3RELA

2.7 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3relA00
2PYOC 4CSRA 3AFAC 5B1MD 4ZBJB 1ZLAA 1F66C 1BH9B 4DRBA 2CWEA 1P3KC 5B1LD 3VH6W 5GT0B 5B24A 3AZJA 3AZLB 3AV1D 3UTBB 1P3PB 4Z5TD 5AV6D 3C1BC 1P3BD 5B40B 3AZMD 3AN2B 4UUZB 1TAFA 3UTAA 3MGRA 3AZHC 5B2JB 4KGCD 5BNXA 1F66D 3WAAA 5GXQD 3LZ0B 1N1JB 3KXBA 4LD9C 5B1MB 4ZUXD 1M19D 3B0DB 2L5AA 4J8WA 3VH6T 1AOIC 3AZHD 1EQZD 5B1LB 1P3AA 4M6BA 4R8PD 3AV1B 4Z5TB 5AV6B 3REKD 1P3BB 4NFTA 3V9RB 3AZMB 1P3OA 2YFWA 3WA9A 1KX4C 2F8NA 4Z2MH 3W98A 3A6NC 1P34A 5E5AC 4J8XC 3AZND 4KGCB 5BS7A 1R4VA 5CPJA 5JA4B 1M18A 3NQUA 1F66B 1P3KB 1ID3D 2NZDC 3AZED 4H9OB 3REHC 4H9RB 3AZFC 3O62C 5CPIA 4YS3D 4ZUXB 3LELA 3X1UD 1M19B 3W96D 1KX4D 1P3LC 4XUJA 4H9SC 5B32G 5GT3A 3AZHB 5CPKA 1EQZB 4CAYB 4QLCD 4R8PB 4WNNA 5AVBA 3W97C 3AZJD 3REKB 3UT9C 3AZGA 3B6GA 5BT1C 3REJC 1F1EA 4EO5C 3AZNB 3AZKC 1ID3B 5AV9D 3REIA 3AZEB 5B0YA 4ZBJC 3W97D 3AV2C 3AZIA 3MGPA 4WU8A 4E45A 5BT1D 2AROC 4YS3B 5GT0C 3X1UB 3W96B 1KX4B 1B67A 1P3PC 5G49A 4J8WD 5E5AB 4QLCB 3B6FD 5DNMA 5AV8A 4Z66A 1S32C 3AZJB 3MNNA 1P3MA 5B2JC 5F99C 3REHB 3KUYA 1P3OD 3AV2D 2BYMA 2CV5A 2F8ND 1TAFB 3WTPA 3W98D 2AROD 1P34D 4H9NA 2PYOA 4KUDA 5CP6C 3AFAA 5AV9B 5BNXB 5B2IA 2HUEC 5B1MC 3W97B 4YM6D 4X23C 3W99D 2F8NH 5CPID 5B1LC 5F99D 3RELD 3AV1C 1TZYD 4Z5TC 5AV6C 4WZSB 4HGAC 3LJAD 1P3BC 4J8WB 3AYWA 2HIOA 4EO5B 4XUJD 4WU9D 5DNNC 3C1CA 3AZMC 5CPKD 3B6FB 3MGQA 5AV5A 5FUGA 3X1TD 2IO5C 5KDMA 4KGCC 3AV2B 5AVCA 4X23D 3W98B 2AROB 1ULYA 1P34B 4LD9A 4J8VA 5GXQC 1HTAA 5C3IC 5JRGA 3NQUB 3X1VD 1P3FC 5DNND 4ZUXC 3REID 1S32B 1P3GD 1M19C 1AOIA 5B0YD 4YM6B 3W99B 4Z2MG 1EQZC 2BYKA 5F99B 3RELB 4WU8D 4R8PC 1TZYB 3REKC 5GSUA 3LJAB 1KX3C 1HQ3A 4WU9B 5BNVB 4XZQD 3A6NA 3VH6A 4J8UA 5CP6B 5AV8D 4Z66D 1JFIB 3MNND 3AZNC 4JJND 3X1TB 1P3FD 4H9PA 2HUEB 2NZDA 4KHAA 3NQJA 1ID3C 4X23B 3MVDA 3AZFA 3AZEC 2CV5D 3O62A 3LZ1A 1P3ID 1KX3D 4HGAB 2FJ7D 2YFVA 3X1VB 5B32A 4YS3C 1H3OA 5DNNB 3REIB 3X1UC 4NE6A 3W96C 1P3GB 1WWIA 5AY8A 5B33A 1ZLAC 3UT9A 2IO5B 4QLCC 1U35D 1KX5A 3AZJC 5G49B 4NE3A 4XZQB 5CHLB 2HIOD 3WKJA 3C1CD 5GXQB 3MGQD 3TU4D 5C3IB 5AV5D 3MNNB 3UTAC 4JJNB 1P3FB 3B0CT 5AV9C 2BYMB 1ZLAD 2CV5B 5AVCD 1BH9A 1P3IB 3MGSA 3X1SA 5B24D 1KX3B 2FJ7B 3AZLA 4J8VD 3UTBA 1P3PA 3KXBC 3KWQA 4H9QB 5B40A 1M1AA 3AN2A 4UUZA 4J8WC 3UTAD 3B6FC 1U35B 3MGRD 5B2JA 2NQBA 1A7WA 1HQ3D 3VH5W 2HIOB 3C1CB 1P3OC 3MGQB 3WAAD 3TU4B 5AV5B 4J8UD 3LZ0A 3W98C 1N1JA 3KXBD 2F8NG 1P34C 3B0BA 5KDMB 5BS7C 4CSRB 5CPJC 5B1MA 1ZLAB 5B31A 5B0ZA 5AVCB 3MVDD 1B6WA 4G91B 1WWSA 5B24B 5B1LA 3LZ1D 1P3AD 4YM6C 3W99C 5CPIC 3RELC 1TZYC 3V9RA 3LJAC 3WA9D 5AY8D 3UTAB 4XUJC 5B33D 4WU9C 3MGRB 5CPKC 5BO0A 4KGCA 5AVBC 5CPJD 3VH5T 1M18D 5JA4A 3X1TC 1F66A 3KSYA 1P3KA 3WAAB 4H9OA 3WKJD 4H9RA 3WTPE 3C1BA 3KXBB 1BFMA 3LELD 1M19A 3NQJB 3X1VC 3MVDB 