C 2ZM5A 3REKB 4KGCB 4Z66A 4H9SC 1HQ3D 5DNNB 4LD9C 4YS3D 3UTBD 2CV5B 1P3BA 5E5AD 3A6ND 2HIOA 3LELD 5GT3A 4WU9C 4ZBJC 5BS7C 3LJAA 4R8PC 3WAAC 5B2JA 3MGRD 4JJNA 5KDMA 2PYOA 3R45B 4J8VA 1HTAA 4J8UA 5AV5C 3REKC 5DNMA 3B0BA 3AZFC 5GXQA 5DNNC 3MNNA 3REHD 3W97B 1BH8B 3B6GA 2AROD 1U35A 2CV5C 2JSSA 1P3MD 3AYWD 5CPKB 5AVCC 3WA9A 4CAYB 3AZEC 3O62A 4XZQD 1KX5A 1M18A 4Z5TA 3LZ1A 1P3KA 5B40B 3KUYB 5FUGA 1TZYA 5AVBB 3AZMB 1P34C 1T3UA 2BYKA 1BH9A 5JRGB 4E45A 3W97C 3X1SD 5BT1C 3KWQB 4NE3A 3AZIB 5JA4A 5B31A 5CPJA 3C1BD 1M1AD 1P3OD 2VQRA 3UTBB 4YS3B 3KUYC 3A6NB 3LELB 1M19A 5AVBC 3V9RB 5BO0A 3AFAA 4M6BA 1P3AA 3AZNC 3MGPB 5JRGC 3MGRB 3NQUB 4X23B 2F8NG 4H9QA 3MGQA 3IP4C 5AV9D 3X1TD 3REID 3AZIC 3EPKA 3AV1D 3RELA 3AZGA 5B32D 3X1UC 2NZDA 4H9NA 1B67A 3REHB 3UT9D 3AYWB 3W96B 4LD9D 3AV2A 4XZQB 3MGPC 4H9OA 4X23C 4WU9D 4QLCA 1WWSA 4WNNA 5AY8C 4NE6A 4R8PD 3WAAD 2UWXA 2FJ7A 2RVQC 3R45A 3REHC 3X1SB 4HGAB 5AV5D 2HUEB 3REKD 3AZFD 1ZLAA 5BNVB 3W96C 5BNXA 1BH8A 3C1BB 3A1KA 4J8WA 1P3OB 1TAFB 4WU8C 5CPKA 3W99B 5AVCD 3MVDB 3KSYA 1KX3C 4NE5A 3WTPB 3AZED 3AL0C 5B40A 2F8NK 1P34D 4EO5C 2HUEC 2YFWB 5C3IB 2FFFB 5AV9B 3REIB 3AV1B 3WKJA 1P3LA 5F99A 3W97D 4J8XC 5BT1D 3AZLA 1EQZA 3W99C 4H9PA 3MVDC 3UT9B 2Y2HA 3WTPC 4JJNC 1HQ3A 3TU4C 5B24B 3UTBA 3KUYD 4J8VC 2NQBC 5E5AA 3LELA 2DQNC 5AVBD 2Y2IA 4WU9B 5B0ZB 3VH5A 4G91C 1Q9CA 3AZND 5B31G 3AZJB 4R8PB 3WAAB 4UUZA 3MGRA 3NQUA 5B1LC 5GSUA 3AZKA 3EG5B 1P3IA 3AZID 3B0CT 4CSRA 3O62C 3X1UD 3AZFB 1M18C 2Y2PA 3VH6A 4Z5TC 1P3KC 5CP6A 2G5IC 5B24C 2AROA 3KXBB 1P3MA 3AYWA 5AVCB 5B0ZC 3AZEB 3B6FA 1Z2CB 4XZQA 3MGPD 2ZY5A 3AZJC 2ZY2A 4X23D 1ID3C 5B31C 5B33A 5AY8D 4XUJA 1S32A 1P34B 2F8ND 2RVQD 1P3PB 3X1SA 3KXBC 5CPIB 5BNVA 2F2AC 1P3FA 3W98B 3W96D 3LZ0C 1P3AC 1BFMA 1M1AA 3F6TA 1P3OA 4WU8D 3MGQC 5B0YA 1KX3D 3AZGC 1F66A 1H3OB 4WJ3C 3REJB 3AZNB 3X1VB 1P3PC 2G5HC 5AV6A 2Y2MA 2YFWA 5CPIC 3AV1A 3MGSA 3X1TA 3W98C 2BYMB 5B32A 3X1UB 4J8XD 3W99D 3MVDD 1JFIA 3WTPD 3UT9A 4JJND 1AOIA 1P3GB 4H9SA 2Y2KA 2FJ7C 5B1MB 3REJC 3TU4D 4LD9A 4J8VD 2NQBD 3NQJA 5AV8B 5B2IA 4YM6B 3X1VC 4Z2MH 4WU9A 5BS7A 5AY8B 4KHAB 3WAAA 4KUDB 2ZY4A 5B1LD 2J8PA 4H9RB 1U35D 2F8NB 3C1CA 3O62D 5AV5A 1M18D 3REKA 4KGCA 4Z5TD 4ZUXB 1P3GC 1P3KD 5DNNA 3UTAC 5B1MC 5B24D 3AZHB 3AN2B 2CV5A 5AV8C 4YM6C 4WU8B 3KFUG 5AVCA 1KX3B 5GT0C 3B0CW 5B0ZD 1B6WA 3AZEA 3H0RC 1P3LC 3AZJD 4KUDC 3VH5T 1ID3D 3AZLC 1EQZC 5B31D 4EO5B 3REJA 4ZUXC 4J8XB 3W97A 1P3BB 3KXBD 5GT3B 3AZHC 3AN2C 1M19D 3LZ0D 1P3AD 5CHLB 4CAYA 3LJAB 5B2JB 4JJNB 1WWIA 5KDMB 1KX4C 3MGQD 3TU4B 3EPJA 3AZKC 1P3IC 2IO5C 3KUYA 4J8VB 2NQBB 3RELD 3AZGD 5AVBA 3AZMA 1H3OA 2DF4C 4G91B 2Y2NA 4Z66C 5GXQB 5CP6C 3MNNB 1P3PD 5JRGA 5B1LB 1U35B 1P3BC 2HIOC 5GT3C 3KWQA 3AZIA 5CPID 3WA9B 3P5JB 3W98D 3O62B 3B6FC 1KX5B 3X1UA 2JE5A 1M18B 3LJAC 5B2JC 4Z5TB 3LZ1B 1P3KB 2PYOC 5FUGB 4NFTA 4YS3A 1TZYB 4UPKA 3EPHA 3A6NA 1S32C 4J8UC 3V9RA 2FJ7D 3REJD 5DNMC 1BH9B 5GXQC 3MGPA 3MNNC 4AWLC 3X1VD 3B6GC 4X23A 1U35C 1PZRA 1ID3B 2W8SA 5JA4B 5B31B 1P3FC 3WA9C 5AY8A 1KX5C 2Y2GA 3LZ1C 5B0YC 3REHA 1TZYC 1M19B 1F66C 5BO0B 1P3GD 3W96A 3LZ0B 1P3AB 3UTAD 5B1MD 3EPLA 5AV8D 4YM6D 5AV6C 4H9QB 4WU8A 3MGQB 4DRAA 