3RELA

2.7 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3relA00
3AZLA 4X23D 3MGQA 3MGPB 3REJC 1AOIA 3W98D 1ULYA 3AZMA 1KX3C 1P3BC 3W99D 1P3MC 5B0ZA 2BYKB 4JJNB 1P3KD 4J8XA 3X1VB 3UT9D 2F8NH 3X1TD 1KX4D 3REHB 5B33C 4YM6A 3AZJA 1EQZA 3C1BC 3AV1D 5DNMA 3A6NC 1TZYC 4QLCA 1P3IB 3WTPB 2NZDD 3NQUA 3LZ0C 1P3OA 2BYMA 1ID3C 2AROA 3AZED 5KDMA 2CV5C 5BNVA 3KSYA 2HIOD 4J8VD 5B0YB 2HIOB 1P3PD 2NQBD 4LD9B 2NQBB 1A7WA 3AZIB 4H9SC 5AVCB 4Z2MH 5GT3B 3X1SB 3MGQD 4G92C 3MGPC 3AZHC 3AN2C 1AOID 4YS3B 5CPKB 1S32D 5AVBA 5AV6B 4XUJC 3MGSB 1S32B 3KXBC 3AZND 5G49A 5F99A 1N1JB 5AV5B 5GXQB 4YM6D 3B0DB 1R4VA 5B32C 1EQZD 1BH8B 5DNMD 3AZKC 5CPJA 5B1LD 3O62B 4H9QB 5B1LB 2FJ7C 3WTPC 3W96C 5JRGA 1KX5A 5B2IA 2F8NG 4WNNB 3RELA 3UTAA 4UUZB 4LD9C 3VH6A 5DNNB 3WKJA 3MGRD 3MNNC 2JSSA 5FUGB 3TU4B 2F8ND 3UTBB 4HGAC 4Z66B 2F8NB 5GSUB 5B1MC 5AV6C 3REIA 5CP6D 5AY8C 3LJAD 1P34C 3LJAB 5AV5C 4DRBA 5AV8A 3MVDD 3MVDB 4Z5TC 1HQ3A 3B6FA 1M19A 3WA9B 4CAYB 1M1AA 3W97A 1ZLAA 5JRGD 4H9NB 3NQJB 1B67A 4CSRB 2F8NK 3LZ1D 3AV2D 3AZGA 3AYWB 1P3GD 3UTAD 3AZFB 2YFVA 5B40C 4J8XC 3VH5T 5B2JA 3B0CT 4R8PC 5B24A 3C1CD 1U35B 4KHAB 3KUYA 1H3OA 4X23A 5B31G 3REJB 1KX3D 1P3FD 1F66B 1P3BB 1P3MD 2AROC 5E5AC 1ZLAD 4JJNA 1TAFB 3WAAC 5B31D 3REHA 5B33B 1BH9B 3X1TA 3V9RA 1M18C 3AFAC 3C1BD 3C1BB 3AZGD 3X1UC 3A6ND 4J8WC 3REKC 3A6NB 4AWLB 1TZYB 1P3IA 3LZ0D 2NZDA 4KUDD 3LZ0B 3VH5W 4WU9C 3B0CW 4WV4B 5B2JD 1ID3D 1Q9CA 4E44A 5B24D 2CV5B 1JFIB 1U35C 2HIOA 4J8VA 2NQBA 3AZIA 4KGCB 5GT3A 3MGPD 4G92B 3AZHB 3AN2B 1KX5C 4YS3A 5CPKA 1F66C 3MGSA 4NFTA 4XUJB 1S32A 4JJND 3KXBB 3X1VD 3AZNA 3REHD 1N1JA 5GXQA 5B32B 1P3LC 3KWQC 3AZKD 4J8UB 3AZKB 3B6GB 3O62A 4H9QA 5BNXB 5B1LA 4AWLC 3WTPD 1P3ID 2FJ7B 3W96B 5JA4B 3LELC 4EO5B 5AV8C 4WU8B 5C3IC 5B0YD 4UUZA 1M19C 4LD9D 3AZID 3W97C 2CWEA 5AVCD 5CPIC 5GT3D 3X1SD 3MNNB 4KGCC 3MGRA 5FUGA 4YS3D 5CPKD 4HGAB 5B1MD 5AV6D 4Z66A 4XZQB 5GSUA 5B1MB 3MGSD 2F8NA 5AY8B 5CP6A 1WWSA 5AV5D 5GXQD 1P34B 3LJAA 2PYOC 3MVDA 4Z5TB 4H9RB 4J8UC 1F1EA 3O62D 3B6GC 2RVQC 1P3AB 3NQJA 5GT0C 3R45B 3AZLB 4X23C 4E45A 3LZ1A 5BS7C 4EO5C 3AV2A 4WU8C 3AYWA 3W98C 4H9PA 1P3GA 3AZFA 2YFWA 3W99C 5B40D 5DNND 1B6WA 5B0ZB 5B40B 4J8XB 1P3KC 3UT9C 3TU4D 5BO0B 3X1TC 5AV9C 1KX4C 4R8PB 3UTBD 4Z66D 5GSUD 4XZQC 3C1CA 3AV1C 3REJA 1P3OB 2BYMB 1KX3A 1P3FA 1P3BA 3WA9D 2AROB 3B0BA 5E5AB 4ZUXC 1P3MA 5KDMB 3AZEC 2IO5C 1P3AC 4Z2MG 5BNVB 1TAFA 3WAAB 1P3PC 5B31A 1M18D 3AZLC 1M18B 3AFAB 3X1UD 3C1BA 3MGQC 3X1UB 3AYWD 4J8WB 4NE5A 3A6NA 3REKB 3AZMC 3AZFD 1AOIC 5AVBB 5B0ZC 4WU9D 3LZ0A 4KUDA 4WU9B 3AZNC 5F99B 5CHLB 1ID3A 4YM6C 1U35D 3AZJC 1JFIA 1EQZC 5CPJB 5DNMC 4QLCC 4H9SA 3REJD 3MGPA 1P3OC 1KX5B 1F66D 1P3BD 2LY8A 4XUJA 5B2IB 2BYKA 4M6BA 3KXBA 3X1VA 5B33D 1P3PA 3WKJB 1P3LD 5B32A 1P3LB 3KWQB 3MGRC 3AZKA 1TZYD 2FJ7A 5AVBC 3WTPA 3REIB 5JA4A 5F99C 3LELB 3VH5A 5AV8B 2CV5D 5C3IB 1HQ3B 3B6FB 1M19B 5B0YA 5CPJC 4LD9A 3W97B 2HUEB 4KGCD 5CPIB 3MNNA 5AVCA 3X1SA 5JRGC 3AZHD 3AN2D 1KU5A 5B32G 4G91C 4XUJD 5B1MA 5AV6A 2L5AA 5B2IC 3KXBD 4ZBJB 3AV2C 4NE3A 1P3GC 5AY8A 3RELC 3UTAC 1P34A 2PYOB 5AV5A 3WKJC 5B32D 1WWIA 1BH8A 4J8UD 3B6GD 2FJ7D 3W96D 3REIC 5GT0B 3R45A 4X23B 4WU8D 1P3FC 3W98B 1HQ3C 4WNNA 3B6FC 3W99B 1M1AC 5B40A 5DNNA 2HUEC 1ZLAC 3MNND 1P3KB 3UT9B 5AV9D 5BO0A 3X1TB 5B31C 5AV9B 4R8PA 3TU4A 1KX4B 4H9OB 3V9RB 3WTPE 3UTBA 4XZQD 3AZGC 4ZBJC 3AV1B 5AY8D 1P34D 2NZDB 4KUDC 4Z5TD 4DRAA 5B2JC 4ZUXD 5E5AA 3WA9A 4CAYA 4ZUXB 1P3AD 5B24C 3AZEB 2IO5B 4H9NA 3VH6T 4CSRA 3KUYC 5BT1C 3WAAA 4J8VB 3AZLD 1P3PB 1M18A 3AFAA 3MGQB 3X1UA 4J8WA 3REKA 3AZMD 1AOIB 3AZMB 5B0ZD 4J8XD 4JJNC 4WU9A 3AZNB 3X1VC 3REHC 4R8PD 4YM6B 3AZJD 3AZJB 1EQZB 1U35A 4KHAA 5DNMB 4QLCD 4QLCB 1P3IC 2NZDC 1P3OD 3NQUB 1F66A 2AROD 5E5AD 3VH6W 3WAAD 5B0YC 2HIOC 5B33A 1BH9A 4J8VC 2NQBC 3AZIC 3AFAD 5AVCC 5GT3C 3KWQA 3MGRB 3X1SC 1P3LA 4J8WD 3REKD 1HTAA 4YS3C 5AVBD 5CPKC 1TZYA 3MGSC 1S32C 5F99D 5G49B 5CP6B 3LELA 5GXQC 3B0DC 2CV5A 5CPJD 3O62C 5B1LC 5CPIA 4KGCA 5JRGB 1KX5D 3AZHA 3AN2A 4G91B 5B2ID 3LZ1B 3AV2B 3RELD 4H9PB 1P3GB 2YFWB 3RELB 3UTAB 2PYOA 3WKJD 5DNNC 3KWQD 4J8UA 4NE6A 3TU4C 3B6GA 5BNXA 3UTBC 4Z66C 3REID 5GSUC 3W96A 3C1CB 5GT0A 5CP6C 3LELD 3LJAC 5AV8D 5BS7A 4WU8A 3MVDC 1HQ3D 1KX3B 1P3FB 3B6FD 3W98A 1M19D 1M1AD 3W99A 1P3MB 3W97D 1M1AB 3WA9C 5CPID 1ZLAB 1P3KA 3UT9A 5AV9A 5B31B 1KX4A 4H9OA 4XZQA 3LZ1C 1BFMA 3AZGB 3AV1A 3AYWC 3AZFC 2PYOD 2YFVB 4KUDB 4Z5TA 5B2JB 4H9RA 1ID3B 2RVQD 4ZUXA 5B24B 3AZEA 4WZSB 1P3AA 3KUYD 5BT1D 3C1CC 5GT0D 3KUYB 1H3OB
