5B31D

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.1.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
93
structure length
93
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.1
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b31D00
1M19B 3KUYA 4H9SC 5G49B 3V9RA 4HGAC 5BS7A 5AV8A 1M18C 5B24B 3REHD 4JJNB 2FJ7B 1HQ3A 1BH9B 3AZFB 3KWQA 1ZLAD 4QLCA 3WAAC 3X1TA 3O62A 2NQBD 1P3OC 3AZGD 3MVDC 1P3FC 5B31C 3LZ0B 3REHA 3KSYA 4WNNB 2CV5D 3KWQB 1S32C 1ZLAA 4QLCB 1ID3B 3X1TB 3AYWC 2PYOC 2NQBA 3AZGA 1P3MC 3UT9C 3REHB 3WKJC 3MGPA 2CV5A 1HTAA 3MGRB 1ZLAB 5AVCD 2NQBB 1P3LD 5B2ID 3TU4C 3AZGB 1TAFB 3W98D 5JRGC 3KXBB 5AVBC 5GT0D 3R45A 4XZQC 3C1CC 3A6ND 1P3AA 5GT3D 3REJC 3AZMC 3B6FB 1Q9CA 2CV5B 4J8VD 3RELC 1F66C 1B67A 1P3LA 5B2IA 1P3GB 5AV6D 3W97C 3W99C 4WU8D 2CWEA 5CHLB 3LELD 1P3KD 4R8PC 2RVQC 4YS3D 4J8VA 2NZDD 5DNND 3AV1A 5AVCB 3NQJB 5FUGA 3AZHD 1KX4C 1P3LB 5C3IB 4CSRB 3W98B 4WZSB 4NFTA 5GT0B 4WU8A 3AZKD 5CPKD 3A6NB 4KUDB 5CPIC 5GT3B 3LELA 4YM6B 4J8VB 5AY8A 4YS3A 2NZDA 5FUGB 3AZHA 5BO0A 1P3BD 3MGQB 4EO5B 5AV6B 5AV9C 4WU8B 3AZKA 5CPKA 1WWIA 4XUJB 3LELB 1P3KB 5AV5B 2NZDB 5DNNB 4X23C 3WA9D 5B24C 3AZHB 4JJNC 3X1UD 1P3BA 2FJ7C 5B2JB 1P34D 3LZ1D 3AZFC 5F99C 3AZND 3X1VD 3AV2C 5CPKB 3KUYC 2HUEB 5BNVB 1M19D 4J8XD 5AV8C 5BS7C 3WA9A 3X1UA 1HQ3C 4LD9D 4WU9D 1P34A 3LZ1A 3X1SD 3KWQC 3AZNA 4QLCC 3X1TC 1P3PD 3O62C 3UTBA 1M19A 4J8XA 3MNNB 3WA9B 3WTPD 1M1AD 3VH5T 3REHC 3X1UB 5B1LD 4AWLB 1P34B 3B0DC 3LZ1B 3AZNB 3X1SA 3X1VB 1ZLAC 1P3PA 2NQBC 2L5AA 1ID3D 5KDMB 4Z2MH 3AZGC 4J8XB 3AZJD 4NE6A 3WTPA 3AN2D 1M1AA 5B1LA 4LD9B 3MGPC 4WU9B 2CV5C 3X1SB 3LZ0A 3MGSB 4WNNA 1P3PB 5JA4A 3MGRD 4NE5A 1ID3A 2F8NK 4ZUXB 3AZJA 3W96B 3WTPB 1P3AC 1M1AB 3VH5A 3KXBD 5B1LB 1H3OB 5B1MB 1BFMA 3NQUA 4Z66D 3C1BD 3B6FD 5JA4B 1KX5D 3MGRA 5DNMD 1P3LC 5B2IC 1B6WA 4G91B 3AZJB 1P3GD 3AN2B 1TAFA 3KXBA 3UTAB 5CPJD 4J8VC 3NQUB 2YFWB 4Z66A 3C1BA 3AV1C 3B6FA 1KX5A 5B40D 5DNMA 4EO5C 4WU8C 1P3GA 1KX3D 3VH6T 3LELC 4ZBJC 1TZYB 5CPJA 4YS3C 2NZDC 5AY8C 5B0ZD 4KUDD 4Z66B 3C1BB 2F8NH 4UUZA 3B6GB 4YM6D 3AZHC 3AZED 1KX5B 5DNMB 5AVCA 3NQJA 2IO5B 5GSUB 3REKD 3MGQD 3AZKC 5CPKC 4H9QB 4CSRA 1KX3A 2HUEC 1A7WA 3W98A 5GT0A 5B32B 5CPJB 5B40C 1R4VA 5B0ZA 3A6NA 4KUDA 4XUJD 5GT3A 4UUZB 5BT1C 5B33D 5AV5D 1N1JA 4YM6A 3AZEA 5B40B 1AOID 1P3BC 5B2JD 3REKA 3MGQA 2AROD 5AV6A 1KX3B 4HGAB 3VH6A 4CAYA 5B0ZB 4XUJA 4KGCD 4G92B 5B33A 1P3KA 3WA9C 1N1JB 5AV5A 3AZEB 1AOIA 5DNNA 5B0YD 4DRAA 3X1UC 4AWLC 1P34C 2F8ND 3LZ1C 3AZNC 3REKB 5B2JA 3UTBC 2AROA 3C1CD 4CAYB 5B31B 1M19C 3REJD 4J8XC 3AFAD 4KGCA 5BNVA 5B33B 2HIOD 1AOIB 5B0YA 3AYWB 3MNND 2PYOB 3AZID 3X1SC 1P3PC 2AROB 4J8WD 3UT9B 3AZLD 3WKJB 3AFAA 4KGCB 3WTPC 1M1AC 2HIOA 4Z5TD 5B0YB 5GXQD 5B1LC 3MNNA 3AZIA 2F8NB 1KX4D 3LZ0C 3TU4B 5JRGB 4J8WA 3X1VA 4J8UD 1ID3C 3C1CB 3MGSD 3REJB 4G91C 3AZLA 3AFAB 3AZJC 5KDMA 2HIOB 4Z5TA 1P3ID 5GXQA 4ZUXD 1F66B 3B0CW 3AZIB 3W96D 5B1MD 4LD9A 3LJAD 4WU9A 4J8WB 3MGRC 4J8UA 3MGSA 1EQZD 3AZLB 1BH8B 3REID 4WV4B 4Z5TB 3KXBC 1P3IA 5GXQB 4ZUXA 4H9RB 3W96A 1KX4B 3UTAD 4Z66C 3C1BC 5F99D 1H3OA 5B1MA 5E5AD 3B6FC 1KX5C 3AV2D 5DNMC 4J8UB 4E44A 1WWSA 1EQZA 2IO5C 1P3GC 3REIA 5CP6D 5AV8D 1P3IB 5CPJC 3AN2A 3UTAA 5E5AA 1TZYD 3LJAB 2YFWA 3B6GD 2BYMB 1EQZB 2BYKB 5AVCC 2JSSA 5C3IC 3REIB 5CP6A 1KX3C 4X23B 1ULYA 3W98C 5GT0C 5GSUD 4Z2MG 5B0ZC 3A6NC 4KUDC 5GT3C 5B32G 5B32D 5F99B 4G92C 5E5AB 1TZYA 4YM6C 1U35D 3AZEC 3AV2B 3B6GA 3KUYB 4H9OA 3REKC 3MGQC 5AV6C 3V9RB 5AV8B 5CP6B 5GSUA 3WTPE 4H9QA 1HQ3B 5BNXA 3MGPD 4XUJC 1M18D 5B32A 5B33C 1P3KC 5AV5C 1U35A 1AOIC 5DNNC 3VH6W 3O62B 3WAAD 5B40A 4H9OB 5B2JC 2AROC 1P3OD 4H9SA 1P3AD 4H9PA 3MVDD 5BNXB 1P3FD 1M18A 3B0DB 4KGCC 5B31G 5B31D 1U35B 5B0YC 1S32D 3WAAA 3AYWD 2PYOD 1P3OA 4H9PB 3MVDA 1P3MD 3UT9D 3AFAC 3MGPB 1P3FA 1M18B 5B31A 2HIOC 3AV1D 3WKJD 3MNNC 1S32A 3AZIC 4H9NA 3WAAB 4M6BA 3AYWA 2PYOA 1P3OB 2F8NG 4J8WC 3X1VC 3R45B 3TU4D 1JFIA 1P3AB 3MVDB 5JRGD 5AVBD 1P3MA 3AZLC 1P3FB 3UT9A 4XZQD 5AY8D 4KHAA 3AZMD 3WKJA 4Z5TC 4DRBA 5GXQC 1S32B 4H9NB 3RELD 5B2IB 1F66D 4LD9C 4WU9C 2F8NA 1JFIB 4J8UC 3TU4A 3W97D 3MGSC 5JRGA 3W99D 5AVBA 1P3MB 4XZQA 3C1CA 4KHAB 3REJA 3AZMA 5BT1D 3AV1B 4R8PD 1P3IC 2RVQD 4ZUXC 3W96C 3RELA 1F66A 5B1MC 3LJAC 3W97A 1EQZC 5AVBB 3W99A 4ZBJB 2LY8A 4YS3B 4XZQB 5AY8B 5CPID 3REIC 3AZMB 4R8PA 2YFVA 1BH8A 5BO0B 3AN2C 3RELB 3UTAC 5E5AC 4H9RA 1KX4A 3AZKB 4E45A 3UTBD 5AV9D 3W97B 3W99B 1KU5A 3VH5W 5CPIA 5CP6C 4R8PB 2YFVB 1P3BB 4X23D 5B24D 1TZYC 4JJND 2FJ7D 3B0BA 3AZFD 5AV9A 3B6GC 3LJAA 3B0CT 3KUYD 2BYMA 5CPIB 2BYKA 5GSUC 5G49A 4X23A 5B32C 4NE3A 5B24A 3LZ0D 4JJNA 2FJ7A 1U35C 1HQ3D 3UTBB 1BH9A 5AV9B 5F99A 1F1EA 3KWQD 3AZFA 4QLCD 3X1TD 3O62D 3AV2A