4G92B 5GT0D 1KX3A 3MGSC 3RELB 3AZGB 3WKJD 2JCHA 1P3LD 5CPJC 4KUDD 2NZDB 3AZLD 1EQZD 1M19C 1AOIC 1R4VA 4ZUXD 3AFAC 3H0LC 3AV2B 4J8XA 3C1BA 5B2IC 4H9OB 3AZHD 3VH5W 3AN2D 3A1IA 1TAFA 4QLCB 3W99A 4G92C 3MVDA 4DRBA 4WNNB 3WTPA 3RELC 5GSUD 1KX4D 2FJ7B 3AZKD 3TU4A 1F1EA 1P3ID 2NZDC 2NQBA 3C1CC 3VH6W 2L5AA 1ZLAB 4KGCC 5AV9A 4Z66D 5CP6D 3REIA 5BNXB 3AV2C 2XD1A 5B1LA 1P3BD 4J8WB 2HIOD 5GT3D 4QLCC 3B6FD 3LJAD 5B2JD 2F8NH 2PYOD 3UTAB 1N1JB 5B24A 2Y2OA 5B33D 4XUJD 1S32D 4J8UD 3WTPE 5GT0B 5DNMD 2YFVB 5B0ZA 1ZLAC 3WKJB 5GXQD 1P3LB 3MNND 5F99B 3AZJA 4R8PA 3B6GD 1ID3A 4J8WC 3AZLB 1EQZB 1P3FD 5CPKC 4H9PB 3WA9D 1KX5D 4WV4B 3AZFA 1HQ3B 3LZ1D 5B0YD 5B40C 2LY8A 5E5AB 1TZYD 3KXBA 1F66D 3AZMC 3LZ0A 3WKJC 4UUZB 2Y2LA 5G49B 5GSUB 5F99C 5AV6D 1KX4B 3AZKB 1P3IB 3KWQC 2IO5B 3MGSD 2ZY3A 5CPJD 4CSRB 1P34A 4Z2MG 4Z66B 5CP6B 1HQ3C 1A7WA 4YS3C 3UTBC 1P3PA 2AROB 2HIOB 5E5AC 3A6NC 3LELC 1P3MB 3VH6T 1AOID 3AFAD 5CPIA 3W98A 3B6FB 5B2ID 2XD5A 3MGRC 5GSUC 2PYOB 3B0DB 5B33B 4XUJB 1S32B 4J8UB 5DNMB 2NZDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZN A;  4AWL B;  3C1C D;  3X1V A;  3B6G B;  2ARO C;  4KGC D;  1P3M C;  3AYW C;  1P3F B;  5DNN D;  3AV2 D;  1M1A B;  2BYM A;  4XZQ C;  2CV5 D;  5B0Y B;  4QLC D;  3B0D C;  5B33 C;  1F66 B;  2CWE A;  4XUJ C;  1P3G A;  3UTA A;  5B1M A;  1N1J A;  2BYK B;  5AV8 A;  5AV6 B;  5B32 G;  4E44 A;  4YM6 A;  3X1S C;  4HGA C;  1ZLA D;  5GT0 A;  2YFV A;  3X1T B;  3MGS B;  5CPJ B;  5B32 B;  4KHA A;  4KUD A;  3C1B C;  4H9R A;  1M1A C;  4J8W D;  2F8N A;  1P3O C;  5CPK D;  1JFI B;  1AOI B;  3AFA B;  4LD9 B;  4ZUX A;  5B40 D;  3NQJ B;  5B2I B;  3AZH A;  3AN2 A;  3AZM D;  4ZBJ B;  1KU5 A;  5AV9 C;  5C3I C;  3AV1 C;  3REI C;  3X1T C;  5JRG D;  5F99 D;  5G49 A;  5B32 C;  1KX4 A;  3KWQ D;  4WZS B;  4H9N B;  3C1C B;  1ULY A;  5AV5 B;  3UT9 C;  3REK B;  4KGC B;  4Z66 A;  4H9S C;  1HQ3 D;  5DNN B;  4LD9 C;  4YS3 D;  3UTB D;  2CV5 B;  1P3B A;  5E5A D;  3A6N D;  2HIO A;  3LEL D;  5GT3 A;  4WU9 C;  4ZBJ C;  5BS7 C;  3LJA A;  4R8P C;  3WAA C;  5B2J A;  3MGR D;  4JJN A;  5KDM A;  2PYO A;  3R45 B;  4J8V A;  1HTA A;  4J8U A;  5AV5 C;  3REK C;  5DNM A;  3B0B A;  3AZF C;  5GXQ A;  5DNN C;  3MNN A;  3REH D;  3W97 B;  1BH8 B;  3B6G A;  2ARO D;  1U35 A;  2CV5 C;  2JSS A;  1P3M D;  3AYW D;  5CPK B;  5AVC C;  3WA9 A;  4CAY B;  3AZE C;  3O62 A;  4XZQ D;  1KX5 A;  1M18 A;  4Z5T A;  3LZ1 A;  1P3K A;  5B40 B;  3KUY B;  5FUG A;  1TZY A;  5AVB B;  3AZM B;  1P34 C;  2BYK A;  1BH9 A;  5JRG B;  4E45 A;  3W97 C;  3X1S D;  5BT1 C;  3KWQ B;  4NE3 A;  3AZI B;  5JA4 A;  5B31 A;  5CPJ A;  3C1B D;  1M1A D;  1P3O D;  3UTB B;  4YS3 B;  3KUY C;  3A6N B;  3LEL B;  1M19 A;  5AVB C;  3V9R B;  5BO0 A;  3AFA A;  4M6B A;  1P3A A;  3AZN C;  3MGP B;  5JRG C;  3MGR B;  3NQU B;  4X23 B;  2F8N G;  4H9Q A;  3MGQ A;  5AV9 D;  3X1T D;  3REI D;  3AZI C;  3AV1 D;  3REL A;  3AZG A;  5B32 D;  3X1U C;  2NZD A;  4H9N A;  1B67 A;  3REH B;  3UT9 D;  3AYW B;  3W96 B;  4LD9 D;  3AV2 A;  4XZQ B;  3MGP C;  4H9O A;  4X23 C;  4WU9 D;  4QLC A;  1WWS A;  4WNN A;  5AY8 C;  4NE6 A;  4R8P D;  3WAA D;  2FJ7 A;  2RVQ C;  3R45 