1P3PD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3pD00
3X1VD 3WKJC 5B1LB 4NE3A 3AZMD 1KX5D 4X23D 5AY8D 3MGQC 4JJNA 3NQJA 5B2IC 1BH9B 3AV2C 3X1SC 1M1AB 1P3IB 3AZEB 3AZHC 3AFAC 4G92C 1P34C 3WKJA 3V9RB 1U35D 4XZQB 3MGQA 5B2IA 4HGAC 3REKB 3X1SA 3AZIC 5B0YD 3UT9B 3AFAA 3B6GB 3MGPC 3B0DB 3AV1D 3WAAB 4Z2MG 1KX5A 4X23A 3TU4B 3AZIA 1KX4B 5B33C 5F99D 5KDMA 3MGPA 3VH5T 3LJAD 1P3LB 4LD9A 2FJ7D 3AZNB 3AZKB 1U35A 4G91C 1P3AB 2BYMB 5B33A 3AN2D 3REJD 4H9OB 4KUDC 3W99D 1HQ3B 3AZGB 3B6FB 3W97B 4Z5TB 2AROB 3W98D 5B31B 1P3MD 4KUDA 4ZUXD 4CSRA 3KWQC 1F66C 2RVQC 3W96B 5F99A 1ID3B 4WU9D 3LJAA 5GT0B 2FJ7A 5B1LC 1BH8B 2F8ND 2HIOC 4EO5B 5DNMD 4YM6D 3KWQA 1F66A 5B1MB 4R8PB 3B0CW 1M1AC 1P3IC 4J8XD 3AZEC 5AV6D 2F8NG 1P3FB 5B1LA 2HIOA 4XZQC 3MGSD 3REKC 3AZJD 3X1UB 1M1AA 1P3IA 4YM6C 3AZEA 3UT9C 3B6GC 4H9QB 5AV9D 3A6ND 3B0DC 1EQZD 5CP6D 3UTAB 3V9RA 5CPJD 4KGCD 4XZQA 3KXBD 2F8NK 2F8NA 5B40B 3MGQB 4YM6A 1KX4C 3X1SB 3UT9A 3B6GA 2PYOD 3NQUA 3AFAB 5E5AD 1P3LC 5CP6C 3VH6W 1P3AC 3WTPD 1KX4A 3AZMB 1KX5B 4X23B 5CHLB 5AY8B 3AZIB 1HQ3C 1P3LA 3RELD 5KDMB 3X1TD 3AZGC 4Z5TC 2AROC 3REHD 3B6FC 5CP6A 3W97C 3KUYD 1BFMA 5CPJA 5B31C 1P3AA 1U35B 5GSUD 1R4VA 1HQ3A 4QLCD 3W96C 5B32D 3W97A 3KSYA 3AZGA 1AOID 2AROA 5B0YB 1ID3C 3AYWC 5GT0C 5B31A 3AV1B 5B32G 5B24D 1WWIA 4EO5C 4R8PC 5B1MC 3O62D 4KUDB 3W96A 5DNND 4CSRB 1KU5A 5AV5D 1ID3A 3AYWA 1B6WA 5F99B 1P3BD 5GT0A 1P3FC 3LZ1D 3LJAB 3KUYA 1BH8A 2FJ7B 5B1MA 5AV8D 3X1UC 3KWQB 1F66B 1P3KC 3AN2B 3REJB 2YFWB 3W99B 1P3FA 4H9NB 3UTAC 3VH5W 3MGRD 4WU8D 4WV4B 5JRGD 3REID 3W98B 4CAYA 3X1UA 2HIOB 5B24A 5B40C 1P3KA 1P3MB 1ZLAC 4ZUXB 4H9QA 1P3OD 3UTAA 5CPID 5AV5A 5AVBD 3X1VC 5B40A 4H9SA 4WZSB 3AZMC 1ZLAA 1KX5C 4X23C 2F8NB 5DNMB 5G49B 5AY8C 4YM6B 4J8VD 5CPKD 1P3GD 4J8XB 3NQUB 5AV6B 3X1VA 3AZMA 1U35C 5BT1D 5AY8A 3MGSB 5AVCD 5B0YC 2NQBD 2CV5D 5AV9B 3A6NB 5CP6B 3AV1C 5GXQD 5CPJB 3MVDD 4KGCB 3KXBB 5B0YA 2BYKB 5F99C 3AV1A 3B0BA 5E5AB 4M6BA 3LJAC 2FJ7C 3WA9D 3AN2C 3REJC 4KHAB 3W99C 3AZFD 3AYWB 3REHB 3W98C 3KUYB 1KX3D 3AN2A 1P3MC 5FUGB 5GSUB 3REJA 4ZUXC 2YFWA 3W99A 4H9NA 4QLCB 5B32B 1AOIB 4YS3D 4UUZB 3W98A 4WU9C 3C1CD 4CAYB 1P3MA 5B24B 5BO0B 4ZUXA 5DNMC 1P3KB 1M19D 3O62B 5DNNB 4Z66D 1M18D 4LD9D 4J8XC 3AZFA 5AV5B 5AV6C 4WU9A 4H9PA 4J8WD 5B0ZD 5DNMA 5G49A 5JA4A 3MGSC 1ZLAB 3AZJC 3VH6A 5AV8B 4J8XA 5BNVB 5AV6A 5AV9C 3A6NC 3LZ0D 1EQZC 4WU8B 3MGRB 3X1VB 5CPJC 4KGCC 3TU4D 5JRGB 3REIB 3MGSA 3MNND 3KXBC 3AZJA 4ZBJB 2JSSA 2YFVB 4XUJD 5GT3D 2CWEA 1B67A 5BS7C 5AV9A 3A6NA 3LELD 3AZKD 3AZND 1P3OB 5CPIB 1EQZA 4Z2MH 5E5AC 2PYOC 4KGCA 2HUEB 3KXBA 3WTPC 3C1BD 2BYKA 5BS7A 2PYOA 2L5AA 1JFIB 3WTPE 1P3GB 5E5AA 3RELC 3X1TC 3LZ0A 3REHC 3KUYC 4H9RA 3WTPA 1TAFB 5GSUC 1S32D 3UTBD 1P3PD 4KHAA 4QLCC 5B32C 3RELA 3X1TA 5B2JD 1AOIC 3REHA 2NQBB 2NZDD 2LY8A 3VH5A 1TZYD 5GXQB 3MVDB 5FUGA 5GSUA 4J8UD 5B24C 3O62C 4QLCA 3C1BA 5B32A 5DNNC 1N1JB 1AOIA 4UUZA 5AV5C 1P3BC 5B2JC 3LZ1C 4JJND 5BO0A 4H9SC 4AWLB 3O62A 5BNXB 3WA9B 5AV8C 5DNNA 4E44A 2F8NH 3WKJD 1P3BA 5B2JA 3LZ1A 3AZFB 3MGRC 4WU8C 4WU9B 3MGQD 5B2ID 4H9PB 5JRGC 3REIC 3AV2D 2NZDA 5AV8A 4ZBJC 5JA4B 3AZHD 3AFAD 1KX3B 5BNVA 1P34D 1P3OC 5CPIC 4WU8A 3MGRA 2HUEC 2IO5B 5AVBC 5JRGA 4YS3B 3REIA 3AZLD 3AZID 3C1CB 2YFVA 3AZJB 3MGPD 4NE5A 1P3OA 4J8VC 5CPKC 1M19B 5CPIA 1P3GC 4Z66B 5AVBA 1M18B 4LD9B 1EQZB 1H3OA 5B33D 4J8WB 3AZLC 3AV2A 5BT1C 5B0ZB 4J8VA 3AZHA 5CPKA 1JFIA 1P34A 5AVCC 1P3GA 2PYOB 4WNNB 2NQBC 1F1EA 2CV5C 3LZ0B 4KUDD 5GXQC 3AZLA 1TAFA 3MVDC 4H9RB 3WTPB 3MNNB 5AVCA 5GT3B 5C3IB 4XUJB 2NQBA 2CV5A 3RELB 4DRAA 3X1TB 4NE6A 3LELB 5GXQA 3MVDA 3KWQD 2RVQD 1F66D 4AWLC 4NFTA 3WA9C 1N1JA 4DRBA 3C1BB 5B1LD 3AZFC 2HIOD 3R45B 1M1AD 3WA9A 5BNXA 1P3ID 3AZED 1WWSA 1A7WA 1KX3C 1S32B 3UTBB 1P3PB 4XZQD 1P3BB 2IO5C 5B2JB 3REKD 4YS3C 3LZ1B 2NZDB 3C1CC 3UT9D 1TZYB 1KX3A 3B6GD 4J8UB 3WAAD 1M19C 4Z66C 1M18C 4LD9C 4YS3A 1KX4D 3C1CA 1BH9A 4J8WC 4JJNB 3NQJB 5B0ZC 1P3LD 1M19A 4Z66A 1M18A 3WAAC 1P3AD 5AVBB 3WKJB 3LZ0C 3REKA 1H3OB 4J8WA 5B2IB 5B0ZA 3TU4C 1HQ3D 3AV2B 3MNNC 3AZGD 3B6FD 3W97D 4Z5TD 2AROD 4J8VB 3AZHB 5CPKB 4WNNA 3WAAA 5GT3C 5C3IC 4XUJC 4G92B 5B31D 1P34B 3AZNC 3LELC 3AZKC 3TU4A 4HGAB 3AZLB 3B0CT 3MNNA 3W96D 5B31G 1ID3D 4E45A 4XUJA 5AVCB 5GT3A 5GT0D 3MGPB 3C1BC 3AYWD 3AZNA 3LELA 3AZKA 1ULYA 2CV5B 5B1MD 2BYMA 4R8PD 4H9OA 5B33B 3B6FA 1S32C 3UTBC 4Z5TA 1P3FD 1P3PC 3R45A 3X1UD 4G91B 1Q9CA 1P3KD 2NZDC 1TZYC 4J8UC 1S32A 3UTBA 1P3PA 3UTAD 1HTAA 3VH6T 5B40D 3X1SD 4R8PA 1ZLAD 1TZYA 4J8UA 4JJNC
