1P3PD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3pD00
4KGCB 3AN2B 4AWLC 2PYOA 1P3BA 4R8PC 3AZKA 4WU9C 5AVBA 1KX5A 4ZBJC 2CV5D 5GT0B 3AZLC 2FJ7D 1P34C 5B31D 5GSUB 5BT1D 3KUYA 3WAAD 2AROB 5B1MB 3AFAA 5AY8D 1BH8A 3REHC 3R45A 3RELA 3AZND 5DNNC 4H9OA 3AV2D 5B0ZD 3REKC 3X1SC 1F66B 1M18A 4J8UB 3AZJB 5DNMD 5CPKD 1P3FC 1P3LA 3LJAD 3VH5W 3UTAC 5GXQB 5B32G 3AV1A 4J8WB 3MGQB 2JSSA 2F8NA 1P3ID 1P3GD 3MGRB 3W97A 3X1VD 1M19C 5B2IA 5G49B 4LD9D 1P3AC 5B31G 4XUJC 2HIOA 3WA9A 3LZ0C 3REID 3X1UB 3TU4A 1EQZA 2NZDA 1N1JA 4H9SC 5AVCA 3LELC 3AZED 3AZGC 4YM6A 1P3KB 3NQUB 2NQBA 4WU8A 5BS7A 3AZMD 5JRGD 4G91C 4NFTA 4UUZB 1KX3C 5F99C 4H9PA 5JA4B 3C1CC 1S32C 4R8PA 4WU9A 5B40B 3A6ND 5B0YB 5B2JC 2IO5C 3MGSD 5CP6C 1P34A 3B0BA 4XZQD 3AZFD 3MGPD 3AYWD 5B33C 4WV4B 3AZHC 5B1MD 3W98C 5B32B 4X23D 3REHA 4J8VD 3UTBC 3W99B 4H9RA 5B1LD 1B67A 3X1SA 3REKA 5CPJC 2CV5B 5AV8C 1P3FA 2RVQD 4J8UD 3O62D 3AZKB 4WNNB 2FJ7B 5B31B 5AV9D 3UTAA 1AOIC 5AY8B 1ZLAC 3B6GD 1TAFB 3WKJD 3REJC 1ULYA 3AZNB 4KUDC 3MGRD 1M19A 3B6FD 3R45B 3RELB 1P3AA 4ZUXD 3KWQA 1WWSA 5B0ZB 1P3MC 4H9OB 4XUJA 3LZ0A 1P3OC 5DNMB 3MVDC 5CPKB 3LJAB 4H9SA 3LELA 2YFWA 1M18B 2BYMB 3AZGA 5E5AD 4HGAB 1B6WA 1P3GB 4G92C 3WTPC 1A7WA 3X1VB 5CPID 3C1BD 5BNVA 1KX3A 4LD9B 3VH6T 5F99A 3LZ1C 3C1CA 4J8XC 1S32A 5AV6C 3REIB 5B2JA 5AV5C 5CP6A 1U35D 3B0DB 4H9NA 4YM6B 5B33A 3AZHA 3W98A 3AZID 3AZMB 1P3IC 5JRGB 2NQBB 5C3IC 5B24C 1KX4C 3UTBA 1TZYC 4Z2MG 1P3PD 3W96D 3V9RA 4JJNA 3A6NB 4Z5TC 5CPJA 5AV8A 3MGSB 4WU9B 2PYOD 4Z66C 1P3BD 3AZKD 5AVBD 4XZQB 3KXBC 1KX5D 1P34B 3AZFB 4DRAA 3MGPB 3UT9C 4YS3C 2HUEC 3MNNA 3AYWB 3VH5T 1BH9B 4X23B 3REJA 4KUDA 3KUYD 4J8VB 3AFAD 1P3MA 5B1LB 3RELD 3X1TC 1P3OA 4KGCC 3MVDA 4H9RB 3AN2C 3O62B 5AV9B 5BNXA 5GT0C 1M18D 1H3OA 1P3LD 5GSUC 3AV1D 3B6GB 3WTPA 2AROC 3WKJB 1HQ3A 5B1MC 4CSRA 3B6FB 2F8ND 3LZ1A 4J8XA 4ZUXB 4QLCC 3B0CT 1M19B 5AV6A 3W97D 5AV5A 5B2ID 3KWQB 1F66C 3AZJC 2HIOD 4H9QA 4CAYA 3WA9D 2YFVA 5E5AB 3TU4D 3LELB 1EQZD 2NZDD 5GXQC 5AVCD 4J8WC 3MGQC 5GT3C 4YM6D 5B24A 3B0CW 1KX4A 5CPIB 1TZYA 3C1BB 4WU8D 2NQBD 5BNVB 4Z5TA 3VH6A 2BYKB 5FUGB 1S32B 4WZSB 3AZLA 4Z66A 3X1UC 4R8PD 1U35B 4WU9D 2CWEA 3KXBA 1JFIA 3UT9A 2F8NG 4YS3A 1P34D 1P3KC 3AZIB 4KHAA 5KDMB 5DNNA 1P3PB 3REHD 3W96B 3X1TA 4KGCA 3AN2A 4JJNB 5B40C 5B0YC 2PYOB 1ID3C 5CPJB 1P3BB 5GT0A 3X1SD 3REKD 5AVBB 1KX5B 1M1AC 1P3FD 5GSUA 5BO0A 3UTAD 2AROA 1BFMA 3MNNB 3KUYB 3VH5A 3AFAB 5B32C 1BH8B 4QLCA 3W99C 1M19D 1P3MB 1P3AD 1F66A 3KSYA 3KWQD 4EO5B 4XUJD 3AZJA 3MVDB 2CV5C 3LZ0D 2FJ7C 3AZKC 1P3LB 5B31C 5BNXB 4Z2MH 5GXQA 3LELD 5BT1C 4J8WA 1H3OB 3MGQA 3AV1B 5GT3A 3WAAC 3AZGD 5AY8C 2F8NB 3AZNC 1HQ3B 5G49A 3W97B 3RELC 5B2IB 3AV2C 5B0ZC 1KX3D 5F99D 3C1CD 1S32D 5DNMC 2HIOB 3X1UA 5CPKC 3WA9B 3LJAC 5B2JD 3TU4B 1EQZB 2NZDB 1N1JB 1M18C 5CP6D 4H9QB 5AVCB 1P3KA 3NQUA 2F8NK 4HGAC 1P3GC 4WU8B 5B33D 5C3IB 3AZHD 3W98D 3X1VC 4UUZA 4LD9C 3UTBD 5JA4A 1KU5A 1R4VA 4H9PB 5B40A 4AWLB 5B0YA 4Z5TB 3REIC 1ID3A 4R8PB 4JJND 1M1AA 4ZBJB 5CPJD 5AV8D 3AZEC 3AZLB 2LY8A 3KXBB 3B0DC 1AOIA 2HUEB 4DRBA 1ZLAA 3MNND 3AZMC 5B32A 5JRGC 3REHB 3REJD 4KUDD 5DNNB 3W99A 1P3MD 1WWIA 3A6NC 1F1EA 2CV5A 3X1SB 3REKB 3MGSC 1P3OD 2FJ7A 1P3FB 4WNNA 3MVDD 5B31A 5CHLB 4XZQC 3UTAB 3AZFC 3MGPC 3WAAA 5BO0B 3AYWC 5AY8A 4X23C 1TAFA 3AZNA 4J8VC 3WTPD 1HQ3D 5B1LC 3AV2A 4QLCB 5B0ZA 2F8NH 3LZ1D 1P3AB 4J8XD 4XUJB 5DNMA 5CPKA 5AV6D 3LZ0B 3LJAA 2RVQC 4J8UC 3O62C 5AV5D 3NQJA 5AV9C 2BYMA 2YFWB 3AZGB 1P3IA 1P3GA 5GT3B 3B6GC 3WKJC 3MGRC 3X1VA 3B6FC 4G91B 5B24D 1KX4D 4LD9A 1TZYD 4ZUXC 1KX3B 5F99B 3C1CB 3REIA 3KWQC 4Z5TD 5B2JB 2IO5B 3AZEA 5CP6B 3AZLD 4Z66D 5E5AC 3KXBD 4H9NB 3UT9D 4YS3D 3AZMA 4NE6A 5B33B 5JRGA 3AZHB 3W98B 5CPIC 3C1BC 3UTBB 4NE5A 5DNND 3A6NA 3V9RB 3X1TD 3MGSA 4KGCD 2L5AA 5AV8B 3AN2D 1ID3B 4E45A 1U35C 4XZQA 1M1AB 5GT0D 3AZFA 3MGPA 3AYWA 1BH9A 5GSUD 5B1MA 3AZIC 4X23A 1AOIB 1ZLAB 4J8VA 2AROD 3REJB 4KUDB 1P3PC 5B1LA 1Q9CA 3W96C 4QLCD 1P3OB 4J8UA 3O62A 4JJNC 2PYOC 1HTAA 5AV9A 1P3BC 1F66D 5AVBC 1KX5C 3AZJD 5GXQD 3B6GA 3WAAB 3WKJA 4J8WD 4NE3A 3MNNC 3MGQD 5GT3D 3MGRA 3KUYC 4G92B 3WTPB 3B6FA 3AFAC 4CSRB 4ZUXA 3LZ1B 4J8XB 5AV6B 3AV2B 4E44A 5AV5B 4EO5C 5E5AA 3X1UD 4CAYB 1P3LC 3NQJB 2YFVB 3AV1C 4M6BA 1P3KD 5CPIA 1P3IB 3C1BA 5B24B 1KX4B 1HQ3C 1TZYB 3W97C 2BYKA 5FUGA 5B2IC 2HIOC 1U35A 3WA9C 5B40D 5B0YD 1ID3D 4Z66B 3TU4C 1EQZC 2NZDC 3AZEB 1M1AD 5AVCC 1JFIB 3UT9B 4YS3B 3AZIA 4YM6C 1AOID 5KDMA 4KHAB 2NQBC 3VH6W 4WU8C 1ZLAD 3WTPE 5BS7C 1P3PA 5B32D 3W96A 3X1TB 3W99D