A;  3REH C;  3X1S B;  4HGA B;  5AV5 D;  2HUE B;  3REK D;  3AZF D;  1ZLA A;  5BNV B;  3W96 C;  5BNX A;  1BH8 A;  3C1B B;  4J8W A;  1P3O B;  1TAF B;  4WU8 C;  5CPK A;  3W99 B;  5AVC D;  3MVD B;  3KSY A;  1KX3 C;  4NE5 A;  3WTP B;  3AZE D;  5B40 A;  2F8N K;  1P34 D;  4EO5 C;  2HUE C;  2YFW B;  5C3I B;  5AV9 B;  3AV1 B;  3REI B;  3WKJ A;  1P3L A;  5F99 A;  3W97 D;  4J8X C;  5BT1 D;  3AZL A;  1EQZ A;  3W99 C;  4H9P A;  3MVD C;  3UT9 B;  3WTP C;  4JJN C;  1HQ3 A;  3TU4 C;  5B24 B;  3UTB A;  3KUY D;  4J8V C;  2NQB C;  5E5A A;  3LEL A;  5AVB D;  4WU9 B;  5B0Z B;  3VH5 A;  4G91 C;  1Q9C A;  3AZN D;  5B31 G;  3AZJ B;  4R8P B;  3WAA B;  4UUZ A;  3MGR A;  3NQU A;  5B1L C;  5GSU A;  3AZK A;  1P3I A;  3AZI D;  3B0C T;  4CSR A;  3O62 C;  3X1U D;  3AZF B;  1M18 C;  3VH6 A;  4Z5T C;  1P3K C;  5CP6 A;  5B24 C;  2ARO A;  3KXB B;  1P3M A;  3AYW A;  5AVC B;  5B0Z C;  3AZE B;  3B6F A;  3MGP D;  4XZQ A;  3AZJ C;  4X23 D;  1ID3 C;  5B31 C;  5B33 A;  5AY8 D;  4XUJ A;  1S32 A;  1P34 B;  2F8N D;  2RVQ D;  1P3P B;  3X1S A;  3KXB C;  5CPI B;  5BNV A;  1P3F A;  3W98 B;  3W96 D;  3LZ0 C;  1P3A C;  1BFM A;  1M1A A;  1P3O A;  4WU8 D;  3MGQ C;  5B0Y A;  1KX3 D;  3AZG C;  1F66 A;  1H3O B;  3REJ B;  3AZN B;  3X1V B;  1P3P C;  5AV6 A;  2YFW A;  5CPI C;  3AV1 A;  3MGS A;  3X1T A;  3W98 C;  2BYM B;  5B32 A;  3X1U B;  4J8X D;  3W99 D;  3MVD D;  1JFI A;  3WTP D;  3UT9 A;  4JJN D;  1AOI A;  1P3G B;  4H9S A;  2FJ7 C;  5B1M B;  3REJ C;  3TU4 D;  4LD9 A;  4J8V D;  2NQB D;  3NQJ A;  5AV8 B;  5B2I A;  4YM6 B;  3X1V C;  4Z2M H;  4WU9 A;  5BS7 A;  5AY8 B;  4KHA B;  3WAA A;  4KUD B;  5B1L D;  4H9R B;  1U35 D;  2F8N B;  3C1C A;  3O62 D;  5AV5 A;  1M18 D;  3REK A;  4KGC A;  4Z5T D;  4ZUX B;  1P3G C;  1P3K D;  5DNN A;  3UTA C;  5B1M C;  5B24 D;  3AZH B;  3AN2 B;  2CV5 A;  5AV8 C;  4YM6 C;  4WU8 B;  5AVC A;  1KX3 B;  5GT0 C;  3B0C W;  5B0Z D;  1B6W A;  3AZE A;  1P3L C;  3AZJ D;  4KUD C;  3VH5 T;  1ID3 D;  3AZL C;  1EQZ C;  5B31 D;  4EO5 B;  3REJ A;  4ZUX C;  4J8X B;  3W97 A;  1P3B B;  3KXB D;  5GT3 B;  3AZH C;  3AN2 C;  1M19 D;  3LZ0 D;  1P3A D;  5CHL B;  4CAY A;  3LJA B;  5B2J B;  4JJN B;  1WWI A;  5KDM B;  1KX4 C;  3MGQ D;  3TU4 B;  3AZK C;  1P3I C;  2IO5 C;  3KUY A;  4J8V B;  2NQB B;  3REL D;  3AZG D;  5AVB A;  3AZM A;  1H3O A;  4G91 B;  4Z66 C;  5GXQ B;  5CP6 C;  3MNN B;  1P3P D;  5JRG A;  5B1L B;  1U35 B;  1P3B C;  2HIO C;  5GT3 C;  3KWQ A;  3AZI A;  5CPI D;  3WA9 B;  3W98 D;  3O62 B;  3B6F C;  1KX5 B;  3X1U A;  1M18 B;  3LJA C;  5B2J C;  4Z5T B;  3LZ1 B;  1P3K B;  2PYO C;  5FUG B;  4NFT A;  4YS3 A;  1TZY B;  3A6N A;  1S32 C;  4J8U C;  3V9R A;  2FJ7 D;  3REJ D;  5DNM C;  1BH9 B;  5GXQ C;  3MGP A;  3MNN C;  4AWL C;  3X1V D;  3B6G C;  4X23 A;  1U35 C;  1ID3 B;  5JA4 B;  5B31 B;  1P3F C;  3WA9 C;  5AY8 A;  1KX5 C;  3LZ1 C;  5B0Y C;  3REH A;  1TZY C;  1M19 B;  1F66 C;  5BO0 B;  1P3G D;  3W96 A;  3LZ0 B;  1P3A B;  3UTA D;  5B1M D;  5AV8 D;  4YM6 D;  5AV6 C;  4H9Q B;  4WU8 A;  3MGQ B;  4DRA A;  4G92 B;  5GT0 D;  1KX3 A;  3MGS C;  3REL B;  3AZG B;  3WKJ D;  1P3L D;  5CPJ C;  4KUD D;  2NZD B;  