3RELA

2.7 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3relA00
3W99B 3W97A 4G91C 1P3ID 5JRGD 1M1AA 3LELC 3WKJB 4J8XA 3REKA 3AZHB 4XUJC 3WAAD 2CV5D 5JA4A 3AZMD 3MGQA 1P3IB 5JRGB 5JRGC 1TAFA 1KU5A 3X1SA 1AOIC 5B40D 5F99D 3B0CT 1F66C 5CPJA 1TZYD 1ID3C 3WAAB 5B1LD 2CV5B 5AV9A 3AZMB 5BO0B 2F8ND 4H9SA 1P3OB 5FUGB 5GT3A 3AZGA 4X23C 3AN2C 2PYOB 5B40B 5F99B 5B40C 3AZLD 5CPKB 3AV2C 3WTPC 4J8UC 3AV1C 1S32D 2YFVA 3WA9A 1TZYB 3AZID 5CPID 5B1LB 2HIOD 5B33B 3AZFA 2F8NB 5BT1D 3UTAA 3AZJD 3REJA 1M18C 3VH5T 4JJND 3REHC 4Z5TA 3X1UD 3LJAD 1F1EA 1M19A 3AYWA 1N1JA 4WU9A 3X1VA 3AZLB 5DNNB 3UT9D 4AWLC 1S32B 5B1MD 1P3BA 3NQJB 3LZ0A 5CPIB 5AV6D 4J8WA 3AZIC 2HIOB 4HGAB 4EO5B 1P3GD 5CP6B 4WU8D 4XZQC 3TU4D 3MGSD 1P3MC 1U35D 5DNMD 4NE6A 3AZJB 3NQUB 4ZBJB 3W96A 4JJNB 3AZEC 3X1UC 3LJAB 2AROC 3MGQC 5B32D 5AY8A 3B0DC 3UT9B 5B1MB 1EQZD 5AV6B 5B2JA 4R8PA 1P3GB 5GT0A 3C1BA 4WU8B 2RVQD 3MGSB 3TU4B 3AZKA 4KUDB 1U35B 5DNMB 3KWQD 5B32B 3KSYA 1P3PA 3AZNC 1EQZB 3MGRD 1P3LA 4H9OB 2YFWB 3KXBD 3B6GD 5B2ID 3X1TA 3LZ1B 3KWQB 3KWQC 1P34D 3REIB 1HQ3A 3R45A 2HUEB 5B0YB 4Z66D 5BNVB 3MGRB 2FJ7A 1H3OA 2IO5B 3VH6A 4CAYB 5GSUC 3RELD 3KXBB 3B6GC 5B2IB 1ZLAA 1P34C 5E5AD 5B31A 3MGPA 3O62C 3A6NA 3W99A 4Z66B 4Z66C 3W98A 4ZUXD 4LD9A 3RELB 2NQBA 3WKJA 2NZDD 4R8PC 4H9QB 5AVCC 3MVDD 3KUYD 3AZHA 3MNND 5AV8B 5E5AB 3LELD 1P3PC 4G92C 2LY8A 1P3IA 4XUJD 4QLCC 4ZUXB 3AFAA 5B24B 2NZDB 5AVBC 3MVDB 3KUYB 3MNNB 3MNNC 3WAAA 4G91B 2CV5A 3AZMA 5BO0A 5CHLB 5KDMB 3LELB 1P3OA 5FUGA 1AOID 1F66D 5G49B 1BH8B 4XUJB 3UTBC 5C3IC 1KX3C 4WV4B 1JFIB 1ID3D 2PYOA 4UUZB 5F99A 5CPKA 4KGCA 4KHAB 1KX5C 1P3KD 1TZYA 5B1LA 5B33A 3B6FD 2F8NA 4X23D 1AOIB 3AN2D 1F66B 5BS7C 3MGPC 3AV2D 3WTPD 3A6NC 4J8UD 3AV1D 1ID3B 3VH5A 4LD9C 3AZLA 5DNNA 1S32A 1P3KB 3NQJA 1P3KC 5CPIA 1M18D 2HIOA 3REHD 3B6FC 5CP6A 2BYKB 4H9PB 4X23B 5GXQC 3AN2B 3AZJA 3NQUA 1M1AD 4JJNA 3AV2B 3WTPB 4J8UB 3AV1B 3LJAA 3C1CA 2BYMB 3AFAC 4XZQD 3KUYC 1KX4C 1P3MD 3UT9A 5B1MA 4J8VA 1M18B 1B67A 1A7WA 3REHB 3AZED 1P3GA 2AROD 3MGQD 3W97C 4KUDA 1U35A 5DNMA 1M1AB 1M1AC 4AWLB 4J8XC 3REKC 5B32A 3AZIB 5AV5A 4XZQB 1Q9CA 1P3MB 5JA4B 3VH6W 1WWSA 1EQZA 3AZEB 1P3FA 3X1UB 4H9OA 2AROB 3MGQB 2YFWA 4CSRB 3B0DB 3AZND 3X1SC 3LZ1A 3REIA 4WZSB 5CPJC 4NFTA 4YS3A 5AV9C 5B0YA 4H9SC 5BNVA 3MGRA 3REJD 5GT3C 3AZGC 4Z5TD 3AZNB 1M19D 5B2IA 3X1VD 1P3BD 4YM6A 3WA9C 1P3AA 5GSUD 3C1CC 3AZFC 3UTAC 3REJB 4DRBA 3REJC 3RELA 4WNNB 4M6BA 4H9QA 4Z5TC 3B0CW 5AY8D 1M19C 3O62D 1N1JB 3AYWC 4WU9C 5AV8A 3X1VC 1P3BB 1P3BC 3LZ0C 5GSUB 5B0ZA 4J8WC 4R8PD 5AVCD 3B6GB 3C1BD 5B24A 2NZDA 1B6WA 3W96C 1P34B 3MVDA 1P3FC 2F8NK 5AY8C 1P3PD 3O62B 4QLCD 5KDMA 3LELA 4R8PB 5AVCB 5B2JC 5AVBD 3C1BB 5GT0C 3C1BC 5G49A 3AZKC 3VH5W 1BH8A 4XUJA 1JFIA 1R4VA 4UUZA 4KHAA 1P3PB 4G92B 4QLCB 3UTBD 5JRGA 1KX3D 1AOIA 5AVBB 1F66A 1P3AC 1P3LC 5BNXB 1KX5D 3V9RB 1ID3A 1ZLAD 3X1TC 4Z2MH 2L5AA 1HQ3C 3R45B 4H9RB 3MGPD 3UTBB 2BYKA 4H9PA 5C3IB 3W99D 5B31G 3A6ND 1KX3B 2F8NH 3W98D 4X23A 3AN2A 4LD9D 3B0BA 5B40A 2FJ7C 2NQBD 3AV2A 3WTPA 1KX5B 3AV1A 3AZHD 2BYMA 1ZLAC 5GXQD 1M18A 5B31C 3REHA 3MGPB 1BH9B 3A6NB 3W99C 3W98B 3W98C 4LD9B 3AFAD 1KX4D 2NQBB 2NQBC 3WKJC 3AZHC 3AZIA 3B6FB 4XZQA 1P3MA 3W97D 5GXQB 1P3OD 1ULYA 3AZEA 4J8XD 3REKD 3X1UA 2AROA 4CSRA 4H9NB 1P3IC 3AFAB 1KX4B 2PYOD 4NE5A 5AV6A 5CPKD 4KGCD 4WU8A 3W97B 5B33D 3WAAC 3MGSA 4Z2MG 3TU4A 2CV5C 3AZMC 1P3OC 3X1SD 4J8XB 3REKB 2F8NG 3AZNA 5CPJD 5AV9D 2PYOC 5F99C 4DRAA 5DNND 4KGCB 5CPKC 4KGCC 1TZYC 5GT3D 5B1LC 5B33C 3AZGD 5CP6D 1TAFB 3X1SB 1BFMA 1HTAA 3KWQA 4WNNA 3WA9D 5CPJB 3C1CD 3AZFD 5AV9B 3AZLC 5DNNC 1S32C 2CWEA 4J8VD 3UTAD 5CPIC 5GSUA 4CAYA 5GT3B 3AZGB 2HIOC 4HGAC 4EO5C 3KXBA 3B6GA 5CP6C 4KUDD 3AYWD 5BT1C 3AZJC 4WU9D 4ZBJC 4JJNC 1P34A 3WA9B 2YFVB 3LZ0D 3LJAC 3C1CB 4J8WD 3AZFB 3O62A 5AV5D 4Z66A 5B32G 4NE3A 3UT9C 5B1MC 4J8VB 3UTAB 4J8VC 5AV6C 3W96D 5AVCA 1P3GC 1P3FD 4Z5TB 4WU8C 3TU4C 3MGSC 4KUDC 1M19B 1U35C 5DNMC 3AYWB 4WU9B 3X1VB 3LZ1D 5E5AA 3LZ0B 5B32C 4J8WB 3REID 5B2JD 5AV5B 5AV5C 5GT0D 3AZKD 4QLCA 4YS3D 4ZUXA 5B0YD 1EQZC 3W96B 5AVBA 1P3FB 3KUYA 3MNNA 2RVQC 5BNXA 5AY8B 3V9RA 1WWIA 2JSSA 3LZ1C 3REIC 5B2JB 4YM6D 5GT0B 1P3AD 1P3LD 3AZKB 4H9RA 3UTBA 4YS3B 2HUEC 4YS3C 1KX3A 5B0YC 3MGRC 3X1TD 2IO5C 1KX5A 3KXBC 4E45A 1HQ3D 5B2IC 5AV8D 4YM6B 4YM6C 2FJ7D 1P3AB 1P3LB 5B0ZD 5BS7A 1BH9A 3WTPE 3X1TB 5B24D 3RELC 1P3KA 1HQ3B 5B31D 3B6FA 3VH6T 5AV8C 5GXQA 2FJ7B 5E5AC 1H3OB 5B0ZB 5B0ZC 3WKJD 4J8UA 4H9NA 1ZLAB 4ZUXC 1KX4A 5B24C 4E44A 2NZDC 3MVDC 5B31B
