4CAYB

Crystal structure of a human anp32e-h2a.z-h2b complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
KESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HISTONE H2A.Z
publication title Anp32E is a Histone Chaperone that Removes H2A.Z from Chromatin
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2013-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4cayB00
5DNMC 3AZLD 3LELA 5BT1D 5AV8C 5JRGD 1P3LB 2F8ND 1TZYB 4H9RA 3B6GB 1N1JB 4EO5C 3C1BB 5F99B 2CWEA 3WTPC 5B0YB 5E5AA 1M18C 3W97D 1ZLAB 3AZHB 3AV1B 3AZLA 1P3MA 1KX3C 2F8NA 5JRGA 5CPKB 4XZQD 3MGSA 1HQ3B 3W98B 1P3FB 4WU8C 1P3GD 3AZED 4KGCB 4H9OB 5BNXB 4QLCA 1HTAA 3AZKD 1P3AD 3WAAB 4XZQA 3W99A 5B32D 3AZEA 3KWQC 3AZKA 5BO0B 1KX5D 2IO5C 3LZ0C 3UTBD 1P3AA 3B6FB 5GXQB 3REIC 5BS7C 2NZDC 5B32A 5JA4B 4WU9D 1KX5A 3MGQA 1P3LD 5CPJB 1TZYD 3RELB 3WTPE 3UTBA 2F8NK 3B6GD 3C1BD 5F99D 3KUYC 3REJB 1P3IB 5B0YD 1ZLAD 3AZHD 3AV1D 1P3LA 1TZYA 1HQ3D 3O62B 3C1BA 3W98D 1P3FD 4KGCD 5B0YA 3AZHA 3AN2B 3AV1A 2CV5C 3X1UC 3MGRB 2RVQD 5CPKA 3WAAD 1HQ3A 5AY8A 2NQBD 3W98A 5BNXA 4J8WB 4E45A 4R8PC 3WAAA 3B6FD 1ID3A 4WNNB 5GXQD 3MVDB 3WA9C 3REKB 3R45A 3UT9C 3X1VB 5B0ZB 5BO0A 3RELD 4G91C 3X1TC 3B6FA 3REJD 1P3ID 4ZUXC 5JA4A 4Z2MG 3UTAB 4G92B 1AOIB 5CPJA 3RELA 1BH8B 3LJAD 1P3OB 3O62D 3REJA 4J8XB 3KSYA 4X23B 5B40C 1P3IA 1P3BC 3A6NB 1KX4B 5DNNC 1EQZB 3C1CD 3MGRD 4UUZB 5AV5C 3O62A 3NQUB 1M1AC 1ULYA 4J8WD 1B6WA 3AN2A 5B1LA 5B31C 4J8VC 3MGRA 2HUEC 5B24A 3MVDD 1P3KA 5AVBA 3REKD 5B2IB 4J8UB 5GSUC 5GT3B 3X1VD 5B1MB 5B0ZD 4J8WA 4WNNA 3MVDA 3X1SB 3AFAB 3REKA 2HIOC 5C3IB 4HGAB 4QLCB 5B0ZA 1AOID 1P3OD 5DNMB 4JJNC 3W99B 5AV8B 4J8XD 4X23D 3AV2C 4EO5B 4H9QB 3UTAA 3A6ND 1U35A 1KX4D 3WTPB 1EQZD 1M18B 2FJ7B 1BH8A 1P3OA 1KX3B 5GT0C 4Z66C 4J8XA 4X23A 3KXBC 4AWLC 3LZ1C 4WU8B 3A6NA 3MGQB 1EQZA 1P3PC 1A7WA 3MNNC 2BYMB 5B2ID 4J8UD 5GT3D 5B1MD 4KUDC 3KWQB 4LD9C 3MGSD 5AV6A 3X1SD 3AFAD 5B2IA 4J8UA 5GT3A 3REIB 4QLCD 5B1MA 2NZDB 4H9SA 5DNMD 3W99D 5B33A 5JRGC 3AZFA 5AV8D 5AY8B 3B0DC 3X1SA 3AFAA 5CPIB 3KUYB 2YFWB 3WTPD 3W97C 1M18D 2FJ7D 5BNVB 1ID3B 5DNMA 1KX3D 5AV8A 4XZQC 3R45B 4H9QA 5B2JC 4WU8D 1P3GC 3MGQD 3WTPA 5AVCC 1M18A 2FJ7A 3AZIC 2CV5B 1KX3A 3X1UB 3AZJB 4WU8A 3AZMC 3KWQD 3AYWC 4R8PB 5B31G 2BYMA 3WA9B 5CP6C 3REID 3KWQA 4WU9C 5CPKD 3UT9B 5AY8D 4G91B 3LZ0A 1F1EA 3B6GC 5CPID 5F99C 3KUYD 5AV9C 3REIA 5BS7A 1P3MD 2NZDA 5B1LB 4ZUXB 1ZLAC 3REHC 1ID3D 5B24B 4KHAB 1P3KB 5AVBB 5CPIA 1P3FC 2PYOC 3KUYA 4CSRB 4KGCC 3TU4C 2YFWA 5B40B 5BNVA 2CV5D 3X1UD 3B0BA 3AZJD 2NQBC 5CPJD 1JFIA 1R4VA 5B31B 4J8VB 2CV5A 3X1UA 4R8PD 3AZJA 5GXQC 1U35B 3WA9D 5KDMB 5GSUB 4H9NB 1M19C 3UT9D 4R8PA 3WA9A 3AN2D 3WKJC 5B1LD 4ZUXD 2HIOB 1WWIA 3UT9A 5B24D 1P3KD 3LJAC 5AVBD 4JJNB 3X1TA 2LY8A 1S32C 5B40D 4ZUXA 4YS3C 2F8NH 2L5AA 3W96C 3C1CC 3MGPC 4KHAA 5AV6B 3MGRC 4XUJC 5GT0B 4Z66B 4CSRA 5B40A 1P3BA 3KXBB 3LZ1B 3AZGC 5B33B 3AZFB 5DNNA 5B31D 4J8VD 2YFVB 1P3PB 2AROC 5AV5A 5FUGB 3UTAD 3MNNB 1U35D 1F66C 5GSUD 1BH9A 3X1VC 4Z5TC 1BFMA 5B31A 4J8VA 3NQJB 4ZBJC 4DRAA 5KDMA 2HIOD 5GSUA 4H9NA 1AOIC 2JSSA 4YM6C 3VH6W 3B0DB 4H9PB 1Q9CA 2HIOA 3AZNC 1P34C 1KX4C 5AV6D 4JJNA 5GT0D 4Z66D 3AV2A 4WZSB 3KXBD 3LZ1D 3LELC 5B33D 5B2JB 3AZFD 5AVCB 2IO5B 3LZ0B 3AZIB 5GT0A 3MNND 4Z66A 5E5AC 4J8UC 1P3MC 3KXBA 3AZLC 3LZ1A 5BT1C 3AZMB 2BYKA 2YFVA 3MGSC 1P3PA 1WWSA 3AYWB 5FUGA 3X1SC 3MNNA 3VH5W 4QLCC 5CP6B 3NQJA 3W99C 3AZEC 1JFIB 5AV9B 3AZKC 1P3AC 2FJ7C 3REHB 4NFTA 4NE3A 5B32C 4H9PA 2PYOB 5B2JD 3MGQC 3TU4B 1KX5C 5AVCD 3W97A 3UTBC 3LZ0D 1TAFA 4CAYB 3AZID 2NZDD 2NQBB 3AZMD 5B2JA 1P3GA 1P3LC 1TZYC 5AVCA 3X1TB 3C1BC 3AZIA 3AYWD 5B0YC 3AZHC 3AV1C 5CP6D 3B0CW 3AZMA 5CPKC 1M19B 1HQ3C 5AY8C 3W98C 3AYWA 5CPIC 1P3BB 5AV9D 5CP6A 5DNNB 3WKJB 2RVQC 1H3OB 3WAAC 3REHD 4WU9A 1ID3C 3VH6T 5AV5B 3LJAB 3B6GA 1N1JA 1BH9B 1M1AB 5F99A 1S32B 2PYOD 5AV9A 3TU4D 4YS3B 1ZLAA 3REHA 3B6FC 2HUEB 3C1CB 5G49B 3MGPB 3W96B 3AZJC 4XUJB 1P3FA 2PYOA 4KGCA 3TU4A 4H9OA 3RELC 5CPJC 3X1TD 3AZGB 1KU5A 4CAYA 4NE5A 3REJC 1P3IC 2AROB 2NQBA 1F66B 1M19D 4Z5TB 3O62C 2F8NG 3AV2B 1P3BD 4ZBJB 3VH6A 5GXQA 3VH5T 3AN2C 5B1LC 5DNND 3WKJD 1M19A 5B24C 4Z2MH 5AV5D 1P3KC 5AVBC 4YM6B 1M1AD 4AWLB 1S32D 4J8WC 2BYKB 3WKJA 4YS3D 1H3OA 3AZNB 1P34B 3W96D 3V9RB 3MVDC 3MGPD 3LJAA 4XUJD 3REKC 1M1AA 1S32A 5CHLB 5B0ZC 4KUDB 4LD9B 5B32G 4YS3A 3LELB 3AZGD 3W96A 4H9RB 5G49A 3MGPA 3C1CA 4XUJA 4E44A 2AROD 3UTAC 1U35C 4G92C 1F66D 5E5AB 1P3MB 4Z5TD 3AZLB 4NE6A 3VH5A 4JJND 3AZGA 5JRGB 1P3OC 2F8NB 4J8XC 4X23C 3MGSB 3AV2D 2AROA 3A6NC 1EQZC 1F66A 4WV4B 3B0CT 3W97B 3X1VA 4Z5TA 1TAFB 4XZQB 4YM6D 4M6BA 1P3GB 3AZEB 1P3PD 3AZKB 3AZND 1P34D 1AOIA 5AV6C 1P3AB 4YM6A 5B2IC 5GT3C 5B1MC 4H9SC 4KUDD 5B32B 4LD9D 1B67A 5B33C 3LELD 3AZFC 3AZNA 1P34A 1KX4A 1KX5B 3V9RA 3UTBB 4UUZA 3AFAC 5C3IC 4HGAC 3NQUA 4KUDA 5E5AD 4DRBA 4LD9A 4WU9B