5GT3D 3REIC 1P3GC 3AZHA 5B0YC 1P3AB 3MGSD 5AVBD 3X1SD 3REKA 3AZGD 4AWLB 4WU8C 3B6GD 3UTBD 3KWQD 4NE5A 1P3OB 2YFWB 3WA9B 2F8NB 1M1AD 3AN2D 5B33B 4XZQC 2F8NK 3R45A 5DNMC 5AV8C 4Z66C 5CPJB 1M18B 3MNNC 2NQBD 4JJNC 1ID3A 3AZEA 1BH8A 3AZID 5CPIB 2CV5C 3MGPD 1P3IC 3LELB 4YS3A 2FJ7C 3X1UA 3W96A 4KUDC 1KX4A 4XUJB 5CPKB 5GT3B 5B31D 5B0ZD 5B2IC 5E5AA 4J8XA 3MGSB 4QLCA 4WNNB 5DNMD 5AVBB 3X1SB 3AZGB 3B6GB 1U35C 1P3MD 3KWQB 1M1AB 3KUYD 3REHA 2JSSA 3B0CW 3AYWC 2HIOC 3WTPD 3C1CC 3MGQC 3TU4C 2PYOD 1KU5A 5AV5C 4KUDD 2NQBB 1Q9CA 3AFAD 1P3LA 5AV9A 4H9SA 5B2ID 5B0YB 1P3KD 3W97A 3AZIB 3MGPB 5AVCC 4WU8B 2LY8A 4G91C 3C1BD 5B24C 3REJA 4J8VC 5JRGC 5B31B 5B0ZB 3AYWD 5DNMB 5AV8B 4Z66B 4G92C 3B6FA 3AZKA 4WV4B 3MGRC 1P3MB 3KUYB 5GSUC 3AV2A 1HQ3C 3WTPB 2AROA 3WAAC 5BO0B 5GT0A 4H9NB 2PYOB 4KUDB 4J8UC 4LD9D 2RVQC 3AFAB 5JRGD 5B2IB 1AOID 1S32A 4YM6A 3MVDC 3C1BB 3W99A 3LZ1C 1P3AC 5F99A 3RELA 1TZYA 5GSUD 3LJAA 5B32C 4AWLC 3AYWB 4WU9A 3WA9C 5BNVA 3A6ND 5E5AD 4J8XD 5AY8C 5FUGB 2RVQD 5CP6A 5B33C 1JFIA 3X1TA 1KX5C 2NZDD 1M18C 3REHD 3AZFD 4X23A 3O62D 3R45B 3WKJC 4LD9B 4J8VB 3AV1A 4Z5TA 5AV6A 1P3BA 4DRAA 5JRGB 5B32D 3X1VA 1P3LD 1AOIB 3VH5A 3LELC 5DNNA 4G92B 3AZMA 1P3GA 1BH8B 5GT3C 2BYKB 3UT9D 3MGSC 1KX5D 3X1SC 5GSUB 3REJD 3AZGC 3AZLC 1HQ3B 3B6GC 3UTBC 3KWQC 4XZQA 3A6NB 5B40C 4J8XB 4J8UB 1M1AC 3AN2C 5GXQA 3AZKD 1P3FA 4H9PB 4JJNA 2NZDB 4KHAB 4ZUXA 2NQBC 3AZFB 3O62B 3LZ1B 1EQZA 4CAYA 4R8PA 1P3IA 5GT0D 3AZIC 1KX3A 3AZLD 2YFVB 3MGPC 5B32B 2FJ7A 1P3PD 3LZ0C 1P3LB 1H3OB 5B40D 4H9QA 5AY8B 1S32D 3B0DC 5B31C 5B0ZC 3UT9B 3AZNA 1KX5B 5B31G 1U35A 3REJB 5B2JD 1P3MC 3WKJB 3KUYC 3AZKB 3TU4A 3WTPC 5CP6D 3LZ0D 4E44A
chains in the Genus database with same CATH superfamily
2PYOC 4CSRA 3AFAC 5B1MD 4ZBJB 1ZLAA 1F66C 1BH9B 4DRBA 2CWEA 1P3KC 5B1LD 3VH6W 5GT0B 5B24A 3AZJA 3AZLB 3AV1D 3UTBB 1P3PB 4Z5TD 5AV6D 3C1BC 1P3BD 5B40B 3AZMD 3AN2B 4UUZB 1TAFA 2ZY2A 3UTAA 3MGRA 3AZHC 5B2JB 2Y2QA 4KGCD 2BG1A 5BNXA 1F66D 3WAAA 2JE5A 5GXQD 3LZ0B 1N1JB 3KXBA 4DQYB 4LD9C 5B1MB 4ZUXD 1M19D 3B0DB 2L5AA 4J8WA 2Y2KA 3VH6T 1AOIC 3AZHD 1EQZD 5B1LB 1P3AA 4M6BA 4R8PD 3AV1B 4Z5TB 5AV6B 3REKD 1P3BB 4NFTA 3V9RB 3AZMB 1P3OA 2YFWA 3WA9A 1KX4C 2F8NA 4Z2MH 3W98A 3FDDA 3A6NC 1P34A 5E5AC 4J8XC 2Y2OA 3AZND 5BS7A 4KGCB 1R4VA 5CPJA 2Y2JA 5JA4B 1M18A 3NQUA 1F66B 1P3KB 1ID3D 2NZDC 3H0MC 3AZED 2Y2HA 4H9OB 3REHC 4H9RB 3AZFC 3O62C 5CPIA 3AL0C 4YS3D 4ZUXB 3LELA 3X1UD 1M19B 3W96D 1KX4D 1P3LC 4XUJA 4H9SC 5B32G 5GT3A 3AZHB 5CPKA 1EQZB 4CAYB 4QLCD 4R8PB 4WNNA 5AVBA 3W97C 3AZJD 3REKB 3UT9C 3AZGA 3B6GA 5BT1C 3REJC 1F1EA 4EO5C 3AZNB 3AZKC 1ID3B 5AV9D 2ZY4A 3REIA 2DF4C 3AZEB 5B0YA 4ZBJC 3W97D 3AV2C 3AZIA 3MGPA 4WU8A 4E45A 5BT1D 2AROC 4YS3B 5GT0C 3X1UB 3W96B 1KX4B 1B67A 2Y2LA 1P3PC 5G49A 4J8WD 5E5AB 4QLCB 3B6FD 5DNMA 5AV8A 