chains in the Genus database with same CATH superfamily
3X1VD 4WJ3C 3WKJC 5B1LB 4NE3A 3AZMD 1KX5D 4X23D 5AY8D 3MGQC 4JJNA 3NQJA 5B2IC 1BH9B 3AV2C 3X1SC 1M1AB 1P3IB 3AZEB 3EPLA 3AZHC 3AFAC 4G92C 1P34C 2J8PA 3WKJA 3V9RB 1U35D 4XZQB 3MGQA 5B2IA 4HGAC 3REKB 3X1SA 3AZIC 5B0YD 3UT9B 3AFAA 3B6GB 3FDDA 3MGPC 3B0DB 3AV1D 2ZY5A 3WAAB 4Z2MG 1KX5A 4X23A 3TU4B 3AZIA 1KX4B 5B33C 5F99D 5KDMA 3MGPA 3VH5T 3LJAD 1P3LB 4LD9A 2FJ7D 3AZNB 3AZKB 1U35A 4G91C 3H0RC 1P3AB 2BYMB 5B33A 3AN2D 3REJD 4H9OB 4KUDC 3W99D 1HQ3B 3AZGB 3B6FB 3W97B 4Z5TB 2AROB 3W98D 5B31B 1P3MD 4KUDA 4ZUXD 4CSRA 3KWQC 1F66C 2RVQC 3W96B 5F99A 1ID3B 4WU9D 3LJAA 5GT0B 2FJ7A 5B1LC 1BH8B 2F8ND 2HIOC 4EO5B 5DNMD 4YM6D 3KWQA 1F66A 5B1MB 4R8PB 3B0CW 3EG5B 1M1AC 1P3IC 3F6TA 4J8XD 3AZEC 5AV6D 2F8NG 1P3FB 5B1LA 2HIOA 4XZQC 3MGSD 3REKC 3AZJD 3X1UB 1M1AA 1T3UA 1P3IA 4YM6C 3AZEA 3UT9C 3B6GC 4H9QB 5AV9D 3A6ND 3B0DC 1EQZD 5CP6D 3UTAB 1W2EA 3V9RA 5CPJD 4KGCD 4XZQA 3KXBD 2F8NK 2F8NA 5B40B 3MGQB 4YM6A 1KX4C 3X1SB 3UT9A 3B6GA 2PYOD 3NQUA 3AFAB 5E5AD 1P3LC 5CP6C 3VH6W 1P3AC 3WTPD 1KX4A 2Y2MA 3AZMB 1KX5B 4X23B 5CHLB 5AY8B 3AZIB 1HQ3C 1P3LA 3RELD 5KDMB 3X1TD 3AZGC 4Z5TC 2AROC 3REHD 3B6FC 5CP6A 3W97C 3KUYD 1BFMA 5CPJA 5B31C 1P3AA 1U35B 5GSUD 2Y2HA 1R4VA 1HQ3A 4QLCD 3W96C 5B32D 2F2AC 3W97A 3KSYA 3AZGA 1AOID 2AROA 1PZRA 2Y2LA 5B0YB 1ID3C 3AYWC 5GT0C 5B31A 3AV1B 5B32G 5B24D 1WWIA 4EO5C 4R8PC 5B1MC 3O62D 4KUDB 3W96A 5DNND 4CSRB 1KU5A 5AV5D 1ID3A 3AYWA 1B6WA 5F99B 1P3BD 5GT0A 1P3FC 3LZ1D 3LJAB 3KUYA 1BH8A 2FJ7B 2G5IC 5B1MA 5AV8D 3X1UC 3KWQB 1F66B 1P3KC 3AN2B 3REJB 2YFWB 3W99B 1P3FA 4H9NB 3UTAC 3VH5W 3MGRD 4WU8D 4WV4B 5JRGD 3REID 3W98B 4CAYA 3X1UA 2HIOB 5B24A 5B40C 1P3KA 1P3MB 1ZLAC 4ZUXB 4H9QA 1P3OD 3UTAA 5CPID 5AV5A 5AVBD 3X1VC 5B40A 4H9SA 4WZSB 3AZMC 1ZLAA 1KX5C 4X23C 2F8NB 5DNMB 5G49B 5AY8C 4YM6B 4J8VD 5CPKD 1P3GD 4J8XB 3NQUB 5AV6B 3X1VA 3AZMA 1U35C 5BT1D 3AL0C 5AY8A 3MGSB 5AVCD 2Y2NA 2ZY4A 5B0YC 2NQBD 2CV5D 5AV9B 3A6NB 5CP6B 3AV1C 5GXQD 5CPJB 3MVDD 4KGCB 3KXBB 5B0YA 2BYKB 5F99C 3AV1A 3B0BA 5E5AB 4M6BA 3LJAC 3EPKA 2VQRA 2FJ7C 3WA9D 3KFUG 3AN2C 3REJC 4KHAB 2UWXA 3W99C 3AZFD 3AYWB 3REHB 3W98C 2Y2GA 3KUYB 1KX3D 3AN2A 1P3MC 5FUGB 5GSUB 3REJA 4ZUXC 3EPJA 2YFWA 3W99A 4H9NA 4QLCB 5B32B 1AOIB 4YS3D 4UUZB 3W98A 4WU9C 3C1CD 4CAYB 1P3MA 5B24B 5BO0B 4ZUXA 5DNMC 1P3KB 1M19D 3O62B 5DNNB 4Z66D 1M18D 4LD9D 4J8XC 3AZFA 5AV5B 5AV6C 4WU9A 4H9PA 4J8WD 5B0ZD 5DNMA 2JE5A 5G49A 5JA4A 3MGSC 1ZLAB 3AZJC 3VH6A 5AV8B 4DQYB 3IP4C 4J8XA 5BNVB 2Y2IA 5AV6A 5AV9C 3A6NC 3LZ0D 1EQZC 4WU8B 3MGRB 3X1VB 5CPJC 4KGCC 3TU4D 5JRGB 3REIB 3MGSA 3MNND 3KXBC 3AZJA 4ZBJB 2JSSA 2YFVB 4XUJD 5GT3D 2CWEA 1B67A 5BS7C 5AV9A 3A6NA 3LELD 3AZKD 3AZND 1P3OB 5CPIB 2JCHA 4Z2MH 1Z2CB 5E5AC 1EQZA 4KGCA 2HUEB 3KXBA 3WTPC 3C1BD 2BYKA 2ZM5A 5BS7A 2PYOA 2L5AA 1JFIB 3WTPE 1P3GB 5E5AA 3RELC 3X1TC 3LZ0A 3REHC 3KUYC 4H9RA 3WTPA 1TAFB 5GSUC 1S32D 3UTBD 1P3PD 4KHAA 4QLCC 3H0MC 5B32C 3RELA 3X1TA 5B2JD 1AOIC 3REHA 2NQBB 2NZDD 2LY8A 3VH5A 1TZYD 5GXQB 3MVDB 5FUGA 5GSUA 4J8UD 5B24C 2Y2JA 3O62C 4QLCA 3C1BA 5B32A 5DNNC 1N1JB 1AOIA 4UUZA 5AV5C 1P3BC 5B2JC 3LZ1C 4JJND 5BO0A 4H9SC 4AWLB 3O62A 5BNXB 3WA9B 5AV8C 5DNNA 4E44A 2F8NH 3WKJD 2FFFB 1P3BA 5B2JA 3LZ1A 3AZFB 3MGRC 4WU8C 4WU9B 4UPKA 3MGQD 5B2ID 4H9PB 5JRGC 3REIC 3AV2D 2NZDA 5AV8A 4ZBJC 2Y2QA 5JA4B 3AZHD 3AFAD 1KX3B 5BNVA 1P34D 1P3OC 2RIQA 5CPIC 2W8SA 4WU8A 3MGRA 2HUEC 2IO5B 5AVBC 5JRGA 4YS3B 3REIA 3AZLD 3AZID 3C1CB 2YFVA 3AZJB 3MGPD 4NE5A 1P3OA 4J8VC 5CPKC 1M19B 5CPIA 1P3GC 4Z66B 5AVBA 2DQNC 1M18B 1EQZB 4LD9B 1H3OA 5B33D 4J8WB 3AZLC 3AV2A 5BT1C 5B0ZB 4J8VA 3AZHA 5CPKA 1JFIA 1P34A 5AVCC 1P3GA 2PYOB 4WNNB 2NQBC 1F1EA 2CV5C 3LZ0B 4KUDD 5GXQC 3AZLA 1TAFA 3MVDC 4H9RB 3WTPB 3MNNB 5AVCA 2XD1A 5GT3B 5C3IB 3A1IA 4XUJB 2NQBA 2CV5A 2BG1A 4DRAA 3RELB 4NE6A 3X1TB 3LELB 5GXQA 3MVDA 3KWQD 2RVQD 1F66D 4AWLC 4NFTA 3WA9C 1N1JA 4DRBA 3C1BB 5B1LD 2ZY2A 3AZFC 2HIOD 3R45B 1M1AD 3WA9A 5BNXA 1P3ID 3AZED 1WWSA 1A7WA 3H0LC 1KX3C 1S32B 3UTBB 1P3PB 4XZQD 1P3BB 2IO5C 5B2JB 3REKD 4YS3C 3LZ1B 2NZDB 2PYOC 3C1CC 3UT9D 1TZYB 1KX3A 3B6GD 4J8UB 3WAAD 1M19C 4Z66C 1M18C 4LD9C 3EPHA 2XD5A 4YS3A 2Y2PA 1KX4D 3C1CA 1BH9A 4J8WC 4JJNB 3NQJB 5B0ZC 1P3LD 1M19A 2ZY3A 4Z66A 1M18A 3WAAC 1P3AD 5AVBB 3WKJB 3LZ0C 3REKA 1H3OB 4J8WA 5B2IB 5B0ZA 3TU4C 1HQ3D 3AV2B 3MNNC 3AZGD 3B6FD 2G5HC 4Z5TD 2AROD 3W97D 4J8VB 3AZHB 5CPKB 2Y2OA 4WNNA 3WAAA 4XUJC 5C3IC 3A1KA 5GT3C 2Y2KA 5B31D 4G92B 1P34B 3AZNC 3LELC 3AZKC 3TU4A 4HGAB 3AZLB 3B0CT 3MNNA 3W96D 5B31G 1ID3D 4E45A 4XUJA 5AVCB 5GT3A 5GT0D 3MGPB 3C1BC 3AYWD 3AZNA 3LELA 3AZKA 1ULYA 2CV5B 5B1MD 2BYMA 4R8PD 4H9OA 2DF4C 5B33B 3B6FA 1S32C 3UTBC 4Z5TA 1P3FD 1P3PC 3R45A 3X1UD 4G91B 1Q9CA 1P3KD 2NZDC 1TZYC 4J8UC 1S32A 3UTBA 1P3PA 3P5JB 3UTAD 1HTAA 3VH6T 5B40D 3X1SD 4R8PA 1ZLAD 1TZYA 4J8UA 4JJNC