chains in the Genus database with same CATH superfamily
4KGCB 3AN2B 4AWLC 2PYOA 2F2AC 4R8PC 3AZKA 1P3BA 4WU9C 5AVBA 1KX5A 4ZBJC 2CV5D 5GT0B 2Y2GA 3AZLC 2FJ7D 1P34C 5B31D 5GSUB 5BT1D 2Y2QA 3KUYA 3WAAD 2AROB 5B1MB 3AFAA 5AY8D 1BH8A 3REHC 3R45A 3RELA 3AZND 5DNNC 4H9OA 3AV2D 5B0ZD 3REKC 3X1SC 1F66B 1M18A 4J8UB 3AZJB 5DNMD 5CPKD 1P3FC 1P3LA 3LJAD 3VH5W 3UTAC 5GXQB 5B32G 3AV1A 4J8WB 3MGQB 2JSSA 2F8NA 3H0MC 1P3ID 1P3GD 3MGRB 3W97A 3X1VD 1M19C 5B2IA 5G49B 4LD9D 3P5JB 3KFUG 1P3AC 5B31G 4XUJC 2HIOA 3WA9A 3LZ0C 3REID 3X1UB 3TU4A 1EQZA 2NZDA 1N1JA 4H9SC 5AVCA 3LELC 3AZED 3AZGC 4YM6A 1P3KB 3NQUB 2NQBA 4WU8A 5BS7A 3AZMD 5JRGD 4G91C 4NFTA 2G5IC 4UUZB 1KX3C 5F99C 4H9PA 5JA4B 3C1CC 1S32C 4R8PA 4WU9A 5B40B 3A6ND 5B0YB 2JE5A 5B2JC 2IO5C 3MGSD 5CP6C 1P34A 3B0BA 4XZQD 3AZFD 3MGPD 3AYWD 5B33C 4WV4B 3AZHC 5B1MD 3W98C 5B32B 4X23D 3REHA 4J8VD 3UTBC 3W99B 4H9RA 5B1LD 1B67A 3X1SA 3REKA 5CPJC 2CV5B 5AV8C 1P3FA 2RVQD 4J8UD 3O62D 3AZKB 4WNNB 2FJ7B 5B31B 5AV9D 3UTAA 1AOIC 5AY8B 1ZLAC 3B6GD 1TAFB 3WKJD 3REJC 1ULYA 3AZNB 4KUDC 3MGRD 1M19A 3B6FD 3R45B 3RELB 1P3AA 4ZUXD 3KWQA 1WWSA 5B0ZB 1P3MC 4H9OB 4XUJA 3LZ0A 1P3OC 5DNMB 3MVDC 5CPKB 3LJAB 4H9SA 3LELA 2YFWA 1M18B 2BYMB 3AZGA 5E5AD 4HGAB 1B6WA 1P3GB 4G92C 3WTPC 1A7WA 2XD1A 3X1VB 5CPID 3C1BD 5BNVA 1KX3A 4LD9B 3VH6T 5F99A 3LZ1C 3C1CA 4J8XC 1S32A 5AV6C 3REIB 5B2JA 5AV5C 5CP6A 1U35D 3B0DB 4H9NA 4YM6B 5B33A 3AZHA 3W98A 3AZID 1W2EA 3AZMB 1P3IC 5JRGB 2NQBB 5C3IC 5B24C 1KX4C 3UTBA 1TZYC 4Z2MG 1P3PD 2Y2OA 3W96D 3V9RA 4JJNA 3A6NB 3IP4C 4Z5TC 5CPJA 5AV8A 3MGSB 2G5HC 4WU9B 2PYOD 3AL0C 4Z66C 1P3BD 3AZKD 5AVBD 4XZQB 3KXBC 1KX5D 1P34B 3H0RC 3AZFB 4DRAA 2ZY4A 3MGPB 3UT9C 4YS3C 2HUEC 3MNNA 3AYWB 3VH5T 1BH9B 4X23B 3REJA 4KUDA 3KUYD 4J8VB 3AFAD 1P3MA 5B1LB 3RELD 3X1TC 1P3OA 4KGCC 3MVDA 4H9RB 3F6TA 3AN2C 3O62B 2Y2LA 2DQNC 5AV9B 5BNXA 5GT0C 1M18D 1H3OA 1P3LD 5GSUC 2Y2NA 3AV1D 3B6GB 2AROC 3WTPA 3WKJB 1HQ3A 5B1MC 4CSRA 3B6FB 2F8ND 3LZ1A 4WJ3C 4J8XA 4ZUXB 4QLCC 3B0CT 1M19B 5AV6A 3W97D 5AV5A 5B2ID 3KWQB 1F66C 3AZJC 2HIOD 4H9QA 4CAYA 3WA9D 2YFVA 3H0LC 5E5AB 3LELB 3TU4D 1EQZD 2NZDD 5GXQC 2XD5A 5AVCD 4J8WC 3MGQC 3FDDA 5GT3C 4YM6D 2ZY3A 5B24A 3B0CW 1KX4A 5CPIB 1TZYA 3C1BB 4WU8D 2NQBD 5BNVB 4Z5TA 3VH6A 2BYKB 5FUGB 1S32B 1PZRA 4WZSB 3AZLA 4Z66A 3X1UC 4R8PD 2Y2KA 4WU9D 2CWEA 3KXBA 1U35B 1JFIA 3UT9A 2F8NG 4YS3A 1P34D 1P3KC 3AZIB 4KHAA 5KDMB 5DNNA 1P3PB 3EPKA 3REHD 3EG5B 3W96B 2UWXA 3X1TA 4KGCA 3AN2A 4JJNB 5B40C 5B0YC 2PYOB 1ID3C 5CPJB 1P3BB 5GT0A 3X1SD 3REKD 5AVBB 1KX5B 1M1AC 1P3FD 5GSUA 5BO0A 3UTAD 2Y2PA 2AROA 1BFMA 3MNNB 3KUYB 3VH5A 3AFAB 5B32C 2Y2JA 1BH8B 4QLCA 3W99C 1M19D 1P3MB 1P3AD 1F66A 3KSYA 3KWQD 4EO5B 4XUJD 3AZJA 3MVDB 2CV5C 3LZ0D 3EPHA 1T3UA 3AZKC 2FJ7C 1P3LB 5B31C 5BNXB 4Z2MH 5GXQA 3LELD 5BT1C 4J8WA 1H3OB 3MGQA 3AV1B 5GT3A 3WAAC 3AZGD 5AY8C 2F8NB 3AZNC 1HQ3B 2RIQA 5G49A 3W97B 3RELC 5B2IB 4DQYB 3AV2C 5B0ZC 1KX3D 5F99D 3C1CD 2Y2IA 4UPKA 1S32D 5DNMC 2HIOB 3X1UA 5CPKC 3WA9B 3LJAC 5B2JD 3TU4B 1EQZB 2NZDB 1N1JB 1M18C 5CP6D 4H9QB 5AVCB 2VQRA 1P3KA 3NQUA 2F8NK 4HGAC 1P3GC 2W8SA 4WU8B 5B33D 5C3IB 3AZHD 3W98D 3X1VC 4UUZA 4LD9C 3UTBD 5JA4A 1KU5A 1R4VA 4H9PB 5B40A 4AWLB 5B0YA 4Z5TB 3EPJA 3REIC 4R8PB 1ID3A 4JJND 1M1AA 4ZBJB 5CPJD 5AV8D 2BG1A 3AZEC 3AZLB 2LY8A 3KXBB 3B0DC 1AOIA 2HUEB 4DRBA 3EPLA 1ZLAA 3MNND 3AZMC 5B32A 5JRGC 2FFFB 3REHB 3REJD 4KUDD 5DNNB 3W99A 1P3MD 1WWIA 3A6NC 1F1EA 2CV5A 3X1SB 3REKB 3MGSC 1P3OD 2FJ7A 1P3FB 4WNNA 3MVDD 5B31A 5CHLB 4XZQC 3UTAB 3AZFC 3MGPC 3WAAA 5BO0B 3AYWC 5AY8A 4X23C 1TAFA 3AZNA 4J8VC 3WTPD 1HQ3D 3A1KA 5B1LC 3AV2A 4QLCB 5B0ZA 2F8NH 3LZ1D 1P3AB 4J8XD 4XUJB 5DNMA 5CPKA 5AV6D 3LZ0B 3LJAA 2RVQC 4J8UC 3O62C 5AV5D 3NQJA 5AV9C 2BYMA 2YFWB 3AZGB 1P3IA 2Y2MA 1P3GA 5GT3B 3B6GC 3WKJC 3MGRC 3X1VA 3B6FC 4G91B 5B24D 1KX4D 4LD9A 1TZYD 4ZUXC 1KX3B 5F99B 3C1CB 3REIA 2ZM5A 3KWQC 4Z5TD 5B2JB 2IO5B 3AZEA 5CP6B 3AZLD 4Z66D 5E5AC 2ZY5A 3KXBD 4H9NB 3UT9D 4YS3D 3AZMA 4NE6A 5B33B 5JRGA 3AZHB 3W98B 5CPIC 3C1BC 3UTBB 4NE5A 5DNND 2J8PA 3A6NA 3V9RB 3X1TD 3MGSA 4KGCD 2L5AA 5AV8B 3AN2D 1ID3B 4E45A 1U35C 4XZQA 1M1AB 5GT0D 3AZFA 3MGPA 3AYWA 1BH9A 5GSUD 5B1MA 3AZIC 4X23A 1AOIB 1ZLAB 4J8VA 2AROD 3REJB 4KUDB 1P3PC 2JCHA 5B1LA 1Q9CA 3W96C 4QLCD 1P3OB 4J8UA 3O62A 4JJNC 2PYOC 1HTAA 5AV9A 1P3BC 1F66D 5AVBC 1KX5C 3AZJD 2Y2HA 5GXQD 3B6GA 3WAAB 3WKJA 4J8WD 4NE3A 3MNNC 3MGQD 5GT3D 3MGRA 3KUYC 4G92B 3WTPB 3B6FA 3AFAC 4CSRB 4ZUXA 2ZY2A 3LZ1B 4J8XB 5AV6B 3AV2B 4E44A 5AV5B 4EO5C 5E5AA 3X1UD 4CAYB 1P3LC 3NQJB 2YFVB 2DF4C 3AV1C 4M6BA 1Z2CB 1P3KD 5CPIA 1P3IB 3C1BA 5B24B 1KX4B 1HQ3C 1TZYB 3W97C 2BYKA 5FUGA 5B2IC 2HIOC 1U35A 3WA9C 5B40D 5B0YD 1ID3D 4Z66B 3TU4C 1EQZC 2NZDC 3AZEB 1M1AD 5AVCC 1JFIB 3UT9B 4YS3B 3AZIA 4YM6C 1AOID 5KDMA 4KHAB 2NQBC 3VH6W 4WU8C 1ZLAD 3WTPE 5BS7C 1P3PA 3A1IA 5B32D 3W96A 3X1TB 3W99D