3AZL D;  1EQZ D;  1M19 C;  1AOI C;  1R4V A;  4ZUX D;  3AFA C;  3AV2 B;  4J8X A;  3C1B A;  5B2I C;  4H9O B;  3AZH D;  3VH5 W;  3AN2 D;  1TAF A;  4QLC B;  3W99 A;  4G92 C;  3MVD A;  4DRB A;  4WNN B;  3WTP A;  3REL C;  5GSU D;  1KX4 D;  2FJ7 B;  3AZK D;  3TU4 A;  1F1E A;  1P3I D;  2NZD C;  2NQB A;  3C1C C;  3VH6 W;  2L5A A;  1ZLA B;  4KGC C;  5AV9 A;  4Z66 D;  5CP6 D;  3REI A;  5BNX B;  3AV2 C;  5B1L A;  1P3B D;  4J8W B;  2HIO D;  5GT3 D;  4QLC C;  3B6F D;  3LJA D;  5B2J D;  2F8N H;  2PYO D;  3UTA B;  1N1J B;  5B24 A;  5B33 D;  4XUJ D;  1S32 D;  4J8U D;  3WTP E;  5GT0 B;  5DNM D;  2YFV B;  5B0Z A;  1ZLA C;  3WKJ B;  5GXQ D;  1P3L B;  3MNN D;  5F99 B;  3AZJ A;  4R8P A;  3B6G D;  1ID3 A;  4J8W C;  3AZL B;  1EQZ B;  1P3F D;  5CPK C;  4H9P B;  3WA9 D;  1KX5 D;  4WV4 B;  3AZF A;  1HQ3 B;  3LZ1 D;  5B0Y D;  5B40 C;  2LY8 A;  5E5A B;  1TZY D;  3KXB A;  1F66 D;  3AZM C;  3LZ0 A;  3WKJ C;  4UUZ B;  5G49 B;  5GSU B;  5F99 C;  5AV6 D;  1KX4 B;  3AZK B;  1P3I B;  3KWQ C;  2IO5 B;  3MGS D;  5CPJ D;  4CSR B;  1P34 A;  4Z2M G;  4Z66 B;  5CP6 B;  1HQ3 C;  1A7W A;  4YS3 C;  3UTB C;  1P3P A;  2ARO B;  2HIO B;  5E5A C;  3A6N C;  3LEL C;  1P3M B;  3VH6 T;  1AOI D;  3AFA D;  5CPI A;  3W98 A;  3B6F B;  5B2I D;  3MGR C;  5GSU C;  2PYO B;  3B0D B;  5B33 B;  4XUJ B;  1S32 B;  4J8U B;  5DNM B;  2NZD D; 
#chains in the Genus database with same CATH topology
 3AZN A;  4AWL B;  3C1C D;  3X1V A;  3B6G B;  2ARO C;  4KGC D;  1P3M C;  3AYW C;  1P3F B;  5DNN D;  3AV2 D;  1M1A B;  2BYM A;  4XZQ C;  2CV5 D;  3H0M C;  5B0Y B;  4QLC D;  3B0D C;  5B33 C;  1F66 B;  2CWE A;  4XUJ C;  4DQY B;  1P3G A;  2Y2Q A;  5B1M A;  3UTA A;  1N1J A;  2BYK B;  5AV8 A;  5AV6 B;  5B32 G;  4E44 A;  4YM6 A;  3X1S C;  4HGA C;  1ZLA D;  5GT0 A;  2YFV A;  3X1T B;  3MGS B;  5CPJ B;  5B32 B;  4KHA A;  4KUD A;  3C1B C;  4H9R A;  1M1A C;  4J8W D;  2F8N A;  1P3O C;  5CPK D;  1JFI B;  2BG1 A;  1AOI B;  3AFA B;  4LD9 B;  4ZUX A;  5B40 D;  3FDD A;  2Y2J A;  3NQJ B;  5B2I B;  3AZH A;  3AN2 A;  3AZM D;  4ZBJ B;  1KU5 A;  5AV9 C;  5C3I C;  3AV1 C;  3REI C;  3X1T C;  5JRG D;  5F99 D;  5G49 A;  5B32 C;  1KX4 A;  2RIQ A;  3KWQ D;  4WZS B;  4H9N B;  1W2E A;  3C1C B;  1ULY A;  5AV5 B;  3UT9 C;  2ZM5 A;  3REK B;  4KGC B;  4Z66 A;  4H9S C;  1HQ3 D;  5DNN B;  4LD9 C;  4YS3 D;  3UTB D;  2CV5 B;  1P3B A;  5E5A D;  3A6N D;  2HIO A;  3LEL D;  5GT3 A;  4WU9 C;  4ZBJ C;  5BS7 C;  3LJA A;  4R8P C;  3WAA C;  5B2J A;  3MGR D;  4JJN A;  5KDM A;  2PYO A;  3R45 B;  4J8V A;  1HTA A;  4J8U A;  5AV5 C;  3REK C;  5DNM A;  3B0B A;  3AZF C;  5GXQ A;  5DNN C;  3MNN A;  3REH D;  3W97 B;  1BH8 B;  3B6G A;  2ARO D;  1U35 A;  2CV5 C;  2JSS A;  1P3M D;  3AYW D;  5CPK B;  5AVC C;  3WA9 A;  4CAY B;  3AZE C;  3O62 A;  4XZQ D;  1KX5 A;  1M18 A;  4Z5T A;  3LZ1 A;  1P3K A;  5B40 B;  3KUY B;  5FUG A;  1TZY A;  5AVB B;  3AZM B;  1P34 C;  1T3U A;  2BYK A;  1BH9 A;  5JRG B;  4E45 A;  3W97 C;  3X1S D;  5BT1 C;  3KWQ B;  4NE3 A;  3AZI B;  5JA4 A;  5B31 A;  5CPJ A;  3C1B D;  1M1A D;  1P3O D;  2VQR A;  3UTB B;  4YS3 B;  3KUY C;  3A6N B;  3LEL B;  1M19 A;  