chains in the Genus database with same CATH superfamily
1M19B 3KUYA 4H9SC 5G49B 3V9RA 4HGAC 5BS7A 5AV8A 1M18C 5B24B 3REHD 4JJNB 2FJ7B 1HQ3A 1BH9B 3AZFB 3KWQA 1ZLAD 4QLCA 3WAAC 3X1TA 3O62A 2NQBD 1P3OC 3AZGD 3MVDC 1P3FC 5B31C 3LZ0B 3REHA 3KSYA 4WNNB 2Y2KA 2CV5D 3KWQB 1S32C 1ZLAA 4QLCB 1ID3B 3X1TB 2Y2MA 3AYWC 2PYOC 2NQBA 3AZGA 1P3MC 3UT9C 2Y2PA 3REHB 3WKJC 3MGPA 2CV5A 1HTAA 3MGRB 1ZLAB 2F2AC 5AVCD 2NQBB 1P3LD 5B2ID 3TU4C 3AZGB 1TAFB 3W98D 5JRGC 3KXBB 2Y2HA 5AVBC 5GT0D 3FDDA 3R45A 4XZQC 3C1CC 3A6ND 1P3AA 5GT3D 3REJC 3AZMC 3B6FB 1Q9CA 2CV5B 4J8VD 3H0RC 3RELC 1F66C 1B67A 1P3LA 5B2IA 1P3GB 5AV6D 3W97C 3W99C 4WU8D 2CWEA 5CHLB 2Y2NA 3LELD 1P3KD 4R8PC 2RVQC 4YS3D 4J8VA 2NZDD 5DNND 3AV1A 5AVCB 3NQJB 5FUGA 3AZHD 1KX4C 1P3LB 5C3IB 4CSRB 3W98B 4WZSB 4NFTA 5GT0B 4WU8A 3AZKD 5CPKD 3A6NB 4KUDB 5CPIC 5GT3B 3LELA 4YM6B 4J8VB 5AY8A 4YS3A 2NZDA 5FUGB 3AZHA 5BO0A 2Y2JA 1P3BD 3MGQB 4EO5B 5AV6B 5AV9C 4WU8B 3AZKA 5CPKA 1WWIA 4XUJB 2JCHA 3LELB 1P3KB 2Y2LA 5AV5B 2NZDB 2UWXA 5DNNB 4X23C 3WA9D 5B24C 3AZHB 3IP4C 4JJNC 3X1UD 1P3BA 2FJ7C 5B2JB 2ZY5A 1P34D 3LZ1D 3AZFC 5F99C 3AZND 3X1VD 3AV2C 5CPKB 3KUYC 2HUEB 5BNVB 1M19D 4J8XD 5AV8C 5BS7C 3WA9A 3X1UA 1HQ3C 4LD9D 4WU9D 1P34A 3LZ1A 3X1SD 3KWQC 3AZNA 4QLCC 3X1TC 1P3PD 3O62C 3UTBA 1M19A 4J8XA 3MNNB 3WA9B 3WTPD 1M1AD 3VH5T 3REHC 3X1UB 5B1LD 4AWLB 1P34B 3B0DC 3LZ1B 3AZNB 3X1SA 3X1VB 1ZLAC 1P3PA 2NQBC 2L5AA 1ID3D 5KDMB 4Z2MH 3AZGC 2JE5A 4J8XB 3AZJD 4NE6A 3WTPA 3AN2D 1M1AA 5B1LA 4LD9B 3MGPC 4WU9B 2CV5C 3X1SB 3LZ0A 3MGSB 4WNNA 1P3PB 5JA4A 3F6TA 3MGRD 4NE5A 1ID3A 2F8NK 4ZUXB 3AZJA 3W96B 1Z2CB 3WTPB 1P3AC 1M1AB 3VH5A 3KXBD 5B1LB 1H3OB 5B1MB 1BFMA 3NQUA 4Z66D 3C1BD 3B6FD 5JA4B 1KX5D 3MGRA 5DNMD 1P3LC 5B2IC 1B6WA 4G91B 3AZJB 3H0LC 3P5JB 1P3GD 3AN2B 1TAFA 3KXBA 3UTAB 5CPJD 4J8VC 3NQUB 2YFWB 4Z66A 3C1BA 3AV1C 3B6FA 1KX5A 5B40D 5DNMA 4EO5C 4WU8C 1P3GA 1KX3D 3VH6T 3LELC 4ZBJC 1TZYB 5CPJA 4YS3C 2NZDC 5AY8C 5B0ZD 4KUDD 2Y2OA 4Z66B 3C1BB 2F8NH 4UUZA 3B6GB 4YM6D 2G5IC 4UPKA 3AZHC 3AZED 1KX5B 5DNMB 5AVCA 3NQJA 2IO5B 5GSUB 3REKD 3MGQD 3AZKC 5CPKC 4H9QB 4CSRA 1KX3A 2HUEC 1A7WA 3W98A 5GT0A 5B32B 5CPJB 5B40C 1R4VA 5B0ZA 3A6NA 4KUDA 3EG5B 4XUJD 5GT3A 4UUZB 5BT1C 5B33D 5AV5D 1N1JA 4YM6A 3AZEA 5B40B 1AOID 1P3BC 2Y2GA 5B2JD 3REKA 3MGQA 2AROD 2Y2QA 5AV6A 1KX3B 4HGAB 3VH6A 3EPHA 4CAYA 5B0ZB 2VQRA 4XUJA 4KGCD 4G92B 5B33A 1P3KA 3WA9C 1N1JB 5AV5A 3AZEB 1AOIA 5DNNA 5B0YD 4DRAA 3X1UC 4AWLC 1P34C 2F8ND 3LZ1C 3AZNC 3REKB 5B2JA 3UTBC 2AROA 2XD5A 3A1KA 3C1CD 4CAYB 5B31B 1M19C 3REJD 4J8XC 3AFAD 4KGCA 5BNVA 5B33B 2HIOD 1AOIB 5B0YA 3AYWB 3MNND 2PYOB 3AZID 3X1SC 1P3PC 2AROB 4J8WD 3UT9B 3AZLD 3WKJB 2ZY2A 3AFAA 4KGCB 3WTPC 1M1AC 2HIOA 4Z5TD 5B0YB 2BG1A 5GXQD 5B1LC 3MNNA 3AZIA 2F8NB 1KX4D 3LZ0C 3TU4B 2DF4C 5JRGB 4J8WA 3X1VA 4J8UD 1ID3C 3C1CB 3MGSD 3REJB 4G91C 3AZLA 3AFAB 3AZJC 5KDMA 2HIOB 4Z5TA 1P3ID 5GXQA 4ZUXD 1F66B 3B0CW 3AZIB 3W96D 2RIQA 5B1MD 4LD9A 3LJAD 4WU9A 4J8WB 3MGRC 4J8UA 3MGSA 1EQZD 3AZLB 1BH8B 3REID 4WV4B 4Z5TB 3KXBC 1P3IA 2XD1A 5GXQB 4ZUXA 4H9RB 3W96A 1KX4B 3UTAD 4Z66C 3C1BC 5F99D 1H3OA 5B1MA 5E5AD 3B6FC 2W8SA 1KX5C 3AV2D 5DNMC 4J8UB 4E44A 1WWSA 1EQZA 2IO5C 1P3GC 3REIA 5CP6D 5AV8D 1P3IB 5CPJC 3AN2A 3UTAA 5E5AA 1TZYD 3LJAB 2YFWA 3B6GD 2BYMB 1EQZB 2BYKB 5AVCC 2JSSA 5C3IC 3REIB 5CP6A 1T3UA 4X23B 1ULYA 1KX3C 5GT0C 3W98C 5GSUD 4Z2MG 5B0ZC 3A6NC 4KUDC 3AL0C 5GT3C 5B32G 5B32D 5F99B 4G92C 5E5AB 1TZYA 4YM6C 1U35D 3AZEC 3AV2B 3B6GA 3KUYB 2G5HC 4H9OA 3REKC 3MGQC 5AV6C 3V9RB 5AV8B 5CP6B 5GSUA 3WTPE 4H9QA 1HQ3B 5BNXA 3MGPD 4XUJC 1M18D 5B32A 5B33C 2FFFB 1P3KC 5AV5C 2ZM5A 1U35A 1AOIC 5DNNC 3VH6W 3O62B 3WAAD 3A1IA 5B40A 4H9OB 3H0MC 5B2JC 2AROC 1P3OD 4H9SA 4DQYB 1P3AD 4H9PA 3MVDD 5BNXB 1P3FD 1M18A 2ZY4A 3B0DB 4KGCC 5B31G 5B31D 1U35B 5B0YC 1S32D 3WAAA 3AYWD 2PYOD 1P3OA 4H9PB 3MVDA 2J8PA 1P3MD 3UT9D 3AFAC 3MGPB 1P3FA 1M18B 3KFUG 5B31A 2HIOC 3AV1D 3WKJD 3MNNC 1S32A 3AZIC 4H9NA 3WAAB 4M6BA 3AYWA 2PYOA 1P3OB 2F8NG 4J8WC 3X1VC 3R45B 3TU4D 1JFIA 1P3AB 3MVDB 5JRGD 5AVBD 1P3MA 3AZLC 1P3FB 3UT9A 4XZQD 5AY8D 4KHAA 2Y2IA 3AZMD 3WKJA 4Z5TC 4DRBA 5GXQC 1S32B 4H9NB 3RELD 5B2IB 1F66D 4LD9C 4WU9C 2F8NA 1JFIB 4J8UC 3TU4A 3W97D 3MGSC 5JRGA 3W99D 5AVBA 1P3MB 1PZRA 4XZQA 3C1CA 4KHAB 3REJA 3AZMA 5BT1D 3AV1B 4R8PD 1P3IC 2RVQD 4ZUXC 3W96C 3RELA 1F66A 5B1MC 3LJAC 3EPLA 3W97A 1EQZC 5AVBB 3EPJA 3W99A 4ZBJB 2LY8A 4YS3B 4XZQB 1W2EA 5AY8B 2DQNC 5CPID 3REIC 3AZMB 4R8PA 2YFVA 1BH8A 5BO0B 3AN2C 3RELB 3UTAC 5E5AC 4H9RA 1KX4A 3AZKB 4E45A 3UTBD 5AV9D 3W97B 3W99B 1KU5A 3VH5W 5CPIA 5CP6C 4R8PB 2YFVB 1P3BB 4X23D 5B24D 1TZYC 4JJND 2FJ7D 3B0BA 3AZFD 5AV9A 3B6GC 3LJAA 2ZY3A 3B0CT 4WJ3C 3KUYD 2BYMA 5CPIB 2BYKA 5GSUC 5G49A 4X23A 5B32C 4NE3A 5B24A 3LZ0D 3EPKA 4JJNA 2FJ7A 1U35C 1HQ3D 3UTBB 1BH9A 5AV9B 5F99A 1F1EA 3KWQD 3AZFA 4QLCD 3X1TD 3O62D 3AV2A