chains in the Genus database with same CATH topology
4KGCB 3AN2B 4AWLC 2PYOA 2F2AC 4R8PC 3AZKA 1P3BA 4WU9C 5AVBA 1KX5A 4ZBJC 2CV5D 5GT0B 2Y2GA 3AZLC 2FJ7D 1P34C 5B31D 5GSUB 5BT1D 2Y2QA 3KUYA 3WAAD 2AROB 5B1MB 3AFAA 5AY8D 1BH8A 3REHC 3R45A 3RELA 3AZND 5DNNC 4H9OA 3AV2D 5B0ZD 3REKC 3X1SC 1F66B 1M18A 4J8UB 3AZJB 5DNMD 5CPKD 1P3FC 1P3LA 3LJAD 3VH5W 3UTAC 5GXQB 5B32G 3AV1A 4J8WB 3MGQB 2JSSA 2F8NA 3H0MC 1P3ID 1P3GD 3MGRB 3W97A 3X1VD 1M19C 5B2IA 5G49B 4LD9D 3P5JB 3KFUG 1P3AC 5B31G 4XUJC 2HIOA 3WA9A 3LZ0C 3REID 3X1UB 3TU4A 1EQZA 2NZDA 1N1JA 4H9SC 5AVCA 3LELC 3AZED 3AZGC 4YM6A 1P3KB 3NQUB 2NQBA 4WU8A 5BS7A 3AZMD 5JRGD 4G91C 4NFTA 2G5IC 4UUZB 1KX3C 5F99C 4H9PA 5JA4B 3C1CC 1S32C 4R8PA 4WU9A 5B40B 3A6ND 5B0YB 2JE5A 5B2JC 2IO5C 3MGSD 5CP6C 1P34A 3B0BA 4XZQD 3AZFD 3MGPD 3AYWD 5B33C 4WV4B 3AZHC 5B1MD 3W98C 5B32B 4X23D 3REHA 4J8VD 3UTBC 3W99B 4H9RA 5B1LD 1B67A 3X1SA 3REKA 5CPJC 2CV5B 5AV8C 1P3FA 2RVQD 4J8UD 3O62D 3AZKB 4WNNB 2FJ7B 5B31B 5AV9D 3UTAA 1AOIC 5AY8B 1ZLAC 3B6GD 1TAFB 3WKJD 3REJC 1ULYA 3AZNB 4KUDC 3MGRD 1M19A 3B6FD 3R45B 3RELB 1P3AA 4ZUXD 3KWQA 1WWSA 5B0ZB 1P3MC 4H9OB 4XUJA 3LZ0A 1P3OC 5DNMB 3MVDC 5CPKB 3LJAB 4H9SA 3LELA 2YFWA 1M18B 2BYMB 3AZGA 5E5AD 4HGAB 1B6WA 1P3GB 4G92C 3WTPC 1A7WA 2XD1A 3X1VB 5CPID 3C1BD 5BNVA 1KX3A 4LD9B 3VH6T 5F99A 3LZ1C 3C1CA 4J8XC 1S32A 5AV6C 3REIB 5B2JA 5AV5C 5CP6A 1U35D 3B0DB 4H9NA 4YM6B 5B33A 3AZHA 3W98A 3AZID 1W2EA 3AZMB 1P3IC 5JRGB 2NQBB 5C3IC 5B24C 1KX4C 3UTBA 1TZYC 4Z2MG 1P3PD 2Y2OA 3W96D 3V9RA 4JJNA 3A6NB 3IP4C 4Z5TC 5CPJA 5AV8A 3MGSB 2G5HC 4WU9B 2PYOD 3AL0C 4Z66C 1P3BD 3AZKD 5AVBD 4XZQB 3KXBC 1KX5D 1P34B 3H0RC 3AZFB 4DRAA 2ZY4A 3MGPB 3UT9C 4YS3C 2HUEC 3MNNA 3AYWB 3VH5T 1BH9B 4X23B 3REJA 4KUDA 3KUYD 4J8VB 3AFAD 1P3MA 5B1LB 3RELD 3X1TC 1P3OA 4KGCC 3MVDA 4H9RB 3F6TA 3AN2C 3O62B 2Y2LA 2DQNC 5AV9B 5BNXA 5GT0C 1M18D 1H3OA 1P3LD 5GSUC 2Y2NA 3AV1D 3B6GB 2AROC 3WTPA 3WKJB 1HQ3A 5B1MC 4CSRA 3B6FB 2F8ND 3LZ1A 4WJ3C 4J8XA 4ZUXB 4QLCC 3B0CT 1M19B 5AV6A 3W97D 5AV5A 5B2ID 3KWQB 1F66C 3AZJC 2HIOD 4H9QA 4CAYA 3WA9D 2YFVA 3H0LC 5E5AB 3LELB 3TU4D 1EQZD 2NZDD 5GXQC 2XD5A 5AVCD 4J8WC 3MGQC 3FDDA 5GT3C 4YM6D 2ZY3A 5B24A 3B0CW 1KX4A 5CPIB 1TZYA 3C1BB 4WU8D 2NQBD 5BNVB 4Z5TA 3VH6A 2BYKB 5FUGB 1S32B 1PZRA 4WZSB 3AZLA 4Z66A 3X1UC 4R8PD 2Y2KA 4WU9D 2CWEA 3KXBA 1U35B 1JFIA 3UT9A 2F8NG 4YS3A 1P34D 1P3KC 3AZIB 4KHAA 5KDMB 5DNNA 1P3PB 3EPKA 3REHD 3EG5B 3W96B 2UWXA 3X1TA 4KGCA 3AN2A 4JJNB 5B40C 5B0YC 2PYOB 1ID3C 5CPJB 1P3BB 5GT0A 3X1SD 3REKD 5AVBB 1KX5B 1M1AC 1P3FD 5GSUA 5BO0A 3UTAD 2Y2PA 2AROA 1BFMA 3MNNB 3KUYB 3VH5A 3AFAB 5B32C 2Y2JA 1BH8B 4QLCA 3W99C 1M19D 1P3MB 1P3AD 1F66A 3KSYA 3KWQD 4EO5B 4XUJD 3AZJA 3MVDB 2CV5C 3LZ0D 3EPHA 1T3UA 3AZKC 2FJ7C 1P3LB 5B31C 5BNXB 4Z2MH 5GXQA 3LELD 5BT1C 4J8WA 1H3OB 3MGQA 3AV1B 5GT3A 3WAAC 3AZGD 5AY8C 2F8NB 3AZNC 1HQ3B 2RIQA 5G49A 3W97B 3RELC 5B2IB 4DQYB 3AV2C 5B0ZC 1KX3D 5F99D 3C1CD 2Y2IA 4UPKA 1S32D 5DNMC 2HIOB 3X1UA 5CPKC 3WA9B 3LJAC 5B2JD 3TU4B 1EQZB 2NZDB 1N1JB 1M18C 5CP6D 4H9QB 5AVCB 2VQRA 1P3KA 3NQUA 2F8NK 4HGAC 1P3GC 2W8SA 4WU8B 5B33D 5C3IB 3AZHD 3W98D 3X1VC 4UUZA 4LD9C 3UTBD 5JA4A 1KU5A 1R4VA 4H9PB 5B40A 4AWLB 5B0YA 4Z5TB 3EPJA 3REIC 4R8PB 1ID3A 4JJND 1M1AA 4ZBJB 5CPJD 5AV8D 2BG1A 3AZEC 3AZLB 2LY8A 3KXBB 3B0DC 1AOIA 2HUEB 4DRBA 3EPLA 1ZLAA 3MNND 3AZMC 5B32A 5JRGC 2FFFB 3REHB 3REJD 4KUDD 5DNNB 3W99A 1P3MD 1WWIA 3A6NC 1F1EA 2CV5A 3X1SB 3REKB 3MGSC 1P3OD 2FJ7A 1P3FB 4WNNA 3MVDD 5B31A 5CHLB 4XZQC 3UTAB 3AZFC 3MGPC 3WAAA 5BO0B 3AYWC 5AY8A 4X23C 1TAFA 3AZNA 4J8VC 3WTPD 1HQ3D 3A1KA 5B1LC 3AV2A 4QLCB 5B0ZA 2F8NH 3LZ1D 1P3AB 4J8XD 4XUJB 5DNMA 5CPKA 5AV6D 3LZ0B 3LJAA 2RVQC 4J8UC 3O62C 5AV5D 3NQJA 5AV9C 2BYMA 2YFWB 3AZGB 1P3IA 2Y2MA 1P3GA 5GT3B 3B6GC 3WKJC 3MGRC 3X1VA 3B6FC 4G91B 5B24D 1KX4D 4LD9A 1TZYD 4ZUXC 1KX3B 5F99B 3C1CB 3REIA 2ZM5A 3KWQC 4Z5TD 5B2JB 2IO5B 3AZEA 5CP6B 3AZLD 4Z66D 5E5AC 2ZY5A 3KXBD 