chains in the Genus database with same CATH superfamily
3W99B 3W97A 4G91C 1P3ID 5JRGD 1M1AA 3LELC 3WKJB 4J8XA 3REKA 3AZHB 4XUJC 3WAAD 2CV5D 5JA4A 3AZMD 2Y2QA 2G5HC 3MGQA 1P3IB 5JRGB 5JRGC 3EPJA 1TAFA 1KU5A 3X1SA 1AOIC 5B40D 5F99D 3B0CT 1F66C 5CPJA 1TZYD 1ID3C 3WAAB 5B1LD 2CV5B 5AV9A 3AZMB 5BO0B 2F8ND 4H9SA 1P3OB 5FUGB 5GT3A 3AZGA 4X23C 3AN2C 2PYOB 5B40B 5F99B 5B40C 3AZLD 5CPKB 3AV2C 3WTPC 4J8UC 3AV1C 1S32D 2YFVA 3WA9A 1TZYB 3AZID 5CPID 5B33B 2HIOD 3H0MC 5B1LB 3AZFA 1PZRA 2F8NB 5BT1D 3UTAA 3AZJD 3REJA 1M18C 3VH5T 4JJND 3REHC 4Z5TA 3X1UD 3LJAD 1F1EA 1M19A 3AYWA 1N1JA 4DQYB 3X1VA 3AZLB 4WU9A 5DNNB 3UT9D 4AWLC 1S32B 2VQRA 5B1MD 1P3BA 3NQJB 3LZ0A 5CPIB 5AV6D 4J8WA 3AZIC 2HIOB 4HGAB 4EO5B 1P3GD 5CP6B 4WU8D 4XZQC 3TU4D 3MGSD 4UPKA 1P3MC 1U35D 5DNMD 4NE6A 3AZJB 3NQUB 4ZBJB 3W96A 4JJNB 3AZEC 3X1UC 3LJAB 2AROC 3MGQC 5B32D 5AY8A 3B0DC 3UT9B 5B1MB 1EQZD 5AV6B 5B2JA 4R8PA 1P3GB 5GT0A 3C1BA 4WU8B 2RVQD 3MGSB 2JCHA 2BG1A 3TU4B 3AZKA 4KUDB 1U35B 5DNMB 3KWQD 5B32B 3KSYA 1P3PA 3AZNC 3FDDA 1EQZB 3MGRD 1P3LA 4H9OB 2YFWB 3KXBD 3B6GD 5B2ID 3X1TA 3LZ1B 3KWQB 3KWQC 1P34D 3REIB 1HQ3A 3R45A 3P5JB 2HUEB 5B0YB 4Z66D 5BNVB 3MGRB 2FJ7A 1H3OA 2IO5B 3VH6A 4CAYB 5GSUC 3RELD 3KXBB 3B6GC 5B2IB 1ZLAA 1P34C 5E5AD 5B31A 3F6TA 3MGPA 3O62C 3A6NA 3W99A 4Z66B 4Z66C 3W98A 4ZUXD 4LD9A 3RELB 2NQBA 3WKJA 2NZDD 4R8PC 4H9QB 5AVCC 3MVDD 3KUYD 3AZHA 3MNND 5AV8B 2Y2NA 5E5AB 3LELD 1P3PC 4G92C 2LY8A 1P3IA 4XUJD 4QLCC 4ZUXB 3AFAA 5B24B 2NZDB 5AVBC 3MVDB 3KUYB 3MNNB 3MNNC 3WAAA 4G91B 2CV5A 3AZMA 5BO0A 5CHLB 5KDMB 3LELB 1P3OA 5FUGA 1AOID 1F66D 5G49B 1BH8B 4XUJB 3UTBC 5C3IC 1KX3C 4WV4B 1JFIB 1ID3D 3EG5B 2PYOA 5F99A 4UUZB 5CPKA 4KGCA 4KHAB 1KX5C 1P3KD 1TZYA 5B1LA 5B33A 1T3UA 3B6FD 2F8NA 4X23D 3KFUG 1AOIB 3AN2D 1F66B 5BS7C 3MGPC 3AV2D 3WTPD 3A6NC 4J8UD 3AV1D 1ID3B 3VH5A 4LD9C 3AZLA 2ZY2A 5DNNA 1S32A 1P3KB 3NQJA 1P3KC 5CPIA 1M18D 2HIOA 3REHD 3B6FC 5CP6A 2BYKB 4H9PB 4X23B 5GXQC 3AN2B 3AZJA 3NQUA 1M1AD 4JJNA 2RIQA 3WTPB 4J8UB 3AV2B 3AV1B 3LJAA 3C1CA 2BYMB 2W8SA 3AFAC 4XZQD 3KUYC 1KX4C 1P3MD 3UT9A 5B1MA 4J8VA 1M18B 1B67A 1A7WA 2F2AC 3REHB 3AZED 1P3GA 2AROD 3MGQD 3W97C 4KUDA 1U35A 5DNMA 1M1AB 1M1AC 4AWLB 4J8XC 3REKC 5B32A 3AZIB 3IP4C 2Y2LA 5AV5A 4XZQB 1Q9CA 1P3MB 5JA4B 3VH6W 1WWSA 1EQZA 3AZEB 1P3FA 3X1UB 4H9OA 2AROB 3MGQB 2YFWA 4CSRB 3B0DB 3AZND 3X1SC 3LZ1A 3REIA 4WZSB 5CPJC 4NFTA 4YS3A 5AV9C 5B0YA 4H9SC 5BNVA 2UWXA 3MGRA 3REJD 5GT3C 3AZGC 4Z5TD 3AZNB 2DF4C 1M19D 5B2IA 3X1VD 2Y2IA 1P3BD 4YM6A 3WA9C 1P3AA 5GSUD 3C1CC 3AZFC 3H0RC 3UTAC 3REJB 4DRBA 3REJC 3RELA 2FFFB 4WNNB 4M6BA 4H9QA 4Z5TC 3B0CW 5AY8D 1M19C 3O62D 1N1JB 3AYWC 4WU9C 5AV8A 3X1VC 1P3BB 2JE5A 1P3BC 3LZ0C 5GSUB 3AL0C 5B0ZA 4J8WC 4R8PD 5AVCD 3B6GB 3C1BD 3A1IA 5B24A 2NZDA 1B6WA 3W96C 1P34B 3MVDA 1P3FC 2F8NK 5AY8C 1P3PD 3O62B 4QLCD 5KDMA 3LELA 4R8PB 5AVCB 5B2JC 5AVBD 3C1BB 5GT0C 3C1BC 5G49A 3AZKC 3VH5W 1BH8A 4XUJA 1JFIA 1R4VA 4UUZA 4KHAA 2DQNC 1P3PB 4G92B 2G5IC 1Z2CB 4QLCB 3UTBD 5JRGA 1KX3D 1AOIA 5AVBB 1F66A 1P3AC 1P3LC 5BNXB 1KX5D 3V9RB 1ID3A 1ZLAD 3X1TC 4Z2MH 2L5AA 1HQ3C 2Y2GA 3R45B 4H9RB 3MGPD 3UTBB 2BYKA 4H9PA 5C3IB 3W99D 5B31G 3A6ND 1KX3B 2F8NH 3W98D 4X23A 3AN2A 4LD9D 3B0BA 5B40A 2FJ7C 2NQBD 3AV2A 3WTPA 1KX5B 3AV1A 3AZHD 2BYMA 1ZLAC 5GXQD 2ZY3A 1M18A 5B31C 3REHA 3MGPB 1BH9B 3A6NB 3W99C 3W98B 3W98C 4LD9B 3AFAD 1KX4D 2NQBB 2NQBC 3WKJC 3AZHC 3AZIA 3B6FB 4XZQA 1P3MA 3W97D 5GXQB 1P3OD 1ULYA 3AZEA 4J8XD 3REKD 3X1UA 2AROA 4CSRA 4H9NB 1P3IC 3AFAB 1KX4B 2PYOD 4NE5A 5AV6A 5CPKD 4KGCD 4WU8A 3W97B 5B33D 3WAAC 3MGSA 4Z2MG 3TU4A 2CV5C 3AZMC 4WJ3C 1P3OC 3X1SD 4J8XB 3REKB 2F8NG 3EPHA 3AZNA 5CPJD 5AV9D 2PYOC 5F99C 4DRAA 5DNND 4KGCB 5CPKC 2ZY5A 4KGCC 1TZYC 5GT3D 2XD1A 5B1LC 5B33C 3AZGD 5CP6D 1TAFB 3H0LC 3X1SB 1BFMA 1HTAA 3KWQA 4WNNA 3WA9D 5CPJB 3C1CD 3AZFD 5AV9B 3AZLC 5DNNC 2Y2HA 1S32C 2CWEA 4J8VD 3UTAD 5CPIC 5GSUA 4CAYA 5GT3B 3AZGB 2HIOC 4HGAC 4EO5C 3KXBA 3B6GA 5CP6C 4KUDD 3AYWD 5BT1C 3AZJC 4WU9D 4ZBJC 2XD5A 4JJNC 1P34A 3EPKA 3WA9B 2YFVB 3LZ0D 3LJAC 3C1CB 4J8WD 3AZFB 3O62A 5AV5D 4Z66A 5B32G 4NE3A 3UT9C 5B1MC 4J8VB 1W2EA 4J8VC 3UTAB 5AV6C 3W96D 5AVCA 1P3GC 1P3FD 4Z5TB 4WU8C 3TU4C 3MGSC 4KUDC 3A1KA 1M19B 1U35C 5DNMC 3AYWB 4WU9B 3X1VB 3LZ1D 5E5AA 3LZ0B 5B32C 4J8WB 3REID 5B2JD 5AV5B 5AV5C 5GT0D 3AZKD 4QLCA 4YS3D 3EPLA 4ZUXA 5B0YD 1EQZC 3W96B 5AVBA 1P3FB 3KUYA 3MNNA 2RVQC 5BNXA 5AY8B 3V9RA 1WWIA 2JSSA 3LZ1C 3REIC 5B2JB 4YM6D 2Y2KA 5GT0B 1P3AD 1P3LD 3AZKB 4H9RA 3UTBA 4YS3B 2HUEC 4YS3C 1KX3A 5B0YC 3MGRC 3X1TD 2IO5C 1KX5A 3KXBC 4E45A 1HQ3D 5B2IC 2Y2JA 5AV8D 2ZY4A 4YM6B 4YM6C 2FJ7D 1P3AB 2J8PA 1P3LB 5B0ZD 5BS7A 1BH9A 3WTPE 2Y2MA 3X1TB 5B24D 3RELC 1P3KA 1HQ3B 5B31D 3B6FA 3VH6T 5AV8C 5GXQA 2FJ7B 5E5AC 1H3OB 5B0ZB 5B0ZC 3WKJD 4J8UA 2Y2OA 2ZM5A 4H9NA 1ZLAB 4ZUXC 1KX4A 5B24C 4E44A 2NZDC 3MVDC 2Y2PA 5B31B