chains in the Genus database with same CATH topology
3X1VD 4WJ3C 3WKJC 5B1LB 4NE3A 3AZMD 1KX5D 4X23D 5AY8D 3MGQC 4JJNA 3NQJA 5B2IC 1BH9B 3AV2C 3X1SC 1M1AB 1P3IB 3AZEB 3EPLA 3AZHC 3AFAC 4G92C 1P34C 2J8PA 3WKJA 3V9RB 1U35D 4XZQB 3MGQA 5B2IA 4HGAC 3REKB 3X1SA 3AZIC 5B0YD 3UT9B 3AFAA 3B6GB 3FDDA 3MGPC 3B0DB 3AV1D 2ZY5A 3WAAB 4Z2MG 1KX5A 4X23A 3TU4B 3AZIA 1KX4B 5B33C 5F99D 5KDMA 3MGPA 3VH5T 3LJAD 1P3LB 4LD9A 2FJ7D 3AZNB 3AZKB 1U35A 4G91C 3H0RC 1P3AB 2BYMB 5B33A 3AN2D 3REJD 4H9OB 4KUDC 3W99D 1HQ3B 3AZGB 3B6FB 3W97B 4Z5TB 2AROB 3W98D 5B31B 1P3MD 4KUDA 4ZUXD 4CSRA 3KWQC 1F66C 2RVQC 3W96B 5F99A 1ID3B 4WU9D 3LJAA 5GT0B 2FJ7A 5B1LC 1BH8B 2F8ND 2HIOC 4EO5B 5DNMD 4YM6D 3KWQA 1F66A 5B1MB 4R8PB 3B0CW 3EG5B 1M1AC 1P3IC 3F6TA 4J8XD 3AZEC 5AV6D 2F8NG 1P3FB 5B1LA 2HIOA 4XZQC 3MGSD 3REKC 3AZJD 3X1UB 1M1AA 1T3UA 1P3IA 4YM6C 3AZEA 3UT9C 3B6GC 4H9QB 5AV9D 3A6ND 3B0DC 1EQZD 5CP6D 3UTAB 1W2EA 3V9RA 5CPJD 4KGCD 4XZQA 3KXBD 2F8NK 2F8NA 5B40B 3MGQB 4YM6A 1KX4C 3X1SB 3UT9A 3B6GA 2PYOD 3NQUA 3AFAB 5E5AD 1P3LC 5CP6C 3VH6W 1P3AC 3WTPD 1KX4A 2Y2MA 3AZMB 1KX5B 4X23B 5CHLB 5AY8B 3AZIB 1HQ3C 1P3LA 3RELD 5KDMB 3X1TD 3AZGC 4Z5TC 2AROC 3REHD 3B6FC 5CP6A 3W97C 3KUYD 1BFMA 5CPJA 5B31C 1P3AA 1U35B 5GSUD 2Y2HA 1R4VA 1HQ3A 4QLCD 3W96C 5B32D 2F2AC 3W97A 3KSYA 3AZGA 1AOID 2AROA 1PZRA 2Y2LA 5B0YB 1ID3C 3AYWC 5GT0C 5B31A 3AV1B 5B32G 5B24D 1WWIA 4EO5C 4R8PC 5B1MC 3O62D 4KUDB 3W96A 5DNND 4CSRB 1KU5A 5AV5D 1ID3A 3AYWA 1B6WA 5F99B 1P3BD 5GT0A 1P3FC 3LZ1D 3LJAB 3KUYA 1BH8A 2FJ7B 2G5IC 5B1MA 5AV8D 3X1UC 3KWQB 1F66B 1P3KC 3AN2B 3REJB 2YFWB 3W99B 1P3FA 4H9NB 3UTAC 3VH5W 3MGRD 4WU8D 4WV4B 5JRGD 3REID 3W98B 4CAYA 3X1UA 2HIOB 5B24A 5B40C 1P3KA 1P3MB 1ZLAC 4ZUXB 4H9QA 1P3OD 3UTAA 5CPID 5AV5A 5AVBD 3X1VC 5B40A 4H9SA 4WZSB 3AZMC 1ZLAA 1KX5C 4X23C 2F8NB 5DNMB 5G49B 5AY8C 4YM6B 4J8VD 5CPKD 1P3GD 4J8XB 3NQUB 5AV6B 3X1VA 3AZMA 1U35C 5BT1D 3AL0C 5AY8A 3MGSB 5AVCD 2Y2NA 2ZY4A 5B0YC 2NQBD 2CV5D 5AV9B 3A6NB 5CP6B 3AV1C 5GXQD 5CPJB 3MVDD 4KGCB 3KXBB 5B0YA 2BYKB 5F99C 3AV1A 3B0BA 5E5AB 4M6BA 3LJAC 3EPKA 2VQRA 2FJ7C 3WA9D 3KFUG 3AN2C 3REJC 4KHAB 2UWXA 3W99C 3AZFD 3AYWB 3REHB 3W98C 2Y2GA 3KUYB 1KX3D 3AN2A 1P3MC 5FUGB 5GSUB 3REJA 4ZUXC 3EPJA 2YFWA 3W99A 4H9NA 4QLCB 5B32B 1AOIB 4YS3D 4UUZB 3W98A 4WU9C 3C1CD 4CAYB 1P3MA 5B24B 5BO0B 4ZUXA 5DNMC 1P3KB 1M19D 3O62B 5DNNB 4Z66D 1M18D 4LD9D 4J8XC 3AZFA 5AV5B 5AV6C 4WU9A 4H9PA 4J8WD 5B0ZD 5DNMA 2JE5A 5G49A 5JA4A 3MGSC 1ZLAB 3AZJC 3VH6A 5AV8B 4DQYB 3IP4C 4J8XA 5BNVB 2Y2IA 5AV6A 5AV9C 3A6NC 3LZ0D 1EQZC 4WU8B 3MGRB 3X1VB 5CPJC 4KGCC 3TU4D 5JRGB 3REIB 3MGSA 3MNND 3KXBC 3AZJA 4ZBJB 2JSSA 2YFVB 4XUJD 5GT3D 2CWEA 1B67A 5BS7C 5AV9A 3A6NA 3LELD 3AZKD 3AZND 1P3OB 5CPIB 2JCHA 4Z2MH 1Z2CB 5E5AC 1EQZA 4KGCA 2HUEB 3KXBA 3WTPC 3C1BD 2BYKA 2ZM5A 5BS7A 2PYOA 2L5AA 1JFIB 3WTPE 1P3GB 5E5AA 3RELC 3X1TC 3LZ0A 3REHC 3KUYC 4H9RA 3WTPA 1TAFB 5GSUC 1S32D 3UTBD 1P3PD 4KHAA 4QLCC 3H0MC 5B32C 3RELA 3X1TA 5B2JD 1AOIC 3REHA 2NQBB 2NZDD 2LY8A 3VH5A 1TZYD 5GXQB 3MVDB 5FUGA 5GSUA 4J8UD 5B24C 2Y2JA 3O62C 4QLCA 3C1BA 5B32A 5DNNC 1N1JB 1AOIA 4UUZA 5AV5C 1P3BC 5B2JC 3LZ1C 4JJND 5BO0A 4H9SC 4AWLB 3O62A 5BNXB 3WA9B 5AV8C 5DNNA 4E44A 2F8NH 3WKJD 2FFFB 1P3BA 5B2JA 3LZ1A 3AZFB 3MGRC 4WU8C 4WU9B 4UPKA 3MGQD 5B2ID 4H9PB 5JRGC 3REIC 3AV2D 2NZDA 5AV8A 4ZBJC 2Y2QA 5JA4B 3AZHD 3AFAD 1KX3B 5BNVA 1P34D 1P3OC 2RIQA 5CPIC 2W8SA 4WU8A 3MGRA 2HUEC 2IO5B 5AVBC 5JRGA 4YS3B 3REIA 3AZLD 3AZID 3C1CB 2YFVA 3AZJB 3MGPD 4NE5A 1P3OA 4J8VC 5CPKC 1M19B 5CPIA 1P3GC 4Z66B 5AVBA 2DQNC 1M18B 1EQZB 4LD9B 1H3OA 5B33D 4J8WB 3AZLC 3AV2A 5BT1C 5B0ZB 4J8VA 3AZHA 5CPKA 1JFIA 1P34A 5AVCC 1P3GA 2PYOB 4WNNB 2NQBC 1F1EA 2CV5C 3LZ0B 4KUDD 5GXQC 3AZLA 1TAFA 3MVDC 4H9RB 3WTPB 3MNNB 5AVCA 2XD1A 5GT3B 5C3IB 3A1IA 4XUJB 2NQBA 2CV5A 2BG1A 4DRAA 3RELB 4NE6A 3X1TB 3LELB 5GXQA 3MVDA 3KWQD 2RVQD 1F66D 4AWLC 4NFTA 3WA9C 1N1JA 4DRBA 3C1BB 5B1LD 2ZY2A 3AZFC 