3RELA

2.7 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 33
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3relA00
5C3IC 3X1VB 3MGSB 5AV9D 4ZUXD 4CAYB 5B40D 3UT9D 1S32D 1EQZD 5AV5C 4J8VC 1WWSA 5GXQB 5B40C 2BYMB 3AZKB 4UUZB 3NQJB 5B31A 5B1MC 1ZLAA 4WV4B 3TU4D 3C1BD 3W96C 5DNMA 5CP6C 4H9NA 4DRAA 1Q9CA 3W98A 4KGCA 5B0ZC 1M1AA 4NE6A 5CP6A 1F66D 4KGCC 4KHAB 5E5AA 5B0ZD 2AROB 1P3ID 1KX5C 2LY8A 3WAAC 4J8UC 3AYWD 5CHLB 5AV6A 5AV5B 4J8VB 1BH8A 5DNNA 3REHC 1U35C 5GXQC 5B40B 3KUYB 3KWQB 4J8UD 3VH6A 4KUDA 5B32B 5B33B 1P3GD 5CPKD 3LZ0A 1KX5B 1AOIA 4X23D 2CV5A 3W99A 1S32A 3LELA 4ZBJC 1KX3D 5BNXA 5GT0C 3AZFA 4H9PB 4YS3C 1TZYC 4WU8B 3AZEA 1HQ3D 3AZGB 2RVQC 2YFWA 1P34B 2F8NK 3NQUB 3X1UA 1JFIB 5JA4B 3MNNA 4Z66A 3REHB 3W97B 5BS7A 2CWEA 5BT1D 4QLCD 4H9QB 3WTPD 4Z5TB 2HUEB 3AYWA 2HIOB 4J8UA 2IO5C 3C1CC 1P3OB 4YS3B 5B0YB 1F1EA 3LJAB 1P3LA 3C1CD 5AV8B 3AV1C 2PYOD 3KXBD 3UTBA 5B1LB 3X1TB 3TU4A 3V9RB 5B24A 3LJAC 2HUEC 3X1VC 4X23B 4YM6A 3AZLA 4WU9A 1P3BC 1M19B 2NZDB 3B6GC 2F8NH 3LZ1A 3O62A 3KUYC 1P3BD 5CP6D 4E45A 4LD9A 5CPJD 3WTPA 3AZJB 4HGAC 3AZHC 3AN2C 4H9RA 3R45A 5B2IA 5AVBD 5BO0B 3REIC 5CPJC 1P3GA 5B1MB 5AV9A 3UTAA 3WKJC 1A7WA 3C1CA 4EO5B 3MVDB 5GT0D 4J8WD 5AY8B 3B6GB 4ZUXA 3W99D 1P3IB 4DRBA 2NZDD 4X23C 4J8WC 3AZFC 1BH9A 5DNMD 3MNNC 4KGCD 5B1MA 3AZLD 3KWQC 4Z66D 3B0CT 5AVBB 5FUGB 3X1UD 4NE5A 3R45B 5B2IB 1P3BA 3WTPB 1R4VA 1F66A 4LD9B 3VH6T 3AV2D 2FJ7B 5F99A 3O62B 1M19D 4XZQD 3AZMD 1P3LD 3AZGD 3AV2C 4X23A 3AZKC 1P3PD 5B24B 1P3LC 4JJNC 5C3IB 5AVCA 5G49B 1P3MA 2NQBA 3KXBA 3X1TA 3AZNA 5B31G 5G49A 3B6FD 5B31C 3UTBB 3C1BB 3MGQC 1H3OA 1H3OB 5B0YA 4XUJB 3AZEC 4YS3A 3AZIC 3LJAD 5B1LC 1F66C 5B0YC 4WU9D 4LD9C 2HIOA 3A6NC 3AZNB 2FJ7A 3AV1B 4Z5TA 3AYWB 1EQZB 3WTPE 5AV8C 5AVCB 5B1LD 5GXQD 3REID 3W97A 5B32C 5B33C 4Z66B 5FUGA 1KX4D 5AVBA 1EQZC 3AV2B 4NE3A 4WU8A 5F99B 5B2JD 2CV5C 4G92B 1F66B 4JJND 4J8WA 5B0ZB 4ZUXB 4M6BA 5AY8A 3LELB 3TU4C 3VH6W 2YFVB 1AOIB 1P34D 3UTAB 1KX5A 1P3GB 1BH9B 2YFVA 4H9RB 3W98C 1M18D 3B0DB 5B0ZA 1M1AC 4J8WB 1P3IA 2FJ7D 3B6GA 4Z66C 4Z5TD 3O62D 3MVDA 3WA9D 1P3IC 5E5AB 3AV2A 1B67A 4KHAA 5AV9B 5CPKC 4J8XC 1ID3C 1P3OD 4WU9B 1M19A 3W98B 2JSSA 4KGCB 5BO0A 3AZLB 1U35D 5AVCD 3VH5T 3X1TC 1AOID 3TU4B 4UUZA 1EQZA 3AZKA 3AV1A 3WKJD 5B31D 1P3KD 1HQ3C 2NZDA 3AZED 4XUJA 3X1VA 5B24C 4Z2MG 3LJAA 1P3LB 3C1BA 2HIOC 2BYKB 3V9RA 3REKC 3KUYD 4J8UB 1P3AC 3AZIA 5B1LA 1M19C 3KXBB 3REKD 1P3AD 4H9QA 1P3MB 2NQBB 3RELC 3REHA 4H9OB 1KX4C 3MVDC 1P3OA 3MGPD 3AZJC 4XZQC 2YFWB 3AZGA 3UT9A 3AZEB 4WU8D 4H9PA 4XUJC 3MGRD 3AZFB 1P3BB 2NZDC 3AV1D 2PYOC 3REJB 1P3MC 1S32B 2NQBC 5JA4A 3MNNB 3B6FC 3LZ1C 1HTAA 1P3FD 1WWIA 4NFTA 1P34A 4H9SA 3A6ND 5DNNC 5B32A 5B33A 3W97C 1P34C 3KWQA 3O62C 3KUYA 1M1AD 3AZID 3VH5W 2FJ7C 5BNXB 5E5AD 3W99B 2AROA 3C1CB 5CP6B 3MGSD 4E44A 4ZUXC 3LZ0D 5DNMB 4ZBJB 5B40A 3AZJA 1BH8B 5DNNB 5B31B 5AV5A 3NQJA 5AV6B 4J8VA 3REJC 3UTBC 1ZLAC 2BYMA 3B0DC 3LZ1B 1TZYD 3W96A 5DNMC 1M1AB 1KX3B 5KDMA 4YM6B 4EO5C 3AFAC 3X1VD 3X1UC 3AYWC 3KWQD 3MNND 4QLCA 3AZLC 4WNNA 4CAYA 5JRGB 5AV8A 1B6WA 4Z2MH 3REHD 2F8NB 3MVDD 5F99C 5AVBC 5CPIC 3LZ0C 4R8PD 3WAAB 5B2JC 2CV5D 1S32C 3MGQA 5AV5D 4J8VD 4AWLB 3REJD 1P3PC 1P3KA 3AZND 3AFAA 5B24D 3AZKD 3WKJA 3AZNC 1JFIA 3NQUA 3X1UB 3A6NA 1KX4B 3MGPB 1P3FA 2L5AA 5JRGD 3AZHA 5BS7C 4AWLC 3AN2A 3LZ1D 2F8ND 1P3FC 5BNVB 5E5AC 3X1SD 2HIOD 5CPJA 5B2JB 2AROD 3MGRB 3WAAD 3WA9B 4JJNB 4XZQA 2CV5B 4J8XD 5CPIA 5AV8D 1ID3D 3LZ0B 2PYOB 1P3FB 1U35B 3UTAD 1P3PA 3AZJD 3B0CW 5AY8C 4KUDB 3A6NB 1AOIC 5GSUA 3MGPC 3W99C 3UTBD 3WKJB 3MGQD 1M18B 1TZYB 4WU8C 1P3KB 5GT3D 1KU5A 4YM6C 5GT0B 3X1SB 3B6FA 4YS3D 4H9NB 4YM6D 3W96D 5GT3C 3B0BA 1TAFA 1N1JB 3W98D 1ZLAB 4J8XB 1ID3B 3RELB 3AZHD 3AN2D 5DNND 5GXQA 3W97D 3MGSC 5AV6C 4KUDD 2F8NG 3AZMA 5B2ID 3MGSA 1P3GC 3RELA 4J8XA 5F99D 5AVCC 5CPID 1ID3A 1N1JA 4R8PA 4R8PB 3UTAC 1P3OC 5KDMB 3LELD 1KX3A 4G91C 3AZMB 2IO5B 1P3KC 5GSUD 5GT0A 3W96B 3AZFD 3LELC 5GSUC 1TZYA 3C1BC 1ZLAD 3REKB 1P3AB 1P3MD 3X1TD 2NQBD 3AFAD 1TAFB 1HQ3A 5B1MD 1KX5D 5JRGC 3B6FB 3X1SA 2RVQD 4CSRA 5GT3B 3WA9C 5CPIB 4H9SC 3B6GD 4QLCC 4XZQB 1M18A 3WA9A 5CPJB 3AZGC 5GSUB 5CPKA 3REIA 4HGAB 3RELD 3AZHB 3AN2B 1U35A 1P3PB 1ULYA 4G91B 3AZMC 3MGPA 2PYOA 1KX4A 4G92C 3REIB 5AV9C 5CPKB 3UT9C 3KXBC 4R8PC 4JJNA 4WZSB 3REJA 3MGRA 1KX3C 5B2JA 5AY8D 5BNVA 4XUJD 3MGRC 4CSRB 5GT3A 3UT9B 5B0YD 1HQ3B 5BT1C 5B32G 2AROC 1M18C 2F8NA 5B33D 5B32D 4H9OA 3REKA 1P3AA 5JRGA 3AFAB 1BFMA 3X1SC 5B2IC 5AV6D 3KSYA 3VH5A 4WNNB 3MGQB 4KUDC 4WU9C 3WTPC 4LD9D 4QLCB 3AZIB 3WAAA 2BYKA 4Z5TC