chains in the Genus database with same CATH topology
3W99B 3W97A 4G91C 1P3ID 5JRGD 1M1AA 3LELC 3WKJB 4J8XA 3REKA 3AZHB 4XUJC 3WAAD 2CV5D 5JA4A 3AZMD 2Y2QA 2G5HC 3MGQA 1P3IB 5JRGB 5JRGC 3EPJA 1TAFA 1KU5A 3X1SA 1AOIC 5B40D 5F99D 3B0CT 1F66C 5CPJA 1TZYD 1ID3C 3WAAB 5B1LD 2CV5B 5AV9A 3AZMB 5BO0B 2F8ND 4H9SA 1P3OB 5FUGB 5GT3A 3AZGA 4X23C 3AN2C 2PYOB 5B40B 5F99B 5B40C 3AZLD 5CPKB 3AV2C 3WTPC 4J8UC 3AV1C 1S32D 2YFVA 3WA9A 1TZYB 3AZID 5CPID 5B33B 2HIOD 3H0MC 5B1LB 3AZFA 1PZRA 2F8NB 5BT1D 3UTAA 3AZJD 3REJA 1M18C 3VH5T 4JJND 3REHC 4Z5TA 3X1UD 3LJAD 1F1EA 1M19A 3AYWA 1N1JA 4DQYB 3X1VA 3AZLB 4WU9A 5DNNB 3UT9D 4AWLC 1S32B 2VQRA 5B1MD 1P3BA 3NQJB 3LZ0A 5CPIB 5AV6D 4J8WA 3AZIC 2HIOB 4HGAB 4EO5B 1P3GD 5CP6B 4WU8D 4XZQC 3TU4D 3MGSD 4UPKA 1P3MC 1U35D 5DNMD 4NE6A 3AZJB 3NQUB 4ZBJB 3W96A 4JJNB 3AZEC 3X1UC 3LJAB 2AROC 3MGQC 5B32D 5AY8A 3B0DC 3UT9B 5B1MB 1EQZD 5AV6B 5B2JA 4R8PA 1P3GB 5GT0A 3C1BA 4WU8B 2RVQD 3MGSB 2JCHA 2BG1A 3TU4B 3AZKA 4KUDB 1U35B 5DNMB 3KWQD 5B32B 3KSYA 1P3PA 3AZNC 3FDDA 1EQZB 3MGRD 1P3LA 4H9OB 2YFWB 3KXBD 3B6GD 5B2ID 3X1TA 3LZ1B 3KWQB 3KWQC 1P34D 3REIB 1HQ3A 3R45A 3P5JB 2HUEB 5B0YB 4Z66D 5BNVB 3MGRB 2FJ7A 1H3OA 2IO5B 3VH6A 4CAYB 5GSUC 3RELD 3KXBB 3B6GC 5B2IB 1ZLAA 1P34C 5E5AD 5B31A 3F6TA 3MGPA 3O62C 3A6NA 3W99A 4Z66B 4Z66C 3W98A 4ZUXD 4LD9A 3RELB 2NQBA 3WKJA 2NZDD 4R8PC 4H9QB 5AVCC 3MVDD 3KUYD 3AZHA 3MNND 5AV8B 2Y2NA 5E5AB 3LELD 1P3PC 4G92C 2LY8A 1P3IA 4XUJD 4QLCC 4ZUXB 3AFAA 5B24B 2NZDB 5AVBC 3MVDB 3KUYB 3MNNB 3MNNC 3WAAA 4G91B 2CV5A 3AZMA 5BO0A 5CHLB 5KDMB 3LELB 1P3OA 5FUGA 1AOID 1F66D 5G49B 1BH8B 4XUJB 3UTBC 5C3IC 1KX3C 4WV4B 1JFIB 1ID3D 3EG5B 2PYOA 5F99A 4UUZB 5CPKA 4KGCA 4KHAB 1KX5C 1P3KD 1TZYA 5B1LA 5B33A 1T3UA 3B6FD 2F8NA 4X23D 3KFUG 1AOIB 3AN2D 1F66B 5BS7C 3MGPC 3AV2D 3WTPD 3A6NC 4J8UD 3AV1D 1ID3B 3VH5A 4LD9C 3AZLA 2ZY2A 5DNNA 1S32A 1P3KB 3NQJA 1P3KC 5CPIA 1M18D 2HIOA 3REHD 3B6FC 5CP6A 2BYKB 4H9PB 4X23B 5GXQC 3AN2B 3AZJA 3NQUA 1M1AD 4JJNA 2RIQA 3WTPB 4J8UB 3AV2B 3AV1B 3LJAA 3C1CA 2BYMB 2W8SA 3AFAC 4XZQD 3KUYC 1KX4C 1P3MD 3UT9A 5B1MA 4J8VA 1M18B 1B67A 1A7WA 2F2AC 3REHB 3AZED 1P3GA 2AROD 3MGQD 3W97C 4KUDA 1U35A 5DNMA 1M1AB 1M1AC 4AWLB 4J8XC 3REKC 5B32A 3AZIB 3IP4C 2Y2LA 5AV5A 4XZQB 1Q9CA 1P3MB 5JA4B 3VH6W 1WWSA 1EQZA 3AZEB 1P3FA 3X1UB 4H9OA 2AROB 3MGQB 2YFWA 4CSRB 3B0DB 3AZND 3X1SC 3LZ1A 3REIA 4WZSB 5CPJC 4NFTA 4YS3A 5AV9C 5B0YA 4H9SC 5BNVA 2UWXA 3MGRA 3REJD 5GT3C 3AZGC 4Z5TD 3AZNB 2DF4C 1M19D 5B2IA 3X1VD 2Y2IA 1P3BD 4YM6A 3WA9C 1P3AA 5GSUD 3C1CC 3AZFC 3H0RC 3UTAC 3REJB 4DRBA 3REJC 3RELA 2FFFB 4WNNB 4M6BA 4H9QA 4Z5TC 3B0CW 5AY8D 1M19C 3O62D 1N1JB 3AYWC 4WU9C 5AV8A 3X1VC 1P3BB 2JE5A 1P3BC 3LZ0C 5GSUB 3AL0C 5B0ZA 4J8WC 4R8PD 5AVCD 3B6GB 3C1BD 3A1IA 5B24A 2NZDA 1B6WA 3W96C 1P34B 3MVDA 1P3FC 2F8NK 5AY8C 1P3PD 3O62B 4QLCD 5KDMA 3LELA 4R8PB 5AVCB 5B2JC 5AVBD 3C1BB 5GT0C 3C1BC 5G49A 3AZKC 3VH5W 1BH8A 4XUJA 1JFIA 1R4VA 4UUZA 4KHAA 2DQNC 1P3PB 4G92B 2G5IC 1Z2CB 4QLCB 3UTBD 5JRGA 1KX3D 1AOIA 5AVBB 1F66A 1P3AC 1P3LC 5BNXB 1KX5D 3V9RB 1ID3A 1ZLAD 3X1TC 4Z2MH 2L5AA 1HQ3C 2Y2GA 3R45B 4H9RB 3MGPD 3UTBB 2BYKA 4H9PA 5C3IB 3W99D 5B31G 3A6ND 1KX3B 2F8NH 3W98D 4X23A 3AN2A 4LD9D 3B0BA 5B40A 2FJ7C 2NQBD 3AV2A 3WTPA 1KX5B 3AV1A 3AZHD 2BYMA 1ZLAC 5GXQD 2ZY3A 1M18A 5B31C 3REHA 3MGPB 1BH9B 3A6NB 3W99C 3W98B 3W98C 4LD9B 3AFAD 1KX4D 2NQBB 2NQBC 3WKJC 3AZHC 3AZIA 3B6FB 4XZQA 1P3MA 3W97D 5GXQB 1P3OD 1ULYA 3AZEA 4J8XD 3REKD 3X1UA 2AROA 4CSRA 4H9NB 1P3IC 3AFAB 1KX4B 2PYOD 4NE5A 5AV6A 5CPKD 4KGCD 4WU8A 3W97B 5B33D 3WAAC 3MGSA 4Z2MG 3TU4A 2CV5C 3AZMC 4WJ3C 1P3OC 3X1SD 4J8XB 3REKB 2F8NG 3EPHA 3AZNA 5CPJD 5AV9D 2PYOC 5F99C 4DRAA 5DNND 4KGCB 5CPKC 2ZY5A 4KGCC 1TZYC 5GT3D 2XD1A 5B1LC 5B33C 3AZGD 5CP6D 1TAFB 3H0LC 3X1SB 1BFMA 1HTAA 3KWQA 4WNNA 3WA9D 5CPJB 3C1CD 3AZFD 5AV9B 3AZLC 5DNNC 2Y2HA 1S32C 2CWEA 4J8VD 3UTAD 5CPIC 5GSUA 4CAYA 5GT3B 3AZGB 2HIOC 4HGAC 4EO5C 