2HIOD 3R45B 1M1AD 3WA9A 5BNXA 1P3ID 3AZED 1WWSA 1A7WA 3H0LC 1KX3C 1S32B 3UTBB 1P3PB 4XZQD 1P3BB 2IO5C 5B2JB 3REKD 4YS3C 3LZ1B 2NZDB 2PYOC 3C1CC 3UT9D 1TZYB 1KX3A 3B6GD 4J8UB 3WAAD 1M19C 4Z66C 1M18C 4LD9C 3EPHA 2XD5A 4YS3A 2Y2PA 1KX4D 3C1CA 1BH9A 4J8WC 4JJNB 3NQJB 5B0ZC 1P3LD 1M19A 2ZY3A 4Z66A 1M18A 3WAAC 1P3AD 5AVBB 3WKJB 3LZ0C 3REKA 1H3OB 4J8WA 5B2IB 5B0ZA 3TU4C 1HQ3D 3AV2B 3MNNC 3AZGD 3B6FD 2G5HC 4Z5TD 2AROD 3W97D 4J8VB 3AZHB 5CPKB 2Y2OA 4WNNA 3WAAA 4XUJC 5C3IC 3A1KA 5GT3C 2Y2KA 5B31D 4G92B 1P34B 3AZNC 3LELC 3AZKC 3TU4A 4HGAB 3AZLB 3B0CT 3MNNA 3W96D 5B31G 1ID3D 4E45A 4XUJA 5AVCB 5GT3A 5GT0D 3MGPB 3C1BC 3AYWD 3AZNA 3LELA 3AZKA 1ULYA 2CV5B 5B1MD 2BYMA 4R8PD 4H9OA 2DF4C 5B33B 3B6FA 1S32C 3UTBC 4Z5TA 1P3FD 1P3PC 3R45A 3X1UD 4G91B 1Q9CA 1P3KD 2NZDC 1TZYC 4J8UC 1S32A 3UTBA 1P3PA 3P5JB 3UTAD 1HTAA 3VH6T 5B40D 3X1SD 4R8PA 1ZLAD 1TZYA 4J8UA 4JJNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1V D;  3WKJ C;  5B1L B;  4NE3 A;  3AZM D;  1KX5 D;  4X23 D;  5AY8 D;  3MGQ C;  4JJN A;  3NQJ A;  5B2I C;  1BH9 B;  3AV2 C;  3X1S C;  1M1A B;  1P3I B;  3AZE B;  3AZH C;  3AFA C;  4G92 C;  1P34 C;  3WKJ A;  3V9R B;  1U35 D;  4XZQ B;  3MGQ A;  5B2I A;  4HGA C;  3REK B;  3X1S A;  3AZI C;  5B0Y D;  3UT9 B;  3AFA A;  3B6G B;  3MGP C;  3B0D B;  3AV1 D;  3WAA B;  4Z2M G;  1KX5 A;  4X23 A;  3TU4 B;  3AZI A;  1KX4 B;  5B33 C;  5F99 D;  5KDM A;  3MGP A;  3VH5 T;  3LJA D;  1P3L B;  4LD9 A;  2FJ7 D;  3AZN B;  3AZK B;  1U35 A;  4G91 C;  1P3A B;  2BYM B;  5B33 A;  3AN2 D;  3REJ D;  4H9O B;  4KUD C;  3W99 D;  1HQ3 B;  3AZG B;  3B6F B;  3W97 B;  4Z5T B;  2ARO B;  3W98 D;  5B31 B;  1P3M D;  4KUD A;  4ZUX D;  4CSR A;  3KWQ C;  1F66 C;  2RVQ C;  3W96 B;  5F99 A;  1ID3 B;  4WU9 D;  3LJA A;  5GT0 B;  2FJ7 A;  5B1L C;  1BH8 B;  2F8N D;  2HIO C;  4EO5 B;  5DNM D;  4YM6 D;  3KWQ A;  1F66 A;  5B1M B;  4R8P B;  3B0C W;  1M1A C;  1P3I C;  4J8X D;  3AZE C;  5AV6 D;  2F8N G;  1P3F B;  5B1L A;  2HIO A;  4XZQ C;  3MGS D;  3REK C;  3AZJ D;  3X1U B;  1M1A A;  1P3I A;  4YM6 C;  3AZE A;  3UT9 C;  3B6G C;  4H9Q B;  5AV9 D;  3A6N D;  3B0D C;  1EQZ D;  5CP6 D;  3UTA B;  3V9R A;  5CPJ D;  4KGC D;  4XZQ A;  3KXB D;  2F8N K;  2F8N A;  5B40 B;  3MGQ B;  4YM6 A;  1KX4 C;  3X1S B;  3UT9 A;  3B6G A;  2PYO D;  3NQU A;  3AFA B;  5E5A D;  1P3L C;  5CP6 C;  3VH6 W;  1P3A C;  3WTP D;  1KX4 A;  3AZM B;  1KX5 B;  4X23 B;  5CHL B;  5AY8 B;  3AZI B;  1HQ3 C;  1P3L A;  3REL D;  5KDM B;  3X1T D;  3AZG C;  4Z5T C;  2ARO C;  3REH D;  3B6F C;  5CP6 A;  3W97 C;  3KUY D;  1BFM A;  5CPJ A;  5B31 C;  1P3A A;  1U35 B;  5GSU D;  1R4V A;  1HQ3 A;  4QLC D;  3W96 C;  5B32 D;  3W97 A;  3KSY A;  3AZG A;  1AOI D;  2ARO A;  5B0Y B;  1ID3 C;  3AYW C;  5GT0 C;  5B31 A;  3AV1 B;  5B32 G;  5B24 D;  1WWI A;  4EO5 C;  4R8P C;  5B1M C;  3O62 D;  4KUD B;  3W96 A;  5DNN D;  4CSR B;  1KU5 A;  5AV5 D;  1ID3 A;  3AYW A;  1B6W A;  5F99 B;  1P3B D;  5GT0 A;  1P3F C;  3LZ1 D;  3LJA B;  3KUY A;  1BH8 A;  2FJ7 B;  5B1M A;  5AV8 D;  3X1U C;  3KWQ B;  1F66 B;  1P3K C;  3AN2 B;  3REJ B;  2YFW B;  3W99 B;  1P3F A;  4H9N B;  3UTA C;  3VH5 W;  3MGR D;  4WU8 D;  4WV4 B;  5JRG D;  3REI D;  3W98 B;  4CAY A;  3X1U A;  2HIO B;  5B24 A;  5B40 C;  1P3K A;  1P3M B;  1ZLA C;  4ZUX B;  4H9Q A;  1P3O D;  3UTA A;  5CPI D;  5AV5 A;  5AVB D;  3X1V C;  5B40 A;  4H9S A;  4WZS B;  3AZM C;  1ZLA A;  1KX5 C;  4X23 C;  2F8N B;  5DNM B;  5G49 B;  5AY8 C;  4YM6 B;  4J8V D;  5CPK D;  1P3G D;  4J8X B;  3NQU B;  5AV6 B;  3X1V A;  3AZM A;  1U35 C;  5BT1 D;  5AY8 A;  3MGS B;  5AVC D;  5B0Y C;  2NQB D;  2CV5 D;  5AV9 B;  3A6N B;  5CP6 B;  3AV1 C;  5GXQ D;  5CPJ B;  3MVD D;  4KGC B;  3KXB B;  5B0Y A;  2BYK B;  5F99 C;  3AV1 A;  3B0B A;  5E5A B;  4M6B A;  3LJA C;  2FJ7 C;  3WA9 D;  3AN2 C;  3REJ C;  4KHA B;  3W99 C;  3AZF D;  3AYW B;  3REH B;  3W98 C;  3KUY B;  1KX3 D;  3AN2 A;  1P3M C;  5FUG B;  5GSU B;  3REJ A;  4ZUX C;  2YFW A;  3W99 A;  4H9N A;  4QLC B;  5B32 B;  1AOI B;  4YS3 D;  4UUZ B;  3W98 A;  4WU9 C;  3C1C D;  4CAY B;  1P3M A;  5B24 B;  5BO0 B;  4ZUX A;  5DNM C;  1P3K B;  1M19 D;  3O62 B;  5DNN B;  4Z66 D;  1M18 D;  4LD9 D;  4J8X C;  3AZF A;  5AV5 B;  5AV6 C;  4WU9 A;  4H9P A;  4J8W D;  5B0Z D;  5DNM A;  5G49 A;  5JA4 A;  3MGS C;  1ZLA B;  3AZJ C;  3VH6 A;  5AV8 B;  4J8X A;  5BNV B;  5AV6 A;  5AV9 C;  3A6N C;  3LZ0 