chains in the Genus database with same CATH superfamily
5C3IC 3X1VB 3MGSB 5AV9D 4ZUXD 4CAYB 5B40D 3UT9D 1S32D 1EQZD 5AV5C 4J8VC 1WWSA 2Y2MA 5GXQB 5B40C 2BYMB 3AZKB 4UUZB 3NQJB 5B31A 5B1MC 2ZM5A 2J8PA 3IP4C 1ZLAA 4WV4B 3A1KA 3TU4D 3C1BD 3W96C 5DNMA 5CP6C 4H9NA 4DRAA 1Q9CA 3W98A 4KGCA 5B0ZC 1M1AA 4NE6A 5CP6A 1F66D 4KGCC 4KHAB 5E5AA 5B0ZD 2AROB 1P3ID 1KX5C 2LY8A 3WAAC 4J8UC 3AYWD 5CHLB 5AV6A 5AV5B 4J8VB 1BH8A 5DNNA 3REHC 2Y2KA 1U35C 5GXQC 2G5HC 5B40B 3KWQB 3KUYB 4J8UD 3VH6A 4KUDA 5B32B 5B33B 1P3GD 5CPKD 3LZ0A 1KX5B 1AOIA 4X23D 2CV5A 2BG1A 3W99A 1S32A 3LELA 4ZBJC 1KX3D 5BNXA 5GT0C 3AZFA 4H9PB 2XD5A 4YS3C 1TZYC 4WU8B 3AZEA 1HQ3D 3AZGB 2RVQC 2YFWA 1P34B 2F8NK 3NQUB 3X1UA 1JFIB 2Y2QA 5JA4B 3MNNA 4Z66A 3REHB 3W97B 5BS7A 2CWEA 5BT1D 4QLCD 4H9QB 3WTPD 4Z5TB 2HUEB 3AYWA 2HIOB 4J8UA 2IO5C 3C1CC 1P3OB 2Y2LA 4YS3B 5B0YB 1F1EA 3LJAB 1P3LA 3C1CD 5AV8B 3AV1C 2PYOD 3KXBD 3UTBA 5B1LB 3X1TB 3TU4A 3V9RB 5B24A 3LJAC 2HUEC 3X1VC 4X23B 4YM6A 3AZLA 4WU9A 1P3BC 1M19B 2NZDB 3B6GC 2F8NH 3LZ1A 3O62A 3KUYC 1P3BD 5CP6D 4E45A 4LD9A 5CPJD 3WTPA 3AZJB 4HGAC 3AZHC 3AN2C 4H9RA 3R45A 5B2IA 5AVBD 1Z2CB 5BO0B 3REIC 5CPJC 1P3GA 5B1MB 5AV9A 3UTAA 3WKJC 1A7WA 3C1CA 4EO5B 3MVDB 5GT0D 2Y2GA 4J8WD 5AY8B 3B6GB 4ZUXA 3W99D 1P3IB 4DRBA 2NZDD 4X23C 2XD1A 4J8WC 3AZFC 1BH9A 5DNMD 3MNNC 4KGCD 5B1MA 3AZLD 3EG5B 3KWQC 4Z66D 3B0CT 5AVBB 5FUGB 3X1UD 2UWXA 4NE5A 3R45B 5B2IB 1P3BA 3WTPB 1R4VA 1F66A 4LD9B 3VH6T 3AV2D 2FJ7B 5F99A 3O62B 1M19D 4XZQD 3AZMD 1P3LD 3AZGD 3AV2C 1PZRA 4X23A 3AZKC 1P3PD 5B24B 1P3LC 4JJNC 5C3IB 5AVCA 5G49B 1P3MA 2NQBA 3KXBA 3X1TA 3AZNA 5B31G 3EPHA 5G49A 3B6FD 2FFFB 5B31C 3UTBB 3C1BB 3MGQC 1H3OA 1H3OB 5B0YA 4XUJB 3AZEC 4YS3A 3AZIC 3LJAD 2ZY4A 5B1LC 1F66C 5B0YC 4WU9D 4LD9C 2HIOA 3A6NC 3AZNB 2FJ7A 3AV1B 4Z5TA 3AYWB 1EQZB 3WTPE 5AV8C 5AVCB 3EPLA 5B1LD 5GXQD 3REID 3W97A 5B32C 5B33C 4Z66B 5FUGA 1KX4D 5AVBA 3H0LC 1EQZC 3AV2B 4NE3A 4WU8A 5F99B 5B2JD 2CV5C 4G92B 1F66B 4JJND 4J8WA 5B0ZB 2RIQA 4ZUXB 4M6BA 5AY8A 3LELB 3TU4C 3VH6W 2YFVB 1AOIB 1P34D 3UTAB 1KX5A 1P3GB 1BH9B 2YFVA 2ZY5A 3KFUG 4H9RB 3W98C 1M18D 3B0DB 5B0ZA 1M1AC 4J8WB 1P3IA 2FJ7D 3B6GA 4Z66C 4Z5TD 3O62D 3MVDA 3WA9D 1P3IC 5E5AB 3AV2A 1B67A 4KHAA 5AV9B 5CPKC 4J8XC 1ID3C 1P3OD 4WU9B 1M19A 3W98B 2JSSA 4KGCB 5BO0A 3AZLB 1U35D 5AVCD 3VH5T 3X1TC 1AOID 3TU4B 4UUZA 1EQZA 3AZKA 3AV1A 3WKJD 5B31D 3A1IA 1P3KD 2Y2NA 1HQ3C 2NZDA 3AZED 4XUJA 3X1VA 5B24C 4Z2MG 3LJAA 1P3LB 3C1BA 2HIOC 2BYKB 3V9RA 3REKC 2DQNC 3KUYD 4J8UB 3AZIA 1P3AC 5B1LA 1M19C 3KXBB 3REKD 1P3AD 4H9QA 1P3MB 2NQBB 3RELC 3REHA 4H9OB 1KX4C 3MVDC 1P3OA 3MGPD 3AZJC 4XZQC 2YFWB 3AZGA 3UT9A 3AZEB 4WU8D 4H9PA 4XUJC 3MGRD 3AZFB 4DQYB 1P3BB 3AV1D 2PYOC 2Y2IA 2NZDC 3REJB 1P3MC 1S32B 2NQBC 5JA4A 3MNNB 3B6FC 3LZ1C 4WJ3C 1HTAA 1P3FD 1WWIA 4NFTA 1P34A 4H9SA 3A6ND 5DNNC 5B32A 5B33A 3W97C 1P34C 3FDDA 3KWQA 3O62C 3KUYA 2Y2HA 3AZID 1M1AD 3VH5W 2FJ7C 5BNXB 5E5AD 3W99B 2AROA 3C1CB 5CP6B 3MGSD 4E44A 4ZUXC 3LZ0D 5DNMB 4ZBJB 5B40A 3AZJA 1BH8B 5DNNB 5B31B 5AV6B 5AV5A 3NQJA 4J8VA 3REJC 3UTBC 1ZLAC 2BYMA 3B0DC 3LZ1B 1TZYD 3W96A 5DNMC 1M1AB 1KX3B 5KDMA 4YM6B 4EO5C 3AFAC 3X1VD 3X1UC 3AYWC 3KWQD 3MNND 4QLCA 3AZLC 4WNNA 4CAYA 5JRGB 5AV8A 1B6WA 4Z2MH 3REHD 2F8NB 3MVDD 3EPJA 5F99C 5AVBC 2Y2JA 5CPIC 3LZ0C 4R8PD 3WAAB 5B2JC 2JCHA 2CV5D 3H0MC 1S32C 3MGQA 5AV5D 4J8VD 4AWLB 3REJD 1P3PC 1P3KA 3AZND 3AFAA 5B24D 3AZKD 3WKJA 3AZNC 1JFIA 3NQUA 3X1UB 3A6NA 1KX4B 2ZY3A 3MGPB 1P3FA 2L5AA 5JRGD 3AZHA 5BS7C 4AWLC 3AN2A 3LZ1D 2F8ND 1P3FC 5BNVB 5E5AC 3X1SD 2HIOD 5CPJA 5B2JB 2AROD 3MGRB 3WAAD 3WA9B 4JJNB 4XZQA 2CV5B 4J8XD 5CPIA 5AV8D 1ID3D 3LZ0B 2PYOB 1P3FB 1U35B 3UTAD 1P3PA 3AZJD 3B0CW 5AY8C 4KUDB 3A6NB 1AOIC 5GSUA 3MGPC 3W99C 3UTBD 3WKJB 3MGQD 1M18B 1TZYB 4WU8C 1P3KB 5GT3D 1KU5A 4YM6C 5GT0B 3X1SB 3B6FA 4YS3D 4H9NB 4YM6D 3W96D 5GT3C 3B0BA 1TAFA 1N1JB 3W98D 1ZLAB 2G5IC 4J8XB 1ID3B 3RELB 3AZHD 3AN2D 5DNND 5GXQA 3W97D 3MGSC 5AV6C 4KUDD 2F8NG 3AZMA 3H0RC 5B2ID 3MGSA 1P3GC 3RELA 3EPKA 4J8XA 5F99D 5AVCC 5CPID 1ID3A 1N1JA 4R8PA 4R8PB 3UTAC 1P3OC 5KDMB 3LELD 1KX3A 4G91C 3AZMB 2IO5B 1P3KC 5GSUD 5GT0A 3W96B 3AZFD 3LELC 5GSUC 1TZYA 3C1BC 1ZLAD 3REKB 1P3AB 1P3MD 3X1TD 2NQBD 3AFAD 2Y2OA 1TAFB 3P5JB 1HQ3A 5B1MD 1KX5D 5JRGC 3B6FB 3X1SA 2RVQD 4CSRA 5GT3B 3WA9C 5CPIB 4H9SC 3B6GD 4QLCC 4XZQB 1M18A 3WA9A 5CPJB 3AZGC 2JE5A 5GSUB 2DF4C 5CPKA 3REIA 3AL0C 4HGAB 3RELD 3AZHB 3AN2B 1U35A 1P3PB 1ULYA 4G91B 3AZMC 3MGPA 2PYOA 1KX4A 1W2EA 3F6TA 4G92C 5AV9C 3REIB 5CPKB 3UT9C 3KXBC 4R8PC 4JJNA 4WZSB 3REJA 2W8SA 2VQRA 3MGRA 4UPKA 5B2JA 5AY8D 1KX3C 2ZY2A 1T3UA 5BNVA 4XUJD 3MGRC 4CSRB 5GT3A 3UT9B 5B0YD 1HQ3B 2F2AC 5BT1C 5B32G 2AROC 1M18C 2Y2PA 2F8NA 5B33D 5B32D 4H9OA 3REKA 1P3AA 5JRGA 3AFAB 1BFMA 3X1SC 5B2IC 5AV6D 3KSYA 3VH5A 4WNNB 3MGQB 4KUDC 4WU9C 3WTPC 4LD9D 4QLCB 3AZIB 3WAAA 2BYKA 4Z5TC