4Z66A 1S32C 3AZJB 3MNNA 1P3MA 5B2JC 5F99C 3REHB 3KUYA 1P3OD 3AV2D 2BYMA 2XD5A 2CV5A 2Y2MA 2F8ND 1TAFB 3P5JB 3WTPA 3W98D 2AROD 1P34D 4H9NA 2PYOA 4KUDA 5CP6C 3AFAA 5AV9B 5BNXB 3F6TA 5B2IA 2HUEC 5B1MC 3W97B 4YM6D 4X23C 3W99D 2F8NH 5CPID 5B1LC 5F99D 3RELD 3AV1C 1TZYD 4Z5TC 5AV6C 4WZSB 4HGAC 3LJAD 1P3BC 4J8WB 3AYWA 2HIOA 4EO5B 4XUJD 4WU9D 5DNNC 3C1CA 3AZMC 5CPKD 3B6FB 3MGQA 5AV5A 5FUGA 3X1TD 2IO5C 5KDMA 4KGCC 3AV2B 5AVCA 4X23D 3W98B 2AROB 1ULYA 1P34B 4LD9A 4J8VA 5GXQC 1HTAA 2XD1A 5C3IC 5JRGA 3NQUB 3X1VD 1P3FC 5DNND 4ZUXC 3REID 1S32B 1P3GD 1M19C 1AOIA 5B0YD 4YM6B 3W99B 4Z2MG 1EQZC 2BYKA 5F99B 3RELB 4WU8D 4R8PC 1TZYB 2ZY3A 3REKC 5GSUA 3LJAB 1KX3C 1HQ3A 4WU9B 5BNVB 4XZQD 3A6NA 3VH6A 4J8UA 5CP6B 5AV8D 4Z66D 1JFIB 3MNND 3AZNC 4JJND 3X1TB 1P3FD 4H9PA 2HUEB 2NZDA 4KHAA 3NQJA 1ID3C 4X23B 3MVDA 3AZFA 3AZEC 2CV5D 3O62A 3LZ1A 1P3ID 1KX3D 4HGAB 2FJ7D 2YFVA 3X1VB 5B32A 4YS3C 1H3OA 5DNNB 3REIB 3X1UC 4NE6A 3W96C 1P3GB 1WWIA 5AY8A 5B33A 1ZLAC 3UT9A 3EPJA 2IO5B 4QLCC 1U35D 1KX5A 3AZJC 5G49B 4NE3A 4XZQB 5CHLB 2HIOD 3WKJA 3C1CD 5GXQB 3MGQD 3TU4D 5C3IB 5AV5D 3MNNB 3UTAC 4JJNB 1P3FB 2G5HC 3B0CT 5AV9C 2BYMB 1ZLAD 2CV5B 5AVCD 1BH9A 1P3IB 3MGSA 3X1SA 5B24D 1KX3B 2FJ7B 3AZLA 2DQNC 4J8VD 3UTBA 1P3PA 3H0LC 3KXBC 3KWQA 4H9QB 5B40A 3IP4C 3A1KA 1M1AA 3AN2A 4UUZA 4UPKA 4J8WC 3UTAD 3B6FC 1U35B 3MGRD 2Y2PA 5B2JA 2NQBA 1A7WA 1HQ3D 3VH5W 2HIOB 3C1CB 1P3OC 3EPKA 3MGQB 3WAAD 3TU4B 2RIQA 5AV5B 4J8UD 2Y2NA 3LZ0A 3W98C 1N1JA 3KXBD 2F8NG 1P34C 3B0BA 5KDMB 5BS7C 4CSRB 5CPJC 5B1MA 1ZLAB 5B31A 5B0ZA 5AVCB 3MVDD 1B6WA 4G91B 1WWSA 5B24B 5B1LA 3LZ1D 1P3AD 4YM6C 3W99C 5CPIC 3RELC 2Y2IA 1TZYC 3V9RA 3LJAC 3WA9D 3H0RC 5AY8D 3UTAB 4XUJC 5B33D 4WU9C 3MGRB 5CPKC 5BO0A 4KGCA 5AVBC 5CPJD 3VH5T 1M18D 5JA4A 3X1TC 1F66A 3KSYA 1P3KA 3WAAB 1W2EA 4H9OA 3WKJD 4H9RA 3WTPE 3C1BA 3KXBB 1BFMA 3LELD 1M19A 3NQJB 3X1VC 3MVDB 5GT3D 3REIC 1P3GC 3AZHA 5B0YC 1P3AB 3MGSD 5AVBD 3X1SD 1Z2CB 3REKA 3AZGD 4AWLB 4WU8C 3B6GD 3UTBD 3KWQD 4NE5A 1P3OB 2YFWB 3WA9B 2F8NB 1M1AD 3AN2D 5B33B 4XZQC 2F8NK 3R45A 5DNMC 5AV8C 4Z66C 5CPJB 1M18B 3MNNC 2NQBD 4JJNC 1ID3A 3AZEA 1BH8A 3AZID 5CPIB 2CV5C 3MGPD 1P3IC 3LELB 4YS3A 2FJ7C 3X1UA 3W96A 4KUDC 1KX4A 1PZRA 4XUJB 5CPKB 5GT3B 5B31D 5B0ZD 5B2IC 5E5AA 4J8XA 3MGSB 4QLCA 4WNNB 5DNMD 5AVBB 3X1SB 3AZGB 3B6GB 1U35C 1P3MD 3KWQB 1M1AB 3KUYD 2UWXA 3REHA 2JSSA 3EG5B 3B0CW 3AYWC 2HIOC 3WTPD 3C1CC 3MGQC 3TU4C 2PYOD 1KU5A 5AV5C 4KUDD 2NQBB 1Q9CA 3AFAD 1P3LA 5AV9A 4H9SA 5B2ID 5B0YB 1P3KD 3W97A 3AZIB 3MGPB 5AVCC 4WU8B 2LY8A 4G91C 3C1BD 5B24C 3REJA 4J8VC 5JRGC 5B31B 5B0ZB 3AYWD 5DNMB 5AV8B 4Z66B 4G92C 3B6FA 3EPLA 3AZKA 4WV4B 3MGRC 1P3MB 3KUYB 5GSUC 3AV2A 1HQ3C 3WTPB 2AROA 3WAAC 5BO0B 5GT0A 4H9NB 2PYOB 4KUDB 4J8UC 4LD9D 2RVQC 3AFAB 5JRGD 5B2IB 1AOID 2VQRA 1S32A 4YM6A 3MVDC 3C1BB 