chains in the Genus database with same CATH superfamily
5DNMC 3AZLD 3LELA 5BT1D 5AV8C 5JRGD 1P3LB 2F8ND 1TZYB 4H9RA 3B6GB 1N1JB 4EO5C 3C1BB 5F99B 2CWEA 3WTPC 5B0YB 5E5AA 1M18C 3W97D 1ZLAB 3AZHB 3AV1B 3AZLA 1P3MA 1KX3C 2F8NA 5JRGA 5CPKB 4XZQD 3MGSA 1HQ3B 3W98B 1P3FB 4WU8C 1P3GD 3AZED 4KGCB 4H9OB 5BNXB 4QLCA 1HTAA 3AZKD 1P3AD 3WAAB 4XZQA 3W99A 2XD1A 5B32D 3AZEA 3KWQC 3AZKA 5BO0B 1KX5D 2IO5C 3LZ0C 3UTBD 1P3AA 3B6FB 5GXQB 3REIC 5BS7C 2NZDC 5B32A 5JA4B 4WU9D 2Y2IA 1KX5A 3MGQA 1P3LD 5CPJB 1TZYD 3RELB 3WTPE 3UTBA 2F8NK 3B6GD 3C1BD 5F99D 3KUYC 3REJB 2ZY4A 1P3IB 5B0YD 1ZLAD 3AZHD 3AV1D 1P3LA 1TZYA 3KFUG 1HQ3D 3O62B 3C1BA 3W98D 1P3FD 4KGCD 5B0YA 3H0MC 3AZHA 3AN2B 3AV1A 2CV5C 3X1UC 3MGRB 2RVQD 5CPKA 3WAAD 1HQ3A 5AY8A 2NQBD 3W98A 5BNXA 4J8WB 4E45A 4R8PC 3WAAA 3B6FD 2FFFB 4WNNB 1ID3A 5GXQD 3MVDB 3WA9C 3REKB 3EPKA 3R45A 3UT9C 3X1VB 5B0ZB 5BO0A 3RELD 4G91C 3X1TC 3B6FA 3REJD 1P3ID 4ZUXC 5JA4A 4Z2MG 3UTAB 4G92B 1AOIB 5CPJA 3RELA 1BH8B 3LJAD 1P3OB 1T3UA 3O62D 3REJA 4J8XB 3KSYA 4X23B 5B40C 1P3IA 1P3BC 1Z2CB 2Y2GA 3A6NB 1KX4B 5DNNC 1EQZB 3C1CD 3MGRD 4UUZB 5AV5C 3O62A 2Y2JA 3NQUB 1M1AC 1ULYA 4J8WD 1B6WA 3AN2A 5B1LA 5B31C 4J8VC 2G5IC 3MGRA 2HUEC 5B24A 3MVDD 2ZY5A 1P3KA 5AVBA 3AL0C 3REKD 5B2IB 4J8UB 5GSUC 5GT3B 3X1VD 5B1MB 5B0ZD 4J8WA 4WNNA 3MVDA 3X1SB 3AFAB 3REKA 2HIOC 5C3IB 4HGAB 4QLCB 5B0ZA 1AOID 1P3OD 5DNMB 4JJNC 3W99B 5AV8B 4J8XD 4X23D 3AV2C 2Y2NA 4EO5B 4H9QB 3UTAA 3A6ND 1U35A 1KX4D 3WTPB 1EQZD 1M18B 2FJ7B 2W8SA 1BH8A 1P3OA 1KX3B 5GT0C 4Z66C 4J8XA 2G5HC 4X23A 3KXBC 4AWLC 3LZ1C 4WU8B 3A6NA 3MGQB 1EQZA 1P3PC 2Y2HA 1A7WA 3MNNC 3FDDA 2BYMB 5B2ID 4J8UD 5GT3D 5B1MD 4KUDC 3KWQB 4LD9C 3H0LC 3MGSD 2ZY2A 3H0RC 5AV6A 3X1SD 3AFAD 5B2IA 4J8UA 5GT3A 3REIB 4QLCD 5B1MA 2NZDB 4H9SA 5DNMD 3W99D 3IP4C 5JRGC 5B33A 5AV8D 3AZFA 5AY8B 3B0DC 3X1SA 3AFAA 5CPIB 3KUYB 2YFWB 3WTPD 3W97C 1M18D 2FJ7D 5BNVB 1ID3B 5DNMA 1KX3D 5AV8A 4XZQC 3R45B 4H9QA 5B2JC 4WU8D 1P3GC 3MGQD 3WTPA 5AVCC 3EPHA 1M18A 2FJ7A 3AZIC 2CV5B 1KX3A 3X1UB 2UWXA 3AZJB 2XD5A 4WU8A 3AZMC 3A1IA 3KWQD 3AYWC 2Y2LA 4R8PB 5B31G 2BYMA 3WA9B 5CP6C 3REID 3KWQA 4WU9C 5CPKD 3UT9B 2RIQA 5AY8D 4G91B 3LZ0A 1F1EA 3B6GC 5CPID 5F99C 3KUYD 5AV9C 3REIA 5BS7A 1P3MD 2Y2PA 5B1LB 2NZDA 4ZUXB 1ZLAC 3REHC 1ID3D 5B24B 4KHAB 1P3KB 5AVBB 5CPIA 1P3FC 2PYOC 3KUYA 4CSRB 4KGCC 3TU4C 2VQRA 2YFWA 5B40B 2F2AC 5BNVA 2CV5D 2JE5A 3X1UD 3B0BA 3AZJD 2NQBC 2DQNC 5CPJD 1JFIA 1R4VA 5B31B 4J8VB 2CV5A 3X1UA 4R8PD 3AZJA 5GXQC 1U35B 3WA9D 5KDMB 5GSUB 4H9NB 1M19C 3UT9D 4R8PA 3WA9A 3AN2D 3WKJC 5B1LD 2Y2OA 2HIOB 4ZUXD 1WWIA 3UT9A 5B24D 3A1KA 1P3KD 3LJAC 5AVBD 4JJNB 3X1TA 2LY8A 1S32C 5B40D 4ZUXA 4YS3C 2F8NH 2L5AA 3W96C 3C1CC 3MGPC 4KHAA 5AV6B 3MGRC 4XUJC 5GT0B 4Z66B 4CSRA 5B40A 1P3BA 3KXBB 3LZ1B 3AZGC 5B33B 3AZFB 5DNNA 5B31D 4J8VD 2YFVB 1P3PB 2AROC 5AV5A 5FUGB 3EPLA 3MNNB 3UTAD 1U35D 1F66C 3F6TA 2Y2QA 5GSUD 1BH9A 3X1VC 4Z5TC 1BFMA 3P5JB 5B31A 4J8VA 3NQJB 4ZBJC 4DRAA 5KDMA 2HIOD 5GSUA 4H9NA 1AOIC 2JSSA 4YM6C 3VH6W 3B0DB 4H9PB 1Q9CA 2HIOA 3AZNC 1P34C 1KX4C 5AV6D 4JJNA 2ZY3A 5GT0D 4Z66D 3AV2A 4WZSB 3KXBD 3LZ1D 3LELC 5B33D 5B2JB 3AZFD 5AVCB 2IO5B 3LZ0B 3AZIB 5GT0A 2DF4C 2ZM5A 3MNND 4Z66A 5E5AC 4J8UC 1P3MC 3KXBA 3AZLC 3LZ1A 5BT1C 3AZMB 2BYKA 2YFVA 3MGSC 1P3PA 1WWSA 3AYWB 5FUGA 3X1SC 3MNNA 3VH5W 4QLCC 5CP6B 4DQYB 3NQJA 3W99C 3EPJA 3AZEC 1JFIB 5AV9B 3AZKC 1P3AC 3EG5B 2FJ7C 3REHB 4NFTA 4NE3A 5B32C 4H9PA 2PYOB 5B2JD 3MGQC 3TU4B 1KX5C 5AVCD 3W97A 3UTBC 3LZ0D 1TAFA 4CAYB 3AZID 2NZDD 1W2EA 2JCHA 2NQBB 3AZMD 5B2JA 1P3GA 1P3LC 1TZYC 5AVCA 3X1TB 3C1BC 3AZIA 3AYWD 5B0YC 3AZHC 3AV1C 5CP6D 3B0CW 3AZMA 5CPKC 1M19B 1HQ3C 5AY8C 3W98C 3AYWA 5CPIC 1P3BB 5AV9D 5CP6A 5DNNB 3WKJB 2RVQC 1H3OB 3WAAC 3REHD 4WU9A 1ID3C 3VH6T 5AV5B 3LJAB 3B6GA 1N1JA 1BH9B 1M1AB 5F99A 1S32B 2PYOD 5AV9A 3TU4D 4YS3B 2Y2KA 1ZLAA 3REHA 3B6FC 2HUEB 3C1CB 5G49B 3MGPB 3W96B 3AZJC 4XUJB 1P3FA 2PYOA 4KGCA 3TU4A 4H9OA 3RELC 5CPJC 3X1TD 3AZGB 1KU5A 4CAYA 4NE5A 3REJC 1PZRA 1P3IC 2AROB 2J8PA 2NQBA 1F66B 1M19D 4Z5TB 3O62C 2BG1A 2F8NG 4UPKA 3AV2B 4ZBJB 1P3BD 2Y2MA 3VH6A 5GXQA 