3KXBA 3B6GA 5CP6C 4KUDD 3AYWD 5BT1C 3AZJC 4WU9D 4ZBJC 2XD5A 4JJNC 1P34A 3EPKA 3WA9B 2YFVB 3LZ0D 3LJAC 3C1CB 4J8WD 3AZFB 3O62A 5AV5D 4Z66A 5B32G 4NE3A 3UT9C 5B1MC 4J8VB 1W2EA 4J8VC 3UTAB 5AV6C 3W96D 5AVCA 1P3GC 1P3FD 4Z5TB 4WU8C 3TU4C 3MGSC 4KUDC 3A1KA 1M19B 1U35C 5DNMC 3AYWB 4WU9B 3X1VB 3LZ1D 5E5AA 3LZ0B 5B32C 4J8WB 3REID 5B2JD 5AV5B 5AV5C 5GT0D 3AZKD 4QLCA 4YS3D 3EPLA 4ZUXA 5B0YD 1EQZC 3W96B 5AVBA 1P3FB 3KUYA 3MNNA 2RVQC 5BNXA 5AY8B 3V9RA 1WWIA 2JSSA 3LZ1C 3REIC 5B2JB 4YM6D 2Y2KA 5GT0B 1P3AD 1P3LD 3AZKB 4H9RA 3UTBA 4YS3B 2HUEC 4YS3C 1KX3A 5B0YC 3MGRC 3X1TD 2IO5C 1KX5A 3KXBC 4E45A 1HQ3D 5B2IC 2Y2JA 5AV8D 2ZY4A 4YM6B 4YM6C 2FJ7D 1P3AB 2J8PA 1P3LB 5B0ZD 5BS7A 1BH9A 3WTPE 2Y2MA 3X1TB 5B24D 3RELC 1P3KA 1HQ3B 5B31D 3B6FA 3VH6T 5AV8C 5GXQA 2FJ7B 5E5AC 1H3OB 5B0ZB 5B0ZC 3WKJD 4J8UA 2Y2OA 2ZM5A 4H9NA 1ZLAB 4ZUXC 1KX4A 5B24C 4E44A 2NZDC 3MVDC 2Y2PA 5B31B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W99 B;  3W97 A;  4G91 C;  1P3I D;  5JRG D;  1M1A A;  3LEL C;  3WKJ B;  4J8X A;  3REK A;  3AZH B;  4XUJ C;  3WAA D;  2CV5 D;  5JA4 A;  3AZM D;  3MGQ A;  1P3I B;  5JRG B;  5JRG C;  1TAF A;  1KU5 A;  3X1S A;  1AOI C;  5B40 D;  5F99 D;  3B0C T;  1F66 C;  5CPJ A;  1TZY D;  1ID3 C;  3WAA B;  5B1L D;  2CV5 B;  5AV9 A;  3AZM B;  5BO0 B;  2F8N D;  4H9S A;  1P3O B;  5FUG B;  5GT3 A;  3AZG A;  4X23 C;  3AN2 C;  2PYO B;  5B40 B;  5F99 B;  5B40 C;  3AZL D;  5CPK B;  3AV2 C;  3WTP C;  4J8U C;  3AV1 C;  1S32 D;  2YFV A;  3WA9 A;  1TZY B;  3AZI D;  5CPI D;  5B1L B;  2HIO D;  5B33 B;  3AZF A;  2F8N B;  5BT1 D;  3UTA A;  3AZJ D;  3REJ A;  1M18 C;  3VH5 T;  4JJN D;  3REH C;  4Z5T A;  3X1U D;  3LJA D;  1F1E A;  1M19 A;  3AYW A;  1N1J A;  4WU9 A;  3X1V A;  3AZL B;  5DNN B;  3UT9 D;  4AWL C;  1S32 B;  5B1M D;  1P3B A;  3NQJ B;  3LZ0 A;  5CPI B;  5AV6 D;  4J8W A;  3AZI C;  2HIO B;  4HGA B;  4EO5 B;  1P3G D;  5CP6 B;  4WU8 D;  4XZQ C;  3TU4 D;  3MGS D;  1P3M C;  1U35 D;  5DNM D;  4NE6 A;  3AZJ B;  3NQU B;  4ZBJ B;  3W96 A;  4JJN B;  3AZE C;  3X1U C;  3LJA B;  2ARO C;  3MGQ C;  5B32 D;  5AY8 A;  3B0D C;  3UT9 B;  5B1M B;  1EQZ D;  5AV6 B;  5B2J A;  4R8P A;  1P3G B;  5GT0 A;  3C1B A;  4WU8 B;  2RVQ D;  3MGS B;  3TU4 B;  3AZK A;  4KUD B;  1U35 B;  5DNM B;  3KWQ D;  5B32 B;  3KSY A;  1P3P A;  3AZN C;  1EQZ B;  3MGR D;  1P3L A;  4H9O B;  2YFW B;  3KXB D;  3B6G D;  5B2I D;  3X1T A;  3LZ1 B;  3KWQ B;  3KWQ C;  1P34 D;  3REI B;  1HQ3 A;  3R45 A;  2HUE B;  5B0Y B;  4Z66 D;  5BNV B;  3MGR B;  2FJ7 A;  1H3O A;  2IO5 B;  3VH6 A;  4CAY B;  5GSU C;  3REL D;  3KXB B;  3B6G C;  5B2I B;  1ZLA A;  1P34 C;  5E5A D;  5B31 A;  3MGP A;  3O62 C;  3A6N A;  3W99 A;  4Z66 B;  4Z66 C;  3W98 A;  4ZUX D;  4LD9 A;  3REL B;  2NQB A;  3WKJ A;  2NZD D;  4R8P C;  4H9Q B;  5AVC C;  3MVD D;  3KUY D;  3AZH A;  3MNN D;  5AV8 B;  5E5A B;  3LEL D;  1P3P C;  4G92 C;  2LY8 A;  1P3I A;  4XUJ D;  4QLC C;  4ZUX B;  3AFA A;  5B24 B;  2NZD B;  5AVB C;  3MVD B;  3KUY B;  3MNN B;  3MNN C;  3WAA A;  4G91 B;  2CV5 A;  3AZM A;  5BO0 A;  5CHL B;  5KDM B;  3LEL B;  1P3O A;  5FUG A;  1AOI D;  1F66 D;  5G49 B;  1BH8 B;  4XUJ B;  3UTB C;  5C3I C;  1KX3 C;  4WV4 B;  1JFI B;  1ID3 D;  2PYO A;  4UUZ B;  5F99 A;  5CPK A;  4KGC A;  4KHA B;  1KX5 C;  1P3K D;  1TZY A;  5B1L A;  5B33 A;  3B6F D;  2F8N A;  4X23 D;  1AOI B;  3AN2 D;  1F66 B;  5BS7 C;  3MGP C;  3AV2 D;  3WTP D;  3A6N C;  4J8U D;  3AV1 D;  1ID3 B;  3VH5 A;  4LD9 C;  3AZL A;  5DNN A;  1S32 A;  1P3K B;  3NQJ A;  1P3K C;  5CPI A;  1M18 D;  2HIO A;  3REH D;  3B6F C;  5CP6 A;  2BYK B;  4H9P B;  4X23 B;  5GXQ C;  3AN2 B;  3AZJ A;  3NQU A;  1M1A D;  4JJN A;  3AV2 B;  3WTP B;  4J8U B;  3AV1 B;  3LJA A;  3C1C A;  2BYM B;  3AFA C;  4XZQ D;  3KUY C;  1KX4 C;  1P3M D;  3UT9 A;  5B1M A;  4J8V A;  1M18 B;  1B67 A;  1A7W A;  3REH B;  3AZE D;  1P3G A;  2ARO D;  3MGQ D;  3W97 C;  4KUD A;  1U35 A;  5DNM A;  1M1A B;  1M1A C;  4AWL B;  4J8X C;  3REK C;  5B32 A;  3AZI B;  5AV5 A;  4XZQ B;  1Q9C A;  1P3M B;  5JA4 B;  3VH6 W;  1WWS A;  1EQZ A;  3AZE B;  1P3F A;  3X1U B;  4H9O A;  2ARO B;  3MGQ B;  2YFW A;  4CSR B;  3B0D B;  3AZN D;  3X1S C;  3LZ1 A;  3REI A;  4WZS B;  5CPJ C;  4NFT A;  4YS3 A;  5AV9 C;  5B0Y A;  4H9S C;  5BNV A;  3MGR A;  3REJ D;  5GT3 C;  3AZG C;  4Z5T D;  3AZN B;  1M19 D;  5B2I A;  3X1V D;  1P3B D;  4YM6 A;  3WA9 C;  1P3A A;  