chains in the Genus database with same CATH topology
1M19B 3KUYA 4H9SC 5G49B 3V9RA 4HGAC 5BS7A 5AV8A 1M18C 5B24B 3REHD 4JJNB 2FJ7B 1HQ3A 1BH9B 3AZFB 3KWQA 1ZLAD 4QLCA 3WAAC 3X1TA 3O62A 2NQBD 1P3OC 3AZGD 3MVDC 1P3FC 5B31C 3LZ0B 3REHA 3KSYA 4WNNB 2Y2KA 2CV5D 3KWQB 1S32C 1ZLAA 4QLCB 1ID3B 3X1TB 2Y2MA 3AYWC 2PYOC 2NQBA 3AZGA 1P3MC 3UT9C 2Y2PA 3REHB 3WKJC 3MGPA 2CV5A 1HTAA 3MGRB 1ZLAB 2F2AC 5AVCD 2NQBB 1P3LD 5B2ID 3TU4C 3AZGB 1TAFB 3W98D 5JRGC 3KXBB 2Y2HA 5AVBC 5GT0D 3FDDA 3R45A 4XZQC 3C1CC 3A6ND 1P3AA 5GT3D 3REJC 3AZMC 3B6FB 1Q9CA 2CV5B 4J8VD 3H0RC 3RELC 1F66C 1B67A 1P3LA 5B2IA 1P3GB 5AV6D 3W97C 3W99C 4WU8D 2CWEA 5CHLB 2Y2NA 3LELD 1P3KD 4R8PC 2RVQC 4YS3D 4J8VA 2NZDD 5DNND 3AV1A 5AVCB 3NQJB 5FUGA 3AZHD 1KX4C 1P3LB 5C3IB 4CSRB 3W98B 4WZSB 4NFTA 5GT0B 4WU8A 3AZKD 5CPKD 3A6NB 4KUDB 5CPIC 5GT3B 3LELA 4YM6B 4J8VB 5AY8A 4YS3A 2NZDA 5FUGB 3AZHA 5BO0A 2Y2JA 1P3BD 3MGQB 4EO5B 5AV6B 5AV9C 4WU8B 3AZKA 5CPKA 1WWIA 4XUJB 2JCHA 3LELB 1P3KB 2Y2LA 5AV5B 2NZDB 2UWXA 5DNNB 4X23C 3WA9D 5B24C 3AZHB 3IP4C 4JJNC 3X1UD 1P3BA 2FJ7C 5B2JB 2ZY5A 1P34D 3LZ1D 3AZFC 5F99C 3AZND 3X1VD 3AV2C 5CPKB 3KUYC 2HUEB 5BNVB 1M19D 4J8XD 5AV8C 5BS7C 3WA9A 3X1UA 1HQ3C 4LD9D 4WU9D 1P34A 3LZ1A 3X1SD 3KWQC 3AZNA 4QLCC 3X1TC 1P3PD 3O62C 3UTBA 1M19A 4J8XA 3MNNB 3WA9B 3WTPD 1M1AD 3VH5T 3REHC 3X1UB 5B1LD 4AWLB 1P34B 3B0DC 3LZ1B 3AZNB 3X1SA 3X1VB 1ZLAC 1P3PA 2NQBC 2L5AA 1ID3D 5KDMB 4Z2MH 3AZGC 2JE5A 4J8XB 3AZJD 4NE6A 3WTPA 3AN2D 1M1AA 5B1LA 4LD9B 3MGPC 4WU9B 2CV5C 3X1SB 3LZ0A 3MGSB 4WNNA 1P3PB 5JA4A 3F6TA 3MGRD 4NE5A 1ID3A 2F8NK 4ZUXB 3AZJA 3W96B 1Z2CB 3WTPB 1P3AC 1M1AB 3VH5A 3KXBD 5B1LB 1H3OB 5B1MB 1BFMA 3NQUA 4Z66D 3C1BD 3B6FD 5JA4B 1KX5D 3MGRA 5DNMD 1P3LC 5B2IC 1B6WA 4G91B 3AZJB 3H0LC 3P5JB 1P3GD 3AN2B 1TAFA 3KXBA 3UTAB 5CPJD 4J8VC 3NQUB 2YFWB 4Z66A 3C1BA 3AV1C 3B6FA 1KX5A 5B40D 5DNMA 4EO5C 4WU8C 1P3GA 1KX3D 3VH6T 3LELC 4ZBJC 1TZYB 5CPJA 4YS3C 2NZDC 5AY8C 5B0ZD 4KUDD 2Y2OA 4Z66B 3C1BB 2F8NH 4UUZA 3B6GB 4YM6D 2G5IC 4UPKA 3AZHC 3AZED 1KX5B 5DNMB 5AVCA 3NQJA 2IO5B 5GSUB 3REKD 3MGQD 3AZKC 5CPKC 4H9QB 4CSRA 1KX3A 2HUEC 1A7WA 3W98A 5GT0A 5B32B 5CPJB 5B40C 1R4VA 5B0ZA 3A6NA 4KUDA 3EG5B 4XUJD 5GT3A 4UUZB 5BT1C 5B33D 5AV5D 1N1JA 4YM6A 3AZEA 5B40B 1AOID 1P3BC 2Y2GA 5B2JD 3REKA 3MGQA 2AROD 2Y2QA 5AV6A 1KX3B 4HGAB 3VH6A 3EPHA 4CAYA 5B0ZB 2VQRA 4XUJA 4KGCD 4G92B 5B33A 1P3KA 3WA9C 1N1JB 5AV5A 3AZEB 1AOIA 5DNNA 5B0YD 4DRAA 3X1UC 4AWLC 1P34C 2F8ND 3LZ1C 3AZNC 3REKB 5B2JA 3UTBC 2AROA 2XD5A 3A1KA 3C1CD 4CAYB 5B31B 1M19C 3REJD 4J8XC 3AFAD 4KGCA 5BNVA 5B33B 2HIOD 1AOIB 5B0YA 3AYWB 3MNND 2PYOB 3AZID 3X1SC 1P3PC 2AROB 4J8WD 3UT9B 3AZLD 3WKJB 2ZY2A 3AFAA 4KGCB 3WTPC 1M1AC 2HIOA 4Z5TD 5B0YB 2BG1A 5GXQD 5B1LC 3MNNA 3AZIA 2F8NB 1KX4D 3LZ0C 3TU4B 2DF4C 5JRGB 4J8WA 3X1VA 4J8UD 1ID3C 3C1CB 3MGSD 3REJB 4G91C 3AZLA 3AFAB 3AZJC 5KDMA 2HIOB 4Z5TA 1P3ID 5GXQA 4ZUXD 1F66B 3B0CW 3AZIB 3W96D 2RIQA 5B1MD 4LD9A 3LJAD 4WU9A 4J8WB 3MGRC 4J8UA 3MGSA 1EQZD 3AZLB 1BH8B 3REID 4WV4B 4Z5TB 3KXBC 1P3IA 2XD1A 5GXQB 4ZUXA 4H9RB 3W96A 1KX4B 3UTAD 4Z66C 3C1BC 5F99D 1H3OA 5B1MA 5E5AD 3B6FC 2W8SA 1KX5C 3AV2D 5DNMC 4J8UB 4E44A 1WWSA 1EQZA 2IO5C 1P3GC 3REIA 5CP6D 5AV8D 1P3IB 5CPJC 3AN2A 3UTAA 5E5AA 1TZYD 3LJAB 2YFWA 3B6GD 2BYMB 1EQZB 2BYKB 5AVCC 2JSSA 5C3IC 3REIB 5CP6A 1T3UA 4X23B 1ULYA 1KX3C 5GT0C 3W98C 5GSUD 4Z2MG 5B0ZC 3A6NC 4KUDC 3AL0C 5GT3C 5B32G 5B32D 5F99B 4G92C 5E5AB 1TZYA 4YM6C 1U35D 3AZEC 3AV2B 3B6GA 3KUYB 2G5HC 4H9OA 3REKC 3MGQC 5AV6C 3V9RB 5AV8B 5CP6B 5GSUA 3WTPE 4H9QA 1HQ3B 5BNXA 3MGPD 4XUJC 1M18D 5B32A 5B33C 2FFFB 1P3KC 5AV5C 2ZM5A 1U35A 1AOIC 5DNNC 3VH6W 3O62B 3WAAD 3A1IA 5B40A 4H9OB 3H0MC 5B2JC 2AROC 1P3OD 4H9SA 4DQYB 1P3AD 4H9PA 3MVDD 5BNXB 1P3FD 1M18A 2ZY4A 3B0DB 4KGCC 5B31G 5B31D 1U35B 5B0YC 1S32D 3WAAA 