chains in the Genus database with same CATH topology
5C3IC 3X1VB 3MGSB 5AV9D 4ZUXD 4CAYB 5B40D 3UT9D 1S32D 1EQZD 5AV5C 4J8VC 1WWSA 2Y2MA 5GXQB 5B40C 2BYMB 3AZKB 4UUZB 3NQJB 5B31A 5B1MC 2ZM5A 2J8PA 3IP4C 1ZLAA 4WV4B 3A1KA 3TU4D 3C1BD 3W96C 5DNMA 5CP6C 4H9NA 4DRAA 1Q9CA 3W98A 4KGCA 5B0ZC 1M1AA 4NE6A 5CP6A 1F66D 4KGCC 4KHAB 5E5AA 5B0ZD 2AROB 1P3ID 1KX5C 2LY8A 3WAAC 4J8UC 3AYWD 5CHLB 5AV6A 5AV5B 4J8VB 1BH8A 5DNNA 3REHC 2Y2KA 1U35C 5GXQC 2G5HC 5B40B 3KWQB 3KUYB 4J8UD 3VH6A 4KUDA 5B32B 5B33B 1P3GD 5CPKD 3LZ0A 1KX5B 1AOIA 4X23D 2CV5A 2BG1A 3W99A 1S32A 3LELA 4ZBJC 1KX3D 5BNXA 5GT0C 3AZFA 4H9PB 2XD5A 4YS3C 1TZYC 4WU8B 3AZEA 1HQ3D 3AZGB 2RVQC 2YFWA 1P34B 2F8NK 3NQUB 3X1UA 1JFIB 2Y2QA 5JA4B 3MNNA 4Z66A 3REHB 3W97B 5BS7A 2CWEA 5BT1D 4QLCD 4H9QB 3WTPD 4Z5TB 2HUEB 3AYWA 2HIOB 4J8UA 2IO5C 3C1CC 1P3OB 2Y2LA 4YS3B 5B0YB 1F1EA 3LJAB 1P3LA 3C1CD 5AV8B 3AV1C 2PYOD 3KXBD 3UTBA 5B1LB 3X1TB 3TU4A 3V9RB 5B24A 3LJAC 2HUEC 3X1VC 4X23B 4YM6A 3AZLA 4WU9A 1P3BC 1M19B 2NZDB 3B6GC 2F8NH 3LZ1A 3O62A 3KUYC 1P3BD 5CP6D 4E45A 4LD9A 5CPJD 3WTPA 3AZJB 4HGAC 3AZHC 3AN2C 4H9RA 3R45A 5B2IA 5AVBD 1Z2CB 5BO0B 3REIC 5CPJC 1P3GA 5B1MB 5AV9A 3UTAA 3WKJC 1A7WA 3C1CA 4EO5B 3MVDB 5GT0D 2Y2GA 4J8WD 5AY8B 3B6GB 4ZUXA 3W99D 1P3IB 4DRBA 2NZDD 4X23C 2XD1A 4J8WC 3AZFC 1BH9A 5DNMD 3MNNC 4KGCD 5B1MA 3AZLD 3EG5B 3KWQC 4Z66D 3B0CT 5AVBB 5FUGB 3X1UD 2UWXA 4NE5A 3R45B 5B2IB 1P3BA 3WTPB 1R4VA 1F66A 4LD9B 3VH6T 3AV2D 2FJ7B 5F99A 3O62B 1M19D 4XZQD 3AZMD 1P3LD 3AZGD 3AV2C 1PZRA 4X23A 3AZKC 1P3PD 5B24B 1P3LC 4JJNC 5C3IB 5AVCA 5G49B 1P3MA 2NQBA 3KXBA 3X1TA 3AZNA 5B31G 3EPHA 5G49A 3B6FD 2FFFB 5B31C 3UTBB 3C1BB 3MGQC 1H3OA 1H3OB 5B0YA 4XUJB 3AZEC 4YS3A 3AZIC 3LJAD 2ZY4A 5B1LC 1F66C 5B0YC 4WU9D 4LD9C 2HIOA 3A6NC 3AZNB 2FJ7A 3AV1B 4Z5TA 3AYWB 1EQZB 3WTPE 5AV8C 5AVCB 3EPLA 5B1LD 5GXQD 3REID 3W97A 5B32C 5B33C 4Z66B 5FUGA 1KX4D 5AVBA 3H0LC 1EQZC 3AV2B 4NE3A 4WU8A 5F99B 5B2JD 2CV5C 4G92B 1F66B 4JJND 4J8WA 5B0ZB 2RIQA 4ZUXB 4M6BA 5AY8A 3LELB 3TU4C 3VH6W 2YFVB 1AOIB 1P34D 3UTAB 1KX5A 1P3GB 1BH9B 2YFVA 2ZY5A 3KFUG 4H9RB 3W98C 1M18D 3B0DB 5B0ZA 1M1AC 4J8WB 1P3IA 2FJ7D 3B6GA 4Z66C 4Z5TD 3O62D 3MVDA 3WA9D 1P3IC 5E5AB 3AV2A 1B67A 4KHAA 5AV9B 5CPKC 4J8XC 1ID3C 1P3OD 4WU9B 1M19A 3W98B 2JSSA 4KGCB 5BO0A 3AZLB 1U35D 5AVCD 3VH5T 3X1TC 1AOID 3TU4B 4UUZA 1EQZA 3AZKA 3AV1A 3WKJD 5B31D 3A1IA 1P3KD 2Y2NA 1HQ3C 2NZDA 3AZED 4XUJA 3X1VA 5B24C 4Z2MG 3LJAA 1P3LB 3C1BA 2HIOC 2BYKB 3V9RA 3REKC 2DQNC 3KUYD 4J8UB 3AZIA 1P3AC 5B1LA 1M19C 3KXBB 3REKD 1P3AD 4H9QA 1P3MB 2NQBB 3RELC 3REHA 4H9OB 1KX4C 3MVDC 1P3OA 3MGPD 3AZJC 4XZQC 2YFWB 3AZGA 3UT9A 3AZEB 4WU8D 4H9PA 4XUJC 3MGRD 3AZFB 4DQYB 1P3BB 3AV1D 2PYOC 2Y2IA 2NZDC 3REJB 1P3MC 1S32B 2NQBC 5JA4A 3MNNB 3B6FC 3LZ1C 4WJ3C 1HTAA 1P3FD 1WWIA 4NFTA 1P34A 4H9SA 3A6ND 5DNNC 5B32A 5B33A 3W97C 1P34C 3FDDA 3KWQA 3O62C 3KUYA 2Y2HA 3AZID 1M1AD 3VH5W 2FJ7C 5BNXB 5E5AD 3W99B 2AROA 3C1CB 5CP6B 3MGSD 4E44A 4ZUXC 3LZ0D 5DNMB 4ZBJB 5B40A 3AZJA 1BH8B 5DNNB 5B31B 5AV6B 5AV5A 3NQJA 4J8VA 3REJC 3UTBC 1ZLAC 2BYMA 3B0DC 3LZ1B 1TZYD 3W96A 5DNMC 1M1AB 1KX3B 5KDMA 4YM6B 4EO5C 3AFAC 3X1VD 3X1UC 3AYWC 3KWQD 3MNND 4QLCA 3AZLC 4WNNA 4CAYA 5JRGB 5AV8A 1B6WA 4Z2MH 3REHD 2F8NB 3MVDD 3EPJA 5F99C 5AVBC 2Y2JA 5CPIC 3LZ0C 4R8PD 3WAAB 5B2JC 2JCHA 2CV5D 3H0MC 1S32C 3MGQA 5AV5D 4J8VD 4AWLB 3REJD 1P3PC 1P3KA 3AZND 3AFAA 5B24D 3AZKD 3WKJA 3AZNC 1JFIA 3NQUA 3X1UB 3A6NA 1KX4B 2ZY3A 3MGPB 1P3FA 2L5AA 5JRGD 3AZHA 5BS7C 4AWLC 3AN2A 3LZ1D 2F8ND 1P3FC 5BNVB 5E5AC 3X1SD 2HIOD 5CPJA 5B2JB 2AROD 3MGRB 3WAAD 3WA9B 4JJNB 4XZQA 2CV5B 4J8XD 5CPIA 5AV8D 1ID3D 3LZ0B 2PYOB 1P3FB 1U35B 3UTAD 1P3PA 3AZJD 3B0CW 5AY8C 4KUDB 3A6NB 1AOIC 5GSUA 3MGPC 3W99C 3UTBD 3WKJB 3MGQD 1M18B 1TZYB 4WU8C 1P3KB 5GT3D 1KU5A 4YM6C 5GT0B 3X1SB 3B6FA 4YS3D 4H9NB 4YM6D 3W96D 5GT3C 3B0BA 1TAFA 1N1JB 3W98D 1ZLAB 2G5IC 4J8XB 1ID3B 