5AVB C;  3V9R B;  5BO0 A;  3AFA A;  4M6B A;  1P3A A;  3AZN C;  3MGP B;  5JRG C;  3MGR B;  3NQU B;  4X23 B;  2F8N G;  4H9Q A;  3MGQ A;  3IP4 C;  5AV9 D;  3X1T D;  3REI D;  3AZI C;  3EPK A;  3AV1 D;  3REL A;  3AZG A;  5B32 D;  3X1U C;  2NZD A;  4H9N A;  1B67 A;  3REH B;  3UT9 D;  3AYW B;  3W96 B;  4LD9 D;  3AV2 A;  4XZQ B;  3MGP C;  4H9O A;  4X23 C;  4WU9 D;  4QLC A;  1WWS A;  4WNN A;  5AY8 C;  4NE6 A;  4R8P D;  3WAA D;  2UWX A;  2FJ7 A;  2RVQ C;  3R45 A;  3REH C;  3X1S B;  4HGA B;  5AV5 D;  2HUE B;  3REK D;  3AZF D;  1ZLA A;  5BNV B;  3W96 C;  5BNX A;  1BH8 A;  3C1B B;  3A1K A;  4J8W A;  1P3O B;  1TAF B;  4WU8 C;  5CPK A;  3W99 B;  5AVC D;  3MVD B;  3KSY A;  1KX3 C;  4NE5 A;  3WTP B;  3AZE D;  3AL0 C;  5B40 A;  2F8N K;  1P34 D;  4EO5 C;  2HUE C;  2YFW B;  5C3I B;  2FFF B;  5AV9 B;  3REI B;  3AV1 B;  3WKJ A;  1P3L A;  5F99 A;  3W97 D;  4J8X C;  5BT1 D;  3AZL A;  1EQZ A;  3W99 C;  4H9P A;  3MVD C;  3UT9 B;  2Y2H A;  3WTP C;  4JJN C;  1HQ3 A;  3TU4 C;  5B24 B;  3UTB A;  3KUY D;  4J8V C;  2NQB C;  5E5A A;  3LEL A;  2DQN C;  5AVB D;  2Y2I A;  4WU9 B;  5B0Z B;  3VH5 A;  4G91 C;  1Q9C A;  3AZN D;  5B31 G;  3AZJ B;  4R8P B;  3WAA B;  4UUZ A;  3MGR A;  3NQU A;  5B1L C;  5GSU A;  3AZK A;  3EG5 B;  1P3I A;  3AZI D;  3B0C T;  4CSR A;  3O62 C;  3X1U D;  3AZF B;  1M18 C;  2Y2P A;  3VH6 A;  4Z5T C;  1P3K C;  5CP6 A;  2G5I C;  5B24 C;  2ARO A;  3KXB B;  1P3M A;  3AYW A;  5AVC B;  5B0Z C;  3AZE B;  3B6F A;  1Z2C B;  4XZQ A;  3MGP D;  2ZY5 A;  3AZJ C;  2ZY2 A;  4X23 D;  1ID3 C;  5B31 C;  5B33 A;  5AY8 D;  4XUJ A;  1S32 A;  1P34 B;  2F8N D;  2RVQ D;  1P3P B;  3X1S A;  3KXB C;  5CPI B;  5BNV A;  2F2A C;  1P3F A;  3W98 B;  3W96 D;  3LZ0 C;  1P3A C;  1BFM A;  1M1A A;  3F6T A;  1P3O A;  4WU8 D;  3MGQ C;  5B0Y A;  1KX3 D;  3AZG C;  1F66 A;  1H3O B;  4WJ3 C;  3REJ B;  3AZN B;  3X1V B;  1P3P C;  2G5H C;  5AV6 A;  2Y2M A;  2YFW A;  5CPI C;  3AV1 A;  3MGS A;  3X1T A;  3W98 C;  2BYM B;  5B32 A;  3X1U B;  4J8X D;  3W99 D;  3MVD D;  1JFI A;  3WTP D;  3UT9 A;  4JJN D;  1AOI A;  1P3G B;  4H9S A;  2Y2K A;  2FJ7 C;  5B1M B;  3REJ C;  3TU4 D;  4LD9 A;  4J8V D;  2NQB D;  3NQJ A;  5AV8 B;  5B2I A;  4YM6 B;  3X1V C;  4Z2M H;  4WU9 A;  5BS7 A;  5AY8 B;  4KHA B;  3WAA A;  4KUD B;  2ZY4 A;  5B1L D;  2J8P A;  4H9R B;  1U35 D;  2F8N B;  3C1C A;  3O62 D;  5AV5 A;  1M18 D;  3REK A;  4KGC A;  4Z5T D;  4ZUX B;  1P3G C;  1P3K D;  5DNN A;  3UTA C;  5B1M C;  5B24 D;  3AZH B;  3AN2 B;  2CV5 A;  5AV8 C;  4YM6 C;  4WU8 B;  3KFU G;  5AVC A;  1KX3 B;  5GT0 C;  3B0C W;  5B0Z D;  1B6W A;  3AZE A;  3H0R C;  1P3L C;  3AZJ D;  4KUD C;  3VH5 T;  1ID3 D;  3AZL C;  1EQZ C;  5B31 D;  4EO5 B;  3REJ A;  4ZUX C;  4J8X B;  3W97 A;  1P3B B;  3KXB D;  5GT3 B;  3AZH C;  3AN2 C;  1M19 D;  3LZ0 D;  1P3A D;  5CHL B;  4CAY A;  3LJA B;  5B2J B;  4JJN B;  1WWI A;  5KDM B;  1KX4 C;  3MGQ D;  3TU4 B;  3EPJ A;  3AZK C;  1P3I C;  2IO5 C;  3KUY A;  4J8V B;  2NQB B;  3REL D;  3AZG D;  5AVB A;  3AZM A;  1H3O A;  2DF4 C;  4G91 B;  2Y2N A;  4Z66 C;  5GXQ B;  5CP6 C;  3MNN B;  1P3P D;  5JRG A;  5B1L B;  1U35 B;  1P3B C;  2HIO