3AYWD 2PYOD 1P3OA 4H9PB 3MVDA 2J8PA 1P3MD 3UT9D 3AFAC 3MGPB 1P3FA 1M18B 3KFUG 5B31A 2HIOC 3AV1D 3WKJD 3MNNC 1S32A 3AZIC 4H9NA 3WAAB 4M6BA 3AYWA 2PYOA 1P3OB 2F8NG 4J8WC 3X1VC 3R45B 3TU4D 1JFIA 1P3AB 3MVDB 5JRGD 5AVBD 1P3MA 3AZLC 1P3FB 3UT9A 4XZQD 5AY8D 4KHAA 2Y2IA 3AZMD 3WKJA 4Z5TC 4DRBA 5GXQC 1S32B 4H9NB 3RELD 5B2IB 1F66D 4LD9C 4WU9C 2F8NA 1JFIB 4J8UC 3TU4A 3W97D 3MGSC 5JRGA 3W99D 5AVBA 1P3MB 1PZRA 4XZQA 3C1CA 4KHAB 3REJA 3AZMA 5BT1D 3AV1B 4R8PD 1P3IC 2RVQD 4ZUXC 3W96C 3RELA 1F66A 5B1MC 3LJAC 3EPLA 3W97A 1EQZC 5AVBB 3EPJA 3W99A 4ZBJB 2LY8A 4YS3B 4XZQB 1W2EA 5AY8B 2DQNC 5CPID 3REIC 3AZMB 4R8PA 2YFVA 1BH8A 5BO0B 3AN2C 3RELB 3UTAC 5E5AC 4H9RA 1KX4A 3AZKB 4E45A 3UTBD 5AV9D 3W97B 3W99B 1KU5A 3VH5W 5CPIA 5CP6C 4R8PB 2YFVB 1P3BB 4X23D 5B24D 1TZYC 4JJND 2FJ7D 3B0BA 3AZFD 5AV9A 3B6GC 3LJAA 2ZY3A 3B0CT 4WJ3C 3KUYD 2BYMA 5CPIB 2BYKA 5GSUC 5G49A 4X23A 5B32C 4NE3A 5B24A 3LZ0D 3EPKA 4JJNA 2FJ7A 1U35C 1HQ3D 3UTBB 1BH9A 5AV9B 5F99A 1F1EA 3KWQD 3AZFA 4QLCD 3X1TD 3O62D 3AV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M19 B;  3KUY A;  4H9S C;  5G49 B;  3V9R A;  4HGA C;  5BS7 A;  5AV8 A;  1M18 C;  5B24 B;  3REH D;  4JJN B;  2FJ7 B;  1HQ3 A;  1BH9 B;  3AZF B;  3KWQ A;  1ZLA D;  4QLC A;  3WAA C;  3X1T A;  3O62 A;  2NQB D;  1P3O C;  3AZG D;  3MVD C;  1P3F C;  5B31 C;  3LZ0 B;  3REH A;  3KSY A;  4WNN B;  2CV5 D;  3KWQ B;  1S32 C;  1ZLA A;  4QLC B;  1ID3 B;  3X1T B;  3AYW C;  2PYO C;  2NQB A;  3AZG A;  1P3M C;  3UT9 C;  3REH B;  3WKJ C;  3MGP A;  2CV5 A;  1HTA A;  3MGR B;  1ZLA B;  5AVC D;  2NQB B;  1P3L D;  5B2I D;  3TU4 C;  3AZG B;  1TAF B;  3W98 D;  5JRG C;  3KXB B;  5AVB C;  5GT0 D;  3R45 A;  4XZQ C;  3C1C C;  3A6N D;  1P3A A;  5GT3 D;  3REJ C;  3AZM C;  3B6F B;  1Q9C A;  2CV5 B;  4J8V D;  3REL C;  1F66 C;  1B67 A;  1P3L A;  5B2I A;  1P3G B;  5AV6 D;  3W97 C;  3W99 C;  4WU8 D;  2CWE A;  5CHL B;  3LEL D;  1P3K D;  4R8P C;  2RVQ C;  4YS3 D;  4J8V A;  2NZD D;  5DNN D;  3AV1 A;  5AVC B;  3NQJ B;  5FUG A;  3AZH D;  1KX4 C;  1P3L B;  5C3I B;  4CSR B;  3W98 B;  4WZS B;  4NFT A;  5GT0 B;  4WU8 A;  3AZK D;  5CPK D;  3A6N B;  4KUD B;  5CPI C;  5GT3 B;  3LEL A;  4YM6 B;  4J8V B;  5AY8 A;  4YS3 A;  2NZD A;  5FUG B;  3AZH A;  5BO0 A;  1P3B D;  3MGQ B;  4EO5 B;  5AV6 B;  5AV9 C;  4WU8 B;  3AZK A;  5CPK A;  1WWI A;  4XUJ B;  3LEL B;  1P3K B;  5AV5 B;  2NZD B;  5DNN B;  4X23 C;  3WA9 D;  5B24 C;  3AZH B;  4JJN C;  3X1U D;  1P3B A;  2FJ7 C;  5B2J B;  1P34 D;  3LZ1 D;  3AZF C;  5F99 C;  3AZN D;  3X1V D;  3AV2 C;  5CPK B;  3KUY C;  2HUE B;  5BNV B;  1M19 D;  4J8X D;  5AV8 C;  5BS7 C;  3WA9 A;  3X1U A;  1HQ3 C;  4LD9 D;  4WU9 D;  1P34 A;  3LZ1 A;  3X1S D;  3KWQ C;  3AZN A;  4QLC C;  3X1T C;  1P3P D;  3O62 C;  3UTB A;  1M19 A;  4J8X A;  3MNN B;  3WA9 B;  3WTP D;  1M1A D;  3VH5 T;  3REH C;  3X1U B;  5B1L D;  4AWL B;  1P34 B;  3B0D C;  3LZ1 B;  3AZN B;  3X1S A;  3X1V B;  1ZLA C;  1P3P A;  2NQB C;  2L5A A;  1ID3 D;  5KDM B;  4Z2M H;  3AZG C;  4J8X B;  3AZJ D;  4NE6 A;  3WTP A;  3AN2 D;  1M1A A;  5B1L A;  4LD9 B;  3MGP C;  4WU9 B;  2CV5 C;  3X1S B;  3LZ0 A;  3MGS B;  4WNN A;  1P3P B;  5JA4 A;  3MGR D;  4NE5 A;  1ID3 A;  2F8N K;  4ZUX B;  3AZJ A;  3W96 B;  3WTP B;  1P3A C;  1M1A B;  3VH5 A;  3KXB D;  5B1L B;  1H3O B;  5B1M B;  1BFM A;  3NQU A;  4Z66 D;  3C1B D;  3B6F D;  5JA4 B;  1KX5 D;  3MGR A;  5DNM D;  1P3L C;  5B2I C;  1B6W A;  4G91 B;  3AZJ B;  1P3G D;  3AN2 B;  1TAF A;  3KXB A;  3UTA B;  5CPJ D;  4J8V C;  3NQU B;  2YFW B;  4Z66 A;  3C1B A;  3AV1 C;  3B6F A;  1KX5 A;  5B40 D;  5DNM A;  4EO5 C;  4WU8 C;  1P3G A;  1KX3 D;  3VH6 T;  3LEL C;  4ZBJ C;  1TZY B;  5CPJ A;  4YS3 C;  2NZD C;  5AY8 C;  5B0Z D;  4KUD D;  4Z66 B;  3C1B B;  2F8N H;  4UUZ A;  3B6G B;  4YM6 D;  3AZH C;  3AZE D;  1KX5 B;  5DNM B;  5AVC A;  3NQJ A;  2IO5 B;  5GSU B;  3REK D;  3MGQ D;  3AZK C;  5CPK C;  4H9Q B;  4CSR A;  1KX3 A;  2HUE C;  1A7W A;  3W98 A;  5GT0 A;  5B32 B;  5CPJ B;  5B40 C;  1R4V A;  5B0Z A;  3A6N A;  4KUD A;  4XUJ D;  5GT3 A;  4UUZ B;  5BT1 C;  5B33 D;  5AV5 D;  1N1J A;  4YM6 A;  3AZE A;  5B40 B;  1AOI D;  1P3B C;  5B2J D;  3REK A;  3MGQ A;  2ARO D;  5AV6 A;  1KX3 B;  4HGA B;  3VH6 A;  4CAY A;  5B0Z B;  4XUJ A;  4KGC D;  4G92 B;  5B33 A;  1P3K A;  3WA9 C;  1N1J B;  5AV5 A;  3AZE B;  1AOI A;  5DNN A;  5B0Y D;  4DRA A;  3X1U C;  4AWL C;  1P34 C;  2F8N D;  3LZ1 