D;  1EQZ C;  4WU8 B;  3MGR B;  3X1V B;  5CPJ C;  4KGC C;  3TU4 D;  5JRG B;  3REI B;  3MGS A;  3MNN D;  3KXB C;  3AZJ A;  4ZBJ B;  2JSS A;  2YFV B;  4XUJ D;  5GT3 D;  2CWE A;  1B67 A;  5BS7 C;  5AV9 A;  3A6N A;  3LEL D;  3AZK D;  3AZN D;  1P3O B;  5CPI B;  1EQZ A;  4Z2M H;  5E5A C;  2PYO C;  4KGC A;  2HUE B;  3KXB A;  3WTP C;  3C1B D;  2BYK A;  5BS7 A;  2PYO A;  2L5A A;  1JFI B;  3WTP E;  1P3G B;  5E5A A;  3REL C;  3X1T C;  3LZ0 A;  3REH C;  3KUY C;  4H9R A;  3WTP A;  1TAF B;  5GSU C;  1S32 D;  3UTB D;  1P3P D;  4KHA A;  4QLC C;  5B32 C;  3REL A;  3X1T A;  5B2J D;  1AOI C;  3REH A;  2NQB B;  2NZD D;  2LY8 A;  3VH5 A;  1TZY D;  5GXQ B;  3MVD B;  5FUG A;  5GSU A;  4J8U D;  5B24 C;  3O62 C;  4QLC A;  3C1B A;  5B32 A;  5DNN C;  1N1J B;  1AOI A;  4UUZ A;  5AV5 C;  1P3B C;  5B2J C;  3LZ1 C;  4JJN D;  5BO0 A;  4H9S C;  4AWL B;  3O62 A;  5BNX B;  3WA9 B;  5AV8 C;  5DNN A;  4E44 A;  2F8N H;  3WKJ D;  1P3B A;  5B2J A;  3LZ1 A;  3AZF B;  3MGR C;  4WU8 C;  4WU9 B;  3MGQ D;  5B2I D;  4H9P B;  5JRG C;  3REI C;  3AV2 D;  2NZD A;  5AV8 A;  4ZBJ C;  5JA4 B;  3AZH D;  3AFA D;  1KX3 B;  5BNV A;  1P34 D;  1P3O C;  5CPI C;  4WU8 A;  3MGR A;  2HUE C;  2IO5 B;  5AVB C;  5JRG A;  4YS3 B;  3REI A;  3AZL D;  3AZI D;  3C1C B;  2YFV A;  3AZJ B;  3MGP D;  4NE5 A;  1P3O A;  4J8V C;  5CPK C;  1M19 B;  5CPI A;  1P3G C;  4Z66 B;  5AVB A;  1M18 B;  4LD9 B;  1EQZ B;  1H3O A;  5B33 D;  4J8W B;  3AZL C;  3AV2 A;  5BT1 C;  5B0Z B;  4J8V A;  3AZH A;  5CPK A;  1JFI A;  1P34 A;  5AVC C;  1P3G A;  2PYO B;  4WNN B;  2NQB C;  1F1E A;  2CV5 C;  3LZ0 B;  4KUD D;  5GXQ C;  3AZL A;  1TAF A;  3MVD C;  4H9R B;  3WTP B;  3MNN B;  5AVC A;  5GT3 B;  5C3I B;  4XUJ B;  2NQB A;  2CV5 A;  3REL B;  4DRA A;  3X1T B;  4NE6 A;  3LEL B;  5GXQ A;  3MVD A;  3KWQ D;  2RVQ D;  1F66 D;  4AWL C;  4NFT A;  3WA9 C;  1N1J A;  4DRB A;  3C1B B;  5B1L D;  3AZF C;  2HIO D;  3R45 B;  1M1A D;  3WA9 A;  5BNX A;  1P3I D;  3AZE D;  1WWS A;  1A7W A;  1KX3 C;  1S32 B;  3UTB B;  1P3P B;  4XZQ D;  1P3B B;  2IO5 C;  5B2J B;  3REK D;  4YS3 C;  3LZ1 B;  2NZD B;  3C1C C;  3UT9 D;  1TZY B;  1KX3 A;  3B6G D;  4J8U B;  3WAA D;  1M19 C;  4Z66 C;  1M18 C;  4LD9 C;  4YS3 A;  1KX4 D;  3C1C A;  1BH9 A;  4J8W C;  4JJN B;  3NQJ B;  5B0Z C;  1P3L D;  1M19 A;  4Z66 A;  1M18 A;  3WAA C;  1P3A D;  5AVB B;  3WKJ B;  3LZ0 C;  3REK A;  1H3O B;  4J8W A;  5B2I B;  5B0Z A;  3TU4 C;  1HQ3 D;  3AV2 B;  3MNN C;  3AZG D;  3B6F D;  3W97 D;  4Z5T D;  2ARO D;  4J8V B;  3AZH B;  5CPK B;  4WNN A;  3WAA A;  5GT3 C;  5C3I C;  4XUJ C;  4G92 B;  5B31 D;  1P34 B;  3AZN C;  3LEL C;  3AZK C;  3TU4 A;  4HGA B;  3AZL B;  3B0C T;  3MNN A;  3W96 D;  5B31 G;  1ID3 D;  4E45 A;  4XUJ A;  5AVC B;  5GT3 A;  5GT0 D;  3MGP B;  3C1B C;  3AYW D;  3AZN A;  3LEL A;  3AZK A;  1ULY A;  2CV5 B;  5B1M D;  2BYM A;  4R8P D;  4H9O A;  5B33 B;  3B6F A;  1S32 C;  3UTB C;  4Z5T A;  1P3F D;  1P3P C;  3R45 A;  3X1U D;  4G91 B;  1Q9C A;  1P3K D;  2NZD C;  1TZY C;  4J8U C;  1S32 A;  3UTB A;  1P3P A;  3UTA D;  1HTA A;  3VH6 T;  5B40 D;  3X1S D;  4R8P A;  1ZLA D;  1TZY A;  4J8U A;  4JJN C; 
#chains in the Genus database with same CATH topology
 3X1V D;  4WJ3 C;  3WKJ C;  5B1L B;  4NE3 A;  3AZM D;  1KX5 D;  4X23 D;  5AY8 D;  3MGQ C;  4JJN A;  3NQJ A;  5B2I C;  1BH9 B;  3AV2 C;  3X1S C;  1M1A B;  1P3I B;  3AZE B;  3EPL A;  3AZH C;  3AFA C;  4G92 C;  1P34 C;  2J8P A;  3WKJ A;  3V9R B;  1U35 D;  4XZQ B;  3MGQ A;  5B2I A;  4HGA C;  3REK B;  3X1S A;  3AZI C;  5B0Y D;  3UT9 B;  3AFA A;  3B6G B;  3FDD A;  3MGP C;  3B0D B;  3AV1 D;  2ZY5 A;  3WAA B;  4Z2M G;  1KX5 A;  4X23 A;  3TU4 B;  3AZI A;  1KX4 B;  5B33 C;  5F99 D;  5KDM A;  3MGP A;  3VH5 T;  3LJA D;  1P3L B;  4LD9 A;  2FJ7 D;  3AZN B;  3AZK B;  1U35 A;  4G91 C;  3H0R C;  1P3A B;  2BYM B;  5B33 A;  3AN2 D;  3REJ D;  4H9O B;  4KUD C;  3W99 D;  1HQ3 B;  3AZG B;  3B6F B;  3W97 B;  4Z5T B;  2ARO B;  3W98 D;  5B31 B;  1P3M D;  4KUD A;  4ZUX D;  4CSR A;  3KWQ C;  1F66 C;  2RVQ C;  3W96 B;  5F99 A;  1ID3 B;  4WU9 D;  3LJA A;  5GT0 B;  2FJ7 A;  5B1L C;  1BH8 B;  2F8N D;  2HIO C;  4EO5 B;  5DNM D;  4YM6 D;  3KWQ A;  1F66 A;  5B1M B;  4R8P B;  3B0C W;  3EG5 B;  1M1A C;  1P3I C;  3F6T A;  4J8X D;  3AZE C;  5AV6 D;  2F8N G;  1P3F B;  5B1L A;  2HIO A;  4XZQ C;  3MGS D;  3REK C;  3AZJ D;  3X1U B;  1M1A A;  