5GSU D;  3C1C C;  3AZF C;  3UTA C;  3REJ B;  4DRB A;  3REJ C;  3REL A;  4WNN B;  4M6B A;  4H9Q A;  4Z5T C;  3B0C W;  5AY8 D;  1M19 C;  3O62 D;  1N1J B;  3AYW C;  4WU9 C;  5AV8 A;  3X1V C;  1P3B B;  1P3B C;  3LZ0 C;  5GSU B;  5B0Z A;  4J8W C;  4R8P D;  5AVC D;  3B6G B;  3C1B D;  5B24 A;  2NZD A;  1B6W A;  3W96 C;  1P34 B;  3MVD A;  1P3F C;  2F8N K;  5AY8 C;  1P3P D;  3O62 B;  4QLC D;  5KDM A;  3LEL A;  4R8P B;  5AVC B;  5B2J C;  5AVB D;  3C1B B;  5GT0 C;  3C1B C;  5G49 A;  3AZK C;  3VH5 W;  1BH8 A;  4XUJ A;  1JFI A;  1R4V A;  4UUZ A;  4KHA A;  1P3P B;  4G92 B;  4QLC B;  3UTB D;  5JRG A;  1KX3 D;  1AOI A;  5AVB B;  1F66 A;  1P3A C;  1P3L C;  5BNX B;  1KX5 D;  3V9R B;  1ID3 A;  1ZLA D;  3X1T C;  4Z2M H;  2L5A A;  1HQ3 C;  3R45 B;  4H9R B;  3MGP D;  3UTB B;  2BYK A;  4H9P A;  5C3I B;  3W99 D;  5B31 G;  3A6N D;  1KX3 B;  2F8N H;  3W98 D;  4X23 A;  3AN2 A;  4LD9 D;  3B0B A;  5B40 A;  2FJ7 C;  2NQB D;  3AV2 A;  3WTP A;  1KX5 B;  3AV1 A;  3AZH D;  2BYM A;  1ZLA C;  5GXQ D;  1M18 A;  5B31 C;  3REH A;  3MGP B;  1BH9 B;  3A6N B;  3W99 C;  3W98 B;  3W98 C;  4LD9 B;  3AFA D;  1KX4 D;  2NQB B;  2NQB C;  3WKJ C;  3AZH C;  3AZI A;  3B6F B;  4XZQ A;  1P3M A;  3W97 D;  5GXQ B;  1P3O D;  1ULY A;  3AZE A;  4J8X D;  3REK D;  3X1U A;  2ARO A;  4CSR A;  4H9N B;  1P3I C;  3AFA B;  1KX4 B;  2PYO D;  4NE5 A;  5AV6 A;  5CPK D;  4KGC D;  4WU8 A;  3W97 B;  5B33 D;  3WAA C;  3MGS A;  4Z2M G;  3TU4 A;  2CV5 C;  3AZM C;  1P3O C;  3X1S D;  4J8X B;  3REK B;  2F8N G;  3AZN A;  5CPJ D;  5AV9 D;  2PYO C;  5F99 C;  4DRA A;  5DNN D;  4KGC B;  5CPK C;  4KGC C;  1TZY C;  5GT3 D;  5B1L C;  5B33 C;  3AZG D;  5CP6 D;  1TAF B;  3X1S B;  1BFM A;  1HTA A;  3KWQ A;  4WNN A;  3WA9 D;  5CPJ B;  3C1C D;  3AZF D;  5AV9 B;  3AZL C;  5DNN C;  1S32 C;  2CWE A;  4J8V D;  3UTA D;  5CPI C;  5GSU A;  4CAY A;  5GT3 B;  3AZG B;  2HIO C;  4HGA C;  4EO5 C;  3KXB A;  3B6G A;  5CP6 C;  4KUD D;  3AYW D;  5BT1 C;  3AZJ C;  4WU9 D;  4ZBJ C;  4JJN C;  1P34 A;  3WA9 B;  2YFV B;  3LZ0 D;  3LJA C;  3C1C B;  4J8W D;  3AZF B;  3O62 A;  5AV5 D;  4Z66 A;  5B32 G;  4NE3 A;  3UT9 C;  5B1M C;  4J8V B;  3UTA B;  4J8V C;  5AV6 C;  3W96 D;  5AVC A;  1P3G C;  1P3F D;  4Z5T B;  4WU8 C;  3TU4 C;  3MGS C;  4KUD C;  1M19 B;  1U35 C;  5DNM C;  3AYW B;  4WU9 B;  3X1V B;  3LZ1 D;  5E5A A;  3LZ0 B;  5B32 C;  4J8W B;  3REI D;  5B2J D;  5AV5 B;  5AV5 C;  5GT0 D;  3AZK D;  4QLC A;  4YS3 D;  4ZUX A;  5B0Y D;  1EQZ C;  3W96 B;  5AVB A;  1P3F B;  3KUY A;  3MNN A;  2RVQ C;  5BNX A;  5AY8 B;  3V9R A;  1WWI A;  2JSS A;  3LZ1 C;  3REI C;  5B2J B;  4YM6 D;  5GT0 B;  1P3A D;  1P3L D;  3AZK B;  4H9R A;  3UTB A;  4YS3 B;  2HUE C;  4YS3 C;  1KX3 A;  5B0Y C;  3MGR C;  3X1T D;  2IO5 C;  1KX5 A;  3KXB C;  4E45 A;  1HQ3 D;  5B2I C;  5AV8 D;  4YM6 B;  4YM6 C;  2FJ7 D;  1P3A B;  1P3L B;  5B0Z D;  5BS7 A;  1BH9 A;  3WTP E;  3X1T B;  5B24 D;  3REL C;  1P3K A;  1HQ3 B;  5B31 D;  3B6F A;  3VH6 T;  5AV8 C;  5GXQ A;  2FJ7 B;  5E5A C;  1H3O B;  5B0Z B;  5B0Z C;  3WKJ D;  4J8U A;  4H9N A;  1ZLA B;  4ZUX C;  1KX4 A;  5B24 C;  4E44 A;  2NZD C;  3MVD C;  5B31 B; 
#chains in the Genus database with same CATH topology
 3W99 B;  3W97 A;  4G91 C;  1P3I D;  5JRG D;  1M1A A;  3LEL C;  3WKJ B;  4J8X A;  3REK A;  3AZH B;  4XUJ C;  3WAA D;  2CV5 D;  5JA4 A;  3AZM D;  2Y2Q A;  2G5H C;  3MGQ A;  1P3I B;  5JRG B;  5JRG C;  3EPJ A;  1TAF A;  1KU5 A;  3X1S A;  1AOI C;  5B40 D;  5F99 D;  3B0C T;  1F66 C;  5CPJ A;  1TZY D;  1ID3 C;  3WAA B;  5B1L D;  2CV5 B;  5AV9 A;  3AZM B;  5BO0 B;  2F8N D;  4H9S A;  1P3O B;  5FUG B;  5GT3 A;  3AZG A;  4X23 C;  3AN2 C;  2PYO B;  5B40 B;  5F99 B;  5B40 C;  3AZL D;  5CPK B;  3AV2 C;  3WTP C;  4J8U C;  3AV1 C;  1S32 D;  2YFV A;  3WA9 A;  1TZY B;  3AZI D;  5CPI D;  5B33 B;  2HIO D;  3H0M C;  5B1L B;  3AZF A;  1PZR A;  2F8N B;  5BT1 D;  3UTA A;  3AZJ D;  3REJ A;  1M18 C;  3VH5 T;  4JJN D;  3REH C;  4Z5T A;  3X1U D;  3LJA D;  1F1E A;  1M19 A;  3AYW A;  1N1J A;  4DQY B;  3X1V A;  3AZL B;  4WU9 A;  5DNN B;  3UT9 D;  4AWL C;  1S32 B;  2VQR A;  5B1M D;  1P3B A;  3NQJ B;  3LZ0 A;  5CPI B;  5AV6 D;  4J8W A;  3AZI C;  2HIO B;  4HGA B;  4EO5 B;  1P3G D;  5CP6 B;  4WU8 D;  4XZQ C;  3TU4 D;  3MGS D;  4UPK A;  1P3M C;  1U35 D;  5DNM D;  4NE6 A;  3AZJ B;  3NQU B;  4ZBJ B;  3W96 A;  4JJN B;  3AZE C;  3X1U