C;  3AZN C;  3REK B;  5B2J A;  3UTB C;  2ARO A;  3C1C D;  4CAY B;  5B31 B;  1M19 C;  3REJ D;  4J8X C;  3AFA D;  4KGC A;  5BNV A;  5B33 B;  2HIO D;  1AOI B;  5B0Y A;  3AYW B;  3MNN D;  2PYO B;  3AZI D;  3X1S C;  1P3P C;  2ARO B;  4J8W D;  3UT9 B;  3AZL D;  3WKJ B;  3AFA A;  4KGC B;  3WTP C;  1M1A C;  2HIO A;  4Z5T D;  5B0Y B;  5GXQ D;  5B1L C;  3MNN A;  3AZI A;  2F8N B;  1KX4 D;  3LZ0 C;  3TU4 B;  5JRG B;  4J8W A;  3X1V A;  4J8U D;  1ID3 C;  3C1C B;  3MGS D;  3REJ B;  4G91 C;  3AZL A;  3AFA B;  3AZJ C;  5KDM A;  2HIO B;  4Z5T A;  1P3I D;  5GXQ A;  4ZUX D;  1F66 B;  3B0C W;  3AZI B;  3W96 D;  5B1M D;  4LD9 A;  3LJA D;  4WU9 A;  4J8W B;  3MGR C;  4J8U A;  3MGS A;  1EQZ D;  3AZL B;  1BH8 B;  3REI D;  4WV4 B;  4Z5T B;  3KXB C;  1P3I A;  5GXQ B;  4ZUX A;  4H9R B;  3W96 A;  1KX4 B;  3UTA D;  4Z66 C;  3C1B C;  5F99 D;  1H3O A;  5B1M A;  5E5A D;  3B6F C;  1KX5 C;  3AV2 D;  5DNM C;  4J8U B;  4E44 A;  1WWS A;  1EQZ A;  2IO5 C;  1P3G C;  3REI A;  5CP6 D;  5AV8 D;  1P3I B;  5CPJ C;  3AN2 A;  3UTA A;  5E5A A;  1TZY D;  3LJA B;  2YFW A;  3B6G D;  2BYM B;  1EQZ B;  2BYK B;  5AVC C;  2JSS A;  5C3I C;  3REI B;  5CP6 A;  1KX3 C;  4X23 B;  1ULY A;  3W98 C;  5GT0 C;  5GSU D;  4Z2M G;  5B0Z C;  3A6N C;  4KUD C;  5GT3 C;  5B32 G;  5B32 D;  5F99 B;  4G92 C;  5E5A B;  1TZY A;  4YM6 C;  1U35 D;  3AZE C;  3AV2 B;  3B6G A;  3KUY B;  4H9O A;  3REK C;  3MGQ C;  5AV6 C;  3V9R B;  5AV8 B;  5CP6 B;  5GSU A;  3WTP E;  4H9Q A;  1HQ3 B;  5BNX A;  3MGP D;  4XUJ C;  1M18 D;  5B32 A;  5B33 C;  1P3K C;  5AV5 C;  1U35 A;  1AOI C;  5DNN C;  3VH6 W;  3O62 B;  3WAA D;  5B40 A;  4H9O B;  5B2J C;  2ARO C;  1P3O D;  4H9S A;  1P3A D;  4H9P A;  3MVD D;  5BNX B;  1P3F D;  1M18 A;  3B0D B;  4KGC C;  5B31 G;  5B31 D;  1U35 B;  5B0Y C;  1S32 D;  3WAA A;  3AYW D;  2PYO D;  1P3O A;  4H9P B;  3MVD A;  1P3M D;  3UT9 D;  3AFA C;  3MGP B;  1P3F A;  1M18 B;  5B31 A;  2HIO C;  3AV1 D;  3WKJ D;  3MNN C;  1S32 A;  3AZI C;  4H9N A;  3WAA B;  4M6B A;  3AYW A;  2PYO A;  1P3O B;  2F8N G;  4J8W C;  3X1V C;  3R45 B;  3TU4 D;  1JFI A;  1P3A B;  3MVD B;  5JRG D;  5AVB D;  1P3M A;  3AZL C;  1P3F B;  3UT9 A;  4XZQ D;  5AY8 D;  4KHA A;  3AZM D;  3WKJ A;  4Z5T C;  4DRB A;  5GXQ C;  1S32 B;  4H9N B;  3REL D;  5B2I B;  1F66 D;  4LD9 C;  4WU9 C;  2F8N A;  1JFI B;  4J8U C;  3TU4 A;  3W97 D;  3MGS C;  5JRG A;  3W99 D;  5AVB A;  1P3M B;  4XZQ A;  3C1C A;  4KHA B;  3REJ A;  3AZM A;  5BT1 D;  3AV1 B;  4R8P D;  1P3I C;  2RVQ D;  4ZUX C;  3W96 C;  3REL A;  1F66 A;  5B1M C;  3LJA C;  3W97 A;  1EQZ C;  5AVB B;  3W99 A;  4ZBJ B;  2LY8 A;  4YS3 B;  4XZQ B;  5AY8 B;  5CPI D;  3REI C;  3AZM B;  4R8P A;  2YFV A;  1BH8 A;  5BO0 B;  3AN2 C;  3REL B;  3UTA C;  5E5A C;  4H9R A;  1KX4 A;  3AZK B;  4E45 A;  3UTB D;  5AV9 D;  3W97 B;  3W99 B;  1KU5 A;  3VH5 W;  5CPI A;  5CP6 C;  4R8P B;  2YFV B;  1P3B B;  4X23 D;  5B24 D;  1TZY C;  4JJN D;  2FJ7 D;  3B0B A;  3AZF D;  5AV9 A;  3B6G C;  3LJA A;  3B0C T;  3KUY D;  2BYM A;  5CPI B;  2BYK A;  5GSU C;  5G49 A;  4X23 A;  5B32 C;  4NE3 A;  5B24 A;  3LZ0 D;  4JJN A;  2FJ7 A;  1U35 C;  1HQ3 D;  3UTB B;  1BH9 A;  5AV9 B;  5F99 A;  1F1E A;  3KWQ D;  3AZF A;  4QLC D;  3X1T D;  3O62 D;  3AV2 A; 
#chains in the Genus database with same CATH topology
 1M19 B;  3KUY A;  4H9S C;  5G49 B;  3V9R A;  4HGA C;  5BS7 A;  5AV8 A;  1M18 C;  5B24 B;  3REH D;  4JJN B;  2FJ7 B;  1HQ3 A;  1BH9 B;  3AZF B;  3KWQ A;  1ZLA D;  4QLC A;  3WAA C;  3X1T A;  3O62 A;  2NQB D;  1P3O C;  3AZG D;  3MVD C;  1P3F C;  5B31 C;  3LZ0 B;  3REH A;  3KSY A;  4WNN B;  2Y2K A;  2CV5 D;  3KWQ B;  1S32 C;  1ZLA A;  4QLC B;  1ID3 B;  3X1T B;  2Y2M A;  3AYW C;  2PYO C;  2NQB A;  3AZG A;  1P3M C;  3UT9 C;  2Y2P A;  3REH B;  3WKJ C;  3MGP A;  2CV5 A;  1HTA A;  3MGR B;  1ZLA B;  2F2A C;  5AVC D;  2NQB B;  1P3L D;  5B2I D;  3TU4 C;  3AZG B;  1TAF B;  3W98 D;  5JRG C;  3KXB B;  2Y2H A;  5AVB C;  5GT0 D;  3FDD A;  3R45 A;  4XZQ C;  3C1C C;  3A6N D;  1P3A A;  5GT3 D;  3REJ C;  3AZM C;  3B6F B;  1Q9C A;  2CV5 B;  4J8V D;  3H0R C;  3REL C;  1F66 C;  1B67 A;  1P3L A;  5B2I A;  1P3G B;  5AV6 D;  3W97 C;  3W99 C;  4WU8 D;  2CWE A;  5CHL B;  2Y2N A;  3LEL D;  1P3K D;  4R8P C;  2RVQ C;  4YS3 D;  4J8V A;  2NZD D;  5DNN D;  3AV1 A;  5AVC B;  3NQJ B;  5FUG A;  3AZH D;  1KX4 C;  1P3L B;  5C3I B;  4CSR B;  3W98 B;  4WZS B;  4NFT A;  