4H9NB 3UT9D 4YS3D 3AZMA 4NE6A 5B33B 5JRGA 3AZHB 3W98B 5CPIC 3C1BC 3UTBB 4NE5A 5DNND 2J8PA 3A6NA 3V9RB 3X1TD 3MGSA 4KGCD 2L5AA 5AV8B 3AN2D 1ID3B 4E45A 1U35C 4XZQA 1M1AB 5GT0D 3AZFA 3MGPA 3AYWA 1BH9A 5GSUD 5B1MA 3AZIC 4X23A 1AOIB 1ZLAB 4J8VA 2AROD 3REJB 4KUDB 1P3PC 2JCHA 5B1LA 1Q9CA 3W96C 4QLCD 1P3OB 4J8UA 3O62A 4JJNC 2PYOC 1HTAA 5AV9A 1P3BC 1F66D 5AVBC 1KX5C 3AZJD 2Y2HA 5GXQD 3B6GA 3WAAB 3WKJA 4J8WD 4NE3A 3MNNC 3MGQD 5GT3D 3MGRA 3KUYC 4G92B 3WTPB 3B6FA 3AFAC 4CSRB 4ZUXA 2ZY2A 3LZ1B 4J8XB 5AV6B 3AV2B 4E44A 5AV5B 4EO5C 5E5AA 3X1UD 4CAYB 1P3LC 3NQJB 2YFVB 2DF4C 3AV1C 4M6BA 1Z2CB 1P3KD 5CPIA 1P3IB 3C1BA 5B24B 1KX4B 1HQ3C 1TZYB 3W97C 2BYKA 5FUGA 5B2IC 2HIOC 1U35A 3WA9C 5B40D 5B0YD 1ID3D 4Z66B 3TU4C 1EQZC 2NZDC 3AZEB 1M1AD 5AVCC 1JFIB 3UT9B 4YS3B 3AZIA 4YM6C 1AOID 5KDMA 4KHAB 2NQBC 3VH6W 4WU8C 1ZLAD 3WTPE 5BS7C 1P3PA 3A1IA 5B32D 3W96A 3X1TB 3W99D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGC B;  3AN2 B;  4AWL C;  2PYO A;  1P3B A;  4R8P C;  3AZK A;  4WU9 C;  5AVB A;  1KX5 A;  4ZBJ C;  2CV5 D;  5GT0 B;  3AZL C;  2FJ7 D;  1P34 C;  5B31 D;  5GSU B;  5BT1 D;  3KUY A;  3WAA D;  2ARO B;  5B1M B;  3AFA A;  5AY8 D;  1BH8 A;  3REH C;  3R45 A;  3REL A;  3AZN D;  5DNN C;  4H9O A;  3AV2 D;  5B0Z D;  3REK C;  3X1S C;  1F66 B;  1M18 A;  4J8U B;  3AZJ B;  5DNM D;  5CPK D;  1P3F C;  1P3L A;  3LJA D;  3VH5 W;  3UTA C;  5GXQ B;  5B32 G;  3AV1 A;  4J8W B;  3MGQ B;  2JSS A;  2F8N A;  1P3I D;  1P3G D;  3MGR B;  3W97 A;  3X1V D;  1M19 C;  5B2I A;  5G49 B;  4LD9 D;  1P3A C;  5B31 G;  4XUJ C;  2HIO A;  3WA9 A;  3LZ0 C;  3REI D;  3X1U B;  3TU4 A;  1EQZ A;  2NZD A;  1N1J A;  4H9S C;  5AVC A;  3LEL C;  3AZE D;  3AZG C;  4YM6 A;  1P3K B;  3NQU B;  2NQB A;  4WU8 A;  5BS7 A;  3AZM D;  5JRG D;  4G91 C;  4NFT A;  4UUZ B;  1KX3 C;  5F99 C;  4H9P A;  5JA4 B;  3C1C C;  1S32 C;  4R8P A;  4WU9 A;  5B40 B;  3A6N D;  5B0Y B;  5B2J C;  2IO5 C;  3MGS D;  5CP6 C;  1P34 A;  3B0B A;  4XZQ D;  3AZF D;  3MGP D;  3AYW D;  5B33 C;  4WV4 B;  3AZH C;  5B1M D;  3W98 C;  5B32 B;  4X23 D;  3REH A;  4J8V D;  3UTB C;  3W99 B;  4H9R A;  5B1L D;  1B67 A;  3X1S A;  3REK A;  5CPJ C;  2CV5 B;  5AV8 C;  1P3F A;  2RVQ D;  4J8U D;  3O62 D;  3AZK B;  4WNN B;  2FJ7 B;  5B31 B;  5AV9 D;  3UTA A;  1AOI C;  5AY8 B;  1ZLA C;  3B6G D;  1TAF B;  3WKJ D;  3REJ C;  1ULY A;  3AZN B;  4KUD C;  3MGR D;  1M19 A;  3B6F D;  3R45 B;  3REL B;  1P3A A;  4ZUX D;  3KWQ A;  1WWS A;  5B0Z B;  1P3M C;  4H9O B;  4XUJ A;  3LZ0 A;  1P3O C;  5DNM B;  3MVD C;  5CPK B;  3LJA B;  4H9S A;  3LEL A;  2YFW A;  1M18 B;  2BYM B;  3AZG A;  5E5A D;  4HGA B;  1B6W A;  1P3G B;  4G92 C;  3WTP C;  1A7W A;  3X1V B;  5CPI D;  3C1B D;  5BNV A;  1KX3 A;  4LD9 B;  3VH6 T;  5F99 A;  3LZ1 C;  3C1C A;  4J8X C;  1S32 A;  5AV6 C;  3REI B;  5B2J A;  5AV5 C;  5CP6 A;  1U35 D;  3B0D B;  4H9N A;  4YM6 B;  5B33 A;  3AZH A;  3W98 A;  3AZI D;  3AZM B;  1P3I C;  5JRG B;  2NQB B;  5C3I C;  5B24 C;  1KX4 C;  3UTB A;  1TZY C;  4Z2M G;  1P3P D;  3W96 D;  3V9R A;  4JJN A;  3A6N B;  4Z5T C;  5CPJ A;  5AV8 A;  3MGS B;  4WU9 B;  2PYO D;  4Z66 C;  1P3B D;  3AZK D;  5AVB D;  4XZQ B;  3KXB C;  1KX5 D;  1P34 B;  3AZF B;  4DRA A;  3MGP B;  3UT9 C;  4YS3 C;  2HUE C;  3MNN A;  3AYW B;  3VH5 T;  1BH9 B;  4X23 B;  3REJ A;  4KUD A;  3KUY D;  4J8V B;  3AFA D;  1P3M A;  5B1L B;  3REL D;  3X1T C;  1P3O A;  4KGC C;  3MVD A;  4H9R B;  3AN2 C;  3O62 B;  5AV9 B;  5BNX A;  5GT0 C;  1M18 D;  1H3O A;  1P3L D;  5GSU C;  3AV1 D;  3B6G B;  3WTP A;  2ARO C;  3WKJ B;  1HQ3 A;  5B1M C;  4CSR A;  3B6F B;  2F8N D;  3LZ1 A;  4J8X A;  4ZUX B;  4QLC C;  3B0C T;  1M19 B;  5AV6 A;  3W97 D;  5AV5 A;  5B2I D;  3KWQ B;  1F66 C;  3AZJ C;  2HIO D;  4H9Q A;  4CAY A;  3WA9 D;  2YFV A;  5E5A B;  3TU4 D;  3LEL B;  1EQZ D;  2NZD D;  5GXQ C;  5AVC D;  4J8W C;  3MGQ C;  5GT3 C;  4YM6 D;  5B24 A;  3B0C W;  1KX4 A;  5CPI B;  1TZY A;  3C1B B;  4WU8 D;  2NQB D;  5BNV B;  4Z5T A;  3VH6 A;  2BYK B;  5FUG B;  1S32 B;  4WZS B;  3AZL A;  4Z66 A;  3X1U C;  4R8P D;  1U35 B;  4WU9 D;  2CWE A;  3KXB A;  1JFI A;  3UT9 A;  2F8N G;  4YS3 A;  1P34 D;  1P3K C;  3AZI B;  4KHA A;  5KDM B;  5DNN A;  1P3P B;  3REH D;  3W96 B;  3X1T A;  4KGC A;  3AN2 A;  4JJN B;  5B40 C;  5B0Y C;  2PYO B;  1ID3 C;  5CPJ B;  1P3B B;  5GT0 A;  3X1S D;  3REK D;  5AVB B;  1KX5 B;  1M1A C;  1P3F D;  5GSU