C;  5GT3 C;  3KWQ A;  3AZI A;  5CPI D;  3WA9 B;  3P5J B;  3W98 D;  3O62 B;  3B6F C;  1KX5 B;  3X1U A;  2JE5 A;  1M18 B;  3LJA C;  5B2J C;  4Z5T B;  3LZ1 B;  1P3K B;  2PYO C;  5FUG B;  4NFT A;  4YS3 A;  1TZY B;  4UPK A;  3EPH A;  3A6N A;  1S32 C;  4J8U C;  3V9R A;  2FJ7 D;  3REJ D;  5DNM C;  1BH9 B;  5GXQ C;  3MGP A;  3MNN C;  4AWL C;  3X1V D;  3B6G C;  4X23 A;  1U35 C;  1PZR A;  1ID3 B;  2W8S A;  5JA4 B;  5B31 B;  1P3F C;  3WA9 C;  5AY8 A;  1KX5 C;  2Y2G A;  3LZ1 C;  5B0Y C;  3REH A;  1TZY C;  1M19 B;  1F66 C;  5BO0 B;  1P3G D;  3W96 A;  3LZ0 B;  1P3A B;  3UTA D;  5B1M D;  3EPL A;  5AV8 D;  4YM6 D;  5AV6 C;  4H9Q B;  4WU8 A;  3MGQ B;  4DRA A;  4G92 B;  5GT0 D;  1KX3 A;  3MGS C;  3REL B;  3AZG B;  3WKJ D;  2JCH A;  1P3L D;  5CPJ C;  4KUD D;  2NZD B;  3AZL D;  1EQZ D;  1M19 C;  1AOI C;  1R4V A;  4ZUX D;  3AFA C;  3H0L C;  3AV2 B;  4J8X A;  3C1B A;  5B2I C;  4H9O B;  3AZH D;  3VH5 W;  3AN2 D;  3A1I A;  1TAF A;  4QLC B;  3W99 A;  4G92 C;  3MVD A;  4DRB A;  4WNN B;  3WTP A;  3REL C;  5GSU D;  1KX4 D;  2FJ7 B;  3AZK D;  3TU4 A;  1F1E A;  1P3I D;  2NZD C;  2NQB A;  3C1C C;  3VH6 W;  2L5A A;  1ZLA B;  4KGC C;  5AV9 A;  4Z66 D;  5CP6 D;  3REI A;  5BNX B;  3AV2 C;  2XD1 A;  5B1L A;  1P3B D;  4J8W B;  2HIO D;  5GT3 D;  4QLC C;  3B6F D;  3LJA D;  5B2J D;  2F8N H;  2PYO D;  3UTA B;  1N1J B;  5B24 A;  2Y2O A;  5B33 D;  4XUJ D;  1S32 D;  4J8U D;  3WTP E;  5GT0 B;  5DNM D;  2YFV B;  5B0Z A;  1ZLA C;  3WKJ B;  5GXQ D;  1P3L B;  3MNN D;  5F99 B;  3AZJ A;  4R8P A;  3B6G D;  1ID3 A;  4J8W C;  3AZL B;  1EQZ B;  1P3F D;  5CPK C;  4H9P B;  3WA9 D;  1KX5 D;  4WV4 B;  3AZF A;  1HQ3 B;  3LZ1 D;  5B0Y D;  5B40 C;  2LY8 A;  5E5A B;  1TZY D;  3KXB A;  1F66 D;  3AZM C;  3LZ0 A;  3WKJ C;  4UUZ B;  2Y2L A;  5G49 B;  5GSU B;  5F99 C;  5AV6 D;  1KX4 B;  3AZK B;  1P3I B;  3KWQ C;  2IO5 B;  3MGS D;  2ZY3 A;  5CPJ D;  4CSR B;  1P34 A;  4Z2M G;  4Z66 B;  5CP6 B;  1HQ3 C;  1A7W A;  4YS3 C;  3UTB C;  1P3P A;  2ARO B;  2HIO B;  5E5A C;  3A6N C;  3LEL C;  1P3M B;  3VH6 T;  1AOI D;  3AFA D;  5CPI A;  3W98 A;  3B6F B;  5B2I D;  2XD5 A;  3MGR C;  5GSU C;  2PYO B;  3B0D B;  5B33 B;  4XUJ B;  1S32 B;  4J8U B;  5DNM B;  2NZD D; 
#chains in the Genus database with same CATH homology
 3AZN A;  4AWL B;  3C1C D;  3X1V A;  3B6G B;  2ARO C;  4KGC D;  1P3M C;  3AYW C;  1P3F B;  5DNN D;  3AV2 D;  1M1A B;  2BYM A;  4XZQ C;  2CV5 D;  3H0M C;  5B0Y B;  4QLC D;  3B0D C;  5B33 C;  1F66 B;  2CWE A;  4XUJ C;  4DQY B;  1P3G A;  2Y2Q A;  5B1M A;  3UTA A;  1N1J A;  2BYK B;  5AV8 A;  5AV6 B;  5B32 G;  4E44 A;  4YM6 A;  3X1S C;  4HGA C;  1ZLA D;  5GT0 A;  2YFV A;  3X1T B;  3MGS B;  5CPJ B;  5B32 B;  4KHA A;  4KUD A;  3C1B C;  4H9R A;  1M1A C;  4J8W D;  2F8N A;  1P3O C;  5CPK D;  1JFI B;  2BG1 A;  1AOI B;  3AFA B;  4LD9 B;  4ZUX A;  5B40 D;  3FDD A;  2Y2J A;  3NQJ B;  5B2I B;  3AZH A;  3AN2 A;  3AZM D;  4ZBJ B;  1KU5 A;  5AV9 C;  5C3I C;  3AV1 C;  3REI C;  3X1T C;  5JRG D;  5F99 D;  5G49 A;  5B32 C;  1KX4 A;  2RIQ A;  3KWQ D;  4WZS B;  4H9N B;  1W2E A;  3C1C B;  1ULY A;  5AV5 B;  3UT9 C;  2ZM5 A;  3REK B;  