5GT0 B;  4WU8 A;  3AZK D;  5CPK D;  3A6N B;  4KUD B;  5CPI C;  5GT3 B;  3LEL A;  4YM6 B;  4J8V B;  5AY8 A;  4YS3 A;  2NZD A;  5FUG B;  3AZH A;  5BO0 A;  2Y2J A;  1P3B D;  3MGQ B;  4EO5 B;  5AV6 B;  5AV9 C;  4WU8 B;  3AZK A;  5CPK A;  1WWI A;  4XUJ B;  2JCH A;  3LEL B;  1P3K B;  2Y2L A;  5AV5 B;  2NZD B;  2UWX A;  5DNN B;  4X23 C;  3WA9 D;  5B24 C;  3AZH B;  3IP4 C;  4JJN C;  3X1U D;  1P3B A;  2FJ7 C;  5B2J B;  2ZY5 A;  1P34 D;  3LZ1 D;  3AZF C;  5F99 C;  3AZN D;  3X1V D;  3AV2 C;  5CPK B;  3KUY C;  2HUE B;  5BNV B;  1M19 D;  4J8X D;  5AV8 C;  5BS7 C;  3WA9 A;  3X1U A;  1HQ3 C;  4LD9 D;  4WU9 D;  1P34 A;  3LZ1 A;  3X1S D;  3KWQ C;  3AZN A;  4QLC C;  3X1T C;  1P3P D;  3O62 C;  3UTB A;  1M19 A;  4J8X A;  3MNN B;  3WA9 B;  3WTP D;  1M1A D;  3VH5 T;  3REH C;  3X1U B;  5B1L D;  4AWL B;  1P34 B;  3B0D C;  3LZ1 B;  3AZN B;  3X1S A;  3X1V B;  1ZLA C;  1P3P A;  2NQB C;  2L5A A;  1ID3 D;  5KDM B;  4Z2M H;  3AZG C;  2JE5 A;  4J8X B;  3AZJ D;  4NE6 A;  3WTP A;  3AN2 D;  1M1A A;  5B1L A;  4LD9 B;  3MGP C;  4WU9 B;  2CV5 C;  3X1S B;  3LZ0 A;  3MGS B;  4WNN A;  1P3P B;  5JA4 A;  3F6T A;  3MGR D;  4NE5 A;  1ID3 A;  2F8N K;  4ZUX B;  3AZJ A;  3W96 B;  1Z2C B;  3WTP B;  1P3A C;  1M1A B;  3VH5 A;  3KXB D;  5B1L B;  1H3O B;  5B1M B;  1BFM A;  3NQU A;  4Z66 D;  3C1B D;  3B6F D;  5JA4 B;  1KX5 D;  3MGR A;  5DNM D;  1P3L C;  5B2I C;  1B6W A;  4G91 B;  3AZJ B;  3H0L C;  3P5J B;  1P3G D;  3AN2 B;  1TAF A;  3KXB A;  3UTA B;  5CPJ D;  4J8V C;  3NQU B;  2YFW B;  4Z66 A;  3C1B A;  3AV1 C;  3B6F A;  1KX5 A;  5B40 D;  5DNM A;  4EO5 C;  4WU8 C;  1P3G A;  1KX3 D;  3VH6 T;  3LEL C;  4ZBJ C;  1TZY B;  5CPJ A;  4YS3 C;  2NZD C;  5AY8 C;  5B0Z D;  4KUD D;  2Y2O A;  4Z66 B;  3C1B B;  2F8N H;  4UUZ A;  3B6G B;  4YM6 D;  2G5I C;  4UPK A;  3AZH C;  3AZE D;  1KX5 B;  5DNM B;  5AVC A;  3NQJ A;  2IO5 B;  5GSU B;  3REK D;  3MGQ D;  3AZK C;  5CPK C;  4H9Q B;  4CSR A;  1KX3 A;  2HUE C;  1A7W A;  3W98 A;  5GT0 A;  5B32 B;  5CPJ B;  5B40 C;  1R4V A;  5B0Z A;  3A6N A;  4KUD A;  3EG5 B;  4XUJ D;  5GT3 A;  4UUZ B;  5BT1 C;  5B33 D;  5AV5 D;  1N1J A;  4YM6 A;  3AZE A;  5B40 B;  1AOI D;  1P3B C;  2Y2G A;  5B2J D;  3REK A;  3MGQ A;  2ARO D;  2Y2Q A;  5AV6 A;  1KX3 B;  4HGA B;  3VH6 A;  3EPH A;  4CAY A;  5B0Z B;  2VQR A;  4XUJ A;  4KGC D;  4G92 B;  5B33 A;  1P3K A;  3WA9 C;  1N1J B;  5AV5 A;  3AZE B;  1AOI A;  5DNN A;  5B0Y D;  4DRA A;  3X1U C;  4AWL C;  1P34 C;  2F8N D;  3LZ1 C;  3AZN C;  3REK B;  5B2J A;  3UTB C;  2ARO A;  2XD5 A;  3A1K A;  3C1C D;  4CAY B;  5B31 B;  1M19 C;  3REJ D;  4J8X C;  3AFA D;  4KGC A;  5BNV A;  5B33 B;  2HIO D;  1AOI B;  5B0Y A;  3AYW B;  3MNN D;  2PYO B;  3AZI D;  3X1S C;  1P3P C;  2ARO B;  4J8W D;  3UT9 B;  3AZL D;  3WKJ B;  2ZY2 A;  3AFA A;  4KGC B;  3WTP C;  1M1A C;  2HIO A;  4Z5T D;  5B0Y B;  2BG1 A;  5GXQ D;  5B1L C;  3MNN A;  3AZI A;  2F8N B;  1KX4 D;  3LZ0 C;  3TU4 B;  2DF4 C;  5JRG B;  4J8W A;  3X1V A;  4J8U D;  1ID3 C;  3C1C B;  3MGS D;  3REJ B;  4G91 C;  3AZL A;  3AFA B;  3AZJ C;  5KDM A;  2HIO B;  4Z5T A;  1P3I D;  5GXQ A;  4ZUX D;  1F66 B;  3B0C W;  3AZI B;  3W96 D;  2RIQ A;  5B1M D;  4LD9 A;  3LJA D;  4WU9 A;  4J8W B;  3MGR C;  4J8U A;  3MGS A;  1EQZ D;  3AZL B;  1BH8 B;  3REI D;  4WV4 B;  4Z5T B;  3KXB C;  1P3I A;  2XD1 A;  5GXQ B;  4ZUX A;  4H9R B;  3W96 A;  1KX4 B;  3UTA D;  4Z66 C;  3C1B C;  5F99 D;  1H3O A;  5B1M A;  5E5A D;  3B6F C;  2W8S A;  1KX5 C;  3AV2 D;  5DNM C;  4J8U B;  4E44 A;  1WWS A;  1EQZ A;  2IO5 C;  1P3G C;  3REI A;  5CP6 D;  5AV8 D;  1P3I B;  5CPJ C;  3AN2 A;  3UTA A;  5E5A A;  1TZY D;  3LJA B;  2YFW A;  3B6G D;  2BYM B;  1EQZ B;  2BYK B;  5AVC C;  2JSS A;  5C3I C;  3REI B;  5CP6 A;  1T3U A;  4X23 B;  1ULY A;  1KX3 C;  5GT0 C;  3W98 C;  5GSU D;  4Z2M G;  5B0Z C;  3A6N C;  4KUD C;  3AL0 C;  5GT3 C;  5B32 G;  5B32 D;  5F99 B;  4G92 C;  5E5A B;  1TZY A;  4YM6 C;  1U35 D;  3AZE C;  3AV2 B;  3B6G A;  3KUY B;  2G5H C;  4H9O A;  3REK C;  3MGQ C;  5AV6 C;  3V9R B;  5AV8 B;  5CP6 B;  5GSU A;  3WTP E;  4H9Q A;  1HQ3 B;  5BNX A;  3MGP D;  4XUJ C;  1M18 D;  5B32 A;  5B33 C;  2FFF B;  1P3K C;  5AV5 C;  2ZM5 A;  1U35 A;  1AOI C;  5DNN C;  3VH6 W;  3O62 B;  3WAA D;  3A1I A;  5B40 A;  4H9O B;  3H0M C;  5B2J C;  2ARO C;  1P3O D;  4H9S A;  4DQY B;  1P3A D;  4H9P A;  3MVD D;  5BNX B;  1P3F D;  1M18 A;  2ZY4 A;  3B0D B;  