1T3U A;  1P3I A;  4YM6 C;  3AZE A;  3UT9 C;  3B6G C;  4H9Q B;  5AV9 D;  3A6N D;  3B0D C;  1EQZ D;  5CP6 D;  3UTA B;  1W2E A;  3V9R A;  5CPJ D;  4KGC D;  4XZQ A;  3KXB D;  2F8N K;  2F8N A;  5B40 B;  3MGQ B;  4YM6 A;  1KX4 C;  3X1S B;  3UT9 A;  3B6G A;  2PYO D;  3NQU A;  3AFA B;  5E5A D;  1P3L C;  5CP6 C;  3VH6 W;  1P3A C;  3WTP D;  1KX4 A;  2Y2M A;  3AZM B;  1KX5 B;  4X23 B;  5CHL B;  5AY8 B;  3AZI B;  1HQ3 C;  1P3L A;  3REL D;  5KDM B;  3X1T D;  3AZG C;  4Z5T C;  2ARO C;  3REH D;  3B6F C;  5CP6 A;  3W97 C;  3KUY D;  1BFM A;  5CPJ A;  5B31 C;  1P3A A;  1U35 B;  5GSU D;  2Y2H A;  1R4V A;  1HQ3 A;  4QLC D;  3W96 C;  5B32 D;  2F2A C;  3W97 A;  3KSY A;  3AZG A;  1AOI D;  2ARO A;  1PZR A;  2Y2L A;  5B0Y B;  1ID3 C;  3AYW C;  5GT0 C;  5B31 A;  3AV1 B;  5B32 G;  5B24 D;  1WWI A;  4EO5 C;  4R8P C;  5B1M C;  3O62 D;  4KUD B;  3W96 A;  5DNN D;  4CSR B;  1KU5 A;  5AV5 D;  1ID3 A;  3AYW A;  1B6W A;  5F99 B;  1P3B D;  5GT0 A;  1P3F C;  3LZ1 D;  3LJA B;  3KUY A;  1BH8 A;  2FJ7 B;  2G5I C;  5B1M A;  5AV8 D;  3X1U C;  3KWQ B;  1F66 B;  1P3K C;  3AN2 B;  3REJ B;  2YFW B;  3W99 B;  1P3F A;  4H9N B;  3UTA C;  3VH5 W;  3MGR D;  4WU8 D;  4WV4 B;  5JRG D;  3REI D;  3W98 B;  4CAY A;  3X1U A;  2HIO B;  5B24 A;  5B40 C;  1P3K A;  1P3M B;  1ZLA C;  4ZUX B;  4H9Q A;  1P3O D;  3UTA A;  5CPI D;  5AV5 A;  5AVB D;  3X1V C;  5B40 A;  4H9S A;  4WZS B;  3AZM C;  1ZLA A;  1KX5 C;  4X23 C;  2F8N B;  5DNM B;  5G49 B;  5AY8 C;  4YM6 B;  4J8V D;  5CPK D;  1P3G D;  4J8X B;  3NQU B;  5AV6 B;  3X1V A;  3AZM A;  1U35 C;  5BT1 D;  3AL0 C;  5AY8 A;  3MGS B;  5AVC D;  2Y2N A;  2ZY4 A;  5B0Y C;  2NQB D;  2CV5 D;  5AV9 B;  3A6N B;  5CP6 B;  3AV1 C;  5GXQ D;  5CPJ B;  3MVD D;  4KGC B;  3KXB B;  5B0Y A;  2BYK B;  5F99 C;  3AV1 A;  3B0B A;  5E5A B;  4M6B A;  3LJA C;  3EPK A;  2VQR A;  2FJ7 C;  3WA9 D;  3KFU G;  3AN2 C;  3REJ C;  4KHA B;  2UWX A;  3W99 C;  3AZF D;  3AYW B;  3REH B;  3W98 C;  2Y2G A;  3KUY B;  1KX3 D;  3AN2 A;  1P3M C;  5FUG B;  5GSU B;  3REJ A;  4ZUX C;  3EPJ A;  2YFW A;  3W99 A;  4H9N A;  4QLC B;  5B32 B;  1AOI B;  4YS3 D;  4UUZ B;  3W98 A;  4WU9 C;  3C1C D;  4CAY B;  1P3M A;  5B24 B;  5BO0 B;  4ZUX A;  5DNM C;  1P3K B;  1M19 D;  3O62 B;  5DNN B;  4Z66 D;  1M18 D;  4LD9 D;  4J8X C;  3AZF A;  5AV5 B;  5AV6 C;  4WU9 A;  4H9P A;  4J8W D;  5B0Z D;  5DNM A;  2JE5 A;  5G49 A;  5JA4 A;  3MGS C;  1ZLA B;  3AZJ C;  3VH6 A;  5AV8 B;  4DQY B;  3IP4 C;  4J8X A;  5BNV B;  2Y2I A;  5AV6 A;  5AV9 C;  3A6N C;  3LZ0 D;  1EQZ C;  4WU8 B;  3MGR B;  3X1V B;  5CPJ C;  4KGC C;  3TU4 D;  5JRG B;  3REI B;  3MGS A;  3MNN D;  3KXB C;  3AZJ A;  4ZBJ B;  2JSS A;  2YFV B;  4XUJ D;  5GT3 D;  2CWE A;  1B67 A;  5BS7 C;  5AV9 A;  3A6N A;  3LEL D;  3AZK D;  3AZN D;  1P3O B;  5CPI B;  2JCH A;  4Z2M H;  1Z2C B;  5E5A C;  1EQZ A;  4KGC A;  2HUE B;  3KXB A;  3WTP C;  3C1B D;  2BYK A;  2ZM5 A;  5BS7 A;  2PYO A;  2L5A A;  1JFI B;  3WTP E;  1P3G B;  5E5A A;  3REL C;  3X1T C;  3LZ0 A;  3REH C;  3KUY C;  4H9R A;  3WTP A;  1TAF B;  5GSU C;  1S32 D;  3UTB D;  1P3P D;  4KHA A;  4QLC C;  3H0M C;  5B32 C;  3REL A;  3X1T A;  5B2J D;  1AOI C;  3REH A;  2NQB B;  2NZD D;  2LY8 A;  3VH5 A;  1TZY D;  5GXQ B;  3MVD B;  5FUG A;  5GSU A;  4J8U D;  5B24 C;  2Y2J A;  3O62 C;  4QLC A;  3C1B A;  5B32 A;  5DNN C;  1N1J B;  1AOI A;  4UUZ A;  5AV5 C;  1P3B C;  5B2J C;  3LZ1 C;  4JJN D;  5BO0 A;  4H9S C;  4AWL B;  3O62 A;  5BNX B;  3WA9 B;  5AV8 C;  5DNN A;  4E44 A;  2F8N H;  3WKJ D;  2FFF B;  1P3B A;  5B2J A;  3LZ1 A;  3AZF B;  3MGR C;  4WU8 C;  4WU9 B;  4UPK A;  3MGQ D;  5B2I D;  4H9P B;  5JRG C;  3REI C;  3AV2 D;  2NZD A;  5AV8 A;  4ZBJ C;  2Y2Q A;  5JA4 B;  3AZH D;  3AFA D;  1KX3 B;  5BNV A;  1P34 D;  1P3O C;  2RIQ A;  5CPI C;  2W8S A;  4WU8 A;  3MGR A;  2HUE C;  2IO5 B;  5AVB C;  5JRG A;  4YS3 B;  3REI A;  3AZL D;  3AZI D;  3C1C B;  2YFV A;  3AZJ B;  3MGP D;  4NE5 A;  1P3O A;  4J8V C;  5CPK C;  1M19 B;  5CPI A;  1P3G C;  4Z66 B;  5AVB A;  2DQN C;  1M18 B;  1EQZ B;  4LD9 B;  1H3O A;  5B33 D;  4J8W B;  3AZL C;  3AV2 A;  5BT1 C;  5B0Z B;  4J8V A;  3AZH A;  5CPK A;  1JFI A;  1P34 A;  5AVC C;  1P3G A;  2PYO B;  4WNN B;  2NQB C;  1F1E A;  2CV5 C;  3LZ0 B;  4KUD D;  5GXQ C;  3AZL A;  1TAF A;  3MVD C;  4H9R B;  3WTP B;  3MNN B;  5AVC A;  2XD1 A;  5GT3 B;  5C3I B;  3A1I A;  4XUJ B;  2NQB