C;  3LJA B;  2ARO C;  3MGQ C;  5B32 D;  5AY8 A;  3B0D C;  3UT9 B;  5B1M B;  1EQZ D;  5AV6 B;  5B2J A;  4R8P A;  1P3G B;  5GT0 A;  3C1B A;  4WU8 B;  2RVQ D;  3MGS B;  2JCH A;  2BG1 A;  3TU4 B;  3AZK A;  4KUD B;  1U35 B;  5DNM B;  3KWQ D;  5B32 B;  3KSY A;  1P3P A;  3AZN C;  3FDD A;  1EQZ B;  3MGR D;  1P3L A;  4H9O B;  2YFW B;  3KXB D;  3B6G D;  5B2I D;  3X1T A;  3LZ1 B;  3KWQ B;  3KWQ C;  1P34 D;  3REI B;  1HQ3 A;  3R45 A;  3P5J B;  2HUE B;  5B0Y B;  4Z66 D;  5BNV B;  3MGR B;  2FJ7 A;  1H3O A;  2IO5 B;  3VH6 A;  4CAY B;  5GSU C;  3REL D;  3KXB B;  3B6G C;  5B2I B;  1ZLA A;  1P34 C;  5E5A D;  5B31 A;  3F6T A;  3MGP A;  3O62 C;  3A6N A;  3W99 A;  4Z66 B;  4Z66 C;  3W98 A;  4ZUX D;  4LD9 A;  3REL B;  2NQB A;  3WKJ A;  2NZD D;  4R8P C;  4H9Q B;  5AVC C;  3MVD D;  3KUY D;  3AZH A;  3MNN D;  5AV8 B;  2Y2N A;  5E5A B;  3LEL D;  1P3P C;  4G92 C;  2LY8 A;  1P3I A;  4XUJ D;  4QLC C;  4ZUX B;  3AFA A;  5B24 B;  2NZD B;  5AVB C;  3MVD B;  3KUY B;  3MNN B;  3MNN C;  3WAA A;  4G91 B;  2CV5 A;  3AZM A;  5BO0 A;  5CHL B;  5KDM B;  3LEL B;  1P3O A;  5FUG A;  1AOI D;  1F66 D;  5G49 B;  1BH8 B;  4XUJ B;  3UTB C;  5C3I C;  1KX3 C;  4WV4 B;  1JFI B;  1ID3 D;  3EG5 B;  2PYO A;  5F99 A;  4UUZ B;  5CPK A;  4KGC A;  4KHA B;  1KX5 C;  1P3K D;  1TZY A;  5B1L A;  5B33 A;  1T3U A;  3B6F D;  2F8N A;  4X23 D;  3KFU G;  1AOI B;  3AN2 D;  1F66 B;  5BS7 C;  3MGP C;  3AV2 D;  3WTP D;  3A6N C;  4J8U D;  3AV1 D;  1ID3 B;  3VH5 A;  4LD9 C;  3AZL A;  2ZY2 A;  5DNN A;  1S32 A;  1P3K B;  3NQJ A;  1P3K C;  5CPI A;  1M18 D;  2HIO A;  3REH D;  3B6F C;  5CP6 A;  2BYK B;  4H9P B;  4X23 B;  5GXQ C;  3AN2 B;  3AZJ A;  3NQU A;  1M1A D;  4JJN A;  2RIQ A;  3WTP B;  4J8U B;  3AV2 B;  3AV1 B;  3LJA A;  3C1C A;  2BYM B;  2W8S A;  3AFA C;  4XZQ D;  3KUY C;  1KX4 C;  1P3M D;  3UT9 A;  5B1M A;  4J8V A;  1M18 B;  1B67 A;  1A7W A;  2F2A C;  3REH B;  3AZE D;  1P3G A;  2ARO D;  3MGQ D;  3W97 C;  4KUD A;  1U35 A;  5DNM A;  1M1A B;  1M1A C;  4AWL B;  4J8X C;  3REK C;  5B32 A;  3AZI B;  3IP4 C;  2Y2L A;  5AV5 A;  4XZQ B;  1Q9C A;  1P3M B;  5JA4 B;  3VH6 W;  1WWS A;  1EQZ A;  3AZE B;  1P3F A;  3X1U B;  4H9O A;  2ARO B;  3MGQ B;  2YFW A;  4CSR B;  3B0D B;  3AZN D;  3X1S C;  3LZ1 A;  3REI A;  4WZS B;  5CPJ C;  4NFT A;  4YS3 A;  5AV9 C;  5B0Y A;  4H9S C;  5BNV A;  2UWX A;  3MGR A;  3REJ D;  5GT3 C;  3AZG C;  4Z5T D;  3AZN B;  2DF4 C;  1M19 D;  5B2I A;  3X1V D;  2Y2I A;  1P3B D;  4YM6 A;  3WA9 C;  1P3A A;  5GSU D;  3C1C C;  3AZF C;  3H0R C;  3UTA C;  3REJ B;  4DRB A;  3REJ C;  3REL A;  2FFF B;  4WNN B;  4M6B A;  4H9Q A;  4Z5T C;  3B0C W;  5AY8 D;  1M19 C;  3O62 D;  1N1J B;  3AYW C;  4WU9 C;  5AV8 A;  3X1V C;  1P3B B;  2JE5 A;  1P3B C;  3LZ0 C;  5GSU B;  3AL0 C;  5B0Z A;  4J8W C;  4R8P D;  5AVC D;  3B6G B;  3C1B D;  3A1I A;  5B24 A;  2NZD A;  1B6W A;  3W96 C;  1P34 B;  3MVD A;  1P3F C;  2F8N K;  5AY8 C;  1P3P D;  3O62 B;  4QLC D;  5KDM A;  3LEL A;  4R8P B;  5AVC B;  5B2J C;  5AVB D;  3C1B B;  5GT0 C;  3C1B C;  5G49 A;  3AZK C;  3VH5 W;  1BH8 A;  4XUJ A;  1JFI A;  1R4V A;  4UUZ A;  4KHA A;  2DQN C;  1P3P B;  4G92 B;  2G5I C;  1Z2C B;  4QLC B;  3UTB D;  5JRG A;  1KX3 D;  1AOI A;  5AVB B;  1F66 A;  1P3A C;  1P3L C;  5BNX B;  1KX5 D;  3V9R B;  1ID3 A;  1ZLA D;  3X1T C;  4Z2M H;  2L5A A;  1HQ3 C;  2Y2G A;  3R45 B;  4H9R B;  3MGP D;  3UTB B;  2BYK A;  4H9P A;  5C3I B;  3W99 D;  5B31 G;  3A6N D;  1KX3 B;  2F8N H;  3W98 D;  4X23 A;  3AN2 A;  4LD9 D;  3B0B A;  5B40 A;  2FJ7 C;  2NQB D;  3AV2 A;  3WTP A;  1KX5 B;  3AV1 A;  3AZH D;  2BYM A;  1ZLA C;  5GXQ D;  2ZY3 A;  1M18 A;  5B31 C;  3REH A;  3MGP B;  1BH9 B;  3A6N B;  3W99 C;  3W98 B;  3W98 C;  4LD9 B;  3AFA D;  1KX4 D;  2NQB B;  2NQB C;  3WKJ C;  3AZH C;  3AZI A;  3B6F B;  4XZQ A;  1P3M A;  3W97 D;  5GXQ B;  1P3O D;  1ULY A;  3AZE A;  4J8X D;  3REK D;  3X1U A;  2ARO A;  4CSR A;  4H9N B;  1P3I C;  3AFA B;  1KX4 B;  2PYO D;  4NE5 A;  5AV6 A;  5CPK D;  4KGC D;  4WU8 A;  3W97 B;  5B33 D;  3WAA C;  3MGS A;  4Z2M G;  3TU4 A;  2CV5 C;  3AZM C;  4WJ3 C;  1P3O C;  3X1S D;  4J8X B;  3REK B;  2F8N G;  3EPH A;  3AZN A;  5CPJ D;  5AV9 D;  2PYO C;  5F99 C;  4DRA A;  5DNN D;  4KGC B;  5CPK C;  2ZY5 A;  4KGC C;  1TZY C;  5GT3 D;  2XD1 A;  5B1L C;  5B33 C;  3AZG D;  5CP6 D;  1TAF B;  3H0L C;  3X1S B;  1BFM A;  1HTA A;  3KWQ A;  4WNN