chains in the Genus database with same CATH superfamily
3AZLA 4X23D 3MGQA 3MGPB 3REJC 1AOIA 3W98D 1ULYA 3AZMA 1KX3C 1P3BC 3W99D 1P3MC 5B0ZA 2BYKB 4JJNB 1P3KD 4J8XA 3X1VB 3UT9D 2F8NH 3X1TD 2FFFB 2UWXA 3REHB 5B33C 1KX4D 4YM6A 2G5IC 3AZJA 1EQZA 3C1BC 3AV1D 5DNMA 3A6NC 2J8PA 1TZYC 4QLCA 1P3IB 3WTPB 2NZDD 3H0MC 3NQUA 3LZ0C 1P3OA 1PZRA 2ZY4A 2BYMA 1ID3C 2AROA 3AZED 5KDMA 2CV5C 5BNVA 3KSYA 2HIOD 4J8VD 5B0YB 2HIOB 1P3PD 2NQBD 4LD9B 2NQBB 1A7WA 3AZIB 4H9SC 5AVCB 4Z2MH 5GT3B 3X1SB 3MGQD 4G92C 3MGPC 3AZHC 3AN2C 1AOID 3H0LC 4YS3B 5CPKB 1S32D 5AVBA 5AV6B 4XUJC 3MGSB 1S32B 3KXBC 3AZND 5G49A 5F99A 3EPHA 1N1JB 5AV5B 5GXQB 4YM6D 3B0DB 1R4VA 5B32C 1EQZD 1BH8B 5DNMD 3AZKC 5CPJA 5B1LD 3O62B 4H9QB 5B1LB 1T3UA 2FJ7C 3WTPC 3W96C 5JRGA 1KX5A 3FDDA 5B2IA 2Y2LA 2F8NG 4WNNB 3RELA 3UTAA 4UUZB 4LD9C 3VH6A 5DNNB 3WKJA 3MGRD 3MNNC 2JSSA 5FUGB 2F2AC 3TU4B 2F8ND 3UTBB 4HGAC 4WJ3C 4Z66B 2F8NB 5GSUB 5B1MC 5AV6C 3REIA 5CP6D 5AY8C 3LJAD 1P34C 3LJAB 5AV5C 4DRBA 5AV8A 3MVDD 3MVDB 4Z5TC 1HQ3A 3B6FA 2JE5A 1M19A 3WA9B 4CAYB 1M1AA 3W97A 1ZLAA 5JRGD 4H9NB 3NQJB 1B67A 4CSRB 2F8NK 3KFUG 3LZ1D 3AV2D 3AZGA 3AYWB 1P3GD 3UTAD 3AZFB 2YFVA 5B40C 4J8XC 3VH5T 5B2JA 3B0CT 4R8PC 5B24A 3C1CD 1U35B 4KHAB 3KUYA 1H3OA 4X23A 5B31G 3REJB 1KX3D 1P3FD 1F66B 1P3BB 1P3MD 2AROC 5E5AC 1ZLAD 2ZY2A 4JJNA 1TAFB 3WAAC 5B31D 3REHA 5B33B 1BH9B 3X1TA 3V9RA 1M18C 3A1KA 3AFAC 3C1BD 3C1BB 3AZGD 3X1UC 3A6ND 4J8WC 3REKC 3A6NB 4AWLB 1TZYB 1P3IA 3LZ0D 2NZDA 4KUDD 3LZ0B 3VH5W 4WU9C 3B0CW 4WV4B 5B2JD 1ID3D 1Q9CA 4E44A 5B24D 3EG5B 2CV5B 2JCHA 1JFIB 1U35C 2XD1A 2HIOA 4J8VA 2NQBA 3AZIA 4KGCB 5GT3A 3MGPD 4G92B 3AZHB 3AN2B 1KX5C 3EPLA 4YS3A 5CPKA 1F66C 3MGSA 4NFTA 4XUJB 1S32A 4JJND 3KXBB 3X1VD 3AZNA 3REHD 1N1JA 5GXQA 5B32B 1P3LC 3KWQC 3AZKD 4J8UB 3AZKB 3B6GB 3O62A 4H9QA 5BNXB 5B1LA 4AWLC 3WTPD 1P3ID 2FJ7B 3W96B 5JA4B 3LELC 4EO5B 5AV8C 4WU8B 2XD5A 5C3IC 5B0YD 4UUZA 1M19C 4LD9D 3AZID 3W97C 2CWEA 5AVCD 5CPIC 5GT3D 3X1SD 3MNNB 4KGCC 3MGRA 5FUGA 4YS3D 5CPKD 4HGAB 5AV6D 5B1MD 4Z66A 4XZQB 5GSUA 5B1MB 3MGSD 2F8NA 5AY8B 5CP6A 1WWSA 5AV5D 5GXQD 1P34B 3LJAA 2PYOC 2Y2NA 3MVDA 4Z5TB 4H9RB 4J8UC 1F1EA 3O62D 3B6GC 2RVQC 1P3AB 3NQJA 5GT0C 2Y2MA 3R45B 3AZLB 4X23C 4E45A 3AL0C 3LZ1A 5BS7C 4EO5C 3AV2A 4WU8C 3AYWA 3W98C 4H9PA 1P3GA 3AZFA 2YFWA 3W99C 5B40D 2ZY3A 5DNND 1B6WA 5B0ZB 5B40B 4J8XB 1P3KC 3UT9C 3TU4D 5BO0B 3X1TC 5AV9C 1KX4C 4R8PB 3UTBD 4Z66D 5GSUD 2Y2QA 4XZQC 4DQYB 3C1CA 3AV1C 2ZM5A 1W2EA 3REJA 1P3OB 2BYMB 1KX3A 1P3FA 1P3BA 3WA9D 2AROB 3B0BA 5E5AB 4ZUXC 1P3MA 5KDMB 3AZEC 2IO5C 1P3AC 4Z2MG 5BNVB 1TAFA 3WAAB 1P3PC 5B31A 1M18D 3AZLC 1M18B 3AFAB 3X1UD 3C1BA 3MGQC 3X1UB 3AYWD 4J8WB 4NE5A 3A6NA 3REKB 3AZMC 3AZFD 1AOIC 2Y2GA 5AVBB 5B0ZC 4WU9D 3LZ0A 4KUDA 4WU9B 3AZNC 5F99B 1Z2CB 5CHLB 1ID3A 2DQNC 4YM6C 1U35D 3AZJC 1JFIA 1EQZC 2Y2OA 5DNMC 5CPJB 4QLCC 4H9SA 3REJD 3MGPA 1P3OC 1KX5B 1F66D 3A1IA 1P3BD 2LY8A 4XUJA 5B2IB 2BYKA 4M6BA 3KXBA 3X1VA 5B33D 1P3PA 3WKJB 1P3LD 5B32A 1P3LB 3KWQB 3MGRC 3AZKA 1TZYD 2FJ7A 5AVBC 3WTPA 3REIB 2Y2PA 5JA4A 2RIQA 5F99C 2Y2HA 3LELB 3VH5A 4UPKA 5AV8B 2W8SA 2CV5D 5C3IB 1HQ3B 3B6FB 1M19B 5B0YA 5CPJC 4LD9A 3W97B 2HUEB 4KGCD 5CPIB 3MNNA 5AVCA 3X1SA 2VQRA 5JRGC 3AZHD 3AN2D 1KU5A 5B32G 4G91C 4XUJD 5B1MA 5AV6A 2L5AA 5B2IC 3KXBD 4ZBJB 3AV2C 4NE3A 1P3GC 5AY8A 3RELC 3UTAC 1P34A 2PYOB 5AV5A 3WKJC 2DF4C 5B32D 1WWIA 1BH8A 4J8UD 3B6GD 2FJ7D 3W96D 3REIC 5GT0B 3P5JB 3R45A 4X23B 4WU8D 1P3FC 3W98B 1HQ3C 4WNNA 3B6FC 3W99B 1M1AC 5B40A 5DNNA 2HUEC 1ZLAC 3MNND 1P3KB 2BG1A 3H0RC 5AV9D 5BO0A 3UT9B 3X1TB 5B31C 5AV9B 4R8PA 3TU4A 1KX4B 4H9OB 3V9RB 3WTPE 3UTBA 4XZQD 2Y2KA 3AZGC 4ZBJC 3AV1B 5AY8D 1P34D 2NZDB 4KUDC 4Z5TD 4DRAA 5B2JC 4ZUXD 5E5AA 3WA9A 4CAYA 4ZUXB 1P3AD 5B24C 3AZEB 2IO5B 4H9NA 3VH6T 4CSRA 3KUYC 5BT1C 3WAAA 4J8VB 3AZLD 1P3PB 1M18A 3EPKA 3AFAA 3MGQB 3X1UA 4J8WA 3REKA 3AZMD 1AOIB 3AZMB 2Y2JA 5B0ZD 4J8XD 4JJNC 4WU9A 3AZNB 3X1VC 3REHC 4R8PD 3IP4C 4YM6B 3AZJD 3AZJB 1EQZB 1U35A 4KHAA 5DNMB 4QLCD 4QLCB 1P3IC 2NZDC 1P3OD 3NQUB 1F66A 2AROD 2ZY5A 5E5AD 3VH6W 3WAAD 5B0YC 2HIOC 5B33A 1BH9A 4J8VC 2NQBC 3AZIC 3AFAD 5AVCC 5GT3C 3KWQA 3MGRB 3X1SC 1P3LA 4J8WD 3REKD 1HTAA 4YS3C 5AVBD 5CPKC 1TZYA 3MGSC 1S32C 5F99D 5G49B 5CP6B 3LELA 5GXQC 3B0DC 2CV5A 5CPJD 3O62C 5B1LC 5CPIA 4KGCA 5JRGB 1KX5D 3AZHA 3AN2A 4G91B 5B2ID 3LZ1B 3AV2B 3F6TA 3RELD 4H9PB 1P3GB 2YFWB 3RELB 3UTAB 2PYOA 3WKJD 2Y2IA 5DNNC 2G5HC 3KWQD 4J8UA 4NE6A 3TU4C 3B6GA 5BNXA 3UTBC 4Z66C 3REID 5GSUC 3W96A 3C1CB 5GT0A 5CP6C 3LELD 3LJAC 5AV8D 5BS7A 4WU8A 3MVDC 1HQ3D 1KX3B 1P3FB 3B6FD 3W98A 1M19D 1M1AD 3W99A 1P3MB 3W97D 1M1AB 3WA9C 5CPID 1ZLAB 1P3KA 3UT9A 5AV9A 5B31B 1KX4A 4H9OA 3EPJA 4XZQA 3LZ1C 1BFMA 3AZGB 3AV1A 3AYWC 3AZFC 2PYOD 2YFVB 4KUDB 4Z5TA 5B2JB 4H9RA 1ID3B 2RVQD 4ZUXA 5B24B 3AZEA 4WZSB 1P3AA 3KUYD 5BT1D 3C1CC 5GT0D 3KUYB 1H3OB