3VH5T 3AN2C 5B1LC 5DNND 3WKJD 1M19A 5B24C 4Z2MH 5AV5D 1P3KC 5AVBC 4YM6B 1M1AD 4AWLB 1S32D 4J8WC 2BYKB 3WKJA 4YS3D 1H3OA 3AZNB 1P34B 3W96D 3V9RB 3MVDC 3MGPD 4WJ3C 3LJAA 4XUJD 3REKC 1M1AA 1S32A 5CHLB 5B0ZC 4KUDB 4LD9B 5B32G 4YS3A 3LELB 3AZGD 3W96A 4H9RB 5G49A 3MGPA 3C1CA 4XUJA 4E44A 2AROD 3UTAC 1U35C 4G92C 1F66D 5E5AB 1P3MB 4Z5TD 3AZLB 4NE6A 3VH5A 4JJND 3AZGA 5JRGB 1P3OC 2F8NB 4J8XC 4X23C 3MGSB 3AV2D 2AROA 3A6NC 1EQZC 1F66A 4WV4B 3B0CT 3W97B 3X1VA 4Z5TA 1TAFB 4XZQB 4YM6D 4M6BA 1P3GB 3AZEB 1P3PD 3AZKB 3AZND 1P34D 1AOIA 5AV6C 1P3AB 4YM6A 5B2IC 5GT3C 5B1MC 4H9SC 4KUDD 5B32B 4LD9D 1B67A 5B33C 3LELD 3AZFC 3AZNA 1P34A 1KX4A 1KX5B 3V9RA 3UTBB 4UUZA 3AFAC 5C3IC 4HGAC 3NQUA 4KUDA 5E5AD 4DRBA 4LD9A 4WU9B
chains in the Genus database with same CATH topology
5DNMC 3AZLD 3LELA 5BT1D 5AV8C 5JRGD 1P3LB 2F8ND 1TZYB 4H9RA 3B6GB 1N1JB 4EO5C 3C1BB 5F99B 2CWEA 3WTPC 5B0YB 5E5AA 1M18C 3W97D 1ZLAB 3AZHB 3AV1B 3AZLA 1P3MA 1KX3C 2F8NA 5JRGA 5CPKB 4XZQD 3MGSA 1HQ3B 3W98B 1P3FB 4WU8C 1P3GD 3AZED 4KGCB 4H9OB 5BNXB 4QLCA 1HTAA 3AZKD 1P3AD 3WAAB 4XZQA 3W99A 2XD1A 5B32D 3AZEA 3KWQC 3AZKA 5BO0B 1KX5D 2IO5C 3LZ0C 3UTBD 1P3AA 3B6FB 5GXQB 3REIC 5BS7C 2NZDC 5B32A 5JA4B 4WU9D 2Y2IA 1KX5A 3MGQA 1P3LD 5CPJB 1TZYD 3RELB 3WTPE 3UTBA 2F8NK 3B6GD 3C1BD 5F99D 3KUYC 3REJB 2ZY4A 1P3IB 5B0YD 1ZLAD 3AZHD 3AV1D 1P3LA 1TZYA 3KFUG 1HQ3D 3O62B 3C1BA 3W98D 1P3FD 4KGCD 5B0YA 3H0MC 3AZHA 3AN2B 3AV1A 2CV5C 3X1UC 3MGRB 2RVQD 5CPKA 3WAAD 1HQ3A 5AY8A 2NQBD 3W98A 5BNXA 4J8WB 4E45A 4R8PC 3WAAA 3B6FD 2FFFB 4WNNB 1ID3A 5GXQD 3MVDB 3WA9C 3REKB 3EPKA 3R45A 3UT9C 3X1VB 5B0ZB 5BO0A 3RELD 4G91C 3X1TC 3B6FA 3REJD 1P3ID 4ZUXC 5JA4A 4Z2MG 3UTAB 4G92B 1AOIB 5CPJA 3RELA 1BH8B 3LJAD 1P3OB 1T3UA 3O62D 3REJA 4J8XB 3KSYA 4X23B 5B40C 1P3IA 1P3BC 1Z2CB 2Y2GA 3A6NB 1KX4B 5DNNC 1EQZB 3C1CD 3MGRD 4UUZB 5AV5C 3O62A 2Y2JA 3NQUB 1M1AC 1ULYA 4J8WD 1B6WA 3AN2A 5B1LA 5B31C 4J8VC 2G5IC 3MGRA 2HUEC 5B24A 3MVDD 2ZY5A 1P3KA 5AVBA 3AL0C 3REKD 5B2IB 4J8UB 5GSUC 5GT3B 3X1VD 5B1MB 5B0ZD 4J8WA 4WNNA 3MVDA 3X1SB 3AFAB 3REKA 2HIOC 5C3IB 4HGAB 4QLCB 5B0ZA 1AOID 1P3OD 5DNMB 4JJNC 3W99B 5AV8B 4J8XD 4X23D 3AV2C 2Y2NA 4EO5B 4H9QB 3UTAA 3A6ND 1U35A 1KX4D 3WTPB 1EQZD 1M18B 2FJ7B 2W8SA 1BH8A 1P3OA 1KX3B 5GT0C 4Z66C 4J8XA 2G5HC 4X23A 3KXBC 4AWLC 3LZ1C 4WU8B 3A6NA 3MGQB 1EQZA 1P3PC 2Y2HA 1A7WA 3MNNC 3FDDA 2BYMB 5B2ID 4J8UD 5GT3D 5B1MD 4KUDC 3KWQB 4LD9C 3H0LC 3MGSD 2ZY2A 3H0RC 5AV6A 3X1SD 3AFAD 5B2IA 4J8UA 5GT3A 3REIB 4QLCD 5B1MA 2NZDB 4H9SA 5DNMD 3W99D 3IP4C 5JRGC 5B33A 5AV8D 3AZFA 5AY8B 3B0DC 3X1SA 3AFAA 5CPIB 3KUYB 2YFWB 3WTPD 3W97C 1M18D 2FJ7D 5BNVB 1ID3B 5DNMA 1KX3D 5AV8A 4XZQC 3R45B 4H9QA 5B2JC 4WU8D 1P3GC 3MGQD 3WTPA 5AVCC 3EPHA 1M18A 2FJ7A 3AZIC 2CV5B 1KX3A 3X1UB 2UWXA 3AZJB 2XD5A 4WU8A 3AZMC 3A1IA 3KWQD 3AYWC 2Y2LA 4R8PB 5B31G 2BYMA 3WA9B 5CP6C 3REID 3KWQA 4WU9C 5CPKD 3UT9B 2RIQA 5AY8D 4G91B 3LZ0A 1F1EA 3B6GC 5CPID 5F99C 3KUYD 5AV9C 3REIA 5BS7A 1P3MD 2Y2PA 5B1LB 2NZDA 4ZUXB 1ZLAC 3REHC 1ID3D 5B24B 4KHAB 1P3KB 5AVBB 5CPIA 1P3FC 2PYOC 3KUYA 4CSRB 4KGCC 3TU4C 2VQRA 2YFWA 5B40B 2F2AC 5BNVA 2CV5D 2JE5A 3X1UD 3B0BA 3AZJD 2NQBC 2DQNC 5CPJD 1JFIA 1R4VA 5B31B 4J8VB 2CV5A 3X1UA 4R8PD 3AZJA 5GXQC 1U35B 3WA9D 5KDMB 5GSUB 4H9NB 1M19C 3UT9D 4R8PA 3WA9A 3AN2D 3WKJC 5B1LD 2Y2OA 2HIOB 4ZUXD 1WWIA 3UT9A 5B24D 3A1KA 1P3KD 3LJAC 5AVBD 4JJNB 3X1TA 2LY8A 1S32C 5B40D 4ZUXA 4YS3C 2F8NH 2L5AA 3W96C 3C1CC 3MGPC 4KHAA 5AV6B 3MGRC 4XUJC 5GT0B 4Z66B 4CSRA 5B40A 1P3BA 3KXBB 3LZ1B 3AZGC 5B33B 3AZFB 5DNNA 5B31D 4J8VD 2YFVB 1P3PB 2AROC 5AV5A 5FUGB 3EPLA 3MNNB 3UTAD 1U35D 1F66C 3F6TA 2Y2QA 5GSUD 1BH9A 3X1VC 4Z5TC 1BFMA 3P5JB 5B31A 4J8VA 3NQJB 4ZBJC 4DRAA 5KDMA 2HIOD 5GSUA 4H9NA 1AOIC 2JSSA 4YM6C 3VH6W 3B0DB 4H9PB 1Q9CA 2HIOA 3AZNC 1P34C 1KX4C 5AV6D 4JJNA 2ZY3A 5GT0D 4Z66D 3AV2A 4WZSB 3KXBD 3LZ1D 3LELC 5B33D 5B2JB 3AZFD 5AVCB 2IO5B 3LZ0B 3AZIB 5GT0A 2DF4C 2ZM5A 3MNND 4Z66A 5E5AC 4J8UC 1P3MC 3KXBA 3AZLC 3LZ1A 5BT1C 3AZMB 2BYKA 2YFVA 3MGSC 1P3PA 1WWSA 3AYWB 5FUGA 3X1SC 3MNNA 3VH5W 4QLCC 5CP6B 4DQYB 3NQJA 3W99C 3EPJA 3AZEC 1JFIB 5AV9B 3AZKC 1P3AC 3EG5B 2FJ7C 3REHB 4NFTA 4NE3A 5B32C 4H9PA 2PYOB 5B2JD 3MGQC 3TU4B 1KX5C 5AVCD 3W97A 3UTBC 3LZ0D 1TAFA 4CAYB 3AZID 2NZDD 1W2EA 2JCHA 2NQBB 3AZMD 5B2JA 1P3GA 1P3LC 1TZYC 5AVCA 3X1TB 3C1BC 3AZIA 3AYWD 5B0YC 3AZHC 3AV1C 5CP6D 3B0CW 3AZMA 5CPKC 1M19B 1HQ3C 5AY8C 3W98C 3AYWA 5CPIC 1P3BB 5AV9D 5CP6A 5DNNB 3WKJB 2RVQC 1H3OB 3WAAC 