A;  3WA9 D;  5CPJ B;  3C1C D;  3AZF D;  5AV9 B;  3AZL C;  5DNN C;  2Y2H A;  1S32 C;  2CWE A;  4J8V D;  3UTA D;  5CPI C;  5GSU A;  4CAY A;  5GT3 B;  3AZG B;  2HIO C;  4HGA C;  4EO5 C;  3KXB A;  3B6G A;  5CP6 C;  4KUD D;  3AYW D;  5BT1 C;  3AZJ C;  4WU9 D;  4ZBJ C;  2XD5 A;  4JJN C;  1P34 A;  3EPK A;  3WA9 B;  2YFV B;  3LZ0 D;  3LJA C;  3C1C B;  4J8W D;  3AZF B;  3O62 A;  5AV5 D;  4Z66 A;  5B32 G;  4NE3 A;  3UT9 C;  5B1M C;  4J8V B;  1W2E A;  4J8V C;  3UTA B;  5AV6 C;  3W96 D;  5AVC A;  1P3G C;  1P3F D;  4Z5T B;  4WU8 C;  3TU4 C;  3MGS C;  4KUD C;  3A1K A;  1M19 B;  1U35 C;  5DNM C;  3AYW B;  4WU9 B;  3X1V B;  3LZ1 D;  5E5A A;  3LZ0 B;  5B32 C;  4J8W B;  3REI D;  5B2J D;  5AV5 B;  5AV5 C;  5GT0 D;  3AZK D;  4QLC A;  4YS3 D;  3EPL A;  4ZUX A;  5B0Y D;  1EQZ C;  3W96 B;  5AVB A;  1P3F B;  3KUY A;  3MNN A;  2RVQ C;  5BNX A;  5AY8 B;  3V9R A;  1WWI A;  2JSS A;  3LZ1 C;  3REI C;  5B2J B;  4YM6 D;  2Y2K A;  5GT0 B;  1P3A D;  1P3L D;  3AZK B;  4H9R A;  3UTB A;  4YS3 B;  2HUE C;  4YS3 C;  1KX3 A;  5B0Y C;  3MGR C;  3X1T D;  2IO5 C;  1KX5 A;  3KXB C;  4E45 A;  1HQ3 D;  5B2I C;  2Y2J A;  5AV8 D;  2ZY4 A;  4YM6 B;  4YM6 C;  2FJ7 D;  1P3A B;  2J8P A;  1P3L B;  5B0Z D;  5BS7 A;  1BH9 A;  3WTP E;  2Y2M A;  3X1T B;  5B24 D;  3REL C;  1P3K A;  1HQ3 B;  5B31 D;  3B6F A;  3VH6 T;  5AV8 C;  5GXQ A;  2FJ7 B;  5E5A C;  1H3O B;  5B0Z B;  5B0Z C;  3WKJ D;  4J8U A;  2Y2O A;  2ZM5 A;  4H9N A;  1ZLA B;  4ZUX C;  1KX4 A;  5B24 C;  4E44 A;  2NZD C;  3MVD C;  2Y2P A;  5B31 B; 
#chains in the Genus database with same CATH homology
 3W99 B;  3W97 A;  4G91 C;  1P3I D;  5JRG D;  1M1A A;  3LEL C;  3WKJ B;  4J8X A;  3REK A;  3AZH B;  4XUJ C;  3WAA D;  2CV5 D;  5JA4 A;  3AZM D;  2Y2Q A;  2G5H C;  3MGQ A;  1P3I B;  5JRG B;  5JRG C;  3EPJ A;  1TAF A;  1KU5 A;  3X1S A;  1AOI C;  5B40 D;  5F99 D;  3B0C T;  1F66 C;  5CPJ A;  1TZY D;  1ID3 C;  3WAA B;  5B1L D;  2CV5 B;  5AV9 A;  3AZM B;  5BO0 B;  2F8N D;  4H9S A;  1P3O B;  5FUG B;  5GT3 A;  3AZG A;  4X23 C;  3AN2 C;  2PYO B;  5B40 B;  5F99 B;  5B40 C;  3AZL D;  5CPK B;  3AV2 C;  3WTP C;  4J8U C;  3AV1 C;  1S32 D;  2YFV A;  3WA9 A;  1TZY B;  3AZI D;  5CPI D;  5B33 B;  2HIO D;  3H0M C;  5B1L B;  3AZF A;  1PZR A;  2F8N B;  5BT1 D;  3UTA A;  3AZJ D;  3REJ A;  1M18 C;  3VH5 T;  4JJN D;  3REH C;  4Z5T A;  3X1U D;  3LJA D;  1F1E A;  1M19 A;  3AYW A;  1N1J A;  4DQY B;  3X1V A;  3AZL B;  4WU9 A;  5DNN B;  3UT9 D;  4AWL C;  1S32 B;  2VQR A;  5B1M D;  1P3B A;  3NQJ B;  3LZ0 A;  5CPI B;  5AV6 D;  4J8W A;  3AZI C;  2HIO B;  4HGA B;  4EO5 B;  1P3G D;  5CP6 B;  4WU8 D;  4XZQ C;  3TU4 D;  3MGS D;  4UPK A;  1P3M C;  1U35 D;  5DNM D;  4NE6 A;  3AZJ B;  3NQU B;  4ZBJ B;  3W96 A;  4JJN B;  3AZE C;  3X1U C;  3LJA B;  2ARO C;  3MGQ C;  5B32 D;  5AY8 A;  3B0D C;  3UT9 B;  5B1M B;  1EQZ D;  5AV6 B;  5B2J A;  4R8P A;  1P3G B;  5GT0 A;  3C1B A;  4WU8 B;  2RVQ D;  3MGS B;  2JCH A;  2BG1 A;  3TU4 B;  3AZK A;  4KUD B;  1U35 B;  5DNM B;  3KWQ D;  5B32 B;  3KSY A;  1P3P A;  3AZN C;  3FDD A;  1EQZ B;  3MGR D;  1P3L A;  4H9O B;  2YFW B;  3KXB D;  3B6G D;  5B2I D;  3X1T A;  3LZ1 B;  3KWQ B;  3KWQ C;  1P34 D;  3REI B;  1HQ3 A;  3R45 A;  3P5J B;  2HUE B;  5B0Y B;  4Z66 D;  5BNV B;  3MGR B;  2FJ7 A;  1H3O A;  2IO5 B;  3VH6 A;  4CAY B;  5GSU C;  3REL D;  3KXB B;  3B6G C;  5B2I B;  1ZLA A;  1P34 C;  5E5A D;  5B31 A;  3F6T A;  3MGP A;  3O62 C;  3A6N A;  3W99 A;  4Z66 B;  4Z66 C;  3W98 A;  4ZUX D;  4LD9 A;  3REL B;  2NQB A;  3WKJ A;  2NZD D;  4R8P C;  4H9Q B;  5AVC C;  3MVD D;  3KUY D;  3AZH A;  3MNN D;  5AV8 B;  2Y2N A;  5E5A B;  3LEL D;  1P3P C;  4G92 C;  2LY8 A;  1P3I A;  4XUJ D;  4QLC C;  4ZUX B;  3AFA A;  5B24 B;  2NZD B;  5AVB C;  3MVD B;  3KUY B;  3MNN B;  3MNN C;  3WAA A;  4G91 B;  2CV5 A;  3AZM A;  5BO0 A;  5CHL B;  5KDM B;  3LEL B;  1P3O A;  5FUG A;  1AOI D;  1F66 D;  5G49 B;  1BH8 B;  4XUJ B;  3UTB C;  5C3I C;  1KX3 C;  4WV4 B;  1JFI B;  1ID3 D;  3EG5 B;  2PYO A;  5F99 A;  4UUZ B;  5CPK A;  4KGC A;  4KHA B;  1KX5 C;  1P3K D;  1TZY A;  5B1L A;  5B33 A;  1T3U A;  3B6F D;  2F8N A;  4X23 D;  3KFU G;  1AOI B;  3AN2 D;  1F66 B;  5BS7 C;  3MGP C;  3AV2 D;  3WTP D;  3A6N C;  4J8U D;  3AV1 D;  1ID3 B;  3VH5 A;  4LD9 C;  3AZL A;  2ZY2 A;  5DNN A;  1S32 A;  1P3K B;  3NQJ A;  1P3K C;  5CPI A;  1M18 D;  2HIO A;  3REH D;  