4KGC C;  5B31 G;  5B31 D;  1U35 B;  5B0Y C;  1S32 D;  3WAA A;  3AYW D;  2PYO D;  1P3O A;  4H9P B;  3MVD A;  2J8P A;  1P3M D;  3UT9 D;  3AFA C;  3MGP B;  1P3F A;  1M18 B;  3KFU G;  5B31 A;  2HIO C;  3AV1 D;  3WKJ D;  3MNN C;  1S32 A;  3AZI C;  4H9N A;  3WAA B;  4M6B A;  3AYW A;  2PYO A;  1P3O B;  2F8N G;  4J8W C;  3X1V C;  3R45 B;  3TU4 D;  1JFI A;  1P3A B;  3MVD B;  5JRG D;  5AVB D;  1P3M A;  3AZL C;  1P3F B;  3UT9 A;  4XZQ D;  5AY8 D;  4KHA A;  2Y2I A;  3AZM D;  3WKJ A;  4Z5T C;  4DRB A;  5GXQ C;  1S32 B;  4H9N B;  3REL D;  5B2I B;  1F66 D;  4LD9 C;  4WU9 C;  2F8N A;  1JFI B;  4J8U C;  3TU4 A;  3W97 D;  3MGS C;  5JRG A;  3W99 D;  5AVB A;  1P3M B;  1PZR A;  4XZQ A;  3C1C A;  4KHA B;  3REJ A;  3AZM A;  5BT1 D;  3AV1 B;  4R8P D;  1P3I C;  2RVQ D;  4ZUX C;  3W96 C;  3REL A;  1F66 A;  5B1M C;  3LJA C;  3EPL A;  3W97 A;  1EQZ C;  5AVB B;  3EPJ A;  3W99 A;  4ZBJ B;  2LY8 A;  4YS3 B;  4XZQ B;  1W2E A;  5AY8 B;  2DQN C;  5CPI D;  3REI C;  3AZM B;  4R8P A;  2YFV A;  1BH8 A;  5BO0 B;  3AN2 C;  3REL B;  3UTA C;  5E5A C;  4H9R A;  1KX4 A;  3AZK B;  4E45 A;  3UTB D;  5AV9 D;  3W97 B;  3W99 B;  1KU5 A;  3VH5 W;  5CPI A;  5CP6 C;  4R8P B;  2YFV B;  1P3B B;  4X23 D;  5B24 D;  1TZY C;  4JJN D;  2FJ7 D;  3B0B A;  3AZF D;  5AV9 A;  3B6G C;  3LJA A;  2ZY3 A;  3B0C T;  4WJ3 C;  3KUY D;  2BYM A;  5CPI B;  2BYK A;  5GSU C;  5G49 A;  4X23 A;  5B32 C;  4NE3 A;  5B24 A;  3LZ0 D;  3EPK A;  4JJN A;  2FJ7 A;  1U35 C;  1HQ3 D;  3UTB B;  1BH9 A;  5AV9 B;  5F99 A;  1F1E A;  3KWQ D;  3AZF A;  4QLC D;  3X1T D;  3O62 D;  3AV2 A; 
#chains in the Genus database with same CATH homology
 1M19 B;  3KUY A;  4H9S C;  5G49 B;  3V9R A;  4HGA C;  5BS7 A;  5AV8 A;  1M18 C;  5B24 B;  3REH D;  4JJN B;  2FJ7 B;  1HQ3 A;  1BH9 B;  3AZF B;  3KWQ A;  1ZLA D;  4QLC A;  3WAA C;  3X1T A;  3O62 A;  2NQB D;  1P3O C;  3AZG D;  3MVD C;  1P3F C;  5B31 C;  3LZ0 B;  3REH A;  3KSY A;  4WNN B;  2Y2K A;  2CV5 D;  3KWQ B;  1S32 C;  1ZLA A;  4QLC B;  1ID3 B;  3X1T B;  2Y2M A;  3AYW C;  2PYO C;  2NQB A;  3AZG A;  1P3M C;  3UT9 C;  2Y2P A;  3REH B;  3WKJ C;  3MGP A;  2CV5 A;  1HTA A;  3MGR B;  1ZLA B;  2F2A C;  5AVC D;  2NQB B;  1P3L D;  5B2I D;  3TU4 C;  3AZG B;  1TAF B;  3W98 D;  5JRG C;  3KXB B;  2Y2H A;  5AVB C;  5GT0 D;  3FDD A;  3R45 A;  4XZQ C;  3C1C C;  3A6N D;  1P3A A;  5GT3 D;  3REJ C;  3AZM C;  3B6F B;  1Q9C A;  2CV5 B;  4J8V D;  3H0R C;  3REL C;  1F66 C;  1B67 A;  1P3L A;  5B2I A;  1P3G B;  5AV6 D;  3W97 C;  3W99 C;  4WU8 D;  2CWE A;  5CHL B;  2Y2N A;  3LEL D;  1P3K D;  4R8P C;  2RVQ C;  4YS3 D;  4J8V A;  2NZD D;  5DNN D;  3AV1 A;  5AVC B;  3NQJ B;  5FUG A;  3AZH D;  1KX4 C;  1P3L B;  5C3I B;  4CSR B;  3W98 B;  4WZS B;  4NFT A;  5GT0 B;  4WU8 A;  3AZK D;  5CPK D;  3A6N B;  4KUD B;  5CPI C;  5GT3 B;  3LEL A;  4YM6 B;  4J8V B;  5AY8 A;  4YS3 A;  2NZD A;  5FUG B;  3AZH A;  5BO0 A;  2Y2J A;  1P3B D;  3MGQ B;  4EO5 B;  5AV6 B;  5AV9 C;  4WU8 B;  3AZK A;  5CPK A;  1WWI A;  4XUJ B;  2JCH A;  3LEL B;  1P3K B;  2Y2L A;  5AV5 B;  2NZD B;  2UWX A;  5DNN B;  4X23 C;  3WA9 D;  5B24 C;  3AZH B;  3IP4 C;  4JJN C;  3X1U D;  1P3B A;  2FJ7 C;  5B2J B;  2ZY5 A;  1P34 D;  3LZ1 D;  3AZF C;  5F99 C;  3AZN D;  3X1V D;  3AV2 C;  5CPK B;  3KUY C;  2HUE B;  5BNV B;  1M19 D;  4J8X D;  5AV8 C;  5BS7 C;  3WA9 A;  3X1U A;  1HQ3 C;  4LD9 D;  4WU9 D;  1P34 A;  3LZ1 A;  3X1S D;  3KWQ C;  3AZN A;  4QLC C;  3X1T C;  1P3P D;  3O62 C;  3UTB A;  1M19 A;  4J8X A;  3MNN B;  3WA9 B;  3WTP D;  1M1A D;  3VH5 T;  3REH C;  3X1U B;  5B1L D;  4AWL B;  1P34 B;  3B0D C;  3LZ1 B;  3AZN B;  3X1S A;  3X1V B;  1ZLA C;  1P3P A;  2NQB C;  2L5A A;  1ID3 D;  5KDM B;  4Z2M H;  3AZG C;  2JE5 A;  4J8X B;  3AZJ D;  4NE6 A;  3WTP A;  3AN2 D;  1M1A A;  5B1L A;  4LD9 B;  3MGP C;  4WU9 B;  2CV5 C;  3X1S B;  3LZ0 A;  3MGS B;  4WNN A;  1P3P B;  5JA4 A;  3F6T A;  3MGR D;  4NE5 A;  1ID3 A;  2F8N K;  4ZUX B;  3AZJ A;  3W96 B;  1Z2C B;  3WTP B;  1P3A C;  1M1A B;  3VH5 A;  3KXB D;  5B1L B;  1H3O B;  5B1M B;  1BFM A;  3NQU A;  4Z66 D;  3C1B D;  3B6F D;  5JA4 B;  1KX5 D;  3MGR A;  5DNM D;  1P3L C;  5B2I C;  1B6W A;  4G91 B;  3AZJ B;  3H0L C;  3P5J B;  1P3G D;  3AN2 B;  1TAF A;  3KXB A;  3UTA B;  5CPJ D;  4J8V C;  3NQU B;  2YFW B;  4Z66 A;  3C1B A;  3AV1 C;  3B6F A;  1KX5 A;  5B40 D;  5DNM A;  4EO5 C;  4WU8 C;  1P3G A;  1KX3 D;  3VH6 T;  3LEL