3REHD 4WU9A 1ID3C 3VH6T 5AV5B 3LJAB 3B6GA 1N1JA 1BH9B 1M1AB 5F99A 1S32B 2PYOD 5AV9A 3TU4D 4YS3B 2Y2KA 1ZLAA 3REHA 3B6FC 2HUEB 3C1CB 5G49B 3MGPB 3W96B 3AZJC 4XUJB 1P3FA 2PYOA 4KGCA 3TU4A 4H9OA 3RELC 5CPJC 3X1TD 3AZGB 1KU5A 4CAYA 4NE5A 3REJC 1PZRA 1P3IC 2AROB 2J8PA 2NQBA 1F66B 1M19D 4Z5TB 3O62C 2BG1A 2F8NG 4UPKA 3AV2B 4ZBJB 1P3BD 2Y2MA 3VH6A 5GXQA 3VH5T 3AN2C 5B1LC 5DNND 3WKJD 1M19A 5B24C 4Z2MH 5AV5D 1P3KC 5AVBC 4YM6B 1M1AD 4AWLB 1S32D 4J8WC 2BYKB 3WKJA 4YS3D 1H3OA 3AZNB 1P34B 3W96D 3V9RB 3MVDC 3MGPD 4WJ3C 3LJAA 4XUJD 3REKC 1M1AA 1S32A 5CHLB 5B0ZC 4KUDB 4LD9B 5B32G 4YS3A 3LELB 3AZGD 3W96A 4H9RB 5G49A 3MGPA 3C1CA 4XUJA 4E44A 2AROD 3UTAC 1U35C 4G92C 1F66D 5E5AB 1P3MB 4Z5TD 3AZLB 4NE6A 3VH5A 4JJND 3AZGA 5JRGB 1P3OC 2F8NB 4J8XC 4X23C 3MGSB 3AV2D 2AROA 3A6NC 1EQZC 1F66A 4WV4B 3B0CT 3W97B 3X1VA 4Z5TA 1TAFB 4XZQB 4YM6D 4M6BA 1P3GB 3AZEB 1P3PD 3AZKB 3AZND 1P34D 1AOIA 5AV6C 1P3AB 4YM6A 5B2IC 5GT3C 5B1MC 4H9SC 4KUDD 5B32B 4LD9D 1B67A 5B33C 3LELD 3AZFC 3AZNA 1P34A 1KX4A 1KX5B 3V9RA 3UTBB 4UUZA 3AFAC 5C3IC 4HGAC 3NQUA 4KUDA 5E5AD 4DRBA 4LD9A 4WU9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNM C;  3AZL D;  3LEL A;  5BT1 D;  5AV8 C;  5JRG D;  1P3L B;  2F8N D;  1TZY B;  4H9R A;  3B6G B;  1N1J B;  4EO5 C;  3C1B B;  5F99 B;  2CWE A;  3WTP C;  5B0Y B;  5E5A A;  1M18 C;  3W97 D;  1ZLA B;  3AZH B;  3AV1 B;  3AZL A;  1P3M A;  1KX3 C;  2F8N A;  5JRG A;  5CPK B;  4XZQ D;  3MGS A;  1HQ3 B;  3W98 B;  1P3F B;  4WU8 C;  1P3G D;  3AZE D;  4KGC B;  4H9O B;  5BNX B;  4QLC A;  1HTA A;  3AZK D;  1P3A D;  3WAA B;  4XZQ A;  3W99 A;  5B32 D;  3AZE A;  3KWQ C;  3AZK A;  5BO0 B;  1KX5 D;  2IO5 C;  3LZ0 C;  3UTB D;  1P3A A;  3B6F B;  5GXQ B;  3REI C;  5BS7 C;  2NZD C;  5B32 A;  5JA4 B;  4WU9 D;  1KX5 A;  3MGQ A;  1P3L D;  5CPJ B;  1TZY D;  3REL B;  3WTP E;  3UTB A;  2F8N K;  3B6G D;  3C1B D;  5F99 D;  3KUY C;  3REJ B;  1P3I B;  5B0Y D;  1ZLA D;  3AZH D;  3AV1 D;  1P3L A;  1TZY A;  1HQ3 D;  3O62 B;  3C1B A;  3W98 D;  1P3F D;  4KGC D;  5B0Y A;  3AZH A;  3AN2 B;  3AV1 A;  2CV5 C;  3X1U C;  3MGR B;  2RVQ D;  5CPK A;  3WAA D;  1HQ3 A;  5AY8 A;  2NQB D;  3W98 A;  5BNX A;  4J8W B;  4E45 A;  4R8P C;  3WAA A;  3B6F D;  1ID3 A;  4WNN B;  5GXQ D;  3MVD B;  3WA9 C;  3REK B;  3R45 A;  3UT9 C;  3X1V B;  5B0Z B;  5BO0 A;  3REL D;  4G91 C;  3X1T C;  3B6F A;  3REJ D;  1P3I D;  4ZUX C;  5JA4 A;  4Z2M G;  3UTA B;  4G92 B;  1AOI B;  5CPJ A;  3REL A;  1BH8 B;  3LJA D;  1P3O B;  3O62 D;  3REJ A;  4J8X B;  3KSY A;  4X23 B;  5B40 C;  1P3I A;  1P3B C;  3A6N B;  1KX4 B;  5DNN C;  1EQZ B;  3C1C D;  3MGR D;  4UUZ B;  5AV5 C;  3O62 A;  3NQU B;  1M1A C;  1ULY A;  4J8W D;  1B6W A;  3AN2 A;  5B1L A;  5B31 C;  4J8V C;  3MGR A;  2HUE C;  5B24 A;  3MVD D;  1P3K A;  5AVB A;  3REK D;  5B2I B;  4J8U B;  5GSU C;  5GT3 B;  3X1V D;  5B1M B;  5B0Z D;  4J8W A;  4WNN A;  3MVD A;  3X1S B;  3AFA B;  3REK A;  2HIO C;  5C3I B;  4HGA B;  4QLC B;  5B0Z A;  1AOI D;  1P3O D;  5DNM B;  4JJN C;  3W99 B;  5AV8 B;  4J8X D;  4X23 D;  3AV2 C;  4EO5 B;  4H9Q B;  3UTA A;  3A6N D;  1U35 A;  1KX4 D;  3WTP B;  1EQZ D;  1M18 B;  2FJ7 B;  1BH8 A;  1P3O A;  1KX3 B;  5GT0 C;  4Z66 C;  4J8X A;  4X23 A;  3KXB C;  4AWL C;  3LZ1 C;  4WU8 B;  3A6N A;  3MGQ B;  1EQZ A;  1P3P C;  1A7W A;  3MNN C;  2BYM B;  5B2I D;  4J8U D;  5GT3 D;  5B1M D;  4KUD C;  3KWQ B;  4LD9 C;  3MGS D;  5AV6 A;  3X1S D;  3AFA D;  5B2I A;  4J8U A;  5GT3 A;  3REI B;  4QLC D;  5B1M A;  2NZD B;  4H9S A;  5DNM D;  3W99 D;  5B33 A;  5JRG C;  3AZF A;  5AV8 D;  5AY8 B;  3B0D C;  3X1S A;  3AFA A;  5CPI B;  3KUY B;  2YFW B;  3WTP D;  3W97 C;  1M18 D;  2FJ7 D;  5BNV B;  1ID3 B;  5DNM A;  1KX3 D;  5AV8 A;  4XZQ C;  3R45 B;  4H9Q A;  5B2J C;  4WU8 D;  1P3G C;  3MGQ D;  3WTP A;  5AVC C;  1M18 A;  2FJ7 A;  3AZI C;  2CV5 B;  1KX3 A;  3X1U B;  3AZJ B;  4WU8 A;  3AZM C;  3KWQ D;  3AYW C;  4R8P B;  5B31 G;  2BYM A;  3WA9 B;  5CP6 C;  3REI D;  3KWQ A;  4WU9 C;  5CPK D;  3UT9 B;  5AY8 D;  4G91 B;  3LZ0 A;  1F1E A;  3B6G C;  5CPI D;  5F99 C;  3KUY D;  5AV9 C;  3REI A;  5BS7 A;  1P3M D;  2NZD A;  5B1L B;  4ZUX B;  1ZLA C;  3REH C;  1ID3 D;  5B24 B;  4KHA B;  1P3K B;  5AVB B;  5CPI A;  1P3F C;  2PYO C;  3KUY A;  4CSR B;  4KGC C;  3TU4 C;  2YFW A;  5B40 B;  5BNV A;  2CV5 D;  3X1U D;  3B0B A;  3AZJ D;  2NQB C;  5CPJ D;  1JFI A;  1R4V A;  5B31 B;  4J8V B;  2CV5 A;  3X1U A;  4R8P