3RELB 3AZHD 3AN2D 5DNND 5GXQA 3W97D 3MGSC 5AV6C 4KUDD 2F8NG 3AZMA 3H0RC 5B2ID 3MGSA 1P3GC 3RELA 3EPKA 4J8XA 5F99D 5AVCC 5CPID 1ID3A 1N1JA 4R8PA 4R8PB 3UTAC 1P3OC 5KDMB 3LELD 1KX3A 4G91C 3AZMB 2IO5B 1P3KC 5GSUD 5GT0A 3W96B 3AZFD 3LELC 5GSUC 1TZYA 3C1BC 1ZLAD 3REKB 1P3AB 1P3MD 3X1TD 2NQBD 3AFAD 2Y2OA 1TAFB 3P5JB 1HQ3A 5B1MD 1KX5D 5JRGC 3B6FB 3X1SA 2RVQD 4CSRA 5GT3B 3WA9C 5CPIB 4H9SC 3B6GD 4QLCC 4XZQB 1M18A 3WA9A 5CPJB 3AZGC 2JE5A 5GSUB 2DF4C 5CPKA 3REIA 3AL0C 4HGAB 3RELD 3AZHB 3AN2B 1U35A 1P3PB 1ULYA 4G91B 3AZMC 3MGPA 2PYOA 1KX4A 1W2EA 3F6TA 4G92C 5AV9C 3REIB 5CPKB 3UT9C 3KXBC 4R8PC 4JJNA 4WZSB 3REJA 2W8SA 2VQRA 3MGRA 4UPKA 5B2JA 5AY8D 1KX3C 2ZY2A 1T3UA 5BNVA 4XUJD 3MGRC 4CSRB 5GT3A 3UT9B 5B0YD 1HQ3B 2F2AC 5BT1C 5B32G 2AROC 1M18C 2Y2PA 2F8NA 5B33D 5B32D 4H9OA 3REKA 1P3AA 5JRGA 3AFAB 1BFMA 3X1SC 5B2IC 5AV6D 3KSYA 3VH5A 4WNNB 3MGQB 4KUDC 4WU9C 3WTPC 4LD9D 4QLCB 3AZIB 3WAAA 2BYKA 4Z5TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3I C;  3X1V B;  3MGS B;  5AV9 D;  4ZUX D;  4CAY B;  5B40 D;  3UT9 D;  1S32 D;  1EQZ D;  5AV5 C;  4J8V C;  1WWS A;  5GXQ B;  5B40 C;  2BYM B;  3AZK B;  4UUZ B;  3NQJ B;  5B31 A;  5B1M C;  1ZLA A;  4WV4 B;  3TU4 D;  3C1B D;  3W96 C;  5DNM A;  5CP6 C;  4H9N A;  4DRA A;  1Q9C A;  3W98 A;  4KGC A;  5B0Z C;  1M1A A;  4NE6 A;  5CP6 A;  1F66 D;  4KGC C;  4KHA B;  5E5A A;  5B0Z D;  2ARO B;  1P3I D;  1KX5 C;  2LY8 A;  3WAA C;  4J8U C;  3AYW D;  5CHL B;  5AV6 A;  5AV5 B;  4J8V B;  1BH8 A;  5DNN A;  3REH C;  1U35 C;  5GXQ C;  5B40 B;  3KUY B;  3KWQ B;  4J8U D;  3VH6 A;  4KUD A;  5B32 B;  5B33 B;  1P3G D;  5CPK D;  3LZ0 A;  1KX5 B;  1AOI A;  4X23 D;  2CV5 A;  3W99 A;  1S32 A;  3LEL A;  4ZBJ C;  1KX3 D;  5BNX A;  5GT0 C;  3AZF A;  4H9P B;  4YS3 C;  1TZY C;  4WU8 B;  3AZE A;  1HQ3 D;  3AZG B;  2RVQ C;  2YFW A;  1P34 B;  2F8N K;  3NQU B;  3X1U A;  1JFI B;  5JA4 B;  3MNN A;  4Z66 A;  3REH B;  3W97 B;  5BS7 A;  2CWE A;  5BT1 D;  4QLC D;  4H9Q B;  3WTP D;  4Z5T B;  2HUE B;  3AYW A;  2HIO B;  4J8U A;  2IO5 C;  3C1C C;  1P3O B;  4YS3 B;  5B0Y B;  1F1E A;  3LJA B;  1P3L A;  3C1C D;  5AV8 B;  3AV1 C;  2PYO D;  3KXB D;  3UTB A;  5B1L B;  3X1T B;  3TU4 A;  3V9R B;  5B24 A;  3LJA C;  2HUE C;  3X1V C;  4X23 B;  4YM6 A;  3AZL A;  4WU9 A;  1P3B C;  1M19 B;  2NZD B;  3B6G C;  2F8N H;  3LZ1 A;  3O62 A;  3KUY C;  1P3B D;  5CP6 D;  4E45 A;  4LD9 A;  5CPJ D;  3WTP A;  3AZJ B;  4HGA C;  3AZH C;  3AN2 C;  4H9R A;  3R45 A;  5B2I A;  5AVB D;  5BO0 B;  3REI C;  5CPJ C;  1P3G A;  5B1M B;  5AV9 A;  3UTA A;  3WKJ C;  1A7W A;  3C1C A;  4EO5 B;  3MVD B;  5GT0 D;  4J8W D;  5AY8 B;  3B6G B;  4ZUX A;  3W99 D;  1P3I B;  4DRB A;  2NZD D;  4X23 C;  4J8W C;  3AZF C;  1BH9 A;  5DNM D;  3MNN C;  4KGC D;  5B1M A;  3AZL D;  3KWQ C;  4Z66 D;  3B0C T;  5AVB B;  5FUG B;  3X1U D;  4NE5 A;  3R45 B;  5B2I B;  1P3B A;  3WTP B;  1R4V A;  1F66 A;  4LD9 B;  3VH6 T;  3AV2 D;  2FJ7 B;  5F99 A;  3O62 B;  1M19 D;  4XZQ D;  3AZM D;  1P3L D;  3AZG D;  3AV2 C;  4X23 A;  3AZK C;  1P3P D;  5B24 B;  1P3L C;  4JJN C;  5C3I B;  5AVC A;  5G49 B;  1P3M A;  2NQB A;  3KXB A;  3X1T A;  3AZN A;  5B31 G;  5G49 A;  3B6F D;  5B31 C;  3UTB B;  3C1B B;  3MGQ C;  1H3O A;  1H3O B;  5B0Y A;  4XUJ B;  3AZE C;  4YS3 A;  3AZI C;  3LJA D;  5B1L C;  1F66 C;  5B0Y C;  4WU9 D;  4LD9 C;  2HIO A;  3A6N C;  3AZN B;  2FJ7 A;  3AV1 B;  4Z5T A;  3AYW B;  1EQZ B;  3WTP E;  5AV8 C;  5AVC B;  5B1L D;  5GXQ D;  3REI D;  3W97 A;  5B32 C;  5B33 C;  4Z66 B;  5FUG A;  1KX4 D;  5AVB A;  1EQZ C;  3AV2 B;  4NE3 A;  4WU8 A;  5F99 B;  5B2J D;  2CV5 C;  4G92 B;  1F66 B;  4JJN D;  4J8W A;  5B0Z B;  4ZUX B;  4M6B A;  5AY8 A;  3LEL B;  3TU4 C;  3VH6 W;  2YFV B;  1AOI B;  1P34 D;  3UTA B;  1KX5 A;  1P3G B;  1BH9 B;  2YFV A;  4H9R B;  3W98 C;  1M18 D;  3B0D B;  5B0Z A;  1M1A C;  4J8W B;  1P3I A;  2FJ7 D;  3B6G A;  4Z66 C;  4Z5T D;  3O62 D;  3MVD A;  3WA9 D;  1P3I C;  5E5A B;  3AV2 A;  1B67 A;  4KHA A;  5AV9 B;  5CPK C;  4J8X C;  1ID3 C;  1P3O D;  4WU9 B;  1M19 A;  3W98 B;  2JSS A;  4KGC B;  5BO0 A;  3AZL B;  1U35 D;  5AVC D;  3VH5 T;  3X1T C;  1AOI D;  3TU4 B;  4UUZ A;  1EQZ A;  3AZK A;  3AV1 A;  3WKJ D;  5B31 D;  1P3K D;  1HQ3 C;  2NZD A;  3AZE D;  4XUJ A;  3X1V A;  5B24 C;  4Z2M G;  3LJA A;  1P3L B;  3C1B A;  2HIO C;  2BYK B;  3V9R A;  3REK C;  3KUY D;  4J8U B;  1P3A C;  3AZI A;  5B1L A;  