3W99A 3LZ1C 1P3AC 5F99A 3RELA 1TZYA 5GSUD 3LJAA 2G5IC 5B32C 4AWLC 3AYWB 4WJ3C 1T3UA 4WU9A 3WA9C 5BNVA 3A6ND 5E5AD 4J8XD 5AY8C 5FUGB 2RVQD 5CP6A 5B33C 2ZM5A 1JFIA 3X1TA 1KX5C 2NZDD 1M18C 3REHD 3AZFD 4X23A 2ZY5A 3O62D 3R45B 3WKJC 4LD9B 4J8VB 3AV1A 3EPHA 2W8SA 4Z5TA 5AV6A 1P3BA 4DRAA 5JRGB 5B32D 3X1VA 2J8PA 1P3LD 1AOIB 3VH5A 3LELC 5DNNA 4G92B 3AZMA 1P3GA 1BH8B 5GT3C 2BYKB 3UT9D 3KFUG 3MGSC 1KX5D 3X1SC 2JCHA 5GSUB 3REJD 3AZGC 3AZLC 1HQ3B 3B6GC 3UTBC 2Y2GA 2FFFB 3KWQC 4XZQA 3A6NB 5B40C 4J8XB 4J8UB 1M1AC 3A1IA 3AN2C 5GXQA 2F2AC 3AZKD 1P3FA 4H9PB 4JJNA 2NZDB 4KHAB 4ZUXA 2NQBC 3AZFB 3O62B 3LZ1B 1EQZA 4CAYA 4R8PA 1P3IA 5GT0D 3AZIC 1KX3A 3AZLD 2YFVB 3MGPC 5B32B 2FJ7A 1P3PD 3LZ0C 1P3LB 1H3OB 5B40D 4H9QA 5AY8B 1S32D 3B0DC 5B31C 5B0ZC 3UT9B 3AZNA 1KX5B 5B31G 1U35A 3REJB 5B2JD 1P3MC 3WKJB 3KUYC 3AZKB 3TU4A 3WTPC 5CP6D 3LZ0D 4E44A
chains in the Genus database with same CATH topology
2PYOC 4CSRA 3AFAC 5B1MD 4ZBJB 1ZLAA 1F66C 1BH9B 4DRBA 2CWEA 1P3KC 5B1LD 3VH6W 5GT0B 5B24A 3AZJA 3AZLB 3AV1D 3UTBB 1P3PB 4Z5TD 5AV6D 3C1BC 1P3BD 5B40B 3AZMD 3AN2B 4UUZB 1TAFA 2ZY2A 3UTAA 3MGRA 3AZHC 5B2JB 2Y2QA 4KGCD 2BG1A 5BNXA 1F66D 3WAAA 2JE5A 5GXQD 3LZ0B 1N1JB 3KXBA 4DQYB 4LD9C 5B1MB 4ZUXD 1M19D 3B0DB 2L5AA 4J8WA 2Y2KA 3VH6T 1AOIC 3AZHD 1EQZD 5B1LB 1P3AA 4M6BA 4R8PD 3AV1B 4Z5TB 5AV6B 3REKD 1P3BB 4NFTA 3V9RB 3AZMB 1P3OA 2YFWA 3WA9A 1KX4C 2F8NA 4Z2MH 3W98A 3FDDA 3A6NC 1P34A 5E5AC 4J8XC 2Y2OA 3AZND 5BS7A 4KGCB 1R4VA 5CPJA 2Y2JA 5JA4B 1M18A 3NQUA 1F66B 1P3KB 1ID3D 2NZDC 3H0MC 3AZED 2Y2HA 4H9OB 3REHC 4H9RB 3AZFC 3O62C 5CPIA 3AL0C 4YS3D 4ZUXB 3LELA 3X1UD 1M19B 3W96D 1KX4D 1P3LC 4XUJA 4H9SC 5B32G 5GT3A 3AZHB 5CPKA 1EQZB 4CAYB 4QLCD 4R8PB 4WNNA 5AVBA 3W97C 3AZJD 3REKB 3UT9C 3AZGA 3B6GA 5BT1C 3REJC 1F1EA 4EO5C 3AZNB 3AZKC 1ID3B 5AV9D 2ZY4A 3REIA 2DF4C 3AZEB 5B0YA 4ZBJC 3W97D 3AV2C 3AZIA 3MGPA 4WU8A 4E45A 5BT1D 2AROC 4YS3B 5GT0C 3X1UB 3W96B 1KX4B 1B67A 2Y2LA 1P3PC 5G49A 4J8WD 5E5AB 4QLCB 3B6FD 5DNMA 5AV8A 4Z66A 1S32C 3AZJB 3MNNA 1P3MA 5B2JC 5F99C 3REHB 3KUYA 1P3OD 3AV2D 2BYMA 2XD5A 2CV5A 2Y2MA 2F8ND 1TAFB 3P5JB 3WTPA 3W98D 2AROD 1P34D 4H9NA 2PYOA 4KUDA 5CP6C 3AFAA 5AV9B 5BNXB 3F6TA 5B2IA 2HUEC 5B1MC 3W97B 4YM6D 4X23C 3W99D 2F8NH 5CPID 5B1LC 5F99D 3RELD 3AV1C 1TZYD 4Z5TC 5AV6C 4WZSB 4HGAC 3LJAD 1P3BC 4J8WB 3AYWA 2HIOA 4EO5B 4XUJD 4WU9D 5DNNC 3C1CA 3AZMC 5CPKD 3B6FB 3MGQA 5AV5A 5FUGA 3X1TD 2IO5C 5KDMA 4KGCC 3AV2B 5AVCA 4X23D 3W98B 2AROB 1ULYA 1P34B 4LD9A 4J8VA 5GXQC 1HTAA 2XD1A 5C3IC 5JRGA 3NQUB 3X1VD 1P3FC 5DNND 4ZUXC 3REID 1S32B 1P3GD 1M19C 1AOIA 5B0YD 4YM6B 3W99B 4Z2MG 1EQZC 2BYKA 5F99B 3RELB 4WU8D 4R8PC 1TZYB 2ZY3A 3REKC 5GSUA 3LJAB 1KX3C 1HQ3A 4WU9B 5BNVB 4XZQD 3A6NA 3VH6A 4J8UA 5CP6B 5AV8D 4Z66D 1JFIB 3MNND 3AZNC 4JJND 3X1TB 1P3FD 4H9PA 2HUEB 2NZDA 