D;  3AZJ A;  5GXQ C;  1U35 B;  3WA9 D;  5KDM B;  5GSU B;  4H9N B;  1M19 C;  3UT9 D;  4R8P A;  3WA9 A;  3AN2 D;  3WKJ C;  5B1L D;  4ZUX D;  2HIO B;  1WWI A;  3UT9 A;  5B24 D;  1P3K D;  3LJA C;  5AVB D;  4JJN B;  3X1T A;  2LY8 A;  1S32 C;  5B40 D;  4ZUX A;  4YS3 C;  2F8N H;  2L5A A;  3W96 C;  3C1C C;  3MGP C;  4KHA A;  5AV6 B;  3MGR C;  4XUJ C;  5GT0 B;  4Z66 B;  4CSR A;  5B40 A;  1P3B A;  3KXB B;  3LZ1 B;  3AZG C;  5B33 B;  3AZF B;  5DNN A;  5B31 D;  4J8V D;  2YFV B;  1P3P B;  2ARO C;  5AV5 A;  5FUG B;  3UTA D;  3MNN B;  1U35 D;  1F66 C;  5GSU D;  1BH9 A;  3X1V C;  4Z5T C;  1BFM A;  5B31 A;  4J8V A;  3NQJ B;  4ZBJ C;  4DRA A;  5KDM A;  2HIO D;  5GSU A;  4H9N A;  1AOI C;  2JSS A;  4YM6 C;  3VH6 W;  3B0D B;  4H9P B;  1Q9C A;  2HIO A;  3AZN C;  1P34 C;  1KX4 C;  5AV6 D;  4JJN A;  5GT0 D;  4Z66 D;  3AV2 A;  4WZS B;  3KXB D;  3LZ1 D;  3LEL C;  5B33 D;  5B2J B;  3AZF D;  5AVC B;  2IO5 B;  3LZ0 B;  3AZI B;  5GT0 A;  3MNN D;  4Z66 A;  5E5A C;  4J8U C;  1P3M C;  3KXB A;  3AZL C;  3LZ1 A;  5BT1 C;  3AZM B;  2BYK A;  2YFV A;  3MGS C;  1P3P A;  1WWS A;  3AYW B;  5FUG A;  3X1S C;  3MNN A;  3VH5 W;  4QLC C;  5CP6 B;  3NQJ A;  3W99 C;  3AZE C;  1JFI B;  5AV9 B;  3AZK C;  1P3A C;  2FJ7 C;  3REH B;  4NFT A;  4NE3 A;  5B32 C;  4H9P A;  2PYO B;  5B2J D;  3MGQ C;  3TU4 B;  1KX5 C;  5AVC D;  3W97 A;  3UTB C;  3LZ0 D;  1TAF A;  4CAY B;  3AZI D;  2NZD D;  2NQB B;  3AZM D;  5B2J A;  1P3G A;  1P3L C;  1TZY C;  5AVC A;  3X1T B;  3C1B C;  3AZI A;  3AYW D;  5B0Y C;  3AZH C;  3AV1 C;  5CP6 D;  3B0C W;  3AZM A;  5CPK C;  1M19 B;  1HQ3 C;  5AY8 C;  3W98 C;  3AYW A;  5CPI C;  1P3B B;  5AV9 D;  5CP6 A;  5DNN B;  3WKJ B;  2RVQ C;  1H3O B;  3WAA C;  3REH D;  4WU9 A;  1ID3 C;  3VH6 T;  5AV5 B;  3LJA B;  3B6G A;  1N1J A;  1BH9 B;  1M1A B;  5F99 A;  1S32 B;  2PYO D;  5AV9 A;  3TU4 D;  4YS3 B;  1ZLA A;  3REH A;  3B6F C;  2HUE B;  3C1C B;  5G49 B;  3MGP B;  3W96 B;  3AZJ C;  4XUJ B;  1P3F A;  2PYO A;  4KGC A;  3TU4 A;  4H9O A;  3REL C;  5CPJ C;  3X1T D;  3AZG B;  1KU5 A;  4CAY A;  4NE5 A;  3REJ C;  1P3I C;  2ARO B;  2NQB A;  1F66 B;  1M19 D;  4Z5T B;  3O62 C;  2F8N G;  3AV2 B;  1P3B D;  4ZBJ B;  3VH6 A;  5GXQ A;  3VH5 T;  3AN2 C;  5B1L C;  5DNN D;  3WKJ D;  1M19 A;  5B24 C;  4Z2M H;  5AV5 D;  1P3K C;  5AVB C;  4YM6 B;  1M1A D;  4AWL B;  1S32 D;  4J8W C;  2BYK B;  3WKJ A;  4YS3 D;  1H3O A;  3AZN B;  1P34 B;  3W96 D;  3V9R B;  3MVD C;  3MGP D;  3LJA A;  4XUJ D;  3REK C;  1M1A A;  1S32 A;  5CHL B;  5B0Z C;  4KUD B;  4LD9 B;  5B32 G;  4YS3 A;  3LEL B;  3AZG D;  3W96 A;  4H9R B;  5G49 A;  3MGP A;  3C1C A;  4XUJ A;  4E44 A;  2ARO D;  3UTA C;  1U35 C;  4G92 C;  1F66 D;  5E5A B;  1P3M B;  4Z5T D;  3AZL B;  4NE6 A;  3VH5 A;  4JJN D;  3AZG A;  5JRG B;  1P3O C;  2F8N B;  4J8X C;  4X23 C;  3MGS B;  3AV2 D;  2ARO A;  3A6N C;  1EQZ C;  1F66 A;  4WV4 B;  3B0C T;  3W97 B;  3X1V A;  4Z5T A;  1TAF B;  4XZQ B;  4YM6 D;  4M6B A;  1P3G B;  3AZE B;  1P3P D;  3AZK B;  3AZN D;  1P34 D;  1AOI A;  5AV6 C;  1P3A B;  4YM6 A;  5B2I C;  5GT3 C;  5B1M C;  4H9S C;  4KUD D;  5B32 B;  4LD9 D;  1B67 A;  5B33 C;  3LEL D;  3AZF C;  3AZN A;  1P34 A;  1KX4 A;  1KX5 B;  3V9R A;  3UTB B;  4UUZ A;  3AFA C;  5C3I C;  4HGA C;  3NQU A;  4KUD A;  5E5A D;  4DRB A;  4LD9 A;  4WU9 B; 
#chains in the Genus database with same CATH topology
 5DNM C;  3AZL D;  3LEL A;  5BT1 D;  5AV8 C;  5JRG D;  1P3L B;  2F8N D;  1TZY B;  4H9R A;  3B6G B;  1N1J B;  4EO5 C;  3C1B B;  5F99 B;  2CWE A;  3WTP C;  5B0Y B;  5E5A A;  1M18 C;  3W97 D;  1ZLA B;  3AZH B;  3AV1 B;  3AZL A;  1P3M A;  1KX3 C;  2F8N A;  5JRG A;  5CPK B;  4XZQ D;  3MGS A;  1HQ3 B;  3W98 B;  1P3F B;  4WU8 C;  1P3G D;  3AZE D;  4KGC B;  4H9O B;  5BNX B;  4QLC A;  1HTA A;  3AZK D;  1P3A D;  3WAA B;  4XZQ A;  3W99 A;  2XD1 A;  5B32 D;  3AZE A;  3KWQ C;  3AZK A;  5BO0 B;  1KX5 D;  2IO5 C;  3LZ0 C;  3UTB D;  1P3A A;  3B6F B;  5GXQ B;  3REI C;  5BS7 C;  2NZD C;  5B32 A;  5JA4 B;  4WU9 D;  2Y2I A;  1KX5 A;  3MGQ A;  1P3L D;  5CPJ B;  1TZY D;  3REL B;  3WTP E;  3UTB A;  2F8N K;  3B6G D;  3C1B D;  5F99 D;  3KUY C;  3REJ B;  2ZY4 A;  1P3I B;  5B0Y D;  1ZLA D;  3AZH D;  3AV1 D;  1P3L A;  1TZY A;  3KFU G;  1HQ3 D;  3O62 B;  3C1B A;  3W98 D;  1P3F D;  4KGC D;  5B0Y A;  3H0M C;  3AZH A;  3AN2 B;  3AV1 A;  2CV5 C;  3X1U C;  3MGR B;  2RVQ D;  5CPK A;  3WAA D;  1HQ3 A;  5AY8 A;  2NQB