chains in the Genus database with same CATH topology
3AZLA 4X23D 3MGQA 3MGPB 3REJC 1AOIA 3W98D 1ULYA 3AZMA 1KX3C 1P3BC 3W99D 1P3MC 5B0ZA 2BYKB 4JJNB 1P3KD 4J8XA 3X1VB 3UT9D 2F8NH 3X1TD 2FFFB 2UWXA 3REHB 5B33C 1KX4D 4YM6A 2G5IC 3AZJA 1EQZA 3C1BC 3AV1D 5DNMA 3A6NC 2J8PA 1TZYC 4QLCA 1P3IB 3WTPB 2NZDD 3H0MC 3NQUA 3LZ0C 1P3OA 1PZRA 2ZY4A 2BYMA 1ID3C 2AROA 3AZED 5KDMA 2CV5C 5BNVA 3KSYA 2HIOD 4J8VD 5B0YB 2HIOB 1P3PD 2NQBD 4LD9B 2NQBB 1A7WA 3AZIB 4H9SC 5AVCB 4Z2MH 5GT3B 3X1SB 3MGQD 4G92C 3MGPC 3AZHC 3AN2C 1AOID 3H0LC 4YS3B 5CPKB 1S32D 5AVBA 5AV6B 4XUJC 3MGSB 1S32B 3KXBC 3AZND 5G49A 5F99A 3EPHA 1N1JB 5AV5B 5GXQB 4YM6D 3B0DB 1R4VA 5B32C 1EQZD 1BH8B 5DNMD 3AZKC 5CPJA 5B1LD 3O62B 4H9QB 5B1LB 1T3UA 2FJ7C 3WTPC 3W96C 5JRGA 1KX5A 3FDDA 5B2IA 2Y2LA 2F8NG 4WNNB 3RELA 3UTAA 4UUZB 4LD9C 3VH6A 5DNNB 3WKJA 3MGRD 3MNNC 2JSSA 5FUGB 2F2AC 3TU4B 2F8ND 3UTBB 4HGAC 4WJ3C 4Z66B 2F8NB 5GSUB 5B1MC 5AV6C 3REIA 5CP6D 5AY8C 3LJAD 1P34C 3LJAB 5AV5C 4DRBA 5AV8A 3MVDD 3MVDB 4Z5TC 1HQ3A 3B6FA 2JE5A 1M19A 3WA9B 4CAYB 1M1AA 3W97A 1ZLAA 5JRGD 4H9NB 3NQJB 1B67A 4CSRB 2F8NK 3KFUG 3LZ1D 3AV2D 3AZGA 3AYWB 1P3GD 3UTAD 3AZFB 2YFVA 5B40C 4J8XC 3VH5T 5B2JA 3B0CT 4R8PC 5B24A 3C1CD 1U35B 4KHAB 3KUYA 1H3OA 4X23A 5B31G 3REJB 1KX3D 1P3FD 1F66B 1P3BB 1P3MD 2AROC 5E5AC 1ZLAD 2ZY2A 4JJNA 1TAFB 3WAAC 5B31D 3REHA 5B33B 1BH9B 3X1TA 3V9RA 1M18C 3A1KA 3AFAC 3C1BD 3C1BB 3AZGD 3X1UC 3A6ND 4J8WC 3REKC 3A6NB 4AWLB 1TZYB 1P3IA 3LZ0D 2NZDA 4KUDD 3LZ0B 3VH5W 4WU9C 3B0CW 4WV4B 5B2JD 1ID3D 1Q9CA 4E44A 5B24D 3EG5B 2CV5B 2JCHA 1JFIB 1U35C 2XD1A 2HIOA 4J8VA 2NQBA 3AZIA 4KGCB 5GT3A 3MGPD 4G92B 3AZHB 3AN2B 1KX5C 3EPLA 4YS3A 5CPKA 1F66C 3MGSA 4NFTA 4XUJB 1S32A 4JJND 3KXBB 3X1VD 3AZNA 3REHD 1N1JA 5GXQA 5B32B 1P3LC 3KWQC 3AZKD 4J8UB 3AZKB 3B6GB 3O62A 4H9QA 5BNXB 5B1LA 4AWLC 3WTPD 1P3ID 2FJ7B 3W96B 5JA4B 3LELC 4EO5B 5AV8C 4WU8B 2XD5A 5C3IC 5B0YD 4UUZA 1M19C 4LD9D 3AZID 3W97C 2CWEA 5AVCD 5CPIC 5GT3D 3X1SD 3MNNB 4KGCC 3MGRA 5FUGA 4YS3D 5CPKD 4HGAB 5AV6D 5B1MD 4Z66A 4XZQB 5GSUA 5B1MB 3MGSD 2F8NA 5AY8B 5CP6A 1WWSA 5AV5D 5GXQD 1P34B 3LJAA 2PYOC 2Y2NA 3MVDA 4Z5TB 4H9RB 4J8UC 1F1EA 3O62D 3B6GC 2RVQC 1P3AB 3NQJA 5GT0C 2Y2MA 3R45B 3AZLB 4X23C 4E45A 3AL0C 3LZ1A 5BS7C 4EO5C 3AV2A 4WU8C 3AYWA 3W98C 4H9PA 1P3GA 3AZFA 2YFWA 3W99C 5B40D 2ZY3A 5DNND 1B6WA 5B0ZB 5B40B 4J8XB 1P3KC 3UT9C 3TU4D 5BO0B 3X1TC 5AV9C 1KX4C 4R8PB 3UTBD 4Z66D 5GSUD 2Y2QA 4XZQC 4DQYB 3C1CA 3AV1C 2ZM5A 1W2EA 3REJA 1P3OB 2BYMB 1KX3A 1P3FA 1P3BA 3WA9D 2AROB 3B0BA 5E5AB 4ZUXC 1P3MA 5KDMB 3AZEC 2IO5C 1P3AC 4Z2MG 5BNVB 1TAFA 3WAAB 1P3PC 5B31A 1M18D 3AZLC 1M18B 3AFAB 3X1UD 3C1BA 3MGQC 3X1UB 3AYWD 4J8WB 4NE5A 3A6NA 3REKB 3AZMC 3AZFD 1AOIC 2Y2GA 5AVBB 5B0ZC 4WU9D 3LZ0A 4KUDA 4WU9B 3AZNC 5F99B 1Z2CB 5CHLB 1ID3A 2DQNC 4YM6C 1U35D 3AZJC 1JFIA 1EQZC 2Y2OA 5DNMC 5CPJB 4QLCC 4H9SA 3REJD 3MGPA 1P3OC 1KX5B 1F66D 3A1IA 1P3BD 2LY8A 4XUJA 5B2IB 2BYKA 4M6BA 3KXBA 3X1VA 5B33D 1P3PA 3WKJB 1P3LD 5B32A 1P3LB 3KWQB 3MGRC 3AZKA 1TZYD 2FJ7A 5AVBC 3WTPA 3REIB 2Y2PA 5JA4A 2RIQA 5F99C 2Y2HA 3LELB 3VH5A 4UPKA 5AV8B 2W8SA 2CV5D 5C3IB 1HQ3B 3B6FB 1M19B 5B0YA 5CPJC 4LD9A 3W97B 2HUEB 4KGCD 5CPIB 3MNNA 5AVCA 3X1SA 2VQRA 5JRGC 3AZHD 3AN2D 1KU5A 5B32G 4G91C 4XUJD 5B1MA 5AV6A 2L5AA 5B2IC 3KXBD 4ZBJB 3AV2C 4NE3A 1P3GC 5AY8A 3RELC 3UTAC 1P34A 2PYOB 5AV5A 3WKJC 2DF4C 5B32D 1WWIA 1BH8A 4J8UD 3B6GD 2FJ7D 3W96D 3REIC 5GT0B 3P5JB 3R45A 4X23B 4WU8D 1P3FC 3W98B 1HQ3C 4WNNA 3B6FC 3W99B 1M1AC 5B40A 5DNNA 2HUEC 1ZLAC 3MNND 1P3KB 2BG1A 3H0RC 5AV9D 5BO0A 3UT9B 3X1TB 5B31C 5AV9B 4R8PA 3TU4A 1KX4B 4H9OB 3V9RB 3WTPE 3UTBA 4XZQD 2Y2KA 3AZGC 4ZBJC 3AV1B 5AY8D 1P34D 2NZDB 4KUDC 4Z5TD 4DRAA 5B2JC 4ZUXD 5E5AA 3WA9A 4CAYA 4ZUXB 1P3AD 5B24C 3AZEB 2IO5B 4H9NA 3VH6T 4CSRA 3KUYC 5BT1C 3WAAA 4J8VB 3AZLD 1P3PB 1M18A 3EPKA 3AFAA 3MGQB 3X1UA 4J8WA 3REKA 3AZMD 1AOIB 3AZMB 2Y2JA 5B0ZD 4J8XD 4JJNC 4WU9A 3AZNB 3X1VC 3REHC 