4KHAA 3NQJA 1ID3C 4X23B 3MVDA 3AZFA 3AZEC 2CV5D 3O62A 3LZ1A 1P3ID 1KX3D 4HGAB 2FJ7D 2YFVA 3X1VB 5B32A 4YS3C 1H3OA 5DNNB 3REIB 3X1UC 4NE6A 3W96C 1P3GB 1WWIA 5AY8A 5B33A 1ZLAC 3UT9A 3EPJA 2IO5B 4QLCC 1U35D 1KX5A 3AZJC 5G49B 4NE3A 4XZQB 5CHLB 2HIOD 3WKJA 3C1CD 5GXQB 3MGQD 3TU4D 5C3IB 5AV5D 3MNNB 3UTAC 4JJNB 1P3FB 2G5HC 3B0CT 5AV9C 2BYMB 1ZLAD 2CV5B 5AVCD 1BH9A 1P3IB 3MGSA 3X1SA 5B24D 1KX3B 2FJ7B 3AZLA 2DQNC 4J8VD 3UTBA 1P3PA 3H0LC 3KXBC 3KWQA 4H9QB 5B40A 3IP4C 3A1KA 1M1AA 3AN2A 4UUZA 4UPKA 4J8WC 3UTAD 3B6FC 1U35B 3MGRD 2Y2PA 5B2JA 2NQBA 1A7WA 1HQ3D 3VH5W 2HIOB 3C1CB 1P3OC 3EPKA 3MGQB 3WAAD 3TU4B 2RIQA 5AV5B 4J8UD 2Y2NA 3LZ0A 3W98C 1N1JA 3KXBD 2F8NG 1P34C 3B0BA 5KDMB 5BS7C 4CSRB 5CPJC 5B1MA 1ZLAB 5B31A 5B0ZA 5AVCB 3MVDD 1B6WA 4G91B 1WWSA 5B24B 5B1LA 3LZ1D 1P3AD 4YM6C 3W99C 5CPIC 3RELC 2Y2IA 1TZYC 3V9RA 3LJAC 3WA9D 3H0RC 5AY8D 3UTAB 4XUJC 5B33D 4WU9C 3MGRB 5CPKC 5BO0A 4KGCA 5AVBC 5CPJD 3VH5T 1M18D 5JA4A 3X1TC 1F66A 3KSYA 1P3KA 3WAAB 1W2EA 4H9OA 3WKJD 4H9RA 3WTPE 3C1BA 3KXBB 1BFMA 3LELD 1M19A 3NQJB 3X1VC 3MVDB 5GT3D 3REIC 1P3GC 3AZHA 5B0YC 1P3AB 3MGSD 5AVBD 3X1SD 1Z2CB 3REKA 3AZGD 4AWLB 4WU8C 3B6GD 3UTBD 3KWQD 4NE5A 1P3OB 2YFWB 3WA9B 2F8NB 1M1AD 3AN2D 5B33B 4XZQC 2F8NK 3R45A 5DNMC 5AV8C 4Z66C 5CPJB 1M18B 3MNNC 2NQBD 4JJNC 1ID3A 3AZEA 1BH8A 3AZID 5CPIB 2CV5C 3MGPD 1P3IC 3LELB 4YS3A 2FJ7C 3X1UA 3W96A 4KUDC 1KX4A 1PZRA 4XUJB 5CPKB 5GT3B 5B31D 5B0ZD 5B2IC 5E5AA 4J8XA 3MGSB 4QLCA 4WNNB 5DNMD 5AVBB 3X1SB 3AZGB 3B6GB 1U35C 1P3MD 3KWQB 1M1AB 3KUYD 2UWXA 3REHA 2JSSA 3EG5B 3B0CW 3AYWC 2HIOC 3WTPD 3C1CC 3MGQC 3TU4C 2PYOD 1KU5A 5AV5C 4KUDD 2NQBB 1Q9CA 3AFAD 1P3LA 5AV9A 4H9SA 5B2ID 5B0YB 1P3KD 3W97A 3AZIB 3MGPB 5AVCC 4WU8B 2LY8A 4G91C 3C1BD 5B24C 3REJA 4J8VC 5JRGC 5B31B 5B0ZB 3AYWD 5DNMB 5AV8B 4Z66B 4G92C 3B6FA 3EPLA 3AZKA 4WV4B 3MGRC 1P3MB 3KUYB 5GSUC 3AV2A 1HQ3C 3WTPB 2AROA 3WAAC 5BO0B 5GT0A 4H9NB 2PYOB 4KUDB 4J8UC 4LD9D 2RVQC 3AFAB 5JRGD 5B2IB 1AOID 2VQRA 1S32A 4YM6A 3MVDC 3C1BB 3W99A 3LZ1C 1P3AC 5F99A 3RELA 1TZYA 5GSUD 3LJAA 2G5IC 5B32C 4AWLC 3AYWB 4WJ3C 1T3UA 4WU9A 3WA9C 5BNVA 3A6ND 5E5AD 4J8XD 5AY8C 5FUGB 2RVQD 5CP6A 5B33C 2ZM5A 1JFIA 3X1TA 1KX5C 2NZDD 1M18C 3REHD 3AZFD 4X23A 2ZY5A 3O62D 3R45B 3WKJC 4LD9B 4J8VB 3AV1A 3EPHA 2W8SA 4Z5TA 5AV6A 1P3BA 4DRAA 5JRGB 5B32D 3X1VA 2J8PA 1P3LD 1AOIB 3VH5A 3LELC 5DNNA 4G92B 3AZMA 1P3GA 1BH8B 5GT3C 2BYKB 3UT9D 3KFUG 3MGSC 1KX5D 3X1SC 2JCHA 5GSUB 3REJD 3AZGC 3AZLC 1HQ3B 3B6GC 3UTBC 2Y2GA 2FFFB 3KWQC 4XZQA 3A6NB 5B40C 4J8XB 4J8UB 1M1AC 3A1IA 3AN2C 5GXQA 2F2AC 3AZKD 1P3FA 4H9PB 4JJNA 2NZDB 4KHAB 4ZUXA 2NQBC 3AZFB 3O62B 3LZ1B 1EQZA 4CAYA 4R8PA 1P3IA 5GT0D 3AZIC 1KX3A 3AZLD 2YFVB 3MGPC 5B32B 2FJ7A 1P3PD 3LZ0C 1P3LB 1H3OB 5B40D 4H9QA 5AY8B 1S32D 3B0DC 5B31C 5B0ZC 3UT9B 3AZNA 1KX5B 5B31G 