1M19 C;  3KXB B;  3REK D;  1P3A D;  4H9Q A;  1P3M B;  2NQB B;  3REL C;  3REH A;  4H9O B;  1KX4 C;  3MVD C;  1P3O A;  3MGP D;  3AZJ C;  4XZQ C;  2YFW B;  3AZG A;  3UT9 A;  3AZE B;  4WU8 D;  4H9P A;  4XUJ C;  3MGR D;  3AZF B;  1P3B B;  2NZD C;  3AV1 D;  2PYO C;  3REJ B;  1P3M C;  1S32 B;  2NQB C;  5JA4 A;  3MNN B;  3B6F C;  3LZ1 C;  1HTA A;  1P3F D;  1WWI A;  4NFT A;  1P34 A;  4H9S A;  3A6N D;  5DNN C;  5B32 A;  5B33 A;  3W97 C;  1P34 C;  3KWQ A;  3O62 C;  3KUY A;  1M1A D;  3AZI D;  3VH5 W;  2FJ7 C;  5BNX B;  5E5A D;  3W99 B;  2ARO A;  3C1C B;  5CP6 B;  3MGS D;  4E44 A;  4ZUX C;  3LZ0 D;  5DNM B;  4ZBJ B;  5B40 A;  3AZJ A;  1BH8 B;  5DNN B;  5B31 B;  5AV5 A;  3NQJ A;  5AV6 B;  4J8V A;  3REJ C;  3UTB C;  1ZLA C;  2BYM A;  3B0D C;  3LZ1 B;  1TZY D;  3W96 A;  5DNM C;  1M1A B;  1KX3 B;  5KDM A;  4YM6 B;  4EO5 C;  3AFA C;  3X1V D;  3X1U C;  3AYW C;  3KWQ D;  3MNN D;  4QLC A;  3AZL C;  4WNN A;  4CAY A;  5JRG B;  5AV8 A;  1B6W A;  4Z2M H;  3REH D;  2F8N B;  3MVD D;  5F99 C;  5AVB C;  5CPI C;  3LZ0 C;  4R8P D;  3WAA B;  5B2J C;  2CV5 D;  1S32 C;  3MGQ A;  5AV5 D;  4J8V D;  4AWL B;  3REJ D;  1P3P C;  1P3K A;  3AZN D;  3AFA A;  5B24 D;  3AZK D;  3WKJ A;  3AZN C;  1JFI A;  3NQU A;  3X1U B;  3A6N A;  1KX4 B;  3MGP B;  1P3F A;  2L5A A;  5JRG D;  3AZH A;  5BS7 C;  4AWL C;  3AN2 A;  3LZ1 D;  2F8N D;  1P3F C;  5BNV B;  5E5A C;  3X1S D;  2HIO D;  5CPJ A;  5B2J B;  2ARO D;  3MGR B;  3WAA D;  3WA9 B;  4JJN B;  4XZQ A;  2CV5 B;  4J8X D;  5CPI A;  5AV8 D;  1ID3 D;  3LZ0 B;  2PYO B;  1P3F B;  1U35 B;  3UTA D;  1P3P A;  3AZJ D;  3B0C W;  5AY8 C;  4KUD B;  3A6N B;  1AOI C;  5GSU A;  3MGP C;  3W99 C;  3UTB D;  3WKJ B;  3MGQ D;  1M18 B;  1TZY B;  4WU8 C;  1P3K B;  5GT3 D;  1KU5 A;  4YM6 C;  5GT0 B;  3X1S B;  3B6F A;  4YS3 D;  4H9N B;  4YM6 D;  3W96 D;  5GT3 C;  3B0B A;  1TAF A;  1N1J B;  3W98 D;  1ZLA B;  4J8X B;  1ID3 B;  3REL B;  3AZH D;  3AN2 D;  5DNN D;  5GXQ A;  3W97 D;  3MGS C;  5AV6 C;  4KUD D;  2F8N G;  3AZM A;  5B2I D;  3MGS A;  1P3G C;  3REL A;  4J8X A;  5F99 D;  5AVC C;  5CPI D;  1ID3 A;  1N1J A;  4R8P A;  4R8P B;  3UTA C;  1P3O C;  5KDM B;  3LEL D;  1KX3 A;  4G91 C;  3AZM B;  2IO5 B;  1P3K C;  5GSU D;  5GT0 A;  3W96 B;  3AZF D;  3LEL C;  5GSU C;  1TZY A;  3C1B C;  1ZLA D;  3REK B;  1P3A B;  1P3M D;  3X1T D;  2NQB D;  3AFA D;  1TAF B;  1HQ3 A;  5B1M D;  1KX5 D;  5JRG C;  3B6F B;  3X1S A;  2RVQ D;  4CSR A;  5GT3 B;  3WA9 C;  5CPI B;  4H9S C;  3B6G D;  4QLC C;  4XZQ B;  1M18 A;  3WA9 A;  5CPJ B;  3AZG C;  5GSU B;  5CPK A;  3REI A;  4HGA B;  3REL D;  3AZH B;  3AN2 B;  1U35 A;  1P3P B;  1ULY A;  4G91 B;  3AZM C;  3MGP A;  2PYO A;  1KX4 A;  4G92 C;  3REI B;  5AV9 C;  5CPK B;  3UT9 C;  3KXB C;  4R8P C;  4JJN A;  4WZS B;  3REJ A;  3MGR A;  1KX3 C;  5B2J A;  5AY8 D;  5BNV A;  4XUJ D;  3MGR C;  4CSR B;  5GT3 A;  3UT9 B;  5B0Y D;  1HQ3 B;  5BT1 C;  5B32 G;  2ARO C;  1M18 C;  2F8N A;  5B33 D;  5B32 D;  4H9O A;  3REK A;  1P3A A;  5JRG A;  3AFA B;  1BFM A;  3X1S C;  5B2I C;  5AV6 D;  3KSY A;  3VH5 A;  4WNN B;  3MGQ B;  4KUD C;  4WU9 C;  3WTP C;  4LD9 D;  4QLC B;  3AZI B;  3WAA A;  2BYK A;  4Z5T C; 
#chains in the Genus database with same CATH topology
 5C3I C;  3X1V B;  3MGS B;  5AV9 D;  4ZUX D;  4CAY B;  5B40 D;  3UT9 D;  1S32 D;  1EQZ D;  5AV5 C;  4J8V C;  1WWS A;  2Y2M A;  5GXQ B;  5B40 C;  2BYM B;  3AZK B;  4UUZ B;  3NQJ B;  5B31 A;  5B1M C;  2ZM5 A;  2J8P A;  3IP4 C;  1ZLA A;  4WV4 B;  3A1K A;  3TU4 D;  3C1B D;  3W96 C;  5DNM A;  5CP6 C;  4H9N A;  4DRA A;  1Q9C A;  3W98 A;  4KGC A;  5B0Z C;  1M1A A;  4NE6 A;  5CP6 A;  1F66 D;  4KGC C;  4KHA B;  5E5A A;  5B0Z D;  2ARO B;  1P3I D;  1KX5 C;  2LY8 A;  3WAA C;  4J8U C;  3AYW D;  5CHL B;  5AV6 A;  5AV5 B;  4J8V B;  1BH8 A;  5DNN A;  3REH C;  2Y2K A;  1U35 C;  5GXQ C;  2G5H C;  5B40 B;  3KWQ B;  3KUY B;  4J8U D;  3VH6 A;  4KUD A;  5B32 B;  5B33 B;  1P3G D;  5CPK D;  3LZ0 A;  1KX5 B;  1AOI A;  4X23 D;  2CV5 A;  2BG1 A;  3W99 A;  1S32 A;  3LEL A;  4ZBJ C;  1KX3 D;  5BNX A;  5GT0 C;  3AZF A;  4H9P B;  2XD5 A;  4YS3 C;  1TZY C;  4WU8 B;  3AZE A;  1HQ3 D;  3AZG B;  2RVQ C;  2YFW A;  1P34 B;  2F8N K;  3NQU B;  3X1U A;  1JFI B;  2Y2Q A;  5JA4 B;  3MNN A;  4Z66 A;  3REH B;  3W97 B;  5BS7 A;  2CWE A;  5BT1 D;  4QLC D;  4H9Q B;  3WTP D;  4Z5T B;  2HUE B;  3AYW A;  2HIO B;  4J8U A;  