4R8PD 3IP4C 4YM6B 3AZJD 3AZJB 1EQZB 1U35A 4KHAA 5DNMB 4QLCD 4QLCB 1P3IC 2NZDC 1P3OD 3NQUB 1F66A 2AROD 2ZY5A 5E5AD 3VH6W 3WAAD 5B0YC 2HIOC 5B33A 1BH9A 4J8VC 2NQBC 3AZIC 3AFAD 5AVCC 5GT3C 3KWQA 3MGRB 3X1SC 1P3LA 4J8WD 3REKD 1HTAA 4YS3C 5AVBD 5CPKC 1TZYA 3MGSC 1S32C 5F99D 5G49B 5CP6B 3LELA 5GXQC 3B0DC 2CV5A 5CPJD 3O62C 5B1LC 5CPIA 4KGCA 5JRGB 1KX5D 3AZHA 3AN2A 4G91B 5B2ID 3LZ1B 3AV2B 3F6TA 3RELD 4H9PB 1P3GB 2YFWB 3RELB 3UTAB 2PYOA 3WKJD 2Y2IA 5DNNC 2G5HC 3KWQD 4J8UA 4NE6A 3TU4C 3B6GA 5BNXA 3UTBC 4Z66C 3REID 5GSUC 3W96A 3C1CB 5GT0A 5CP6C 3LELD 3LJAC 5AV8D 5BS7A 4WU8A 3MVDC 1HQ3D 1KX3B 1P3FB 3B6FD 3W98A 1M19D 1M1AD 3W99A 1P3MB 3W97D 1M1AB 3WA9C 5CPID 1ZLAB 1P3KA 3UT9A 5AV9A 5B31B 1KX4A 4H9OA 3EPJA 4XZQA 3LZ1C 1BFMA 3AZGB 3AV1A 3AYWC 3AZFC 2PYOD 2YFVB 4KUDB 4Z5TA 5B2JB 4H9RA 1ID3B 2RVQD 4ZUXA 5B24B 3AZEA 4WZSB 1P3AA 3KUYD 5BT1D 3C1CC 5GT0D 3KUYB 1H3OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL A;  4X23 D;  3MGQ A;  3MGP B;  3REJ C;  1AOI A;  3W98 D;  1ULY A;  3AZM A;  1KX3 C;  1P3B C;  3W99 D;  1P3M C;  5B0Z A;  2BYK B;  4JJN B;  1P3K D;  4J8X A;  3X1V B;  3UT9 D;  2F8N H;  3X1T D;  1KX4 D;  3REH B;  5B33 C;  4YM6 A;  3AZJ A;  1EQZ A;  3C1B C;  3AV1 D;  5DNM A;  3A6N C;  1TZY C;  4QLC A;  1P3I B;  3WTP B;  2NZD D;  3NQU A;  3LZ0 C;  1P3O A;  2BYM A;  1ID3 C;  2ARO A;  3AZE D;  5KDM A;  2CV5 C;  5BNV A;  3KSY A;  2HIO D;  4J8V D;  5B0Y B;  2HIO B;  1P3P D;  2NQB D;  4LD9 B;  2NQB B;  1A7W A;  3AZI B;  4H9S C;  5AVC B;  4Z2M H;  5GT3 B;  3X1S B;  3MGQ D;  4G92 C;  3MGP C;  3AZH C;  3AN2 C;  1AOI D;  4YS3 B;  5CPK B;  1S32 D;  5AVB A;  5AV6 B;  4XUJ C;  3MGS B;  1S32 B;  3KXB C;  3AZN D;  5G49 A;  5F99 A;  1N1J B;  5AV5 B;  5GXQ B;  4YM6 D;  3B0D B;  1R4V A;  5B32 C;  1EQZ D;  1BH8 B;  5DNM D;  3AZK C;  5CPJ A;  5B1L D;  3O62 B;  4H9Q B;  5B1L B;  2FJ7 C;  3WTP C;  3W96 C;  5JRG A;  1KX5 A;  5B2I A;  2F8N G;  4WNN B;  3REL A;  3UTA A;  4UUZ B;  4LD9 C;  3VH6 A;  5DNN B;  3WKJ A;  3MGR D;  3MNN C;  2JSS A;  5FUG B;  3TU4 B;  2F8N D;  3UTB B;  4HGA C;  4Z66 B;  2F8N B;  5GSU B;  5B1M C;  5AV6 C;  3REI A;  5CP6 D;  5AY8 C;  3LJA D;  1P34 C;  3LJA B;  5AV5 C;  4DRB A;  5AV8 A;  3MVD D;  3MVD B;  4Z5T C;  1HQ3 A;  3B6F A;  1M19 A;  3WA9 B;  4CAY B;  1M1A A;  3W97 A;  1ZLA A;  5JRG D;  4H9N B;  3NQJ B;  1B67 A;  4CSR B;  2F8N K;  3LZ1 D;  3AV2 D;  3AZG A;  3AYW B;  1P3G D;  3UTA D;  3AZF B;  2YFV A;  5B40 C;  4J8X C;  3VH5 T;  5B2J A;  3B0C T;  4R8P C;  5B24 A;  3C1C D;  1U35 B;  4KHA B;  3KUY A;  1H3O A;  4X23 A;  5B31 G;  3REJ B;  1KX3 D;  1P3F D;  1F66 B;  1P3B B;  1P3M D;  2ARO C;  5E5A C;  1ZLA D;  4JJN A;  1TAF B;  3WAA C;  5B31 D;  3REH A;  5B33 B;  1BH9 B;  3X1T A;  3V9R A;  1M18 C;  3AFA C;  3C1B D;  3C1B B;  3AZG D;  3X1U C;  3A6N D;  4J8W C;  3REK C;  3A6N B;  4AWL B;  1TZY B;  1P3I A;  3LZ0 D;  2NZD A;  4KUD D;  3LZ0 B;  3VH5 W;  4WU9 C;  3B0C W;  4WV4 B;  5B2J D;  1ID3 D;  1Q9C A;  4E44 A;  5B24 D;  2CV5 B;  1JFI B;  1U35 C;  2HIO A;  4J8V A;  2NQB A;  3AZI A;  4KGC B;  5GT3 A;  3MGP D;  4G92 B;  3AZH B;  3AN2 B;  1KX5 C;  4YS3 A;  5CPK A;  1F66 C;  3MGS A;  4NFT A;  4XUJ B;  1S32 A;  4JJN D;  3KXB B;  3X1V D;  3AZN A;  3REH D;  1N1J A;  5GXQ A;  5B32 B;  1P3L C;  3KWQ C;  3AZK D;  4J8U B;  3AZK B;  3B6G B;  3O62 A;  4H9Q A;  5BNX B;  5B1L A;  4AWL C;  3WTP D;  1P3I D;  2FJ7 B;  3W96 B;  5JA4 B;  3LEL C;  4EO5 B;  5AV8 C;  4WU8 B;  5C3I C;  5B0Y D;  4UUZ A;  1M19 C;  4LD9 D;  3AZI D;  3W97 C;  2CWE A;  5AVC D;  5CPI C;  5GT3 D;  3X1S D;  3MNN B;  4KGC C;  3MGR A;  5FUG A;  4YS3 D;  5CPK D;  4HGA B;  5B1M D;  5AV6 D;  4Z66 A;  4XZQ B;  5GSU A;  5B1M B;  3MGS D;  2F8N A;  5AY8 B;  5CP6 A;  1WWS A;  5AV5 D;  5GXQ D;  1P34 B;  3LJA A;  2PYO C;  3MVD A;  4Z5T B;  4H9R B;  4J8U C;  1F1E A;  3O62 D;  3B6G C;  2RVQ C;  1P3A B;  3NQJ A;  5GT0 C;  3R45 B;  3AZL B;  4X23 C;  4E45 A;  3LZ1 A;  5BS7 C;  4EO5 C;  3AV2 A;  4WU8 C;  3AYW A;  3W98 C;  4H9P A;  1P3G A;  3AZF A;  2YFW A;  3W99 C;  5B40 D;  5DNN D;  1B6W A;  5B0Z B;  5B40 B;  4J8X B;  1P3K C;  3UT9 C;  3TU4 D;  5BO0 B;  3X1T C;  5AV9 C;  1KX4 C;  4R8P B;  3UTB D;  4Z66 D;  5GSU D;  4XZQ C;  3C1C A;  3AV1 C;  3REJ A;  1P3O B;  2BYM B;  1KX3 A;  1P3F A;  1P3B A;  3WA9 D;  2ARO B;  3B0B A;  5E5A B;  4ZUX C;  1P3M A;  5KDM B;  3AZE C;  