1U35A 3REJB 5B2JD 1P3MC 3WKJB 3KUYC 3AZKB 3TU4A 3WTPC 5CP6D 3LZ0D 4E44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYO C;  4CSR A;  3AFA C;  5B1M D;  4ZBJ B;  1ZLA A;  1F66 C;  1BH9 B;  4DRB A;  2CWE A;  1P3K C;  5B1L D;  3VH6 W;  5GT0 B;  5B24 A;  3AZJ A;  3AZL B;  3AV1 D;  3UTB B;  1P3P B;  4Z5T D;  5AV6 D;  3C1B C;  1P3B D;  5B40 B;  3AZM D;  3AN2 B;  4UUZ B;  1TAF A;  3UTA A;  3MGR A;  3AZH C;  5B2J B;  4KGC D;  5BNX A;  1F66 D;  3WAA A;  5GXQ D;  3LZ0 B;  1N1J B;  3KXB A;  4LD9 C;  5B1M B;  4ZUX D;  1M19 D;  3B0D B;  2L5A A;  4J8W A;  3VH6 T;  1AOI C;  3AZH D;  1EQZ D;  5B1L B;  1P3A A;  4M6B A;  4R8P D;  3AV1 B;  4Z5T B;  5AV6 B;  3REK D;  1P3B B;  4NFT A;  3V9R B;  3AZM B;  1P3O A;  2YFW A;  3WA9 A;  1KX4 C;  2F8N A;  4Z2M H;  3W98 A;  3A6N C;  1P34 A;  5E5A C;  4J8X C;  3AZN D;  4KGC B;  5BS7 A;  1R4V A;  5CPJ A;  5JA4 B;  1M18 A;  3NQU A;  1F66 B;  1P3K B;  1ID3 D;  2NZD C;  3AZE D;  4H9O B;  3REH C;  4H9R B;  3AZF C;  3O62 C;  5CPI A;  4YS3 D;  4ZUX B;  3LEL A;  3X1U D;  1M19 B;  3W96 D;  1KX4 D;  1P3L C;  4XUJ A;  4H9S C;  5B32 G;  5GT3 A;  3AZH B;  5CPK A;  1EQZ B;  4CAY B;  4QLC D;  4R8P B;  4WNN A;  5AVB A;  3W97 C;  3AZJ D;  3REK B;  3UT9 C;  3AZG A;  3B6G A;  5BT1 C;  3REJ C;  1F1E A;  4EO5 C;  3AZN B;  3AZK C;  1ID3 B;  5AV9 D;  3REI A;  3AZE B;  5B0Y A;  4ZBJ C;  3W97 D;  3AV2 C;  3AZI A;  3MGP A;  4WU8 A;  4E45 A;  5BT1 D;  2ARO C;  4YS3 B;  5GT0 C;  3X1U B;  3W96 B;  1KX4 B;  1B67 A;  1P3P C;  5G49 A;  4J8W D;  5E5A B;  4QLC B;  3B6F D;  5DNM A;  5AV8 A;  4Z66 A;  1S32 C;  3AZJ B;  3MNN A;  1P3M A;  5B2J C;  5F99 C;  3REH B;  3KUY A;  1P3O D;  3AV2 D;  2BYM A;  2CV5 A;  2F8N D;  1TAF B;  3WTP A;  3W98 D;  2ARO D;  1P34 D;  4H9N A;  2PYO A;  4KUD A;  5CP6 C;  3AFA A;  5AV9 B;  5BNX B;  5B2I A;  2HUE C;  5B1M C;  3W97 B;  4YM6 D;  4X23 C;  3W99 D;  2F8N H;  5CPI D;  5B1L C;  5F99 D;  3REL D;  3AV1 C;  1TZY D;  4Z5T C;  5AV6 C;  4WZS B;  4HGA C;  3LJA D;  1P3B C;  4J8W B;  3AYW A;  2HIO A;  4EO5 B;  4XUJ D;  4WU9 D;  5DNN C;  3C1C A;  3AZM C;  5CPK D;  3B6F B;  3MGQ A;  5AV5 A;  5FUG A;  3X1T D;  2IO5 C;  5KDM A;  4KGC C;  3AV2 B;  5AVC A;  4X23 D;  3W98 B;  2ARO B;  1ULY A;  1P34 B;  4LD9 A;  4J8V A;  5GXQ C;  1HTA A;  5C3I C;  5JRG A;  3NQU B;  3X1V D;  1P3F C;  5DNN D;  4ZUX C;  3REI D;  1S32 B;  1P3G D;  1M19 C;  1AOI A;  5B0Y D;  4YM6 B;  3W99 B;  4Z2M G;  1EQZ C;  2BYK A;  5F99 B;  3REL B;  4WU8 D;  4R8P C;  1TZY B;  3REK C;  5GSU A;  3LJA B;  1KX3 C;  1HQ3 A;  4WU9 B;  5BNV B;  4XZQ D;  3A6N A;  3VH6 A;  4J8U A;  5CP6 B;  5AV8 D;  4Z66 D;  1JFI B;  3MNN D;  3AZN C;  4JJN D;  3X1T B;  1P3F D;  4H9P A;  2HUE B;  2NZD A;  4KHA A;  3NQJ A;  1ID3 C;  4X23 B;  3MVD A;  3AZF A;  3AZE C;  