2IO5 C;  3C1C C;  1P3O B;  2Y2L A;  4YS3 B;  5B0Y B;  1F1E A;  3LJA B;  1P3L A;  3C1C D;  5AV8 B;  3AV1 C;  2PYO D;  3KXB D;  3UTB A;  5B1L B;  3X1T B;  3TU4 A;  3V9R B;  5B24 A;  3LJA C;  2HUE C;  3X1V C;  4X23 B;  4YM6 A;  3AZL A;  4WU9 A;  1P3B C;  1M19 B;  2NZD B;  3B6G C;  2F8N H;  3LZ1 A;  3O62 A;  3KUY C;  1P3B D;  5CP6 D;  4E45 A;  4LD9 A;  5CPJ D;  3WTP A;  3AZJ B;  4HGA C;  3AZH C;  3AN2 C;  4H9R A;  3R45 A;  5B2I A;  5AVB D;  1Z2C B;  5BO0 B;  3REI C;  5CPJ C;  1P3G A;  5B1M B;  5AV9 A;  3UTA A;  3WKJ C;  1A7W A;  3C1C A;  4EO5 B;  3MVD B;  5GT0 D;  2Y2G A;  4J8W D;  5AY8 B;  3B6G B;  4ZUX A;  3W99 D;  1P3I B;  4DRB A;  2NZD D;  4X23 C;  2XD1 A;  4J8W C;  3AZF C;  1BH9 A;  5DNM D;  3MNN C;  4KGC D;  5B1M A;  3AZL D;  3EG5 B;  3KWQ C;  4Z66 D;  3B0C T;  5AVB B;  5FUG B;  3X1U D;  2UWX A;  4NE5 A;  3R45 B;  5B2I B;  1P3B A;  3WTP B;  1R4V A;  1F66 A;  4LD9 B;  3VH6 T;  3AV2 D;  2FJ7 B;  5F99 A;  3O62 B;  1M19 D;  4XZQ D;  3AZM D;  1P3L D;  3AZG D;  3AV2 C;  1PZR A;  4X23 A;  3AZK C;  1P3P D;  5B24 B;  1P3L C;  4JJN C;  5C3I B;  5AVC A;  5G49 B;  1P3M A;  2NQB A;  3KXB A;  3X1T A;  3AZN A;  5B31 G;  3EPH A;  5G49 A;  3B6F D;  2FFF B;  5B31 C;  3UTB B;  3C1B B;  3MGQ C;  1H3O A;  1H3O B;  5B0Y A;  4XUJ B;  3AZE C;  4YS3 A;  3AZI C;  3LJA D;  2ZY4 A;  5B1L C;  1F66 C;  5B0Y C;  4WU9 D;  4LD9 C;  2HIO A;  3A6N C;  3AZN B;  2FJ7 A;  3AV1 B;  4Z5T A;  3AYW B;  1EQZ B;  3WTP E;  5AV8 C;  5AVC B;  3EPL A;  5B1L D;  5GXQ D;  3REI D;  3W97 A;  5B32 C;  5B33 C;  4Z66 B;  5FUG A;  1KX4 D;  5AVB A;  3H0L C;  1EQZ C;  3AV2 B;  4NE3 A;  4WU8 A;  5F99 B;  5B2J D;  2CV5 C;  4G92 B;  1F66 B;  4JJN D;  4J8W A;  5B0Z B;  2RIQ A;  4ZUX B;  4M6B A;  5AY8 A;  3LEL B;  3TU4 C;  3VH6 W;  2YFV B;  1AOI B;  1P34 D;  3UTA B;  1KX5 A;  1P3G B;  1BH9 B;  2YFV A;  2ZY5 A;  3KFU G;  4H9R B;  3W98 C;  1M18 D;  3B0D B;  5B0Z A;  1M1A C;  4J8W B;  1P3I A;  2FJ7 D;  3B6G A;  4Z66 C;  4Z5T D;  3O62 D;  3MVD A;  3WA9 D;  1P3I C;  5E5A B;  3AV2 A;  1B67 A;  4KHA A;  5AV9 B;  5CPK C;  4J8X C;  1ID3 C;  1P3O D;  4WU9 B;  1M19 A;  3W98 B;  2JSS A;  4KGC B;  5BO0 A;  3AZL B;  1U35 D;  5AVC D;  3VH5 T;  3X1T C;  1AOI D;  3TU4 B;  4UUZ A;  1EQZ A;  3AZK A;  3AV1 A;  3WKJ D;  5B31 D;  3A1I A;  1P3K D;  2Y2N A;  1HQ3 C;  2NZD A;  3AZE D;  4XUJ A;  3X1V A;  5B24 C;  4Z2M G;  3LJA A;  1P3L B;  3C1B A;  2HIO C;  2BYK B;  3V9R A;  3REK C;  2DQN C;  3KUY D;  4J8U B;  3AZI A;  1P3A C;  5B1L A;  1M19 C;  3KXB B;  3REK D;  1P3A D;  4H9Q A;  1P3M B;  2NQB B;  3REL C;  3REH A;  4H9O B;  1KX4 C;  3MVD C;  1P3O A;  3MGP D;  3AZJ C;  4XZQ C;  2YFW B;  3AZG A;  3UT9 A;  3AZE B;  4WU8 D;  4H9P A;  4XUJ C;  3MGR D;  3AZF B;  4DQY B;  1P3B B;  3AV1 D;  2PYO C;  2Y2I A;  2NZD C;  3REJ B;  1P3M C;  1S32 B;  2NQB C;  5JA4 A;  3MNN B;  3B6F C;  3LZ1 C;  4WJ3 C;  1HTA A;  1P3F D;  1WWI A;  4NFT A;  1P34 A;  4H9S A;  3A6N D;  5DNN C;  5B32 A;  5B33 A;  3W97 C;  1P34 C;  3FDD A;  3KWQ A;  3O62 C;  3KUY A;  2Y2H A;  3AZI D;  1M1A D;  3VH5 W;  2FJ7 C;  5BNX B;  5E5A D;  3W99 B;  2ARO A;  3C1C B;  5CP6 B;  3MGS D;  4E44 A;  4ZUX C;  3LZ0 D;  5DNM B;  4ZBJ B;  5B40 A;  3AZJ A;  1BH8 B;  5DNN B;  5B31 B;  5AV6 B;  5AV5 A;  3NQJ A;  4J8V A;  3REJ C;  3UTB C;  1ZLA C;  2BYM A;  3B0D C;  3LZ1 B;  1TZY D;  3W96 A;  5DNM C;  1M1A B;  1KX3 B;  5KDM A;  4YM6 B;  4EO5 C;  3AFA C;  3X1V D;  3X1U C;  3AYW C;  3KWQ D;  3MNN D;  4QLC A;  3AZL C;  4WNN A;  4CAY A;  5JRG B;  5AV8 A;  1B6W A;  4Z2M H;  3REH D;  2F8N B;  3MVD D;  3EPJ A;  5F99 C;  5AVB C;  2Y2J A;  5CPI C;  3LZ0 C;  4R8P D;  3WAA B;  5B2J C;  2JCH A;  2CV5 D;  3H0M C;  1S32 C;  3MGQ A;  5AV5 D;  4J8V D;  4AWL B;  3REJ D;  1P3P C;  1P3K A;  3AZN D;  3AFA A;  5B24 D;  3AZK D;  3WKJ A;  3AZN C;  1JFI A;  3NQU A;  3X1U B;  3A6N A;  1KX4 B;  2ZY3 A;  3MGP B;  1P3F A;  2L5A A;  5JRG D;  3AZH A;  5BS7 C;  4AWL C;  3AN2 A;  3LZ1 D;  2F8N D;  1P3F C;  5BNV B;  5E5A C;  3X1S D;  2HIO D;  5CPJ A;  5B2J B;  2ARO D;  3MGR B;  3WAA D;  3WA9 B;  4JJN B;  4XZQ A;  2CV5 B;  4J8X D;  5CPI A;  5AV8 D;  1ID3 D;  3LZ0 B;  2PYO B;  1P3F B;  1U35 B;  3UTA D;  1P3P A;  3AZJ D;  3B0C W;  5AY8 C;  4KUD B;  3A6N B;  1AOI C;  5GSU A;  3MGP C;  3W99 C;  3UTB D;  3WKJ B;  3MGQ D;  1M18 B;  1TZY B;  4WU8 C;  1P3K B;  5GT3 D;  1KU5 A;  4YM6 