2IO5 C;  1P3A C;  4Z2M G;  5BNV B;  1TAF A;  3WAA B;  1P3P C;  5B31 A;  1M18 D;  3AZL C;  1M18 B;  3AFA B;  3X1U D;  3C1B A;  3MGQ C;  3X1U B;  3AYW D;  4J8W B;  4NE5 A;  3A6N A;  3REK B;  3AZM C;  3AZF D;  1AOI C;  5AVB B;  5B0Z C;  4WU9 D;  3LZ0 A;  4KUD A;  4WU9 B;  3AZN C;  5F99 B;  5CHL B;  1ID3 A;  4YM6 C;  1U35 D;  3AZJ C;  1JFI A;  1EQZ C;  5CPJ B;  5DNM C;  4QLC C;  4H9S A;  3REJ D;  3MGP A;  1P3O C;  1KX5 B;  1F66 D;  1P3B D;  2LY8 A;  4XUJ A;  5B2I B;  2BYK A;  4M6B A;  3KXB A;  3X1V A;  5B33 D;  1P3P A;  3WKJ B;  1P3L D;  5B32 A;  1P3L B;  3KWQ B;  3MGR C;  3AZK A;  1TZY D;  2FJ7 A;  5AVB C;  3WTP A;  3REI B;  5JA4 A;  5F99 C;  3LEL B;  3VH5 A;  5AV8 B;  2CV5 D;  5C3I B;  1HQ3 B;  3B6F B;  1M19 B;  5B0Y A;  5CPJ C;  4LD9 A;  3W97 B;  2HUE B;  4KGC D;  5CPI B;  3MNN A;  5AVC A;  3X1S A;  5JRG C;  3AZH D;  3AN2 D;  1KU5 A;  5B32 G;  4G91 C;  4XUJ D;  5B1M A;  5AV6 A;  2L5A A;  5B2I C;  3KXB D;  4ZBJ B;  3AV2 C;  4NE3 A;  1P3G C;  5AY8 A;  3REL C;  3UTA C;  1P34 A;  2PYO B;  5AV5 A;  3WKJ C;  5B32 D;  1WWI A;  1BH8 A;  4J8U D;  3B6G D;  2FJ7 D;  3W96 D;  3REI C;  5GT0 B;  3R45 A;  4X23 B;  4WU8 D;  1P3F C;  3W98 B;  1HQ3 C;  4WNN A;  3B6F C;  3W99 B;  1M1A C;  5B40 A;  5DNN A;  2HUE C;  1ZLA C;  3MNN D;  1P3K B;  3UT9 B;  5AV9 D;  5BO0 A;  3X1T B;  5B31 C;  5AV9 B;  4R8P A;  3TU4 A;  1KX4 B;  4H9O B;  3V9R B;  3WTP E;  3UTB A;  4XZQ D;  3AZG C;  4ZBJ C;  3AV1 B;  5AY8 D;  1P34 D;  2NZD B;  4KUD C;  4Z5T D;  4DRA A;  5B2J C;  4ZUX D;  5E5A A;  3WA9 A;  4CAY A;  4ZUX B;  1P3A D;  5B24 C;  3AZE B;  2IO5 B;  4H9N A;  3VH6 T;  4CSR A;  3KUY C;  5BT1 C;  3WAA A;  4J8V B;  3AZL D;  1P3P B;  1M18 A;  3AFA A;  3MGQ B;  3X1U A;  4J8W A;  3REK A;  3AZM D;  1AOI B;  3AZM B;  5B0Z D;  4J8X D;  4JJN C;  4WU9 A;  3AZN B;  3X1V C;  3REH C;  4R8P D;  4YM6 B;  3AZJ D;  3AZJ B;  1EQZ B;  1U35 A;  4KHA A;  5DNM B;  4QLC D;  4QLC B;  1P3I C;  2NZD C;  1P3O D;  3NQU B;  1F66 A;  2ARO D;  5E5A D;  3VH6 W;  3WAA D;  5B0Y C;  2HIO C;  5B33 A;  1BH9 A;  4J8V C;  2NQB C;  3AZI C;  3AFA D;  5AVC C;  5GT3 C;  3KWQ A;  3MGR B;  3X1S C;  1P3L A;  4J8W D;  3REK D;  1HTA A;  4YS3 C;  5AVB D;  5CPK C;  1TZY A;  3MGS C;  1S32 C;  5F99 D;  5G49 B;  5CP6 B;  3LEL A;  5GXQ C;  3B0D C;  2CV5 A;  5CPJ D;  3O62 C;  5B1L C;  5CPI A;  4KGC A;  5JRG B;  1KX5 D;  3AZH A;  3AN2 A;  4G91 B;  5B2I D;  3LZ1 B;  3AV2 B;  3REL D;  4H9P B;  1P3G B;  2YFW B;  3REL B;  3UTA B;  2PYO A;  3WKJ D;  5DNN C;  3KWQ D;  4J8U A;  4NE6 A;  3TU4 C;  3B6G A;  5BNX A;  3UTB C;  4Z66 C;  3REI D;  5GSU C;  3W96 A;  3C1C B;  5GT0 A;  5CP6 C;  3LEL D;  3LJA C;  5AV8 D;  5BS7 A;  4WU8 A;  3MVD C;  1HQ3 D;  1KX3 B;  1P3F B;  3B6F D;  3W98 A;  1M19 D;  1M1A D;  3W99 A;  1P3M B;  3W97 D;  1M1A B;  3WA9 C;  5CPI D;  1ZLA B;  1P3K A;  3UT9 A;  5AV9 A;  5B31 B;  1KX4 A;  4H9O A;  4XZQ A;  3LZ1 C;  1BFM A;  3AZG B;  3AV1 A;  3AYW C;  3AZF C;  2PYO D;  2YFV B;  4KUD B;  4Z5T A;  5B2J B;  4H9R A;  1ID3 B;  2RVQ D;  4ZUX A;  5B24 B;  3AZE A;  4WZS B;  1P3A A;  3KUY D;  5BT1 D;  3C1C C;  5GT0 D;  3KUY B;  1H3O B; 
#chains in the Genus database with same CATH topology
 3AZL A;  4X23 D;  3MGQ A;  3MGP B;  3REJ C;  1AOI A;  3W98 D;  1ULY A;  3AZM A;  1KX3 C;  1P3B C;  3W99 D;  1P3M C;  5B0Z A;  2BYK B;  4JJN B;  1P3K D;  4J8X A;  3X1V B;  3UT9 D;  2F8N H;  3X1T D;  2FFF B;  2UWX A;  3REH B;  5B33 C;  1KX4 D;  4YM6 A;  2G5I C;  3AZJ A;  1EQZ A;  3C1B C;  3AV1 D;  5DNM A;  3A6N C;  2J8P A;  1TZY C;  4QLC A;  1P3I B;  3WTP B;  2NZD D;  3H0M C;  3NQU A;  3LZ0 C;  1P3O A;  1PZR A;  2ZY4 A;  2BYM A;  1ID3 C;  2ARO A;  3AZE D;  5KDM A;  2CV5 C;  5BNV A;  3KSY A;  2HIO D;  4J8V D;  5B0Y B;  2HIO B;  1P3P D;  2NQB D;  4LD9 B;  2NQB B;  1A7W A;  3AZI B;  4H9S C;  5AVC B;  4Z2M H;  5GT3 B;  3X1S B;  3MGQ D;  4G92 C;  3MGP C;  3AZH C;  3AN2 C;  1AOI D;  3H0L C;  4YS3 B;  5CPK B;  1S32 D;  5AVB A;  5AV6 B;  4XUJ C;  3MGS B;  1S32 B;  3KXB C;  3AZN D;  5G49 A;  5F99 A;  3EPH A;  1N1J B;  5AV5 B;  5GXQ B;  4YM6 D;  3B0D B;  1R4V A;  5B32 C;  1EQZ D;  1BH8 B;  5DNM D;  3AZK C;  5CPJ A;  5B1L D;  3O62 B;  4H9Q B;  5B1L B;  1T3U A;  2FJ7 C;  3WTP C;  3W96 C;  5JRG A;  1KX5 A;  3FDD A;  5B2I A;  2Y2L A;  2F8N G;  4WNN B;  3REL A;  3UTA A;  4UUZ B;  4LD9 C;  3VH6 A;  5DNN B;  3WKJ A;  3MGR D;  3MNN C;  2JSS A;  5FUG B;  2F2A C;  3TU4 B;  2F8N D;  3UTB B;  4HGA C;  4WJ3 C;  4Z66 B;  2F8N B;  5GSU B;  5B1M C;  5AV6 C;  3REI A;  5CP6 D;  5AY8 C;  3LJA D;  1P34 C;  3LJA B;  5AV5 C;  4DRB A;  5AV8 A;  3MVD D;  3MVD B;  4Z5T C;  1HQ3 A;  3B6F A;  2JE5 A;  1M19 A;  3WA9 B;  4CAY B;  1M1A A;  3W97 A;  1ZLA A;  5JRG D;  4H9N B;  3NQJ B;  1B67 A;  4CSR B;  2F8N K;  3KFU G;  3LZ1 D;  3AV2 D;  3AZG A;  3AYW B;  1P3G D;  3UTA D;  3AZF B;  2YFV A;  5B40 C;  4J8X C;  3VH5 T;  5B2J A;  3B0C T;  4R8P C;  5B24 A;  3C1C D;  1U35 B;  4KHA B;  3KUY A;  1H3O A;  4X23 A;  5B31 G;  3REJ B;  1KX3 D;  1P3F D;  1F66 B;  1P3B B;  1P3M D;  2ARO C;  5E5A C;  1ZLA D;  2ZY2 A;  4JJN A;  1TAF B;  3WAA C;  5B31 D;  3REH A;  5B33 B;  1BH9 B;  3X1T A;  3V9R A;  1M18 C;  3A1K A;  3AFA C;  3C1B D;  3C1B B;  3AZG D;  3X1U C;  3A6N D;  4J8W C;  3REK C;  3A6N B;  4AWL B;  1TZY B;  1P3I A;  3LZ0 D;  2NZD A;  4KUD D;  3LZ0 B;  3VH5 W;  4WU9 C;  3B0C W;  4WV4 B;  5B2J D;  1ID3 D;  1Q9C A;  4E44 A;  5B24 D;  3EG5 B;  2CV5 B;  2JCH A;  1JFI B;  1U35 C;  2XD1 A;  2HIO A;  4J8V A;  2NQB A;  3AZI A;  4KGC B;  5GT3 A;  3MGP D;  4G92 B;  3AZH B;  3AN2 B;  1KX5 C;  3EPL A;  4YS3 A;  5CPK A;  1F66 C;  3MGS A;  4NFT A;  4XUJ B;  1S32 A;  4JJN D;  3KXB B;  3X1V D;  3AZN A;  3REH D;  1N1J A;  5GXQ A;  5B32 B;  1P3L C;  3KWQ C;  3AZK D;  4J8U B;  3AZK B;  3B6G B;  3O62 A;  4H9Q A;  5BNX B;  5B1L A;  4AWL C;  3WTP D;  1P3I D;  2FJ7 B;  3W96 B;  5JA4 B;  3LEL C;  4EO5 B;  5AV8 C;  4WU8 B;  2XD5 A;  5C3I C;  5B0Y D;  4UUZ A;  1M19 C;  4LD9 D;  3AZI D;  3W97 C;  2CWE A;  5AVC D;  5CPI C;  5GT3 D;  3X1S D;  3MNN B;  4KGC C;  3MGR A;  5FUG A;  4YS3 D;  5CPK D;  4HGA B;  5AV6 D;  5B1M D;  4Z66 A;  4XZQ B;  5GSU A;  5B1M B;  3MGS D;  2F8N A;  5AY8 B;  5CP6 A;  1WWS A;  5AV5 D;  5GXQ D;  1P34 B;  3LJA A;  2PYO C;  2Y2N A;  3MVD A;  4Z5T B;  4H9R B;  4J8U C;  1F1E A;  3O62 D;  3B6G C;  2RVQ C;  1P3A B;  3NQJ A;  5GT0 C;  2Y2M A;  3R45 B;  3AZL B;  4X23 C;  4E45 A;  3AL0 C;  3LZ1 A;  5BS7 C;  4EO5 C;  3AV2 A;  4WU8 C;  3AYW A;  3W98 C;  4H9P A;  1P3G A;  3AZF A;  2YFW A;  3W99 C;  5B40 D;  2ZY3 A;  5DNN D;  1B6W A;  5B0Z B;  5B40 B;  4J8X B;  1P3K C;  3UT9 C;  3TU4 D;  5BO0 B;  3X1T C;  5AV9 C;  1KX4 C;  4R8P B;  3UTB D;  4Z66 D;  5GSU D;  2Y2Q A;  4XZQ C;  4DQY B;  3C1C A;  3AV1 C;  2ZM5 A;  1W2E A;  3REJ A;  1P3O B;  2BYM B;  1KX3 A;  1P3F A;  1P3B A;  3WA9 D;  2ARO B;  3B0B A;  5E5A B;  4ZUX C;  1P3M A;  5KDM B;  3AZE C;  2IO5 C;  1P3A C;  4Z2M G;  5BNV B;  1TAF A;  3WAA B;  1P3P C;  5B31 A;  1M18 D;  3AZL C;  1M18 B;  3AFA B;  3X1U D;  3C1B A;  3MGQ C;  3X1U B;  3AYW D;  4J8W B;  4NE5 A;  3A6N A;  3REK B;  3AZM C;  3AZF D;  1AOI C;  2Y2G A;  5AVB B;  5B0Z C;  4WU9 D;  3LZ0 A;  4KUD A;  4WU9 B;  3AZN C;  5F99 B;  1Z2C B;  5CHL B;  1ID3 A;  2DQN C;  4YM6 C;  1U35 D;  3AZJ C;  1JFI A;  1EQZ C;  2Y2O A;  5DNM C;  5CPJ B;  4QLC C;  4H9S A;  3REJ D;  3MGP A;  1P3O C;  1KX5 B;  1F66 D;  3A1I A;  1P3B D;  2LY8 A;  4XUJ A;  5B2I B;  2BYK A;  4M6B A;  3KXB A;  3X1V A;  5B33 D;  1P3P A;  3WKJ B;  1P3L D;  5B32 A;  1P3L B;  3KWQ B;  3MGR C;  3AZK A;  1TZY D;  2FJ7 A;  5AVB C;  3WTP A;  3REI B;  2Y2P A;  5JA4 A;  2RIQ A;  5F99 C;  2Y2H A;  3LEL B;  3VH5 A;  4UPK A;  5AV8 B;  2W8S A;  2CV5 D;  5C3I B;  1HQ3 B;  3B6F B;  1M19 B;  5B0Y A;  5CPJ C;  4LD9 A;  3W97 B;  2HUE B;  4KGC D;  5CPI B;  3MNN A;  5AVC A;  3X1S A;  2VQR A;  5JRG C;  3AZH D;  3AN2 D;  1KU5 A;  5B32 G;  4G91 C;  4XUJ D;  5B1M A;  5AV6 A;  2L5A A;  5B2I C;  3KXB D;  4ZBJ B;  3AV2 C;  4NE3 A;  1P3G C;  5AY8 A;  3REL C;  3UTA C;  1P34 A;  2PYO B;  5AV5 A;  3WKJ C;  2DF4 C;  5B32 D;  1WWI A;  1BH8 A;  4J8U D;  3B6G D;  2FJ7 D;  3W96 D;  3REI C;  5GT0 B;  3P5J B;  3R45 A;  4X23 B;  4WU8 D;  1P3F C;  3W98 B;  1HQ3 C;  4WNN A;  3B6F C;  3W99 B;  1M1A C;  5B40 A;  5DNN A;  2HUE C;  1ZLA C;  3MNN D;  1P3K B;  2BG1 A;  3H0R C;  5AV9 D;  5BO0 A;  3UT9 B;  3X1T B;  5B31 C;  5AV9 B;  4R8P A;  3TU4 A;  1KX4 B;  4H9O B;  3V9R B;  3WTP E;  3UTB A;  4XZQ D;  2Y2K A;  3AZG C;  4ZBJ C;  3AV1 B;  5AY8 D;  1P34 D;  2NZD B;  4KUD C;  4Z5T D;  4DRA A;  5B2J C;  4ZUX D;  5E5A A;  3WA9 A;  4CAY A;  4ZUX B;  1P3A D;  5B24 C;  3AZE B;  2IO5 B;  4H9N A;  3VH6 T;  4CSR A;  3KUY C;  5BT1 C;  3WAA A;  4J8V