D;  3W98 A;  5BNX A;  4J8W B;  4E45 A;  4R8P C;  3WAA A;  3B6F D;  2FFF B;  4WNN B;  1ID3 A;  5GXQ D;  3MVD B;  3WA9 C;  3REK B;  3EPK A;  3R45 A;  3UT9 C;  3X1V B;  5B0Z B;  5BO0 A;  3REL D;  4G91 C;  3X1T C;  3B6F A;  3REJ D;  1P3I D;  4ZUX C;  5JA4 A;  4Z2M G;  3UTA B;  4G92 B;  1AOI B;  5CPJ A;  3REL A;  1BH8 B;  3LJA D;  1P3O B;  1T3U A;  3O62 D;  3REJ A;  4J8X B;  3KSY A;  4X23 B;  5B40 C;  1P3I A;  1P3B C;  1Z2C B;  2Y2G A;  3A6N B;  1KX4 B;  5DNN C;  1EQZ B;  3C1C D;  3MGR D;  4UUZ B;  5AV5 C;  3O62 A;  2Y2J A;  3NQU B;  1M1A C;  1ULY A;  4J8W D;  1B6W A;  3AN2 A;  5B1L A;  5B31 C;  4J8V C;  2G5I C;  3MGR A;  2HUE C;  5B24 A;  3MVD D;  2ZY5 A;  1P3K A;  5AVB A;  3AL0 C;  3REK D;  5B2I B;  4J8U B;  5GSU C;  5GT3 B;  3X1V D;  5B1M B;  5B0Z D;  4J8W A;  4WNN A;  3MVD A;  3X1S B;  3AFA B;  3REK A;  2HIO C;  5C3I B;  4HGA B;  4QLC B;  5B0Z A;  1AOI D;  1P3O D;  5DNM B;  4JJN C;  3W99 B;  5AV8 B;  4J8X D;  4X23 D;  3AV2 C;  2Y2N A;  4EO5 B;  4H9Q B;  3UTA A;  3A6N D;  1U35 A;  1KX4 D;  3WTP B;  1EQZ D;  1M18 B;  2FJ7 B;  2W8S A;  1BH8 A;  1P3O A;  1KX3 B;  5GT0 C;  4Z66 C;  4J8X A;  2G5H C;  4X23 A;  3KXB C;  4AWL C;  3LZ1 C;  4WU8 B;  3A6N A;  3MGQ B;  1EQZ A;  1P3P C;  2Y2H A;  1A7W A;  3MNN C;  3FDD A;  2BYM B;  5B2I D;  4J8U D;  5GT3 D;  5B1M D;  4KUD C;  3KWQ B;  4LD9 C;  3H0L C;  3MGS D;  2ZY2 A;  3H0R C;  5AV6 A;  3X1S D;  3AFA D;  5B2I A;  4J8U A;  5GT3 A;  3REI B;  4QLC D;  5B1M A;  2NZD B;  4H9S A;  5DNM D;  3W99 D;  3IP4 C;  5JRG C;  5B33 A;  5AV8 D;  3AZF A;  5AY8 B;  3B0D C;  3X1S A;  3AFA A;  5CPI B;  3KUY B;  2YFW B;  3WTP D;  3W97 C;  1M18 D;  2FJ7 D;  5BNV B;  1ID3 B;  5DNM A;  1KX3 D;  5AV8 A;  4XZQ C;  3R45 B;  4H9Q A;  5B2J C;  4WU8 D;  1P3G C;  3MGQ D;  3WTP A;  5AVC C;  3EPH A;  1M18 A;  2FJ7 A;  3AZI C;  2CV5 B;  1KX3 A;  3X1U B;  2UWX A;  3AZJ B;  2XD5 A;  4WU8 A;  3AZM C;  3A1I A;  3KWQ D;  3AYW C;  2Y2L A;  4R8P B;  5B31 G;  2BYM A;  3WA9 B;  5CP6 C;  3REI D;  3KWQ A;  4WU9 C;  5CPK D;  3UT9 B;  2RIQ A;  5AY8 D;  4G91 B;  3LZ0 A;  1F1E A;  3B6G C;  5CPI D;  5F99 C;  3KUY D;  5AV9 C;  3REI A;  5BS7 A;  1P3M D;  2Y2P A;  5B1L B;  2NZD A;  4ZUX B;  1ZLA C;  3REH C;  1ID3 D;  5B24 B;  4KHA B;  1P3K B;  5AVB B;  5CPI A;  1P3F C;  2PYO C;  3KUY A;  4CSR B;  4KGC C;  3TU4 C;  2VQR A;  2YFW A;  5B40 B;  2F2A C;  5BNV A;  2CV5 D;  2JE5 A;  3X1U D;  3B0B A;  3AZJ D;  2NQB C;  2DQN C;  5CPJ D;  1JFI A;  1R4V A;  5B31 B;  4J8V B;  2CV5 A;  3X1U A;  4R8P D;  3AZJ A;  5GXQ C;  1U35 B;  3WA9 D;  5KDM B;  5GSU B;  4H9N B;  1M19 C;  3UT9 D;  4R8P A;  3WA9 A;  3AN2 D;  3WKJ C;  5B1L D;  2Y2O A;  2HIO B;  4ZUX D;  1WWI A;  3UT9 A;  5B24 D;  3A1K A;  1P3K D;  3LJA C;  5AVB D;  4JJN B;  3X1T A;  2LY8 A;  1S32 C;  5B40 D;  4ZUX A;  4YS3 C;  2F8N H;  2L5A A;  3W96 C;  3C1C C;  3MGP C;  4KHA A;  5AV6 B;  3MGR C;  4XUJ C;  5GT0 B;  4Z66 B;  4CSR A;  5B40 A;  1P3B A;  3KXB B;  3LZ1 B;  3AZG C;  5B33 B;  3AZF B;  5DNN A;  5B31 D;  4J8V D;  2YFV B;  1P3P B;  2ARO C;  5AV5 A;  5FUG B;  3EPL A;  3MNN B;  3UTA D;  1U35 D;  1F66 C;  3F6T A;  2Y2Q A;  5GSU D;  1BH9 A;  3X1V C;  4Z5T C;  1BFM A;  3P5J B;  5B31 A;  4J8V A;  3NQJ B;  4ZBJ C;  4DRA A;  5KDM A;  2HIO D;  5GSU A;  4H9N A;  1AOI C;  2JSS A;  4YM6 C;  3VH6 W;  3B0D B;  4H9P B;  1Q9C A;  2HIO A;  3AZN C;  1P34 C;  1KX4 C;  5AV6 D;  4JJN A;  2ZY3 A;  5GT0 D;  4Z66 D;  3AV2 A;  4WZS B;  3KXB D;  3LZ1 D;  3LEL C;  5B33 D;  5B2J B;  3AZF D;  5AVC B;  2IO5 B;  3LZ0 B;  3AZI B;  5GT0 A;  2DF4 C;  2ZM5 A;  3MNN D;  4Z66 A;  5E5A C;  4J8U C;  1P3M C;  3KXB A;  3AZL C;  3LZ1 A;  5BT1 C;  3AZM B;  2BYK A;  2YFV A;  3MGS C;  1P3P A;  1WWS A;  3AYW B;  5FUG A;  3X1S C;  3MNN A;  3VH5 W;  4QLC C;  5CP6 B;  4DQY B;  3NQJ A;  3W99 C;  3EPJ A;  3AZE C;  1JFI B;  5AV9 B;  3AZK C;  1P3A C;  3EG5 B;  2FJ7 C;  3REH B;  4NFT A;  4NE3 A;  5B32 C;  4H9P A;  2PYO B;  5B2J D;  3MGQ C;  3TU4 B;  1KX5 C;  5AVC D;  3W97 A;  3UTB C;  3LZ0 D;  1TAF A;  4CAY B;  3AZI D;  2NZD D;  1W2E A;  2JCH A;  2NQB B;  3AZM D;  5B2J A;  1P3G A;  1P3L C;  1TZY C;  5AVC A;  3X1T B;  3C1B C;  3AZI A;  3AYW D;  5B0Y C;  3AZH C;  3AV1 C;  5CP6 D;  3B0C W;  3AZM A;  5CPK C;  1M19 B;  1HQ3 C;  5AY8 C;  3W98 C;  3AYW A;  5CPI C;  1P3B B;  5AV9 D;  5CP6 A;  5DNN B;  3WKJ B;  2RVQ C;  1H3O B;  3WAA C;  3REH D;  4WU9 A;  1ID3 C;  3VH6 T;  5AV5 B;  3LJA B;  3B6G A;  1N1J A;  1BH9 B;  1M1A B;  5F99 A;  1S32 B;  2PYO D;  5AV9 A;  3TU4 D;  4YS3 B;  2Y2K A;  1ZLA A;  3REH A;  3B6F C;  2HUE B;  3C1C B;  5G49 B;  3MGP B;  3W96 B;  3AZJ C;  4XUJ B;  1P3F A;  2PYO A;  4KGC A;  3TU4 A;  4H9O A;  3REL C;  5CPJ C;  3X1T D;  3AZG B;  1KU5 A;  4CAY A;  4NE5 A;  3REJ C;  1PZR A;  1P3I C;  2ARO B;  2J8P A;  2NQB A;  1F66 B;  1M19 D;  4Z5T B;  3O62 C;  2BG1 A;  2F8N G;  4UPK A;  3AV2 B;  4ZBJ B;  1P3B D;  2Y2M A;  3VH6 A;  5GXQ A;  3VH5 T;  3AN2 C;  5B1L C;  5DNN D;  3WKJ D;  1M19 A;  5B24 C;  4Z2M H;  5AV5 D;  1P3K C;  5AVB C;  4YM6 B;  1M1A D;  4AWL B;  1S32 D;  4J8W C;  2BYK B;  3WKJ A;  4YS3 D;  1H3O A;  3AZN B;  1P34 B;  3W96 D;  3V9R B;  3MVD C;  3MGP D;  4WJ3 C;  3LJA A;  4XUJ D;  3REK C;  1M1A A;  1S32 A;  5CHL B;  5B0Z C;  4KUD B;  4LD9 B;  5B32 G;  4YS3 A;  3LEL B;  3AZG D;  3W96 A;  4H9R B;  5G49 A;  3MGP A;  3C1C A;  4XUJ A;  4E44 A;  2ARO D;  3UTA C;  1U35 C;  4G92 C;  1F66 D;  5E5A B;  1P3M B;  4Z5T D;  3AZL B;  4NE6 A;  3VH5 A;  4JJN D;  3AZG A;  5JRG B;  1P3O C;  2F8N B;  4J8X C;  4X23 C;  3MGS B;  3AV2 D;  2ARO A;  3A6N C;  1EQZ C;  1F66 A;  4WV4 B;  3B0C T;  3W97 B;  3X1V A;  4Z5T A;  1TAF B;  4XZQ B;  4YM6 D;  4M6B A;  1P3G B;  3AZE B;  1P3P D;  3AZK B;  3AZN D;  1P34 D;  1AOI A;  5AV6 C;  1P3A B;  4YM6 A;  5B2I C;  5GT3 C;  5B1M C;  4H9S C;  4KUD D;  5B32 B;  4LD9 D;  1B67 A;  5B33 C;  3LEL D;  3AZF C;  3AZN A;  1P34 A;  1KX4 A;  1KX5 B;  3V9R A;  3UTB B;  4UUZ A;  3AFA C;  5C3I C;  4HGA C;  3NQU A;  4KUD A;  5E5A D;  4DRB A;  4LD9 A;  4WU9 B; 
#chains in the Genus database with same CATH homology
 5DNM C;  3AZL D;  3LEL A;  5BT1 D;  5AV8 C;  5JRG D;  1P3L B;  2F8N D;  1TZY B;  4H9R A;  3B6G B;  1N1J B;  4EO5 C;  3C1B B;  5F99 B;  2CWE A;  3WTP C;  5B0Y B;  5E5A A;  1M18 C;  3W97 D;  1ZLA B;  3AZH B;  3AV1 B;  3AZL A;  1P3M A;  1KX3 C;  2F8N A;  5JRG A;  5CPK B;  4XZQ D;  3MGS A;  1HQ3 B;  3W98 B;  1P3F B;  4WU8 C;  1P3G D;  3AZE D;  4KGC B;  4H9O B;  5BNX B;  4QLC A;  1HTA A;  3AZK D;  1P3A D;  3WAA B;  4XZQ A;  3W99 A;  2XD1 A;  5B32 D;  3AZE A;  3KWQ C;  3AZK A;  5BO0 B;  1KX5 D;  2IO5 C;  3LZ0 C;  3UTB D;  1P3A A;  3B6F B;  5GXQ B;  3REI C;  5BS7 C;  2NZD C;  5B32 A;  5JA4 B;  4WU9 D;  2Y2I A;  1KX5 A;  3MGQ A;  1P3L D;  5CPJ B;  1TZY D;  3REL B;  3WTP E;  3UTB A;  2F8N K;  3B6G D;  3C1B D;  5F99 D;  3KUY C;  3REJ B;  2ZY4 A;  1P3I B;  5B0Y D;  1ZLA D;  3AZH D;  3AV1 D;  1P3L A;  1TZY A;  3KFU G;  1HQ3 D;  3O62 B;  3C1B A;  3W98 D;  1P3F D;  4KGC D;  5B0Y A;  3H0M C;  3AZH A;  3AN2 B;  3AV1 A;  2CV5 C;  3X1U C;  3MGR B;  2RVQ D;  5CPK A;  3WAA D;  1HQ3 A;  5AY8 A;  2NQB D;  3W98 A;  5BNX A;  4J8W B;  4E45 A;  4R8P C;  3WAA A;  3B6F D;  2FFF B;  4WNN B;  1ID3 A;  5GXQ D;  3MVD B;  3WA9 C;  3REK B;  3EPK A;  3R45 A;  3UT9 C;  3X1V B;  5B0Z B;  5BO0 A;  3REL D;  4G91 C;  3X1T C;  3B6F A;  3REJ D;  1P3I D;  4ZUX C;  5JA4 A;  4Z2M G;  3UTA B;  4G92 B;  1AOI B;  5CPJ A;  3REL A;  1BH8 B;  3LJA D;  1P3O B;  1T3U A;  3O62 D;  3REJ A;  4J8X B;  3KSY A;  4X23 B;  5B40 C;  1P3I A;  1P3B C;  1Z2C B;  2Y2G A;  3A6N B;  1KX4 B;  5DNN C;  1EQZ B;  3C1C D;  3MGR D;  4UUZ B;  5AV5 C;  3O62 A;  2Y2J A;  3NQU B;  1M1A C;  1ULY A;  4J8W D;  1B6W A;  3AN2 A;  5B1L A;  5B31 C;  4J8V C;  2G5I C;  3MGR A;  2HUE C;  5B24 A;  3MVD D;  2ZY5 A;  1P3K A;  5AVB A;  3AL0 C;  3REK D;  5B2I B;  4J8U B;  5GSU C;  5GT3 B;  3X1V D;  5B1M B;  5B0Z D;  4J8W A;  4WNN A;  3MVD A;  3X1S B;  3AFA B;  3REK A;  2HIO C;  5C3I B;  4HGA B;  4QLC B;  5B0Z A;  1AOI D;  1P3O D;  5DNM B;  4JJN C;  3W99 B;  5AV8 B;  4J8X D;  4X23 D;  3AV2 C;  2Y2N A;  4EO5 B;  4H9Q B;  3UTA A;  3A6N D;  1U35 A;  1KX4 D;  3WTP B;  1EQZ D;  1M18 B;  2FJ7 B;  2W8S A;  1BH8 A;  1P3O A;  1KX3 B;  5GT0 C;  4Z66 C;  4J8X A;  2G5H C;  4X23 A;  3KXB C;  4AWL C;  3LZ1 C;  4WU8 B;  3A6N A;  3MGQ B;  1EQZ A;  1P3P C;  2Y2H A;  1A7W A;  3MNN C;  3FDD A;  2BYM B;  5B2I D;  4J8U D;  5GT3 D;  5B1M D;  4KUD C;  3KWQ B;  4LD9 C;  3H0L C;  3MGS D;  2ZY2 A;  3H0R C;  5AV6 A;  3X1S D;  3AFA D;  5B2I A;  4J8U A;  5GT3 A;  3REI B;  4QLC D;  5B1M A;  2NZD B;  4H9S A;  5DNM D;  3W99 D;  3IP4 C;  5JRG C;  5B33 A;  5AV8 D;  3AZF A;  5AY8 B;  3B0D C;  3X1S A;  3AFA A;  5CPI B;  3KUY B;  2YFW B;  3WTP D;  3W97 C;  1M18 D;  2FJ7 D;  5BNV