4KGC B;  4Z66 A;  4H9S C;  1HQ3 D;  5DNN B;  4LD9 C;  4YS3 D;  3UTB D;  2CV5 B;  1P3B A;  5E5A D;  3A6N D;  2HIO A;  3LEL D;  5GT3 A;  4WU9 C;  4ZBJ C;  5BS7 C;  3LJA A;  4R8P C;  3WAA C;  5B2J A;  3MGR D;  4JJN A;  5KDM A;  2PYO A;  3R45 B;  4J8V A;  1HTA A;  4J8U A;  5AV5 C;  3REK C;  5DNM A;  3B0B A;  3AZF C;  5GXQ A;  5DNN C;  3MNN A;  3REH D;  3W97 B;  1BH8 B;  3B6G A;  2ARO D;  1U35 A;  2CV5 C;  2JSS A;  1P3M D;  3AYW D;  5CPK B;  5AVC C;  3WA9 A;  4CAY B;  3AZE C;  3O62 A;  4XZQ D;  1KX5 A;  1M18 A;  4Z5T A;  3LZ1 A;  1P3K A;  5B40 B;  3KUY B;  5FUG A;  1TZY A;  5AVB B;  3AZM B;  1P34 C;  1T3U A;  2BYK A;  1BH9 A;  5JRG B;  4E45 A;  3W97 C;  3X1S D;  5BT1 C;  3KWQ B;  4NE3 A;  3AZI B;  5JA4 A;  5B31 A;  5CPJ A;  3C1B D;  1M1A D;  1P3O D;  2VQR A;  3UTB B;  4YS3 B;  3KUY C;  3A6N B;  3LEL B;  1M19 A;  5AVB C;  3V9R B;  5BO0 A;  3AFA A;  4M6B A;  1P3A A;  3AZN C;  3MGP B;  5JRG C;  3MGR B;  3NQU B;  4X23 B;  2F8N G;  4H9Q A;  3MGQ A;  3IP4 C;  5AV9 D;  3X1T D;  3REI D;  3AZI C;  3EPK A;  3AV1 D;  3REL A;  3AZG A;  5B32 D;  3X1U C;  2NZD A;  4H9N A;  1B67 A;  3REH B;  3UT9 D;  3AYW B;  3W96 B;  4LD9 D;  3AV2 A;  4XZQ B;  3MGP C;  4H9O A;  4X23 C;  4WU9 D;  4QLC A;  1WWS A;  4WNN A;  5AY8 C;  4NE6 A;  4R8P D;  3WAA D;  2UWX A;  2FJ7 A;  2RVQ C;  3R45 A;  3REH C;  3X1S B;  4HGA B;  5AV5 D;  2HUE B;  3REK D;  3AZF D;  1ZLA A;  5BNV B;  3W96 C;  5BNX A;  1BH8 A;  3C1B B;  3A1K A;  4J8W A;  1P3O B;  1TAF B;  4WU8 C;  5CPK A;  3W99 B;  5AVC D;  3MVD B;  3KSY A;  1KX3 C;  4NE5 A;  3WTP B;  3AZE D;  3AL0 C;  5B40 A;  2F8N K;  1P34 D;  4EO5 C;  2HUE C;  2YFW B;  5C3I B;  2FFF B;  5AV9 B;  3REI B;  3AV1 B;  3WKJ A;  1P3L A;  5F99 A;  3W97 D;  4J8X C;  5BT1 D;  3AZL A;  1EQZ A;  3W99 C;  4H9P A;  3MVD C;  3UT9 B;  2Y2H A;  3WTP C;  4JJN C;  1HQ3 A;  3TU4 C;  5B24 B;  3UTB A;  3KUY D;  4J8V C;  2NQB C;  5E5A A;  3LEL A;  2DQN C;  5AVB D;  2Y2I A;  4WU9 B;  5B0Z B;  3VH5 A;  4G91 C;  1Q9C A;  3AZN D;  5B31 G;  3AZJ B;  4R8P B;  3WAA B;  4UUZ A;  3MGR A;  3NQU A;  5B1L C;  5GSU A;  3AZK A;  3EG5 B;  1P3I A;  3AZI D;  3B0C T;  4CSR A;  3O62 C;  3X1U D;  3AZF B;  1M18 C;  2Y2P A;  3VH6 A;  4Z5T C;  1P3K C;  5CP6 A;  2G5I C;  5B24 C;  2ARO A;  3KXB B;  1P3M A;  3AYW A;  5AVC B;  5B0Z C;  3AZE B;  3B6F A;  1Z2C B;  4XZQ A;  3MGP D;  2ZY5 A;  3AZJ C;  2ZY2 A;  4X23 D;  1ID3 C;  5B31 C;  5B33 A;  5AY8 D;  4XUJ A;  1S32 A;  1P34 B;  2F8N D;  2RVQ D;  1P3P B;  3X1S A;  3KXB C;  5CPI B;  5BNV A;  2F2A C;  1P3F A;  3W98 B;  3W96 D;  3LZ0 C;  1P3A C;  1BFM A;  1M1A A;  3F6T A;  1P3O A;  4WU8 D;  3MGQ C;  5B0Y A;  1KX3 D;  3AZG C;  1F66 A;  1H3O B;  4WJ3 C;  3REJ B;  3AZN B;  3X1V B;  1P3P C;  2G5H C;  5AV6 A;  2Y2M A;  2YFW A;  5CPI C;  3AV1 A;  3MGS A;  3X1T A;  3W98 C;  2BYM B;  5B32 A;  3X1U B;  4J8X D;  3W99 D;  3MVD D;  1JFI A;  3WTP D;  3UT9 A;  4JJN D;  1AOI A;  1P3G B;  4H9S A;  2Y2K A;  2FJ7 C;  5B1M B;  3REJ C;  3TU4 D;  4LD9 A;  4J8V D;  2NQB D;  3NQJ A;  5AV8 B;  5B2I A;  4YM6 B;  3X1V C;  4Z2M H;  4WU9 A;  5BS7 A;  5AY8 B;  4KHA B;  3WAA A;  4KUD