B;  3AZL D;  1P3P B;  1M18 A;  3EPK A;  3AFA A;  3MGQ B;  3X1U A;  4J8W A;  3REK A;  3AZM D;  1AOI B;  3AZM B;  2Y2J A;  5B0Z D;  4J8X D;  4JJN C;  4WU9 A;  3AZN B;  3X1V C;  3REH C;  4R8P D;  3IP4 C;  4YM6 B;  3AZJ D;  3AZJ B;  1EQZ B;  1U35 A;  4KHA A;  5DNM B;  4QLC D;  4QLC B;  1P3I C;  2NZD C;  1P3O D;  3NQU B;  1F66 A;  2ARO D;  2ZY5 A;  5E5A D;  3VH6 W;  3WAA D;  5B0Y C;  2HIO C;  5B33 A;  1BH9 A;  4J8V C;  2NQB C;  3AZI C;  3AFA D;  5AVC C;  5GT3 C;  3KWQ A;  3MGR B;  3X1S C;  1P3L A;  4J8W D;  3REK D;  1HTA A;  4YS3 C;  5AVB D;  5CPK C;  1TZY A;  3MGS C;  1S32 C;  5F99 D;  5G49 B;  5CP6 B;  3LEL A;  5GXQ C;  3B0D C;  2CV5 A;  5CPJ D;  3O62 C;  5B1L C;  5CPI A;  4KGC A;  5JRG B;  1KX5 D;  3AZH A;  3AN2 A;  4G91 B;  5B2I D;  3LZ1 B;  3AV2 B;  3F6T A;  3REL D;  4H9P B;  1P3G B;  2YFW B;  3REL B;  3UTA B;  2PYO A;  3WKJ D;  2Y2I A;  5DNN C;  2G5H C;  3KWQ D;  4J8U A;  4NE6 A;  3TU4 C;  3B6G A;  5BNX A;  3UTB C;  4Z66 C;  3REI D;  5GSU C;  3W96 A;  3C1C B;  5GT0 A;  5CP6 C;  3LEL D;  3LJA C;  5AV8 D;  5BS7 A;  4WU8 A;  3MVD C;  1HQ3 D;  1KX3 B;  1P3F B;  3B6F D;  3W98 A;  1M19 D;  1M1A D;  3W99 A;  1P3M B;  3W97 D;  1M1A B;  3WA9 C;  5CPI D;  1ZLA B;  1P3K A;  3UT9 A;  5AV9 A;  5B31 B;  1KX4 A;  4H9O A;  3EPJ A;  4XZQ A;  3LZ1 C;  1BFM A;  3AZG B;  3AV1 A;  3AYW C;  3AZF C;  2PYO D;  2YFV B;  4KUD B;  4Z5T A;  5B2J B;  4H9R A;  1ID3 B;  2RVQ D;  4ZUX A;  5B24 B;  3AZE A;  4WZS B;  1P3A A;  3KUY D;  5BT1 D;  3C1C C;  5GT0 D;  3KUY B;  1H3O B; 
#chains in the Genus database with same CATH homology
 3AZL A;  4X23 D;  3MGQ A;  3MGP B;  3REJ C;  1AOI A;  3W98 D;  1ULY A;  3AZM A;  1KX3 C;  1P3B C;  3W99 D;  1P3M C;  5B0Z A;  2BYK B;  4JJN B;  1P3K D;  4J8X A;  3X1V B;  3UT9 D;  2F8N H;  3X1T D;  2FFF B;  2UWX A;  3REH B;  5B33 C;  1KX4 D;  4YM6 A;  2G5I C;  3AZJ A;  1EQZ A;  3C1B C;  3AV1 D;  5DNM A;  3A6N C;  2J8P A;  1TZY C;  4QLC A;  1P3I B;  3WTP B;  2NZD D;  3H0M C;  3NQU A;  3LZ0 C;  1P3O A;  1PZR A;  2ZY4 A;  2BYM A;  1ID3 C;  2ARO A;  3AZE D;  5KDM A;  2CV5 C;  5BNV A;  3KSY A;  2HIO D;  4J8V D;  5B0Y B;  2HIO B;  1P3P D;  2NQB D;  4LD9 B;  2NQB B;  1A7W A;  3AZI B;  4H9S C;  5AVC B;  4Z2M H;  5GT3 B;  3X1S B;  3MGQ D;  4G92 C;  3MGP C;  3AZH C;  3AN2 C;  1AOI D;  3H0L C;  4YS3 B;  5CPK B;  1S32 D;  5AVB A;  5AV6 B;  4XUJ C;  3MGS B;  1S32 B;  3KXB C;  3AZN D;  5G49 A;  5F99 A;  3EPH A;  1N1J B;  5AV5 B;  5GXQ B;  4YM6 D;  3B0D B;  1R4V A;  5B32 C;  1EQZ D;  1BH8 B;  5DNM D;  3AZK C;  5CPJ A;  5B1L D;  3O62 B;  4H9Q B;  5B1L B;  1T3U A;  2FJ7 C;  3WTP C;  3W96 C;  5JRG A;  1KX5 A;  3FDD A;  5B2I A;  2Y2L A;  2F8N G;  4WNN B;  3REL A;  3UTA A;  4UUZ B;  4LD9 C;  3VH6 A;  5DNN B;  3WKJ A;  3MGR D;  3MNN C;  2JSS A;  5FUG B;  2F2A C;  3TU4 B;  2F8N D;  3UTB B;  4HGA C;  4WJ3 C;  4Z66 B;  2F8N B;  5GSU B;  5B1M C;  5AV6 C;  3REI A;  5CP6 D;  5AY8 C;  3LJA D;  1P34 C;  3LJA B;  5AV5 C;  4DRB A;  5AV8 A;  3MVD D;  3MVD B;  4Z5T C;  1HQ3 A;  3B6F A;  2JE5 A;  1M19 A;  3WA9 B;  4CAY B;  1M1A A;  3W97 A;  1ZLA A;  5JRG D;  4H9N B;  3NQJ B;  1B67 A;  4CSR B;  2F8N K;  3KFU G;  3LZ1 D;  3AV2 D;  3AZG A;  3AYW B;  1P3G D;  3UTA D;  3AZF B;  2YFV A;  5B40 C;  4J8X C;  3VH5 T;  5B2J A;  3B0C T;  4R8P C;  5B24 A;  3C1C D;  1U35 B;  4KHA B;  3KUY A;  1H3O A;  4X23 A;  5B31 G;  3REJ B;  1KX3 D;  1P3F D;  1F66 B;  1P3B B;  1P3M D;  2ARO C;  5E5A C;  1ZLA D;  2ZY2 A;  4JJN A;  1TAF B;  3WAA C;  5B31 D;  3REH A;  5B33 B;  1BH9 B;  3X1T A;  3V9R A;  1M18 C;  3A1K A;  3AFA C;  3C1B D;  3C1B B;  3AZG D;  3X1U C;  3A6N D;  4J8W C;  3REK C;  3A6N B;  4AWL B;  1TZY B;  1P3I A;  3LZ0 D;  2NZD A;  4KUD D;  3LZ0 B;  3VH5 W;  4WU9 C;  3B0C W;  4WV4 B;  5B2J D;  1ID3 D;  1Q9C A;  4E44 A;  5B24 D;  3EG5 B;  2CV5 B;  2JCH A;  1JFI B;  1U35 C;  2XD1 A;  2HIO A;  4J8V A;  2NQB A;  3AZI A;  4KGC B;  5GT3 A;  3MGP D;  4G92 B;  3AZH B;  3AN2 B;  1KX5 C;  3EPL A;  4YS3 A;  5CPK A;  1F66 C;  3MGS A;  4NFT A;  4XUJ B;  1S32 A;  4JJN D;  3KXB B;  3X1V D;  3AZN A;  3REH D;  1N1J A;  5GXQ A;  5B32 B;  1P3L C;  3KWQ C;  3AZK D;  4J8U B;  3AZK B;  3B6G B;  3O62 A;  4H9Q A;  5BNX B;  5B1L A;  4AWL C;  3WTP D;  1P3I D;  2FJ7 B;  3W96 B;  5JA4 B;  3LEL C;  4EO5 B;  5AV8 C;  4WU8 B;  2XD5 A;  5C3I C;  5B0Y D;  4UUZ A;  1M19 C;  