C;  5GT0 B;  3X1S B;  3B6F A;  4YS3 D;  4H9N B;  4YM6 D;  3W96 D;  5GT3 C;  3B0B A;  1TAF A;  1N1J B;  3W98 D;  1ZLA B;  2G5I C;  4J8X B;  1ID3 B;  3REL B;  3AZH D;  3AN2 D;  5DNN D;  5GXQ A;  3W97 D;  3MGS C;  5AV6 C;  4KUD D;  2F8N G;  3AZM A;  3H0R C;  5B2I D;  3MGS A;  1P3G C;  3REL A;  3EPK A;  4J8X A;  5F99 D;  5AVC C;  5CPI D;  1ID3 A;  1N1J A;  4R8P A;  4R8P B;  3UTA C;  1P3O C;  5KDM B;  3LEL D;  1KX3 A;  4G91 C;  3AZM B;  2IO5 B;  1P3K C;  5GSU D;  5GT0 A;  3W96 B;  3AZF D;  3LEL C;  5GSU C;  1TZY A;  3C1B C;  1ZLA D;  3REK B;  1P3A B;  1P3M D;  3X1T D;  2NQB D;  3AFA D;  2Y2O A;  1TAF B;  3P5J B;  1HQ3 A;  5B1M D;  1KX5 D;  5JRG C;  3B6F B;  3X1S A;  2RVQ D;  4CSR A;  5GT3 B;  3WA9 C;  5CPI B;  4H9S C;  3B6G D;  4QLC C;  4XZQ B;  1M18 A;  3WA9 A;  5CPJ B;  3AZG C;  2JE5 A;  5GSU B;  2DF4 C;  5CPK A;  3REI A;  3AL0 C;  4HGA B;  3REL D;  3AZH B;  3AN2 B;  1U35 A;  1P3P B;  1ULY A;  4G91 B;  3AZM C;  3MGP A;  2PYO A;  1KX4 A;  1W2E A;  3F6T A;  4G92 C;  5AV9 C;  3REI B;  5CPK B;  3UT9 C;  3KXB C;  4R8P C;  4JJN A;  4WZS B;  3REJ A;  2W8S A;  2VQR A;  3MGR A;  4UPK A;  5B2J A;  5AY8 D;  1KX3 C;  2ZY2 A;  1T3U A;  5BNV A;  4XUJ D;  3MGR C;  4CSR B;  5GT3 A;  3UT9 B;  5B0Y D;  1HQ3 B;  2F2A C;  5BT1 C;  5B32 G;  2ARO C;  1M18 C;  2Y2P A;  2F8N A;  5B33 D;  5B32 D;  4H9O A;  3REK A;  1P3A A;  5JRG A;  3AFA B;  1BFM A;  3X1S C;  5B2I C;  5AV6 D;  3KSY A;  3VH5 A;  4WNN B;  3MGQ B;  4KUD C;  4WU9 C;  3WTP C;  4LD9 D;  4QLC B;  3AZI B;  3WAA A;  2BYK A;  4Z5T C; 
#chains in the Genus database with same CATH homology
 5C3I C;  3X1V B;  3MGS B;  5AV9 D;  4ZUX D;  4CAY B;  5B40 D;  3UT9 D;  1S32 D;  1EQZ D;  5AV5 C;  4J8V C;  1WWS A;  2Y2M A;  5GXQ B;  5B40 C;  2BYM B;  3AZK B;  4UUZ B;  3NQJ B;  5B31 A;  5B1M C;  2ZM5 A;  2J8P A;  3IP4 C;  1ZLA A;  4WV4 B;  3A1K A;  3TU4 D;  3C1B D;  3W96 C;  5DNM A;  5CP6 C;  4H9N A;  4DRA A;  1Q9C A;  3W98 A;  4KGC A;  5B0Z C;  1M1A A;  4NE6 A;  5CP6 A;  1F66 D;  4KGC C;  4KHA B;  5E5A A;  5B0Z D;  2ARO B;  1P3I D;  1KX5 C;  2LY8 A;  3WAA C;  4J8U C;  3AYW D;  5CHL B;  5AV6 A;  5AV5 B;  4J8V B;  1BH8 A;  5DNN A;  3REH C;  2Y2K A;  1U35 C;  5GXQ C;  2G5H C;  5B40 B;  3KWQ B;  3KUY B;  4J8U D;  3VH6 A;  4KUD A;  5B32 B;  5B33 B;  1P3G D;  5CPK D;  3LZ0 A;  1KX5 B;  1AOI A;  4X23 D;  2CV5 A;  2BG1 A;  3W99 A;  1S32 A;  3LEL A;  4ZBJ C;  1KX3 D;  5BNX A;  5GT0 C;  3AZF A;  4H9P B;  2XD5 A;  4YS3 C;  1TZY C;  4WU8 B;  3AZE A;  1HQ3 D;  3AZG B;  2RVQ C;  2YFW A;  1P34 B;  2F8N K;  3NQU B;  3X1U A;  1JFI B;  2Y2Q A;  5JA4 B;  3MNN A;  4Z66 A;  3REH B;  3W97 B;  5BS7 A;  2CWE A;  5BT1 D;  4QLC D;  4H9Q B;  3WTP D;  4Z5T B;  2HUE B;  3AYW A;  2HIO B;  4J8U A;  2IO5 C;  3C1C C;  1P3O B;  2Y2L A;  4YS3 B;  5B0Y B;  1F1E A;  3LJA B;  1P3L A;  3C1C D;  5AV8 B;  3AV1 C;  2PYO D;  3KXB D;  3UTB A;  5B1L B;  3X1T B;  3TU4 A;  3V9R B;  5B24 A;  3LJA C;  2HUE C;  3X1V C;  4X23 B;  4YM6 A;  3AZL A;  4WU9 A;  1P3B C;  1M19 B;  2NZD B;  3B6G C;  2F8N H;  3LZ1 A;  3O62 A;  3KUY C;  1P3B D;  5CP6 D;  4E45 A;  4LD9 A;  5CPJ D;  3WTP A;  3AZJ B;  4HGA C;  3AZH C;  3AN2 C;  4H9R A;  3R45 A;  5B2I A;  5AVB D;  1Z2C B;  5BO0 B;  3REI C;  5CPJ C;  1P3G A;  5B1M B;  5AV9 A;  3UTA A;  3WKJ C;  1A7W A;  3C1C A;  4EO5 B;  3MVD B;  5GT0 D;  2Y2G A;  4J8W D;  5AY8 B;  3B6G B;  4ZUX A;  3W99 D;  1P3I B;  4DRB A;  2NZD D;  4X23 C;  2XD1 A;  4J8W C;  3AZF C;  1BH9 A;  5DNM D;  3MNN C;  4KGC D;  5B1M A;  3AZL D;  3EG5 B;  3KWQ C;  4Z66 D;  3B0C T;  5AVB B;  5FUG B;  3X1U D;  2UWX A;  4NE5 A;  3R45 B;  5B2I B;  1P3B A;  3WTP B;  1R4V A;  1F66 A;  4LD9 B;  3VH6 T;  3AV2 D;  2FJ7 B;  5F99 A;  3O62 B;  1M19 D;  4XZQ D;  3AZM D;  1P3L D;  3AZG D;  3AV2 C;  1PZR A;  4X23 A;  3AZK C;  1P3P D;  5B24 B;  1P3L C;  4JJN C;  5C3I B;  5AVC A;  5G49 B;  1P3M A;  2NQB A;  3KXB A;  3X1T A;  3AZN A;  5B31 G;  3EPH A;  5G49 A;  3B6F D;  2FFF B;  5B31 C;  3UTB B;  3C1B B;  3MGQ C;  1H3O A;  1H3O B;  5B0Y A;  4XUJ B;  3AZE C;  4YS3 A;  3AZI C;  3LJA D;  2ZY4 A;  5B1L C;  1F66 C;  5B0Y C;  4WU9 D;  4LD9 C;  2HIO A;  3A6N C;  3AZN B;  2FJ7 A;  3AV1 B;  4Z5T A;  3AYW B;  1EQZ B;  3WTP E;  5AV8 C;  5AVC B;  3EPL A;  5B1L D;  5GXQ D;  3REI D;  3W97 A;  5B32 C;  5B33 C;  4Z66 B;  5FUG A;  1KX4 D;  5AVB A;  3H0L C;  1EQZ C;  