3B6F C;  5CP6 A;  2BYK B;  4H9P B;  4X23 B;  5GXQ C;  3AN2 B;  3AZJ A;  3NQU A;  1M1A D;  4JJN A;  2RIQ A;  3WTP B;  4J8U B;  3AV2 B;  3AV1 B;  3LJA A;  3C1C A;  2BYM B;  2W8S A;  3AFA C;  4XZQ D;  3KUY C;  1KX4 C;  1P3M D;  3UT9 A;  5B1M A;  4J8V A;  1M18 B;  1B67 A;  1A7W A;  2F2A C;  3REH B;  3AZE D;  1P3G A;  2ARO D;  3MGQ D;  3W97 C;  4KUD A;  1U35 A;  5DNM A;  1M1A B;  1M1A C;  4AWL B;  4J8X C;  3REK C;  5B32 A;  3AZI B;  3IP4 C;  2Y2L A;  5AV5 A;  4XZQ B;  1Q9C A;  1P3M B;  5JA4 B;  3VH6 W;  1WWS A;  1EQZ A;  3AZE B;  1P3F A;  3X1U B;  4H9O A;  2ARO B;  3MGQ B;  2YFW A;  4CSR B;  3B0D B;  3AZN D;  3X1S C;  3LZ1 A;  3REI A;  4WZS B;  5CPJ C;  4NFT A;  4YS3 A;  5AV9 C;  5B0Y A;  4H9S C;  5BNV A;  2UWX A;  3MGR A;  3REJ D;  5GT3 C;  3AZG C;  4Z5T D;  3AZN B;  2DF4 C;  1M19 D;  5B2I A;  3X1V D;  2Y2I A;  1P3B D;  4YM6 A;  3WA9 C;  1P3A A;  5GSU D;  3C1C C;  3AZF C;  3H0R C;  3UTA C;  3REJ B;  4DRB A;  3REJ C;  3REL A;  2FFF B;  4WNN B;  4M6B A;  4H9Q A;  4Z5T C;  3B0C W;  5AY8 D;  1M19 C;  3O62 D;  1N1J B;  3AYW C;  4WU9 C;  5AV8 A;  3X1V C;  1P3B B;  2JE5 A;  1P3B C;  3LZ0 C;  5GSU B;  3AL0 C;  5B0Z A;  4J8W C;  4R8P D;  5AVC D;  3B6G B;  3C1B D;  3A1I A;  5B24 A;  2NZD A;  1B6W A;  3W96 C;  1P34 B;  3MVD A;  1P3F C;  2F8N K;  5AY8 C;  1P3P D;  3O62 B;  4QLC D;  5KDM A;  3LEL A;  4R8P B;  5AVC B;  5B2J C;  5AVB D;  3C1B B;  5GT0 C;  3C1B C;  5G49 A;  3AZK C;  3VH5 W;  1BH8 A;  4XUJ A;  1JFI A;  1R4V A;  4UUZ A;  4KHA A;  2DQN C;  1P3P B;  4G92 B;  2G5I C;  1Z2C B;  4QLC B;  3UTB D;  5JRG A;  1KX3 D;  1AOI A;  5AVB B;  1F66 A;  1P3A C;  1P3L C;  5BNX B;  1KX5 D;  3V9R B;  1ID3 A;  1ZLA D;  3X1T C;  4Z2M H;  2L5A A;  1HQ3 C;  2Y2G A;  3R45 B;  4H9R B;  3MGP D;  3UTB B;  2BYK A;  4H9P A;  5C3I B;  3W99 D;  5B31 G;  3A6N D;  1KX3 B;  2F8N H;  3W98 D;  4X23 A;  3AN2 A;  4LD9 D;  3B0B A;  5B40 A;  2FJ7 C;  2NQB D;  3AV2 A;  3WTP A;  1KX5 B;  3AV1 A;  3AZH D;  2BYM A;  1ZLA C;  5GXQ D;  2ZY3 A;  1M18 A;  5B31 C;  3REH A;  3MGP B;  1BH9 B;  3A6N B;  3W99 C;  3W98 B;  3W98 C;  4LD9 B;  3AFA D;  1KX4 D;  2NQB B;  2NQB C;  3WKJ C;  3AZH C;  3AZI A;  3B6F B;  4XZQ A;  1P3M A;  3W97 D;  5GXQ B;  1P3O D;  1ULY A;  3AZE A;  4J8X D;  3REK D;  3X1U A;  2ARO A;  4CSR A;  4H9N B;  1P3I C;  3AFA B;  1KX4 B;  2PYO D;  4NE5 A;  5AV6 A;  5CPK D;  4KGC D;  4WU8 A;  3W97 B;  5B33 D;  3WAA C;  3MGS A;  4Z2M G;  3TU4 A;  2CV5 C;  3AZM C;  4WJ3 C;  1P3O C;  3X1S D;  4J8X B;  3REK B;  2F8N G;  3EPH A;  3AZN A;  5CPJ D;  5AV9 D;  2PYO C;  5F99 C;  4DRA A;  5DNN D;  4KGC B;  5CPK C;  2ZY5 A;  4KGC C;  1TZY C;  5GT3 D;  2XD1 A;  5B1L C;  5B33 C;  3AZG D;  5CP6 D;  1TAF B;  3H0L C;  3X1S B;  1BFM A;  1HTA A;  3KWQ A;  4WNN A;  3WA9 D;  5CPJ B;  3C1C D;  3AZF D;  5AV9 B;  3AZL C;  5DNN C;  2Y2H A;  1S32 C;  2CWE A;  4J8V D;  3UTA D;  5CPI C;  5GSU A;  4CAY A;  5GT3 B;  3AZG B;  2HIO C;  4HGA C;  4EO5 C;  3KXB A;  3B6G A;  5CP6 C;  4KUD D;  3AYW D;  5BT1 C;  3AZJ C;  4WU9 D;  4ZBJ C;  2XD5 A;  4JJN C;  1P34 A;  3EPK A;  3WA9 B;  2YFV B;  3LZ0 D;  3LJA C;  3C1C B;  4J8W D;  3AZF B;  3O62 A;  5AV5 D;  4Z66 A;  5B32 G;  4NE3 A;  3UT9 C;  5B1M C;  4J8V B;  1W2E A;  4J8V C;  3UTA B;  5AV6 C;  3W96 D;  5AVC A;  1P3G C;  1P3F D;  4Z5T B;  4WU8 C;  3TU4 C;  3MGS C;  4KUD C;  3A1K A;  1M19 B;  1U35 C;  5DNM C;  3AYW B;  4WU9 B;  3X1V B;  3LZ1 D;  5E5A A;  3LZ0 B;  5B32 C;  4J8W B;  3REI D;  5B2J D;  5AV5 B;  5AV5 C;  5GT0 D;  3AZK D;  4QLC A;  4YS3 D;  3EPL A;  4ZUX A;  5B0Y D;  1EQZ C;  3W96 B;  5AVB A;  1P3F B;  3KUY A;  3MNN A;  2RVQ C;  5BNX A;  5AY8 B;  3V9R A;  1WWI A;  2JSS A;  3LZ1 C;  3REI C;  5B2J B;  4YM6 D;  2Y2K A;  5GT0 B;  1P3A D;  1P3L D;  3AZK B;  4H9R A;  3UTB A;  4YS3 B;  2HUE C;  4YS3 C;  1KX3 A;  5B0Y C;  3MGR C;  3X1T D;  2IO5 C;  1KX5 A;  3KXB C;  4E45 A;  1HQ3 D;  5B2I C;  2Y2J A;  5AV8 D;  2ZY4 A;  4YM6 B;  4YM6 C;  2FJ7 D;  1P3A B;  2J8P A;  1P3L B;  5B0Z D;  5BS7 A;  1BH9 A;  3WTP E;  2Y2M A;  3X1T B;  5B24 D;  3REL C;  1P3K A;  1HQ3 B;  5B31 D;  3B6F A;  3VH6 T;  5AV8 C;  5GXQ A;  2FJ7 B;  5E5A C;  1H3O B;  5B0Z B;  5B0Z C;  3WKJ D;  4J8U A;  2Y2O A;  2ZM5 A;  4H9N A;  1ZLA B;  4ZUX C;  1KX4 A;  5B24 C;  4E44 A;  2NZD C;  3MVD C;  2Y2P A;  5B31 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...