B;  2ZY4 A;  5B1L D;  2J8P A;  4H9R B;  1U35 D;  2F8N B;  3C1C A;  3O62 D;  5AV5 A;  1M18 D;  3REK A;  4KGC A;  4Z5T D;  4ZUX B;  1P3G C;  1P3K D;  5DNN A;  3UTA C;  5B1M C;  5B24 D;  3AZH B;  3AN2 B;  2CV5 A;  5AV8 C;  4YM6 C;  4WU8 B;  3KFU G;  5AVC A;  1KX3 B;  5GT0 C;  3B0C W;  5B0Z D;  1B6W A;  3AZE A;  3H0R C;  1P3L C;  3AZJ D;  4KUD C;  3VH5 T;  1ID3 D;  3AZL C;  1EQZ C;  5B31 D;  4EO5 B;  3REJ A;  4ZUX C;  4J8X B;  3W97 A;  1P3B B;  3KXB D;  5GT3 B;  3AZH C;  3AN2 C;  1M19 D;  3LZ0 D;  1P3A D;  5CHL B;  4CAY A;  3LJA B;  5B2J B;  4JJN B;  1WWI A;  5KDM B;  1KX4 C;  3MGQ D;  3TU4 B;  3EPJ A;  3AZK C;  1P3I C;  2IO5 C;  3KUY A;  4J8V B;  2NQB B;  3REL D;  3AZG D;  5AVB A;  3AZM A;  1H3O A;  2DF4 C;  4G91 B;  2Y2N A;  4Z66 C;  5GXQ B;  5CP6 C;  3MNN B;  1P3P D;  5JRG A;  5B1L B;  1U35 B;  1P3B C;  2HIO C;  5GT3 C;  3KWQ A;  3AZI A;  5CPI D;  3WA9 B;  3P5J B;  3W98 D;  3O62 B;  3B6F C;  1KX5 B;  3X1U A;  2JE5 A;  1M18 B;  3LJA C;  5B2J C;  4Z5T B;  3LZ1 B;  1P3K B;  2PYO C;  5FUG B;  4NFT A;  4YS3 A;  1TZY B;  4UPK A;  3EPH A;  3A6N A;  1S32 C;  4J8U C;  3V9R A;  2FJ7 D;  3REJ D;  5DNM C;  1BH9 B;  5GXQ C;  3MGP A;  3MNN C;  4AWL C;  3X1V D;  3B6G C;  4X23 A;  1U35 C;  1PZR A;  1ID3 B;  2W8S A;  5JA4 B;  5B31 B;  1P3F C;  3WA9 C;  5AY8 A;  1KX5 C;  2Y2G A;  3LZ1 C;  5B0Y C;  3REH A;  1TZY C;  1M19 B;  1F66 C;  5BO0 B;  1P3G D;  3W96 A;  3LZ0 B;  1P3A B;  3UTA D;  5B1M D;  3EPL A;  5AV8 D;  4YM6 D;  5AV6 C;  4H9Q B;  4WU8 A;  3MGQ B;  4DRA A;  4G92 B;  5GT0 D;  1KX3 A;  3MGS C;  3REL B;  3AZG B;  3WKJ D;  2JCH A;  1P3L D;  5CPJ C;  4KUD D;  2NZD B;  3AZL D;  1EQZ D;  1M19 C;  1AOI C;  1R4V A;  4ZUX D;  3AFA C;  3H0L C;  3AV2 B;  4J8X A;  3C1B A;  5B2I C;  4H9O B;  3AZH D;  3VH5 W;  3AN2 D;  3A1I A;  1TAF A;  4QLC B;  3W99 A;  4G92 C;  3MVD A;  4DRB A;  4WNN B;  3WTP A;  3REL C;  5GSU D;  1KX4 D;  2FJ7 B;  3AZK D;  3TU4 A;  1F1E A;  1P3I D;  2NZD C;  2NQB A;  3C1C C;  3VH6 W;  2L5A A;  1ZLA B;  4KGC C;  5AV9 A;  4Z66 D;  5CP6 D;  3REI A;  5BNX B;  3AV2 C;  2XD1 A;  5B1L A;  1P3B D;  4J8W B;  2HIO D;  5GT3 D;  4QLC C;  3B6F D;  3LJA D;  5B2J D;  2F8N H;  2PYO D;  3UTA B;  1N1J B;  5B24 A;  2Y2O A;  5B33 D;  4XUJ D;  1S32 D;  4J8U D;  3WTP E;  5GT0 B;  5DNM D;  2YFV B;  5B0Z A;  1ZLA C;  3WKJ B;  5GXQ D;  1P3L B;  3MNN D;  5F99 B;  3AZJ A;  4R8P A;  3B6G D;  1ID3 A;  4J8W C;  3AZL B;  1EQZ B;  1P3F D;  5CPK C;  4H9P B;  3WA9 D;  1KX5 D;  4WV4 B;  3AZF A;  1HQ3 B;  3LZ1 D;  5B0Y D;  5B40 C;  2LY8 A;  5E5A B;  1TZY D;  3KXB A;  1F66 D;  3AZM C;  3LZ0 A;  3WKJ C;  4UUZ B;  2Y2L A;  5G49 B;  5GSU B;  5F99 C;  5AV6 D;  1KX4 B;  3AZK B;  1P3I B;  3KWQ C;  2IO5 B;  3MGS D;  2ZY3 A;  5CPJ D;  4CSR B;  1P34 A;  4Z2M G;  4Z66 B;  5CP6 B;  1HQ3 C;  1A7W A;  4YS3 C;  3UTB C;  1P3P A;  2ARO B;  2HIO B;  5E5A C;  3A6N C;  3LEL C;  1P3M B;  3VH6 T;  1AOI D;  3AFA D;  5CPI A;  3W98 A;  3B6F B;  5B2I D;  2XD5 A;  3MGR C;  5GSU C;  2PYO B;  3B0D B;  5B33 B;  4XUJ B;  1S32 B;  4J8U B;  5DNM B;  2NZD D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...