2CV5 D;  3O62 A;  3LZ1 A;  1P3I D;  1KX3 D;  4HGA B;  2FJ7 D;  2YFV A;  3X1V B;  5B32 A;  4YS3 C;  1H3O A;  5DNN B;  3REI B;  3X1U C;  4NE6 A;  3W96 C;  1P3G B;  1WWI A;  5AY8 A;  5B33 A;  1ZLA C;  3UT9 A;  2IO5 B;  4QLC C;  1U35 D;  1KX5 A;  3AZJ C;  5G49 B;  4NE3 A;  4XZQ B;  5CHL B;  2HIO D;  3WKJ A;  3C1C D;  5GXQ B;  3MGQ D;  3TU4 D;  5C3I B;  5AV5 D;  3MNN B;  3UTA C;  4JJN B;  1P3F B;  3B0C T;  5AV9 C;  2BYM B;  1ZLA D;  2CV5 B;  5AVC D;  1BH9 A;  1P3I B;  3MGS A;  3X1S A;  5B24 D;  1KX3 B;  2FJ7 B;  3AZL A;  4J8V D;  3UTB A;  1P3P A;  3KXB C;  3KWQ A;  4H9Q B;  5B40 A;  1M1A A;  3AN2 A;  4UUZ A;  4J8W C;  3UTA D;  3B6F C;  1U35 B;  3MGR D;  5B2J A;  2NQB A;  1A7W A;  1HQ3 D;  3VH5 W;  2HIO B;  3C1C B;  1P3O C;  3MGQ B;  3WAA D;  3TU4 B;  5AV5 B;  4J8U D;  3LZ0 A;  3W98 C;  1N1J A;  3KXB D;  2F8N G;  1P34 C;  3B0B A;  5KDM B;  5BS7 C;  4CSR B;  5CPJ C;  5B1M A;  1ZLA B;  5B31 A;  5B0Z A;  5AVC B;  3MVD D;  1B6W A;  4G91 B;  1WWS A;  5B24 B;  5B1L A;  3LZ1 D;  1P3A D;  4YM6 C;  3W99 C;  5CPI C;  3REL C;  1TZY C;  3V9R A;  3LJA C;  3WA9 D;  5AY8 D;  3UTA B;  4XUJ C;  5B33 D;  4WU9 C;  3MGR B;  5CPK C;  5BO0 A;  4KGC A;  5AVB C;  5CPJ D;  3VH5 T;  1M18 D;  5JA4 A;  3X1T C;  1F66 A;  3KSY A;  1P3K A;  3WAA B;  4H9O A;  3WKJ D;  4H9R A;  3WTP E;  3C1B A;  3KXB B;  1BFM A;  3LEL D;  1M19 A;  3NQJ B;  3X1V C;  3MVD B;  5GT3 D;  3REI C;  1P3G C;  3AZH A;  5B0Y C;  1P3A B;  3MGS D;  5AVB D;  3X1S D;  3REK A;  3AZG D;  4AWL B;  4WU8 C;  3B6G D;  3UTB D;  3KWQ D;  4NE5 A;  1P3O B;  2YFW B;  3WA9 B;  2F8N B;  1M1A D;  3AN2 D;  5B33 B;  4XZQ C;  2F8N K;  3R45 A;  5DNM C;  5AV8 C;  4Z66 C;  5CPJ B;  1M18 B;  3MNN C;  2NQB D;  4JJN C;  1ID3 A;  3AZE A;  1BH8 A;  3AZI D;  5CPI B;  2CV5 C;  3MGP D;  1P3I C;  3LEL B;  4YS3 A;  2FJ7 C;  3X1U A;  3W96 A;  4KUD C;  1KX4 A;  4XUJ B;  5CPK B;  5GT3 B;  5B31 D;  5B0Z D;  5B2I C;  5E5A A;  4J8X A;  3MGS B;  4QLC A;  4WNN B;  5DNM D;  5AVB B;  3X1S B;  3AZG B;  3B6G B;  1U35 C;  1P3M D;  3KWQ B;  1M1A B;  3KUY D;  3REH A;  2JSS A;  3B0C W;  3AYW C;  2HIO C;  3WTP D;  3C1C C;  3MGQ C;  3TU4 C;  2PYO D;  1KU5 A;  5AV5 C;  4KUD D;  2NQB B;  1Q9C A;  3AFA D;  1P3L A;  5AV9 A;  4H9S A;  5B2I D;  5B0Y B;  1P3K D;  3W97 A;  3AZI B;  3MGP B;  5AVC C;  4WU8 B;  2LY8 A;  4G91 C;  3C1B D;  5B24 C;  3REJ A;  4J8V C;  5JRG C;  5B31 B;  5B0Z B;  3AYW D;  5DNM B;  5AV8 B;  4Z66 B;  4G92 C;  3B6F A;  3AZK A;  4WV4 B;  3MGR C;  1P3M B;  3KUY B;  5GSU C;  3AV2 A;  1HQ3 C;  3WTP B;  2ARO A;  3WAA C;  5BO0 B;  5GT0 A;  4H9N B;  2PYO B;  4KUD B;  4J8U C;  4LD9 D;  2RVQ C;  3AFA B;  5JRG D;  5B2I B;  1AOI D;  1S32 A;  4YM6 A;  3MVD C;  3C1B B;  3W99 A;  3LZ1 C;  1P3A C;  5F99 A;  3REL A;  1TZY A;  