4LD9 D;  3AZI D;  3W97 C;  2CWE A;  5AVC D;  5CPI C;  5GT3 D;  3X1S D;  3MNN B;  4KGC C;  3MGR A;  5FUG A;  4YS3 D;  5CPK D;  4HGA B;  5AV6 D;  5B1M D;  4Z66 A;  4XZQ B;  5GSU A;  5B1M B;  3MGS D;  2F8N A;  5AY8 B;  5CP6 A;  1WWS A;  5AV5 D;  5GXQ D;  1P34 B;  3LJA A;  2PYO C;  2Y2N A;  3MVD A;  4Z5T B;  4H9R B;  4J8U C;  1F1E A;  3O62 D;  3B6G C;  2RVQ C;  1P3A B;  3NQJ A;  5GT0 C;  2Y2M A;  3R45 B;  3AZL B;  4X23 C;  4E45 A;  3AL0 C;  3LZ1 A;  5BS7 C;  4EO5 C;  3AV2 A;  4WU8 C;  3AYW A;  3W98 C;  4H9P A;  1P3G A;  3AZF A;  2YFW A;  3W99 C;  5B40 D;  2ZY3 A;  5DNN D;  1B6W A;  5B0Z B;  5B40 B;  4J8X B;  1P3K C;  3UT9 C;  3TU4 D;  5BO0 B;  3X1T C;  5AV9 C;  1KX4 C;  4R8P B;  3UTB D;  4Z66 D;  5GSU D;  2Y2Q A;  4XZQ C;  4DQY B;  3C1C A;  3AV1 C;  2ZM5 A;  1W2E A;  3REJ A;  1P3O B;  2BYM B;  1KX3 A;  1P3F A;  1P3B A;  3WA9 D;  2ARO B;  3B0B A;  5E5A B;  4ZUX C;  1P3M A;  5KDM B;  3AZE C;  2IO5 C;  1P3A C;  4Z2M G;  5BNV B;  1TAF A;  3WAA B;  1P3P C;  5B31 A;  1M18 D;  3AZL C;  1M18 B;  3AFA B;  3X1U D;  3C1B A;  3MGQ C;  3X1U B;  3AYW D;  4J8W B;  4NE5 A;  3A6N A;  3REK B;  3AZM C;  3AZF D;  1AOI C;  2Y2G A;  5AVB B;  5B0Z C;  4WU9 D;  3LZ0 A;  4KUD A;  4WU9 B;  3AZN C;  5F99 B;  1Z2C B;  5CHL B;  1ID3 A;  2DQN C;  4YM6 C;  1U35 D;  3AZJ C;  1JFI A;  1EQZ C;  2Y2O A;  5DNM C;  5CPJ B;  4QLC C;  4H9S A;  3REJ D;  3MGP A;  1P3O C;  1KX5 B;  1F66 D;  3A1I A;  1P3B D;  2LY8 A;  4XUJ A;  5B2I B;  2BYK A;  4M6B A;  3KXB A;  3X1V A;  5B33 D;  1P3P A;  3WKJ B;  1P3L D;  5B32 A;  1P3L B;  3KWQ B;  3MGR C;  3AZK A;  1TZY D;  2FJ7 A;  5AVB C;  3WTP A;  3REI B;  2Y2P A;  5JA4 A;  2RIQ A;  5F99 C;  2Y2H A;  3LEL B;  3VH5 A;  4UPK A;  5AV8 B;  2W8S A;  2CV5 D;  5C3I B;  1HQ3 B;  3B6F B;  1M19 B;  5B0Y A;  5CPJ C;  4LD9 A;  3W97 B;  2HUE B;  4KGC D;  5CPI B;  3MNN A;  5AVC A;  3X1S A;  2VQR A;  5JRG C;  3AZH D;  3AN2 D;  1KU5 A;  5B32 G;  4G91 C;  4XUJ D;  5B1M A;  5AV6 A;  2L5A A;  5B2I C;  3KXB D;  4ZBJ B;  3AV2 C;  4NE3 A;  1P3G C;  5AY8 A;  3REL C;  3UTA C;  1P34 A;  2PYO B;  5AV5 A;  3WKJ C;  2DF4 C;  5B32 D;  1WWI A;  1BH8 A;  4J8U D;  3B6G D;  2FJ7 D;  3W96 D;  3REI C;  5GT0 B;  3P5J B;  3R45 A;  4X23 B;  4WU8 D;  1P3F C;  3W98 B;  1HQ3 C;  4WNN A;  3B6F C;  3W99 B;  1M1A C;  5B40 A;  5DNN A;  2HUE C;  1ZLA C;  3MNN D;  1P3K B;  2BG1 A;  3H0R C;  5AV9 D;  5BO0 A;  3UT9 B;  3X1T B;  5B31 C;  5AV9 B;  4R8P A;  3TU4 A;  1KX4 B;  4H9O B;  3V9R B;  3WTP E;  3UTB A;  4XZQ D;  2Y2K A;  3AZG C;  4ZBJ C;  3AV1 B;  5AY8 D;  1P34 D;  2NZD B;  4KUD C;  4Z5T D;  4DRA A;  5B2J C;  4ZUX D;  5E5A A;  3WA9 A;  4CAY A;  4ZUX B;  1P3A D;  5B24 C;  3AZE B;  2IO5 B;  4H9N A;  3VH6 T;  4CSR A;  3KUY C;  5BT1 C;  3WAA A;  4J8V B;  3AZL D;  1P3P B;  1M18 A;  3EPK A;  3AFA A;  3MGQ B;  3X1U A;  4J8W A;  3REK A;  3AZM D;  1AOI B;  3AZM B;  2Y2J A;  5B0Z D;  4J8X D;  4JJN C;  4WU9 A;  3AZN B;  3X1V C;  3REH C;  4R8P D;  3IP4 C;  4YM6 B;  3AZJ D;  3AZJ B;  1EQZ B;  1U35 A;  4KHA A;  5DNM B;  4QLC D;  4QLC B;  1P3I C;  2NZD C;  1P3O D;  3NQU B;  1F66 A;  2ARO D;  2ZY5 A;  5E5A D;  3VH6 W;  3WAA D;  5B0Y C;  2HIO C;  5B33 A;  1BH9 A;  4J8V C;  2NQB C;  3AZI C;  3AFA D;  5AVC C;  5GT3 C;  3KWQ A;  3MGR B;  3X1S C;  1P3L A;  4J8W D;  3REK D;  1HTA A;  4YS3 C;  5AVB D;  5CPK C;  1TZY A;  3MGS C;  1S32 C;  5F99 D;  5G49 B;  5CP6 B;  3LEL A;  5GXQ C;  3B0D C;  2CV5 A;  5CPJ D;  3O62 C;  5B1L C;  5CPI A;  4KGC A;  5JRG B;  1KX5 D;  3AZH A;  3AN2 A;  4G91 B;  5B2I D;  3LZ1 B;  3AV2 B;  3F6T A;  3REL D;  4H9P B;  1P3G B;  2YFW B;  3REL B;  3UTA B;  2PYO A;  3WKJ D;  2Y2I A;  5DNN C;  2G5H C;  3KWQ D;  4J8U A;  4NE6 A;  3TU4 C;  3B6G A;  5BNX A;  3UTB C;  4Z66 C;  3REI D;  5GSU C;  3W96 A;  3C1C B;  5GT0 A;  5CP6 C;  3LEL D;  3LJA C;  5AV8 D;  5BS7 A;  4WU8 A;  3MVD C;  1HQ3 D;  1KX3 B;  1P3F B;  3B6F D;  3W98 A;  1M19 D;  1M1A D;  3W99 A;  1P3M B;  3W97 D;  1M1A B;  3WA9 C;  5CPI D;  1ZLA B;  1P3K A;  3UT9 A;  5AV9 A;  5B31 B;  1KX4 A;  4H9O A;  3EPJ A;  4XZQ A;  3LZ1 C;  1BFM A;  3AZG B;  3AV1 A;  3AYW C;  3AZF C;  2PYO D;  2YFV B;  4KUD B;  4Z5T A;  5B2J B;  4H9R A;  1ID3 B;  2RVQ D;  4ZUX A;  5B24 B;  3AZE A;  4WZS B;  1P3A A;  3KUY D;  5BT1 D;  3C1C C;  5GT0 D;  3KUY B;  1H3O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...