B;  1ID3 B;  5DNM A;  1KX3 D;  5AV8 A;  4XZQ C;  3R45 B;  4H9Q A;  5B2J C;  4WU8 D;  1P3G C;  3MGQ D;  3WTP A;  5AVC C;  3EPH A;  1M18 A;  2FJ7 A;  3AZI C;  2CV5 B;  1KX3 A;  3X1U B;  2UWX A;  3AZJ B;  2XD5 A;  4WU8 A;  3AZM C;  3A1I A;  3KWQ D;  3AYW C;  2Y2L A;  4R8P B;  5B31 G;  2BYM A;  3WA9 B;  5CP6 C;  3REI D;  3KWQ A;  4WU9 C;  5CPK D;  3UT9 B;  2RIQ A;  5AY8 D;  4G91 B;  3LZ0 A;  1F1E A;  3B6G C;  5CPI D;  5F99 C;  3KUY D;  5AV9 C;  3REI A;  5BS7 A;  1P3M D;  2Y2P A;  5B1L B;  2NZD A;  4ZUX B;  1ZLA C;  3REH C;  1ID3 D;  5B24 B;  4KHA B;  1P3K B;  5AVB B;  5CPI A;  1P3F C;  2PYO C;  3KUY A;  4CSR B;  4KGC C;  3TU4 C;  2VQR A;  2YFW A;  5B40 B;  2F2A C;  5BNV A;  2CV5 D;  2JE5 A;  3X1U D;  3B0B A;  3AZJ D;  2NQB C;  2DQN C;  5CPJ D;  1JFI A;  1R4V A;  5B31 B;  4J8V B;  2CV5 A;  3X1U A;  4R8P D;  3AZJ A;  5GXQ C;  1U35 B;  3WA9 D;  5KDM B;  5GSU B;  4H9N B;  1M19 C;  3UT9 D;  4R8P A;  3WA9 A;  3AN2 D;  3WKJ C;  5B1L D;  2Y2O A;  2HIO B;  4ZUX D;  1WWI A;  3UT9 A;  5B24 D;  3A1K A;  1P3K D;  3LJA C;  5AVB D;  4JJN B;  3X1T A;  2LY8 A;  1S32 C;  5B40 D;  4ZUX A;  4YS3 C;  2F8N H;  2L5A A;  3W96 C;  3C1C C;  3MGP C;  4KHA A;  5AV6 B;  3MGR C;  4XUJ C;  5GT0 B;  4Z66 B;  4CSR A;  5B40 A;  1P3B A;  3KXB B;  3LZ1 B;  3AZG C;  5B33 B;  3AZF B;  5DNN A;  5B31 D;  4J8V D;  2YFV B;  1P3P B;  2ARO C;  5AV5 A;  5FUG B;  3EPL A;  3MNN B;  3UTA D;  1U35 D;  1F66 C;  3F6T A;  2Y2Q A;  5GSU D;  1BH9 A;  3X1V C;  4Z5T C;  1BFM A;  3P5J B;  5B31 A;  4J8V A;  3NQJ B;  4ZBJ C;  4DRA A;  5KDM A;  2HIO D;  5GSU A;  4H9N A;  1AOI C;  2JSS A;  4YM6 C;  3VH6 W;  3B0D B;  4H9P B;  1Q9C A;  2HIO A;  3AZN C;  1P34 C;  1KX4 C;  5AV6 D;  4JJN A;  2ZY3 A;  5GT0 D;  4Z66 D;  3AV2 A;  4WZS B;  3KXB D;  3LZ1 D;  3LEL C;  5B33 D;  5B2J B;  3AZF D;  5AVC B;  2IO5 B;  3LZ0 B;  3AZI B;  5GT0 A;  2DF4 C;  2ZM5 A;  3MNN D;  4Z66 A;  5E5A C;  4J8U C;  1P3M C;  3KXB A;  3AZL C;  3LZ1 A;  5BT1 C;  3AZM B;  2BYK A;  2YFV A;  3MGS C;  1P3P A;  1WWS A;  3AYW B;  5FUG A;  3X1S C;  3MNN A;  3VH5 W;  4QLC C;  5CP6 B;  4DQY B;  3NQJ A;  3W99 C;  3EPJ A;  3AZE C;  1JFI B;  5AV9 B;  3AZK C;  1P3A C;  3EG5 B;  2FJ7 C;  3REH B;  4NFT A;  4NE3 A;  5B32 C;  4H9P A;  2PYO B;  5B2J D;  3MGQ C;  3TU4 B;  1KX5 C;  5AVC D;  3W97 A;  3UTB C;  3LZ0 D;  1TAF A;  4CAY B;  3AZI D;  2NZD D;  1W2E A;  2JCH A;  2NQB B;  3AZM D;  5B2J A;  1P3G A;  1P3L C;  1TZY C;  5AVC A;  3X1T B;  3C1B C;  3AZI A;  3AYW D;  5B0Y C;  3AZH C;  3AV1 C;  5CP6 D;  3B0C W;  3AZM A;  5CPK C;  1M19 B;  1HQ3 C;  5AY8 C;  3W98 C;  3AYW A;  5CPI C;  1P3B B;  5AV9 D;  5CP6 A;  5DNN B;  3WKJ B;  2RVQ C;  1H3O B;  3WAA C;  3REH D;  4WU9 A;  1ID3 C;  3VH6 T;  5AV5 B;  3LJA B;  3B6G A;  1N1J A;  1BH9 B;  1M1A B;  5F99 A;  1S32 B;  2PYO D;  5AV9 A;  3TU4 D;  4YS3 B;  2Y2K A;  1ZLA A;  3REH A;  3B6F C;  2HUE B;  3C1C B;  5G49 B;  3MGP B;  3W96 B;  3AZJ C;  4XUJ B;  1P3F A;  2PYO A;  4KGC A;  3TU4 A;  4H9O A;  3REL C;  5CPJ C;  3X1T D;  3AZG B;  1KU5 A;  4CAY A;  4NE5 A;  3REJ C;  1PZR A;  1P3I C;  2ARO B;  2J8P A;  2NQB A;  1F66 B;  1M19 D;  4Z5T B;  3O62 C;  2BG1 A;  2F8N G;  4UPK A;  3AV2 B;  4ZBJ B;  1P3B D;  2Y2M A;  3VH6 A;  5GXQ A;  3VH5 T;  3AN2 C;  5B1L C;  5DNN D;  3WKJ D;  1M19 A;  5B24 C;  4Z2M H;  5AV5 D;  1P3K C;  5AVB C;  4YM6 B;  1M1A D;  4AWL B;  1S32 D;  4J8W C;  2BYK B;  3WKJ A;  4YS3 D;  1H3O A;  3AZN B;  1P34 B;  3W96 D;  3V9R B;  3MVD C;  3MGP D;  4WJ3 C;  3LJA A;  4XUJ D;  3REK C;  1M1A A;  1S32 A;  5CHL B;  5B0Z C;  4KUD B;  4LD9 B;  5B32 G;  4YS3 A;  3LEL B;  3AZG D;  3W96 A;  4H9R B;  5G49 A;  3MGP A;  3C1C A;  4XUJ A;  4E44 A;  2ARO D;  3UTA C;  1U35 C;  4G92 C;  1F66 D;  5E5A B;  1P3M B;  4Z5T D;  3AZL B;  4NE6 A;  3VH5 A;  4JJN D;  3AZG A;  5JRG B;  1P3O C;  2F8N B;  4J8X C;  4X23 C;  3MGS B;  3AV2 D;  2ARO A;  3A6N C;  1EQZ C;  1F66 A;  4WV4 B;  3B0C T;  3W97 B;  3X1V A;  4Z5T A;  1TAF B;  4XZQ B;  4YM6 D;  4M6B A;  1P3G B;  3AZE B;  1P3P D;  3AZK B;  3AZN D;  1P34 D;  1AOI A;  5AV6 C;  1P3A B;  4YM6 A;  5B2I C;  5GT3 C;  5B1M C;  4H9S C;  4KUD D;  5B32 B;  4LD9 D;  1B67 A;  5B33 C;  3LEL D;  3AZF C;  3AZN A;  1P34 A;  1KX4 A;  1KX5 B;  3V9R A;  3UTB B;  4UUZ A;  3AFA C;  5C3I C;  4HGA C;  3NQU A;  4KUD A;  5E5A D;  4DRB A;  4LD9 A;  4WU9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...