A;  5BO0 A;  3UTA D;  2ARO A;  1BFM A;  3MNN B;  3KUY B;  3VH5 A;  3AFA B;  5B32 C;  1BH8 B;  4QLC A;  3W99 C;  1M19 D;  1P3M B;  1P3A D;  1F66 A;  3KSY A;  3KWQ D;  4EO5 B;  4XUJ D;  3AZJ A;  3MVD B;  2CV5 C;  3LZ0 D;  2FJ7 C;  3AZK C;  1P3L B;  5B31 C;  5BNX B;  4Z2M H;  5GXQ A;  3LEL D;  5BT1 C;  4J8W A;  1H3O B;  3MGQ A;  3AV1 B;  5GT3 A;  3WAA C;  3AZG D;  5AY8 C;  2F8N B;  3AZN C;  1HQ3 B;  5G49 A;  3W97 B;  3REL C;  5B2I B;  3AV2 C;  5B0Z C;  1KX3 D;  5F99 D;  3C1C D;  1S32 D;  5DNM C;  2HIO B;  3X1U A;  5CPK C;  3WA9 B;  3LJA C;  5B2J D;  3TU4 B;  1EQZ B;  2NZD B;  1N1J B;  1M18 C;  5CP6 D;  4H9Q B;  5AVC B;  1P3K A;  3NQU A;  2F8N K;  4HGA C;  1P3G C;  4WU8 B;  5B33 D;  5C3I B;  3AZH D;  3W98 D;  3X1V C;  4UUZ A;  4LD9 C;  3UTB D;  5JA4 A;  1KU5 A;  1R4V A;  4H9P B;  5B40 A;  4AWL B;  5B0Y A;  4Z5T B;  3REI C;  1ID3 A;  4R8P B;  4JJN D;  1M1A A;  4ZBJ B;  5CPJ D;  5AV8 D;  3AZE C;  3AZL B;  2LY8 A;  3KXB B;  3B0D C;  1AOI A;  2HUE B;  4DRB A;  1ZLA A;  3MNN D;  3AZM C;  5B32 A;  5JRG C;  3REH B;  3REJ D;  4KUD D;  5DNN B;  3W99 A;  1P3M D;  1WWI A;  3A6N C;  1F1E A;  2CV5 A;  3X1S B;  3REK B;  3MGS C;  1P3O D;  2FJ7 A;  1P3F B;  4WNN A;  3MVD D;  5B31 A;  5CHL B;  4XZQ C;  3UTA B;  3AZF C;  3MGP C;  3WAA A;  5BO0 B;  3AYW C;  5AY8 A;  4X23 C;  1TAF A;  3AZN A;  4J8V C;  3WTP D;  1HQ3 D;  5B1L C;  3AV2 A;  4QLC B;  5B0Z A;  2F8N H;  3LZ1 D;  1P3A B;  4J8X D;  4XUJ B;  5DNM A;  5CPK A;  5AV6 D;  3LZ0 B;  3LJA A;  2RVQ C;  4J8U C;  3O62 C;  5AV5 D;  3NQJ A;  5AV9 C;  2BYM A;  2YFW B;  3AZG B;  1P3I A;  1P3G A;  5GT3 B;  3B6G C;  3WKJ C;  3MGR C;  3X1V A;  3B6F C;  4G91 B;  5B24 D;  1KX4 D;  4LD9 A;  1TZY D;  4ZUX C;  1KX3 B;  5F99 B;  3C1C B;  3REI A;  3KWQ C;  4Z5T D;  5B2J B;  2IO5 B;  3AZE A;  5CP6 B;  3AZL D;  4Z66 D;  5E5A C;  3KXB D;  4H9N B;  3UT9 D;  4YS3 D;  3AZM A;  4NE6 A;  5B33 B;  5JRG A;  3AZH B;  3W98 B;  5CPI C;  3C1B C;  3UTB B;  4NE5 A;  5DNN D;  3A6N A;  3V9R B;  3X1T D;  3MGS A;  4KGC D;  2L5A A;  5AV8 B;  3AN2 D;  1ID3 B;  4E45 A;  1U35 C;  4XZQ A;  1M1A B;  5GT0 D;  3AZF A;  3MGP A;  3AYW A;  1BH9 A;  5GSU D;  5B1M A;  3AZI C;  4X23 A;  1AOI B;  1ZLA B;  4J8V A;  2ARO D;  3REJ B;  4KUD B;  1P3P C;  5B1L A;  1Q9C A;  3W96 C;  4QLC D;  1P3O B;  4J8U A;  3O62 A;  4JJN C;  2PYO C;  1HTA A;  5AV9 A;  1P3B C;  1F66 D;  5AVB C;  1KX5 C;  3AZJ D;  5GXQ D;  3B6G A;  3WAA B;  3WKJ A;  4J8W D;  4NE3 A;  3MNN C;  3MGQ D;  5GT3 D;  3MGR A;  3KUY C;  4G92 B;  3WTP B;  3B6F A;  3AFA C;  4CSR B;  4ZUX A;  3LZ1 B;  4J8X B;  5AV6 B;  3AV2 B;  4E44 A;  5AV5 B;  4EO5 C;  5E5A A;  3X1U D;  4CAY B;  1P3L C;  3NQJ B;  2YFV B;  3AV1 C;  4M6B A;  1P3K D;  5CPI A;  1P3I B;  3C1B A;  5B24 B;  1KX4 B;  1HQ3 C;  1TZY B;  3W97 C;  2BYK A;  5FUG A;  5B2I C;  2HIO C;  1U35 A;  3WA9 C;  5B40 D;  5B0Y D;  1ID3 D;  4Z66 B;  3TU4 C;  1EQZ C;  2NZD C;  3AZE B;  1M1A D;  5AVC C;  1JFI B;  3UT9 B;  4YS3 B;  3AZI A;  4YM6 C;  1AOI D;  5KDM A;  4KHA B;  2NQB C;  3VH6 W;  4WU8 C;  1ZLA D;  3WTP E;  5BS7 C;  1P3P A;  5B32 D;  3W96 A;  3X1T B;  3W99 D; 
#chains in the Genus database with same CATH topology
 4KGC B;  3AN2 B;  4AWL C;  2PYO A;  2F2A C;  4R8P C;  3AZK A;  1P3B A;  4WU9 C;  5AVB A;  1KX5 A;  4ZBJ C;  2CV5 D;  5GT0 B;  2Y2G A;  3AZL C;  2FJ7 D;  1P34 C;  5B31 D;  5GSU B;  5BT1 D;  2Y2Q A;  3KUY A;  3WAA D;  2ARO B;  5B1M B;  3AFA A;  5AY8 D;  1BH8 A;  3REH C;  3R45 A;  3REL A;  3AZN D;  5DNN C;  4H9O A;  3AV2 D;  5B0Z D;  3REK C;  3X1S C;  1F66 B;  1M18 A;  4J8U B;  3AZJ B;  5DNM D;  5CPK D;  1P3F C;  1P3L A;  3LJA D;  3VH5 W;  3UTA C;  5GXQ B;  5B32 G;  3AV1 A;  4J8W B;  3MGQ B;  2JSS A;  2F8N A;  3H0M C;  1P3I D;  1P3G D;  3MGR B;  3W97 A;  3X1V D;  1M19 C;  5B2I A;  5G49 B;  4LD9 D;  3P5J B;  3KFU G;  1P3A C;  5B31 G;  4XUJ C;  2HIO A;  3WA9 A;  3LZ0 C;  3REI D;  3X1U B;  3TU4 A;  1EQZ A;  2NZD A;  1N1J A;  4H9S C;  5AVC A;  3LEL C;  3AZE D;  3AZG C;  4YM6 A;  1P3K B;  3NQU B;  2NQB A;  4WU8 A;  5BS7 A;  3AZM D;  5JRG D;  4G91 C;  4NFT A;  2G5I C;  4UUZ B;  1KX3 C;  5F99 C;  4H9P A;  5JA4 B;  3C1C C;  1S32 C;  4R8P A;  4WU9 A;  5B40 B;  3A6N D;  5B0Y B;  2JE5 A;  5B2J C;  2IO5 C;  3MGS D;  5CP6 C;  1P34 A;  3B0B A;  4XZQ D;  3AZF D;  3MGP D;  3AYW D;  5B33 C;  4WV4 B;  3AZH C;  5B1M D;  