3AV2 B;  4NE3 A;  4WU8 A;  5F99 B;  5B2J D;  2CV5 C;  4G92 B;  1F66 B;  4JJN D;  4J8W A;  5B0Z B;  2RIQ A;  4ZUX B;  4M6B A;  5AY8 A;  3LEL B;  3TU4 C;  3VH6 W;  2YFV B;  1AOI B;  1P34 D;  3UTA B;  1KX5 A;  1P3G B;  1BH9 B;  2YFV A;  2ZY5 A;  3KFU G;  4H9R B;  3W98 C;  1M18 D;  3B0D B;  5B0Z A;  1M1A C;  4J8W B;  1P3I A;  2FJ7 D;  3B6G A;  4Z66 C;  4Z5T D;  3O62 D;  3MVD A;  3WA9 D;  1P3I C;  5E5A B;  3AV2 A;  1B67 A;  4KHA A;  5AV9 B;  5CPK C;  4J8X C;  1ID3 C;  1P3O D;  4WU9 B;  1M19 A;  3W98 B;  2JSS A;  4KGC B;  5BO0 A;  3AZL B;  1U35 D;  5AVC D;  3VH5 T;  3X1T C;  1AOI D;  3TU4 B;  4UUZ A;  1EQZ A;  3AZK A;  3AV1 A;  3WKJ D;  5B31 D;  3A1I A;  1P3K D;  2Y2N A;  1HQ3 C;  2NZD A;  3AZE D;  4XUJ A;  3X1V A;  5B24 C;  4Z2M G;  3LJA A;  1P3L B;  3C1B A;  2HIO C;  2BYK B;  3V9R A;  3REK C;  2DQN C;  3KUY D;  4J8U B;  3AZI A;  1P3A C;  5B1L A;  1M19 C;  3KXB B;  3REK D;  1P3A D;  4H9Q A;  1P3M B;  2NQB B;  3REL C;  3REH A;  4H9O B;  1KX4 C;  3MVD C;  1P3O A;  3MGP D;  3AZJ C;  4XZQ C;  2YFW B;  3AZG A;  3UT9 A;  3AZE B;  4WU8 D;  4H9P A;  4XUJ C;  3MGR D;  3AZF B;  4DQY B;  1P3B B;  3AV1 D;  2PYO C;  2Y2I A;  2NZD C;  3REJ B;  1P3M C;  1S32 B;  2NQB C;  5JA4 A;  3MNN B;  3B6F C;  3LZ1 C;  4WJ3 C;  1HTA A;  1P3F D;  1WWI A;  4NFT A;  1P34 A;  4H9S A;  3A6N D;  5DNN C;  5B32 A;  5B33 A;  3W97 C;  1P34 C;  3FDD A;  3KWQ A;  3O62 C;  3KUY A;  2Y2H A;  3AZI D;  1M1A D;  3VH5 W;  2FJ7 C;  5BNX B;  5E5A D;  3W99 B;  2ARO A;  3C1C B;  5CP6 B;  3MGS D;  4E44 A;  4ZUX C;  3LZ0 D;  5DNM B;  4ZBJ B;  5B40 A;  3AZJ A;  1BH8 B;  5DNN B;  5B31 B;  5AV6 B;  5AV5 A;  3NQJ A;  4J8V A;  3REJ C;  3UTB C;  1ZLA C;  2BYM A;  3B0D C;  3LZ1 B;  1TZY D;  3W96 A;  5DNM C;  1M1A B;  1KX3 B;  5KDM A;  4YM6 B;  4EO5 C;  3AFA C;  3X1V D;  3X1U C;  3AYW C;  3KWQ D;  3MNN D;  4QLC A;  3AZL C;  4WNN A;  4CAY A;  5JRG B;  5AV8 A;  1B6W A;  4Z2M H;  3REH D;  2F8N B;  3MVD D;  3EPJ A;  5F99 C;  5AVB C;  2Y2J A;  5CPI C;  3LZ0 C;  4R8P D;  3WAA B;  5B2J C;  2JCH A;  2CV5 D;  3H0M C;  1S32 C;  3MGQ A;  5AV5 D;  4J8V D;  4AWL B;  3REJ D;  1P3P C;  1P3K A;  3AZN D;  3AFA A;  5B24 D;  3AZK D;  3WKJ A;  3AZN C;  1JFI A;  3NQU A;  3X1U B;  3A6N A;  1KX4 B;  2ZY3 A;  3MGP B;  1P3F A;  2L5A A;  5JRG D;  3AZH A;  5BS7 C;  4AWL C;  3AN2 A;  3LZ1 D;  2F8N D;  1P3F C;  5BNV B;  5E5A C;  3X1S D;  2HIO D;  5CPJ A;  5B2J B;  2ARO D;  3MGR B;  3WAA D;  3WA9 B;  4JJN B;  4XZQ A;  2CV5 B;  4J8X D;  5CPI A;  5AV8 D;  1ID3 D;  3LZ0 B;  2PYO B;  1P3F B;  1U35 B;  3UTA D;  1P3P A;  3AZJ D;  3B0C W;  5AY8 C;  4KUD B;  3A6N B;  1AOI C;  5GSU A;  3MGP C;  3W99 C;  3UTB D;  3WKJ B;  3MGQ D;  1M18 B;  1TZY B;  4WU8 C;  1P3K B;  5GT3 D;  1KU5 A;  4YM6 C;  5GT0 B;  3X1S B;  3B6F A;  4YS3 D;  4H9N B;  4YM6 D;  3W96 D;  5GT3 C;  3B0B A;  1TAF A;  1N1J B;  3W98 D;  1ZLA B;  2G5I C;  4J8X B;  1ID3 B;  3REL B;  3AZH D;  3AN2 D;  5DNN D;  5GXQ A;  3W97 D;  3MGS C;  5AV6 C;  4KUD D;  2F8N G;  3AZM A;  3H0R C;  5B2I D;  3MGS A;  1P3G C;  3REL A;  3EPK A;  4J8X A;  5F99 D;  5AVC C;  5CPI D;  1ID3 A;  1N1J A;  4R8P A;  4R8P B;  3UTA C;  1P3O C;  5KDM B;  3LEL D;  1KX3 A;  4G91 C;  3AZM B;  2IO5 B;  1P3K C;  5GSU D;  5GT0 A;  3W96 B;  3AZF D;  3LEL C;  5GSU C;  1TZY A;  3C1B C;  1ZLA D;  3REK B;  1P3A B;  1P3M D;  3X1T D;  2NQB D;  3AFA D;  2Y2O A;  1TAF B;  3P5J B;  1HQ3 A;  5B1M D;  1KX5 D;  5JRG C;  3B6F B;  3X1S A;  2RVQ D;  4CSR A;  5GT3 B;  3WA9 C;  5CPI B;  4H9S C;  3B6G D;  4QLC C;  4XZQ B;  1M18 A;  3WA9 A;  5CPJ B;  3AZG C;  2JE5 A;  5GSU B;  2DF4 C;  5CPK A;  3REI A;  3AL0 C;  4HGA B;  3REL D;  3AZH B;  3AN2 B;  1U35 A;  1P3P B;  1ULY A;  4G91 B;  3AZM C;  3MGP A;  2PYO A;  1KX4 A;  1W2E A;  3F6T A;  4G92 C;  5AV9 C;  3REI B;  5CPK B;  3UT9 C;  3KXB C;  4R8P C;  4JJN A;  4WZS B;  3REJ A;  2W8S A;  2VQR A;  3MGR A;  4UPK A;  5B2J A;  5AY8 D;  1KX3 C;  2ZY2 A;  1T3U A;  5BNV A;  4XUJ D;  3MGR C;  4CSR B;  5GT3 A;  3UT9 B;  5B0Y D;  1HQ3 B;  2F2A C;  5BT1 C;  5B32 G;  2ARO C;  1M18 C;  2Y2P A;  2F8N A;  5B33 D;  5B32 D;  4H9O A;  3REK A;  1P3A A;  5JRG A;  3AFA B;  1BFM A;  3X1S C;  5B2I C;  5AV6 D;  3KSY A;  3VH5 A;  4WNN B;  3MGQ B;  4KUD C;  4WU9 C;  3WTP C;  4LD9 D;  4QLC B;  3AZI B;  3WAA A;  2BYK A;  4Z5T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...