A;  2CV5 A;  2BG1 A;  4DRA A;  3REL B;  4NE6 A;  3X1T B;  3LEL B;  5GXQ A;  3MVD A;  3KWQ D;  2RVQ D;  1F66 D;  4AWL C;  4NFT A;  3WA9 C;  1N1J A;  4DRB A;  3C1B B;  5B1L D;  2ZY2 A;  3AZF C;  2HIO D;  3R45 B;  1M1A D;  3WA9 A;  5BNX A;  1P3I D;  3AZE D;  1WWS A;  1A7W A;  3H0L C;  1KX3 C;  1S32 B;  3UTB B;  1P3P B;  4XZQ D;  1P3B B;  2IO5 C;  5B2J B;  3REK D;  4YS3 C;  3LZ1 B;  2NZD B;  2PYO C;  3C1C C;  3UT9 D;  1TZY B;  1KX3 A;  3B6G D;  4J8U B;  3WAA D;  1M19 C;  4Z66 C;  1M18 C;  4LD9 C;  3EPH A;  2XD5 A;  4YS3 A;  2Y2P A;  1KX4 D;  3C1C A;  1BH9 A;  4J8W C;  4JJN B;  3NQJ B;  5B0Z C;  1P3L D;  1M19 A;  2ZY3 A;  4Z66 A;  1M18 A;  3WAA C;  1P3A D;  5AVB B;  3WKJ B;  3LZ0 C;  3REK A;  1H3O B;  4J8W A;  5B2I B;  5B0Z A;  3TU4 C;  1HQ3 D;  3AV2 B;  3MNN C;  3AZG D;  3B6F D;  2G5H C;  4Z5T D;  2ARO D;  3W97 D;  4J8V B;  3AZH B;  5CPK B;  2Y2O A;  4WNN A;  3WAA A;  4XUJ C;  5C3I C;  3A1K A;  5GT3 C;  2Y2K A;  5B31 D;  4G92 B;  1P34 B;  3AZN C;  3LEL C;  3AZK C;  3TU4 A;  4HGA B;  3AZL B;  3B0C T;  3MNN A;  3W96 D;  5B31 G;  1ID3 D;  4E45 A;  4XUJ A;  5AVC B;  5GT3 A;  5GT0 D;  3MGP B;  3C1B C;  3AYW D;  3AZN A;  3LEL A;  3AZK A;  1ULY A;  2CV5 B;  5B1M D;  2BYM A;  4R8P D;  4H9O A;  2DF4 C;  5B33 B;  3B6F A;  1S32 C;  3UTB C;  4Z5T A;  1P3F D;  1P3P C;  3R45 A;  3X1U D;  4G91 B;  1Q9C A;  1P3K D;  2NZD C;  1TZY C;  4J8U C;  1S32 A;  3UTB A;  1P3P A;  3P5J B;  3UTA D;  1HTA A;  3VH6 T;  5B40 D;  3X1S D;  4R8P A;  1ZLA D;  1TZY A;  4J8U A;  4JJN C; 
#chains in the Genus database with same CATH homology
 3X1V D;  4WJ3 C;  3WKJ C;  5B1L B;  4NE3 A;  3AZM D;  1KX5 D;  4X23 D;  5AY8 D;  3MGQ C;  4JJN A;  3NQJ A;  5B2I C;  1BH9 B;  3AV2 C;  3X1S C;  1M1A B;  1P3I B;  3AZE B;  3EPL A;  3AZH C;  3AFA C;  4G92 C;  1P34 C;  2J8P A;  3WKJ A;  3V9R B;  1U35 D;  4XZQ B;  3MGQ A;  5B2I A;  4HGA C;  3REK B;  3X1S A;  3AZI C;  5B0Y D;  3UT9 B;  3AFA A;  3B6G B;  3FDD A;  3MGP C;  3B0D B;  3AV1 D;  2ZY5 A;  3WAA B;  4Z2M G;  1KX5 A;  4X23 A;  3TU4 B;  3AZI A;  1KX4 B;  5B33 C;  5F99 D;  5KDM A;  3MGP A;  3VH5 T;  3LJA D;  1P3L B;  4LD9 A;  2FJ7 D;  3AZN B;  3AZK B;  1U35 A;  4G91 C;  3H0R C;  1P3A B;  2BYM B;  5B33 A;  3AN2 D;  3REJ D;  4H9O B;  4KUD C;  3W99 D;  1HQ3 B;  3AZG B;  3B6F B;  3W97 B;  4Z5T B;  2ARO B;  3W98 D;  5B31 B;  1P3M D;  4KUD A;  4ZUX D;  4CSR A;  3KWQ C;  1F66 C;  2RVQ C;  3W96 B;  5F99 A;  1ID3 B;  4WU9 D;  3LJA A;  5GT0 B;  2FJ7 A;  5B1L C;  1BH8 B;  2F8N D;  2HIO C;  4EO5 B;  5DNM D;  4YM6 D;  3KWQ A;  1F66 A;  5B1M B;  4R8P B;  3B0C W;  3EG5 B;  1M1A C;  1P3I C;  3F6T A;  4J8X D;  3AZE C;  5AV6 D;  2F8N G;  1P3F B;  5B1L A;  2HIO A;  4XZQ C;  3MGS D;  3REK C;  3AZJ D;  3X1U B;  1M1A A;  1T3U A;  1P3I A;  4YM6 C;  3AZE A;  3UT9 C;  3B6G C;  4H9Q B;  5AV9 D;  3A6N D;  3B0D C;  1EQZ D;  5CP6 D;  3UTA B;  1W2E A;  3V9R A;  5CPJ D;  4KGC D;  4XZQ A;  3KXB D;  2F8N K;  2F8N A;  5B40 B;  3MGQ B;  4YM6 A;  1KX4 C;  3X1S B;  3UT9 A;  3B6G A;  2PYO D;  3NQU A;  3AFA B;  5E5A D;  1P3L C;  5CP6 C;  3VH6 W;  1P3A C;  3WTP D;  1KX4 A;  2Y2M A;  3AZM B;  1KX5 B;  4X23 B;  5CHL B;  5AY8 B;  3AZI B;  1HQ3 C;  1P3L A;  3REL D;  5KDM B;  3X1T D;  3AZG C;  4Z5T C;  2ARO C;  3REH D;  3B6F C;  5CP6 A;  3W97 C;  3KUY D;  1BFM A;  5CPJ A;  5B31 C;  1P3A A;  1U35 B;  5GSU D;  2Y2H A;  1R4V A;  1HQ3 A;  4QLC D;  3W96 C;  5B32 D;  2F2A C;  3W97 A;  3KSY A;  3AZG A;  1AOI D;  2ARO A;  1PZR A;  2Y2L A;  5B0Y B;  1ID3 C;  3AYW C;  5GT0 C;  5B31 A;  3AV1 B;  5B32 G;  5B24 D;  1WWI A;  4EO5 C;  4R8P C;  5B1M C;  3O62 D;  4KUD B;  3W96 A;  5DNN D;  4CSR B;  1KU5 A;  5AV5 D;  1ID3 A;  3AYW A;  1B6W A;  5F99 B;  1P3B D;  5GT0 A;  1P3F C;  3LZ1 D;  3LJA B;  3KUY A;  1BH8 A;  2FJ7 B;  2G5I C;  5B1M A;  5AV8 D;  3X1U C;  3KWQ B;  1F66 B;  1P3K C;  3AN2 B;  3REJ B;  2YFW B;  3W99 B;  1P3F A;  4H9N B;  3UTA C;  3VH5 W;  3MGR D;  4WU8 D;  4WV4 B;  5JRG D;  3REI D;  3W98 B;  4CAY A;  3X1U A;  2HIO B;  5B24 A;  5B40 C;  1P3K A;  1P3M B;  1ZLA C;  4ZUX B;  4H9Q A;  1P3O D;  3UTA A;  5CPI D;  5AV5 A;  5AVB D;  3X1V C;  5B40 A;  4H9S A;  4WZS B;  3AZM C;  1ZLA A;  1KX5 C;  4X23 C;  2F8N B;  5DNM B;  5G49 B;  5AY8 C;  4YM6 B;  4J8V D;  5CPK D;  1P3G D;  4J8X B;  3NQU B;  5AV6 B;  3X1V A;  3AZM A;  1U35 C;  5BT1 D;  3AL0 C;  