3W98 C;  5B32 B;  4X23 D;  3REH A;  4J8V D;  3UTB C;  3W99 B;  4H9R A;  5B1L D;  1B67 A;  3X1S A;  3REK A;  5CPJ C;  2CV5 B;  5AV8 C;  1P3F A;  2RVQ D;  4J8U D;  3O62 D;  3AZK B;  4WNN B;  2FJ7 B;  5B31 B;  5AV9 D;  3UTA A;  1AOI C;  5AY8 B;  1ZLA C;  3B6G D;  1TAF B;  3WKJ D;  3REJ C;  1ULY A;  3AZN B;  4KUD C;  3MGR D;  1M19 A;  3B6F D;  3R45 B;  3REL B;  1P3A A;  4ZUX D;  3KWQ A;  1WWS A;  5B0Z B;  1P3M C;  4H9O B;  4XUJ A;  3LZ0 A;  1P3O C;  5DNM B;  3MVD C;  5CPK B;  3LJA B;  4H9S A;  3LEL A;  2YFW A;  1M18 B;  2BYM B;  3AZG A;  5E5A D;  4HGA B;  1B6W A;  1P3G B;  4G92 C;  3WTP C;  1A7W A;  2XD1 A;  3X1V B;  5CPI D;  3C1B D;  5BNV A;  1KX3 A;  4LD9 B;  3VH6 T;  5F99 A;  3LZ1 C;  3C1C A;  4J8X C;  1S32 A;  5AV6 C;  3REI B;  5B2J A;  5AV5 C;  5CP6 A;  1U35 D;  3B0D B;  4H9N A;  4YM6 B;  5B33 A;  3AZH A;  3W98 A;  3AZI D;  1W2E A;  3AZM B;  1P3I C;  5JRG B;  2NQB B;  5C3I C;  5B24 C;  1KX4 C;  3UTB A;  1TZY C;  4Z2M G;  1P3P D;  2Y2O A;  3W96 D;  3V9R A;  4JJN A;  3A6N B;  3IP4 C;  4Z5T C;  5CPJ A;  5AV8 A;  3MGS B;  2G5H C;  4WU9 B;  2PYO D;  3AL0 C;  4Z66 C;  1P3B D;  3AZK D;  5AVB D;  4XZQ B;  3KXB C;  1KX5 D;  1P34 B;  3H0R C;  3AZF B;  4DRA A;  2ZY4 A;  3MGP B;  3UT9 C;  4YS3 C;  2HUE C;  3MNN A;  3AYW B;  3VH5 T;  1BH9 B;  4X23 B;  3REJ A;  4KUD A;  3KUY D;  4J8V B;  3AFA D;  1P3M A;  5B1L B;  3REL D;  3X1T C;  1P3O A;  4KGC C;  3MVD A;  4H9R B;  3F6T A;  3AN2 C;  3O62 B;  2Y2L A;  2DQN C;  5AV9 B;  5BNX A;  5GT0 C;  1M18 D;  1H3O A;  1P3L D;  5GSU C;  2Y2N A;  3AV1 D;  3B6G B;  2ARO C;  3WTP A;  3WKJ B;  1HQ3 A;  5B1M C;  4CSR A;  3B6F B;  2F8N D;  3LZ1 A;  4WJ3 C;  4J8X A;  4ZUX B;  4QLC C;  3B0C T;  1M19 B;  5AV6 A;  3W97 D;  5AV5 A;  5B2I D;  3KWQ B;  1F66 C;  3AZJ C;  2HIO D;  4H9Q A;  4CAY A;  3WA9 D;  2YFV A;  3H0L C;  5E5A B;  3LEL B;  3TU4 D;  1EQZ D;  2NZD D;  5GXQ C;  2XD5 A;  5AVC D;  4J8W C;  3MGQ C;  3FDD A;  5GT3 C;  4YM6 D;  2ZY3 A;  5B24 A;  3B0C W;  1KX4 A;  5CPI B;  1TZY A;  3C1B B;  4WU8 D;  2NQB D;  5BNV B;  4Z5T A;  3VH6 A;  2BYK B;  5FUG B;  1S32 B;  1PZR A;  4WZS B;  3AZL A;  4Z66 A;  3X1U C;  4R8P D;  2Y2K A;  4WU9 D;  2CWE A;  3KXB A;  1U35 B;  1JFI A;  3UT9 A;  2F8N G;  4YS3 A;  1P34 D;  1P3K C;  3AZI B;  4KHA A;  5KDM B;  5DNN A;  1P3P B;  3EPK A;  3REH D;  3EG5 B;  3W96 B;  2UWX A;  3X1T A;  4KGC A;  3AN2 A;  4JJN B;  5B40 C;  5B0Y C;  2PYO B;  1ID3 C;  5CPJ B;  1P3B B;  5GT0 A;  3X1S D;  3REK D;  5AVB B;  1KX5 B;  1M1A C;  1P3F D;  5GSU A;  5BO0 A;  3UTA D;  2Y2P A;  2ARO A;  1BFM A;  3MNN B;  3KUY B;  3VH5 A;  3AFA B;  5B32 C;  2Y2J A;  1BH8 B;  4QLC A;  3W99 C;  1M19 D;  1P3M B;  1P3A D;  1F66 A;  3KSY A;  3KWQ D;  4EO5 B;  4XUJ D;  3AZJ A;  3MVD B;  2CV5 C;  3LZ0 D;  3EPH A;  1T3U A;  3AZK C;  2FJ7 C;  1P3L B;  5B31 C;  5BNX B;  4Z2M H;  5GXQ A;  3LEL D;  5BT1 C;  4J8W A;  1H3O B;  3MGQ A;  3AV1 B;  5GT3 A;  3WAA C;  3AZG D;  5AY8 C;  2F8N B;  3AZN C;  1HQ3 B;  2RIQ A;  5G49 A;  3W97 B;  3REL C;  5B2I B;  4DQY B;  3AV2 C;  5B0Z C;  1KX3 D;  5F99 D;  3C1C D;  2Y2I A;  4UPK A;  1S32 D;  5DNM C;  2HIO B;  3X1U A;  5CPK C;  3WA9 B;  3LJA C;  5B2J D;  3TU4 B;  1EQZ B;  2NZD B;  1N1J B;  1M18 C;  5CP6 D;  4H9Q B;  5AVC B;  2VQR A;  1P3K A;  3NQU A;  2F8N K;  4HGA C;  1P3G C;  2W8S A;  4WU8 B;  5B33 D;  5C3I B;  3AZH D;  3W98 D;  3X1V C;  4UUZ A;  4LD9 C;  3UTB D;  5JA4 A;  1KU5 A;  1R4V A;  4H9P B;  5B40 A;  4AWL B;  5B0Y A;  4Z5T B;  3EPJ A;  3REI C;  4R8P B;  1ID3 A;  4JJN D;  1M1A A;  4ZBJ B;  5CPJ D;  5AV8 D;  2BG1 A;  3AZE C;  3AZL B;  2LY8 A;  3KXB B;  3B0D C;  1AOI A;  2HUE B;  4DRB A;  3EPL A;  1ZLA A;  3MNN D;  3AZM C;  5B32 A;  5JRG C;  2FFF B;  3REH B;  3REJ D;  4KUD D;  5DNN B;  3W99 A;  1P3M D;  1WWI A;  3A6N C;  1F1E A;  2CV5 A;  3X1S B;  3REK B;  3MGS C;  1P3O D;  2FJ7 A;  1P3F B;  4WNN A;  3MVD D;  5B31 A;  5CHL B;  4XZQ C;  3UTA B;  3AZF C;  3MGP C;  3WAA A;  5BO0 B;  3AYW C;  5AY8 A;  4X23 C;  1TAF A;  3AZN A;  4J8V C;  3WTP D;  1HQ3 D;  3A1K A;  5B1L C;  3AV2 A;  4QLC B;  5B0Z A;  2F8N H;  3LZ1 D;  1P3A B;  4J8X D;  4XUJ B;  5DNM A;  5CPK A;  5AV6 D;  3LZ0 B;  3LJA A;  2RVQ C;  4J8U C;  3O62 C;  5AV5 D;  3NQJ A;  5AV9 C;  2BYM A;  2YFW B;  3AZG B;  1P3I A;  2Y2M A;  1P3G A;  5GT3 B;  3B6G C;  3WKJ C;  3MGR C;  3X1V A;  3B6F C;  4G91 