C;  4ZBJ C;  1TZY B;  5CPJ A;  4YS3 C;  2NZD C;  5AY8 C;  5B0Z D;  4KUD D;  2Y2O A;  4Z66 B;  3C1B B;  2F8N H;  4UUZ A;  3B6G B;  4YM6 D;  2G5I C;  4UPK A;  3AZH C;  3AZE D;  1KX5 B;  5DNM B;  5AVC A;  3NQJ A;  2IO5 B;  5GSU B;  3REK D;  3MGQ D;  3AZK C;  5CPK C;  4H9Q B;  4CSR A;  1KX3 A;  2HUE C;  1A7W A;  3W98 A;  5GT0 A;  5B32 B;  5CPJ B;  5B40 C;  1R4V A;  5B0Z A;  3A6N A;  4KUD A;  3EG5 B;  4XUJ D;  5GT3 A;  4UUZ B;  5BT1 C;  5B33 D;  5AV5 D;  1N1J A;  4YM6 A;  3AZE A;  5B40 B;  1AOI D;  1P3B C;  2Y2G A;  5B2J D;  3REK A;  3MGQ A;  2ARO D;  2Y2Q A;  5AV6 A;  1KX3 B;  4HGA B;  3VH6 A;  3EPH A;  4CAY A;  5B0Z B;  2VQR A;  4XUJ A;  4KGC D;  4G92 B;  5B33 A;  1P3K A;  3WA9 C;  1N1J B;  5AV5 A;  3AZE B;  1AOI A;  5DNN A;  5B0Y D;  4DRA A;  3X1U C;  4AWL C;  1P34 C;  2F8N D;  3LZ1 C;  3AZN C;  3REK B;  5B2J A;  3UTB C;  2ARO A;  2XD5 A;  3A1K A;  3C1C D;  4CAY B;  5B31 B;  1M19 C;  3REJ D;  4J8X C;  3AFA D;  4KGC A;  5BNV A;  5B33 B;  2HIO D;  1AOI B;  5B0Y A;  3AYW B;  3MNN D;  2PYO B;  3AZI D;  3X1S C;  1P3P C;  2ARO B;  4J8W D;  3UT9 B;  3AZL D;  3WKJ B;  2ZY2 A;  3AFA A;  4KGC B;  3WTP C;  1M1A C;  2HIO A;  4Z5T D;  5B0Y B;  2BG1 A;  5GXQ D;  5B1L C;  3MNN A;  3AZI A;  2F8N B;  1KX4 D;  3LZ0 C;  3TU4 B;  2DF4 C;  5JRG B;  4J8W A;  3X1V A;  4J8U D;  1ID3 C;  3C1C B;  3MGS D;  3REJ B;  4G91 C;  3AZL A;  3AFA B;  3AZJ C;  5KDM A;  2HIO B;  4Z5T A;  1P3I D;  5GXQ A;  4ZUX D;  1F66 B;  3B0C W;  3AZI B;  3W96 D;  2RIQ A;  5B1M D;  4LD9 A;  3LJA D;  4WU9 A;  4J8W B;  3MGR C;  4J8U A;  3MGS A;  1EQZ D;  3AZL B;  1BH8 B;  3REI D;  4WV4 B;  4Z5T B;  3KXB C;  1P3I A;  2XD1 A;  5GXQ B;  4ZUX A;  4H9R B;  3W96 A;  1KX4 B;  3UTA D;  4Z66 C;  3C1B C;  5F99 D;  1H3O A;  5B1M A;  5E5A D;  3B6F C;  2W8S A;  1KX5 C;  3AV2 D;  5DNM C;  4J8U B;  4E44 A;  1WWS A;  1EQZ A;  2IO5 C;  1P3G C;  3REI A;  5CP6 D;  5AV8 D;  1P3I B;  5CPJ C;  3AN2 A;  3UTA A;  5E5A A;  1TZY D;  3LJA B;  2YFW A;  3B6G D;  2BYM B;  1EQZ B;  2BYK B;  5AVC C;  2JSS A;  5C3I C;  3REI B;  5CP6 A;  1T3U A;  4X23 B;  1ULY A;  1KX3 C;  5GT0 C;  3W98 C;  5GSU D;  4Z2M G;  5B0Z C;  3A6N C;  4KUD C;  3AL0 C;  5GT3 C;  5B32 G;  5B32 D;  5F99 B;  4G92 C;  5E5A B;  1TZY A;  4YM6 C;  1U35 D;  3AZE C;  3AV2 B;  3B6G A;  3KUY B;  2G5H C;  4H9O A;  3REK C;  3MGQ C;  5AV6 C;  3V9R B;  5AV8 B;  5CP6 B;  5GSU A;  3WTP E;  4H9Q A;  1HQ3 B;  5BNX A;  3MGP D;  4XUJ C;  1M18 D;  5B32 A;  5B33 C;  2FFF B;  1P3K C;  5AV5 C;  2ZM5 A;  1U35 A;  1AOI C;  5DNN C;  3VH6 W;  3O62 B;  3WAA D;  3A1I A;  5B40 A;  4H9O B;  3H0M C;  5B2J C;  2ARO C;  1P3O D;  4H9S A;  4DQY B;  1P3A D;  4H9P A;  3MVD D;  5BNX B;  1P3F D;  1M18 A;  2ZY4 A;  3B0D B;  4KGC C;  5B31 G;  5B31 D;  1U35 B;  5B0Y C;  1S32 D;  3WAA A;  3AYW D;  2PYO D;  1P3O A;  4H9P B;  3MVD A;  2J8P A;  1P3M D;  3UT9 D;  3AFA C;  3MGP B;  1P3F A;  1M18 B;  3KFU G;  5B31 A;  2HIO C;  3AV1 D;  3WKJ D;  3MNN C;  1S32 A;  3AZI C;  4H9N A;  3WAA B;  4M6B A;  3AYW A;  2PYO A;  1P3O B;  2F8N G;  4J8W C;  3X1V C;  3R45 B;  3TU4 D;  1JFI A;  1P3A B;  3MVD B;  5JRG D;  5AVB D;  1P3M A;  3AZL C;  1P3F B;  3UT9 A;  4XZQ D;  5AY8 D;  4KHA A;  2Y2I A;  3AZM D;  3WKJ A;  4Z5T C;  4DRB A;  5GXQ C;  1S32 B;  4H9N B;  3REL D;  5B2I B;  1F66 D;  4LD9 C;  4WU9 C;  2F8N A;  1JFI B;  4J8U C;  3TU4 A;  3W97 D;  3MGS C;  5JRG A;  3W99 D;  5AVB A;  1P3M B;  1PZR A;  4XZQ A;  3C1C A;  4KHA B;  3REJ A;  3AZM A;  5BT1 D;  3AV1 B;  4R8P D;  1P3I C;  2RVQ D;  4ZUX C;  3W96 C;  3REL A;  1F66 A;  5B1M C;  3LJA C;  3EPL A;  3W97 A;  1EQZ C;  5AVB B;  3EPJ A;  3W99 A;  4ZBJ B;  2LY8 A;  4YS3 B;  4XZQ B;  1W2E A;  5AY8 B;  2DQN C;  5CPI D;  3REI C;  3AZM B;  4R8P A;  2YFV A;  1BH8 A;  5BO0 B;  3AN2 C;  3REL B;  3UTA C;  5E5A C;  4H9R A;  1KX4 A;  3AZK B;  4E45 A;  3UTB D;  5AV9 D;  3W97 B;  3W99 B;  1KU5 A;  3VH5 W;  5CPI A;  5CP6 C;  4R8P B;  2YFV B;  1P3B B;  4X23 D;  5B24 D;  1TZY C;  4JJN D;  2FJ7 D;  3B0B A;  3AZF D;  5AV9 A;  3B6G C;  3LJA A;  2ZY3 A;  3B0C T;  4WJ3 C;  3KUY D;  2BYM A;  5CPI B;  2BYK A;  5GSU C;  5G49 A;  4X23 A;  5B32 C;  4NE3 A;  5B24 A;  3LZ0 D;  3EPK A;  4JJN A;  2FJ7 A;  1U35 C;  1HQ3 D;  3UTB B;  1BH9 A;  5AV9 B;  5F99 A;  1F1E A;  3KWQ D;  3AZF A;  4QLC D;  3X1T D;  3O62 D;  3AV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...