5AY8 A;  3MGS B;  5AVC D;  2Y2N A;  2ZY4 A;  5B0Y C;  2NQB D;  2CV5 D;  5AV9 B;  3A6N B;  5CP6 B;  3AV1 C;  5GXQ D;  5CPJ B;  3MVD D;  4KGC B;  3KXB B;  5B0Y A;  2BYK B;  5F99 C;  3AV1 A;  3B0B A;  5E5A B;  4M6B A;  3LJA C;  3EPK A;  2VQR A;  2FJ7 C;  3WA9 D;  3KFU G;  3AN2 C;  3REJ C;  4KHA B;  2UWX A;  3W99 C;  3AZF D;  3AYW B;  3REH B;  3W98 C;  2Y2G A;  3KUY B;  1KX3 D;  3AN2 A;  1P3M C;  5FUG B;  5GSU B;  3REJ A;  4ZUX C;  3EPJ A;  2YFW A;  3W99 A;  4H9N A;  4QLC B;  5B32 B;  1AOI B;  4YS3 D;  4UUZ B;  3W98 A;  4WU9 C;  3C1C D;  4CAY B;  1P3M A;  5B24 B;  5BO0 B;  4ZUX A;  5DNM C;  1P3K B;  1M19 D;  3O62 B;  5DNN B;  4Z66 D;  1M18 D;  4LD9 D;  4J8X C;  3AZF A;  5AV5 B;  5AV6 C;  4WU9 A;  4H9P A;  4J8W D;  5B0Z D;  5DNM A;  2JE5 A;  5G49 A;  5JA4 A;  3MGS C;  1ZLA B;  3AZJ C;  3VH6 A;  5AV8 B;  4DQY B;  3IP4 C;  4J8X A;  5BNV B;  2Y2I A;  5AV6 A;  5AV9 C;  3A6N C;  3LZ0 D;  1EQZ C;  4WU8 B;  3MGR B;  3X1V B;  5CPJ C;  4KGC C;  3TU4 D;  5JRG B;  3REI B;  3MGS A;  3MNN D;  3KXB C;  3AZJ A;  4ZBJ B;  2JSS A;  2YFV B;  4XUJ D;  5GT3 D;  2CWE A;  1B67 A;  5BS7 C;  5AV9 A;  3A6N A;  3LEL D;  3AZK D;  3AZN D;  1P3O B;  5CPI B;  2JCH A;  4Z2M H;  1Z2C B;  5E5A C;  1EQZ A;  4KGC A;  2HUE B;  3KXB A;  3WTP C;  3C1B D;  2BYK A;  2ZM5 A;  5BS7 A;  2PYO A;  2L5A A;  1JFI B;  3WTP E;  1P3G B;  5E5A A;  3REL C;  3X1T C;  3LZ0 A;  3REH C;  3KUY C;  4H9R A;  3WTP A;  1TAF B;  5GSU C;  1S32 D;  3UTB D;  1P3P D;  4KHA A;  4QLC C;  3H0M C;  5B32 C;  3REL A;  3X1T A;  5B2J D;  1AOI C;  3REH A;  2NQB B;  2NZD D;  2LY8 A;  3VH5 A;  1TZY D;  5GXQ B;  3MVD B;  5FUG A;  5GSU A;  4J8U D;  5B24 C;  2Y2J A;  3O62 C;  4QLC A;  3C1B A;  5B32 A;  5DNN C;  1N1J B;  1AOI A;  4UUZ A;  5AV5 C;  1P3B C;  5B2J C;  3LZ1 C;  4JJN D;  5BO0 A;  4H9S C;  4AWL B;  3O62 A;  5BNX B;  3WA9 B;  5AV8 C;  5DNN A;  4E44 A;  2F8N H;  3WKJ D;  2FFF B;  1P3B A;  5B2J A;  3LZ1 A;  3AZF B;  3MGR C;  4WU8 C;  4WU9 B;  4UPK A;  3MGQ D;  5B2I D;  4H9P B;  5JRG C;  3REI C;  3AV2 D;  2NZD A;  5AV8 A;  4ZBJ C;  2Y2Q A;  5JA4 B;  3AZH D;  3AFA D;  1KX3 B;  5BNV A;  1P34 D;  1P3O C;  2RIQ A;  5CPI C;  2W8S A;  4WU8 A;  3MGR A;  2HUE C;  2IO5 B;  5AVB C;  5JRG A;  4YS3 B;  3REI A;  3AZL D;  3AZI D;  3C1C B;  2YFV A;  3AZJ B;  3MGP D;  4NE5 A;  1P3O A;  4J8V C;  5CPK C;  1M19 B;  5CPI A;  1P3G C;  4Z66 B;  5AVB A;  2DQN C;  1M18 B;  1EQZ B;  4LD9 B;  1H3O A;  5B33 D;  4J8W B;  3AZL C;  3AV2 A;  5BT1 C;  5B0Z B;  4J8V A;  3AZH A;  5CPK A;  1JFI A;  1P34 A;  5AVC C;  1P3G A;  2PYO B;  4WNN B;  2NQB C;  1F1E A;  2CV5 C;  3LZ0 B;  4KUD D;  5GXQ C;  3AZL A;  1TAF A;  3MVD C;  4H9R B;  3WTP B;  3MNN B;  5AVC A;  2XD1 A;  5GT3 B;  5C3I B;  3A1I A;  4XUJ B;  2NQB A;  2CV5 A;  2BG1 A;  4DRA A;  3REL B;  4NE6 A;  3X1T B;  3LEL B;  5GXQ A;  3MVD A;  3KWQ D;  2RVQ D;  1F66 D;  4AWL C;  4NFT A;  3WA9 C;  1N1J A;  4DRB A;  3C1B B;  5B1L D;  2ZY2 A;  3AZF C;  2HIO D;  3R45 B;  1M1A D;  3WA9 A;  5BNX A;  1P3I D;  3AZE D;  1WWS A;  1A7W A;  3H0L C;  1KX3 C;  1S32 B;  3UTB B;  1P3P B;  4XZQ D;  1P3B B;  2IO5 C;  5B2J B;  3REK D;  4YS3 C;  3LZ1 B;  2NZD B;  2PYO C;  3C1C C;  3UT9 D;  1TZY B;  1KX3 A;  3B6G D;  4J8U B;  3WAA D;  1M19 C;  4Z66 C;  1M18 C;  4LD9 C;  3EPH A;  2XD5 A;  4YS3 A;  2Y2P A;  1KX4 D;  3C1C A;  1BH9 A;  4J8W C;  4JJN B;  3NQJ B;  5B0Z C;  1P3L D;  1M19 A;  2ZY3 A;  4Z66 A;  1M18 A;  3WAA C;  1P3A D;  5AVB B;  3WKJ B;  3LZ0 C;  3REK A;  1H3O B;  4J8W A;  5B2I B;  5B0Z A;  3TU4 C;  1HQ3 D;  3AV2 B;  3MNN C;  3AZG D;  3B6F D;  2G5H C;  4Z5T D;  2ARO D;  3W97 D;  4J8V B;  3AZH B;  5CPK B;  2Y2O A;  4WNN A;  3WAA A;  4XUJ C;  5C3I C;  3A1K A;  5GT3 C;  2Y2K A;  5B31 D;  4G92 B;  1P34 B;  3AZN C;  3LEL C;  3AZK C;  3TU4 A;  4HGA B;  3AZL B;  3B0C T;  3MNN A;  3W96 D;  5B31 G;  1ID3 D;  4E45 A;  4XUJ A;  5AVC B;  5GT3 A;  5GT0 D;  3MGP B;  3C1B C;  3AYW D;  3AZN A;  3LEL A;  3AZK A;  1ULY A;  2CV5 B;  5B1M D;  2BYM A;  4R8P D;  4H9O A;  2DF4 C;  5B33 B;  3B6F A;  1S32 C;  3UTB C;  4Z5T A;  1P3F D;  1P3P C;  3R45 A;  3X1U D;  4G91 B;  1Q9C A;  1P3K D;  2NZD C;  1TZY C;  4J8U C;  1S32 A;  3UTB A;  1P3P A;  3P5J B;  3UTA D;  1HTA A;  3VH6 T;  5B40 D;  3X1S D;  4R8P A;  1ZLA D;  1TZY A;  4J8U A;  4JJN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...