B;  5B24 D;  1KX4 D;  4LD9 A;  1TZY D;  4ZUX C;  1KX3 B;  5F99 B;  3C1C B;  3REI A;  2ZM5 A;  3KWQ C;  4Z5T D;  5B2J B;  2IO5 B;  3AZE A;  5CP6 B;  3AZL D;  4Z66 D;  5E5A C;  2ZY5 A;  3KXB D;  4H9N B;  3UT9 D;  4YS3 D;  3AZM A;  4NE6 A;  5B33 B;  5JRG A;  3AZH B;  3W98 B;  5CPI C;  3C1B C;  3UTB B;  4NE5 A;  5DNN D;  2J8P A;  3A6N A;  3V9R B;  3X1T D;  3MGS A;  4KGC D;  2L5A A;  5AV8 B;  3AN2 D;  1ID3 B;  4E45 A;  1U35 C;  4XZQ A;  1M1A B;  5GT0 D;  3AZF A;  3MGP A;  3AYW A;  1BH9 A;  5GSU D;  5B1M A;  3AZI C;  4X23 A;  1AOI B;  1ZLA B;  4J8V A;  2ARO D;  3REJ B;  4KUD B;  1P3P C;  2JCH A;  5B1L A;  1Q9C A;  3W96 C;  4QLC D;  1P3O B;  4J8U A;  3O62 A;  4JJN C;  2PYO C;  1HTA A;  5AV9 A;  1P3B C;  1F66 D;  5AVB C;  1KX5 C;  3AZJ D;  2Y2H A;  5GXQ D;  3B6G A;  3WAA B;  3WKJ A;  4J8W D;  4NE3 A;  3MNN C;  3MGQ D;  5GT3 D;  3MGR A;  3KUY C;  4G92 B;  3WTP B;  3B6F A;  3AFA C;  4CSR B;  4ZUX A;  2ZY2 A;  3LZ1 B;  4J8X B;  5AV6 B;  3AV2 B;  4E44 A;  5AV5 B;  4EO5 C;  5E5A A;  3X1U D;  4CAY B;  1P3L C;  3NQJ B;  2YFV B;  2DF4 C;  3AV1 C;  4M6B A;  1Z2C B;  1P3K D;  5CPI A;  1P3I B;  3C1B A;  5B24 B;  1KX4 B;  1HQ3 C;  1TZY B;  3W97 C;  2BYK A;  5FUG A;  5B2I C;  2HIO C;  1U35 A;  3WA9 C;  5B40 D;  5B0Y D;  1ID3 D;  4Z66 B;  3TU4 C;  1EQZ C;  2NZD C;  3AZE B;  1M1A D;  5AVC C;  1JFI B;  3UT9 B;  4YS3 B;  3AZI A;  4YM6 C;  1AOI D;  5KDM A;  4KHA B;  2NQB C;  3VH6 W;  4WU8 C;  1ZLA D;  3WTP E;  5BS7 C;  1P3P A;  3A1I A;  5B32 D;  3W96 A;  3X1T B;  3W99 D; 
#chains in the Genus database with same CATH homology
 4KGC B;  3AN2 B;  4AWL C;  2PYO A;  2F2A C;  4R8P C;  3AZK A;  1P3B A;  4WU9 C;  5AVB A;  1KX5 A;  4ZBJ C;  2CV5 D;  5GT0 B;  2Y2G A;  3AZL C;  2FJ7 D;  1P34 C;  5B31 D;  5GSU B;  5BT1 D;  2Y2Q A;  3KUY A;  3WAA D;  2ARO B;  5B1M B;  3AFA A;  5AY8 D;  1BH8 A;  3REH C;  3R45 A;  3REL A;  3AZN D;  5DNN C;  4H9O A;  3AV2 D;  5B0Z D;  3REK C;  3X1S C;  1F66 B;  1M18 A;  4J8U B;  3AZJ B;  5DNM D;  5CPK D;  1P3F C;  1P3L A;  3LJA D;  3VH5 W;  3UTA C;  5GXQ B;  5B32 G;  3AV1 A;  4J8W B;  3MGQ B;  2JSS A;  2F8N A;  3H0M C;  1P3I D;  1P3G D;  3MGR B;  3W97 A;  3X1V D;  1M19 C;  5B2I A;  5G49 B;  4LD9 D;  3P5J B;  3KFU G;  1P3A C;  5B31 G;  4XUJ C;  2HIO A;  3WA9 A;  3LZ0 C;  3REI D;  3X1U B;  3TU4 A;  1EQZ A;  2NZD A;  1N1J A;  4H9S C;  5AVC A;  3LEL C;  3AZE D;  3AZG C;  4YM6 A;  1P3K B;  3NQU B;  2NQB A;  4WU8 A;  5BS7 A;  3AZM D;  5JRG D;  4G91 C;  4NFT A;  2G5I C;  4UUZ B;  1KX3 C;  5F99 C;  4H9P A;  5JA4 B;  3C1C C;  1S32 C;  4R8P A;  4WU9 A;  5B40 B;  3A6N D;  5B0Y B;  2JE5 A;  5B2J C;  2IO5 C;  3MGS D;  5CP6 C;  1P34 A;  3B0B A;  4XZQ D;  3AZF D;  3MGP D;  3AYW D;  5B33 C;  4WV4 B;  3AZH C;  5B1M D;  3W98 C;  5B32 B;  4X23 D;  3REH A;  4J8V D;  3UTB C;  3W99 B;  4H9R A;  5B1L D;  1B67 A;  3X1S A;  3REK A;  5CPJ C;  2CV5 B;  5AV8 C;  1P3F A;  2RVQ D;  4J8U D;  3O62 D;  3AZK B;  4WNN B;  2FJ7 B;  5B31 B;  5AV9 D;  3UTA A;  1AOI C;  5AY8 B;  1ZLA C;  3B6G D;  1TAF B;  3WKJ D;  3REJ C;  1ULY A;  3AZN B;  4KUD C;  3MGR D;  1M19 A;  3B6F D;  3R45 B;  3REL B;  1P3A A;  4ZUX D;  3KWQ A;  1WWS A;  5B0Z B;  1P3M C;  4H9O B;  4XUJ A;  3LZ0 A;  1P3O C;  5DNM B;  3MVD C;  5CPK B;  3LJA B;  4H9S A;  3LEL A;  2YFW A;  1M18 B;  2BYM B;  3AZG A;  5E5A D;  4HGA B;  1B6W A;  1P3G B;  4G92 C;  3WTP C;  1A7W A;  2XD1 A;  3X1V B;  5CPI D;  3C1B D;  5BNV A;  1KX3 A;  4LD9 B;  3VH6 T;  5F99 A;  3LZ1 C;  3C1C A;  4J8X C;  1S32 A;  5AV6 C;  3REI B;  5B2J A;  5AV5 C;  5CP6 A;  1U35 D;  3B0D B;  4H9N A;  4YM6 B;  5B33 A;  3AZH A;  3W98 A;  3AZI D;  1W2E A;  3AZM B;  1P3I C;  5JRG B;  2NQB B;  5C3I C;  5B24 C;  1KX4 C;  3UTB A;  1TZY C;  4Z2M G;  1P3P D;  2Y2O A;  3W96 D;  3V9R A;  4JJN A;  3A6N B;  3IP4 C;  4Z5T C;  5CPJ A;  5AV8 A;  3MGS B;  2G5H C;  4WU9 B;  2PYO D;  3AL0 C;  4Z66 C;  1P3B D;  3AZK D;  5AVB D;  4XZQ B;  3KXB C;  1KX5 D;  1P34 B;  3H0R C;  3AZF B;  4DRA A;  2ZY4 A;  3MGP B;  3UT9 C;  4YS3 C;  2HUE C;  3MNN A;  3AYW B;  3VH5 T;  1BH9 B;  4X23 B;  3REJ A;  4KUD A;  3KUY D;  4J8V B;  3AFA D;  1P3M A;  5B1L B;  3REL D;  3X1T C;  1P3O A;  4KGC C;  3MVD A;  4H9R B;  3F6T A;  3AN2 C;  3O62 B;  2Y2L A;  2DQN C;  5AV9 B;  5BNX A;  5GT0 C;  1M18 D;  1H3O A;  1P3L D;  5GSU C;  2Y2N A;  3AV1 D;  3B6G B;  2ARO C;  3WTP A;  3WKJ B;  1HQ3 A;  5B1M C;  4CSR A;  3B6F B;  2F8N D;  3LZ1 A;  4WJ3 C;  4J8X A;  4ZUX B;  4QLC C;  3B0C T;  1M19 B;  5AV6 A;  3W97 D;  5AV5 A;  5B2I D;  3KWQ B;  1F66 C;  3AZJ C;  2HIO D;  4H9Q A;  4CAY A;  3WA9 D;  2YFV A;  3H0L C;  5E5A B;  3LEL B;  3TU4 D;  1EQZ D;  2NZD D;  5GXQ C;  2XD5 A;  5AVC D;  4J8W C;  3MGQ C;  3FDD A;  5GT3 C;  4YM6 D;  2ZY3 A;  5B24 A;  3B0C W;  1KX4 A;  5CPI B;  1TZY A;  3C1B B;  4WU8 D;  2NQB D;  5BNV B;  4Z5T A;  3VH6 A;  2BYK B;  5FUG B;  1S32 B;  1PZR A;  4WZS B;  3AZL A;  4Z66 A;  3X1U C;  4R8P D;  2Y2K A;  4WU9 D;  2CWE A;  3KXB A;  1U35 B;  1JFI A;  3UT9 A;  2F8N G;  4YS3 A;  1P34 D;  1P3K C;  3AZI B;  4KHA A;  5KDM B;  5DNN A;  1P3P B;  3EPK A;  3REH D;  3EG5 B;  3W96 B;  2UWX A;  3X1T A;  4KGC A;  3AN2 A;  4JJN B;  5B40 C;  5B0Y C;  2PYO B;  1ID3 C;  5CPJ B;  1P3B B;  5GT0 A;  3X1S D;  3REK D;  5AVB B;  1KX5 B;  1M1A C;  1P3F D;  5GSU A;  5BO0 A;  3UTA D;  2Y2P A;  2ARO A;  1BFM A;  3MNN B;  3KUY B;  3VH5 A;  3AFA B;  5B32 C;  2Y2J A;  1BH8 B;  4QLC A;  3W99 C;  1M19 D;  1P3M B;  1P3A D;  1F66 A;  3KSY A;  3KWQ D;  4EO5 B;  4XUJ D;  3AZJ A;  3MVD B;  2CV5 C;  3LZ0 D;  3EPH A;  1T3U A;  3AZK C;  2FJ7 C;  1P3L B;  5B31 C;  5BNX B;  4Z2M H;  5GXQ A;  3LEL D;  5BT1 C;  4J8W A;  1H3O B;  3MGQ A;  3AV1 B;  5GT3 A;  3WAA C;  3AZG D;  5AY8 C;  2F8N B;  3AZN C;  1HQ3 B;  2RIQ A;  5G49 A;  3W97 B;  3REL C;  5B2I B;  4DQY B;  3AV2 C;  5B0Z C;  1KX3 D;  5F99 D;  3C1C D;  2Y2I A;  4UPK A;  1S32 D;  5DNM C;  2HIO B;  3X1U A;  5CPK C;  3WA9 B;  3LJA C;  5B2J D;  3TU4 B;  1EQZ B;  2NZD B;  1N1J B;  1M18 C;  5CP6 D;  4H9Q B;  5AVC B;  2VQR A;  1P3K A;  3NQU A;  2F8N K;  4HGA C;  1P3G C;  2W8S A;  4WU8 B;  5B33 D;  5C3I B;  3AZH D;  3W98 D;  3X1V C;  4UUZ A;  4LD9 C;  3UTB D;  5JA4 A;  1KU5 A;  1R4V A;  4H9P B;  5B40 A;  4AWL B;  5B0Y A;  4Z5T B;  3EPJ A;  3REI C;  4R8P B;  1ID3 A;  4JJN D;  1M1A A;  4ZBJ B;  5CPJ D;  5AV8 D;  2BG1 A;  3AZE C;  3AZL B;  2LY8 A;  3KXB B;  3B0D C;  1AOI A;  2HUE B;  4DRB A;  3EPL A;  1ZLA A;  3MNN D;  3AZM C;  5B32 A;  5JRG C;  2FFF B;  3REH B;  3REJ D;  4KUD D;  5DNN B;  3W99 A;  1P3M D;  1WWI A;  3A6N C;  1F1E A;  2CV5 A;  3X1S B;  3REK B;  3MGS C;  1P3O D;  2FJ7 A;  1P3F B;  4WNN A;  3MVD D;  5B31 A;  5CHL B;  4XZQ C;  3UTA B;  3AZF C;  3MGP C;  3WAA A;  5BO0 B;  3AYW C;  5AY8 A;  4X23 C;  1TAF A;  3AZN A;  4J8V C;  3WTP D;  1HQ3 D;  3A1K A;  5B1L C;  3AV2 A;  4QLC B;  5B0Z A;  2F8N H;  3LZ1 D;  1P3A B;  4J8X D;  4XUJ B;  5DNM A;  5CPK A;  5AV6 D;  3LZ0 B;  3LJA A;  2RVQ C;  4J8U C;  3O62 C;  5AV5 D;  3NQJ A;  5AV9 C;  2BYM A;  2YFW B;  3AZG B;  1P3I A;  2Y2M A;  1P3G A;  5GT3 B;  3B6G C;  3WKJ C;  3MGR C;  3X1V A;  3B6F C;  4G91 B;  5B24 D;  1KX4 D;  4LD9 A;  1TZY D;  4ZUX C;  1KX3 B;  5F99 B;  3C1C B;  3REI A;  2ZM5 A;  3KWQ C;  4Z5T D;  5B2J B;  2IO5 B;  3AZE A;  5CP6 B;  3AZL D;  4Z66 D;  5E5A C;  2ZY5 A;  3KXB D;  4H9N B;  3UT9 D;  4YS3 D;  3AZM A;  4NE6 A;  5B33 B;  5JRG A;  3AZH B;  3W98 B;  5CPI C;  3C1B C;  3UTB B;  4NE5 A;  5DNN D;  2J8P A;  3A6N A;  3V9R B;  3X1T D;  3MGS A;  4KGC D;  2L5A A;  5AV8 B;  3AN2 D;  1ID3 B;  4E45 A;  1U35 C;  4XZQ A;  1M1A B;  5GT0 D;  3AZF A;  3MGP A;  3AYW A;  1BH9 A;  5GSU D;  5B1M A;  3AZI C;  4X23 A;  1AOI B;  1ZLA B;  4J8V A;  2ARO D;  3REJ B;  4KUD B;  1P3P C;  2JCH A;  5B1L A;  1Q9C A;  3W96 C;  4QLC D;  1P3O B;  4J8U A;  3O62 A;  4JJN C;  2PYO C;  1HTA A;  5AV9 A;  1P3B C;  1F66 D;  5AVB C;  1KX5 C;  3AZJ D;  2Y2H A;  5GXQ D;  3B6G A;  3WAA B;  3WKJ A;  4J8W D;  4NE3 A;  3MNN C;  3MGQ D;  5GT3 D;  3MGR A;  3KUY C;  4G92 B;  3WTP B;  3B6F A;  3AFA C;  4CSR B;  4ZUX A;  2ZY2 A;  3LZ1 B;  4J8X B;  5AV6 B;  3AV2 B;  4E44 A;  5AV5 B;  4EO5 C;  5E5A A;  3X1U D;  4CAY B;  1P3L C;  3NQJ B;  2YFV B;  2DF4 C;  3AV1 C;  4M6B A;  1Z2C B;  1P3K D;  5CPI A;  1P3I B;  3C1B A;  5B24 B;  1KX4 B;  1HQ3 C;  1TZY B;  3W97 C;  2BYK A;  5FUG A;  5B2I C;  2HIO C;  1U35 A;  3WA9 C;  5B40 D;  5B0Y D;  1ID3 D;  4Z66 B;  3TU4 C;  1EQZ C;  2NZD C;  3AZE B;  1M1A D;  5AVC C;  1JFI B;  3UT9 B;  4YS3 B;  3AZI A;  4YM6 C;  1AOI D;  5KDM A;  4KHA B;  2NQB C;  3VH6 W;  4WU8 C;  1ZLA D;  3WTP E;  5BS7 C;  1P3P A;  3A1I A;  5B32 D;  3W96 A;  3X1T B;  3W99 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...