5GSU D;  3LJA A;  5B32 C;  4AWL C;  3AYW B;  4WU9 A;  3WA9 C;  5BNV A;  3A6N D;  5E5A D;  4J8X D;  5AY8 C;  5FUG B;  2RVQ D;  5CP6 A;  5B33 C;  1JFI A;  3X1T A;  1KX5 C;  2NZD D;  1M18 C;  3REH D;  3AZF D;  4X23 A;  3O62 D;  3R45 B;  3WKJ C;  4LD9 B;  4J8V B;  3AV1 A;  4Z5T A;  5AV6 A;  1P3B A;  4DRA A;  5JRG B;  5B32 D;  3X1V A;  1P3L D;  1AOI B;  3VH5 A;  3LEL C;  5DNN A;  4G92 B;  3AZM A;  1P3G A;  1BH8 B;  5GT3 C;  2BYK B;  3UT9 D;  3MGS C;  1KX5 D;  3X1S C;  5GSU B;  3REJ D;  3AZG C;  3AZL C;  1HQ3 B;  3B6G C;  3UTB C;  3KWQ C;  4XZQ A;  3A6N B;  5B40 C;  4J8X B;  4J8U B;  1M1A C;  3AN2 C;  5GXQ A;  3AZK D;  1P3F A;  4H9P B;  4JJN A;  2NZD B;  4KHA B;  4ZUX A;  2NQB C;  3AZF B;  3O62 B;  3LZ1 B;  1EQZ A;  4CAY A;  4R8P A;  1P3I A;  5GT0 D;  3AZI C;  1KX3 A;  3AZL D;  2YFV B;  3MGP C;  5B32 B;  2FJ7 A;  1P3P D;  3LZ0 C;  1P3L B;  1H3O B;  5B40 D;  4H9Q A;  5AY8 B;  1S32 D;  3B0D C;  5B31 C;  5B0Z C;  3UT9 B;  3AZN A;  1KX5 B;  5B31 G;  1U35 A;  3REJ B;  5B2J D;  1P3M C;  3WKJ B;  3KUY C;  3AZK B;  3TU4 A;  3WTP C;  5CP6 D;  3LZ0 D;  4E44 A; 
#chains in the Genus database with same CATH topology
 2PYO C;  4CSR A;  3AFA C;  5B1M D;  4ZBJ B;  1ZLA A;  1F66 C;  1BH9 B;  4DRB A;  2CWE A;  1P3K C;  5B1L D;  3VH6 W;  5GT0 B;  5B24 A;  3AZJ A;  3AZL B;  3AV1 D;  3UTB B;  1P3P B;  4Z5T D;  5AV6 D;  3C1B C;  1P3B D;  5B40 B;  3AZM D;  3AN2 B;  4UUZ B;  1TAF A;  2ZY2 A;  3UTA A;  3MGR A;  3AZH C;  5B2J B;  2Y2Q A;  4KGC D;  2BG1 A;  5BNX A;  1F66 D;  3WAA A;  2JE5 A;  5GXQ D;  3LZ0 B;  1N1J B;  3KXB A;  4DQY B;  4LD9 C;  5B1M B;  4ZUX D;  1M19 D;  3B0D B;  2L5A A;  4J8W A;  2Y2K A;  3VH6 T;  1AOI C;  3AZH D;  1EQZ D;  5B1L B;  1P3A A;  4M6B A;  4R8P D;  3AV1 B;  4Z5T B;  5AV6 B;  3REK D;  1P3B B;  4NFT A;  3V9R B;  3AZM B;  1P3O A;  2YFW A;  3WA9 A;  1KX4 C;  2F8N A;  4Z2M H;  3W98 A;  3FDD A;  3A6N C;  1P34 A;  5E5A C;  4J8X C;  2Y2O A;  3AZN D;  5BS7 A;  4KGC B;  1R4V A;  5CPJ A;  2Y2J A;  5JA4 B;  1M18 A;  3NQU A;  1F66 B;  1P3K B;  1ID3 D;  2NZD C;  3H0M C;  3AZE D;  2Y2H A;  4H9O B;  3REH C;  4H9R B;  3AZF C;  3O62 C;  5CPI A;  3AL0 C;  4YS3 D;  4ZUX B;  3LEL A;  3X1U D;  1M19 B;  3W96 D;  1KX4 D;  1P3L C;  4XUJ A;  4H9S C;  5B32 G;  5GT3 A;  3AZH B;  5CPK A;  1EQZ B;  4CAY B;  4QLC D;  4R8P B;  4WNN A;  5AVB A;  3W97 C;  3AZJ D;  3REK B;  3UT9 C;  3AZG A;  3B6G A;  5BT1 C;  3REJ C;  1F1E A;  4EO5 C;  3AZN B;  3AZK C;  1ID3 B;  5AV9 D;  2ZY4 A;  3REI A;  2DF4 C;  3AZE B;  5B0Y A;  4ZBJ C;  3W97 D;  3AV2 C;  3AZI A;  3MGP A;  4WU8 A;  4E45 A;  5BT1 D;  2ARO C;  4YS3 B;  5GT0 C;  3X1U B;  3W96 B;  1KX4 B;  1B67 A;  2Y2L A;  1P3P C;  5G49 A;  4J8W D;  5E5A B;  4QLC B;  3B6F D;  5DNM A;  5AV8 A;  4Z66 A;  1S32 C;  3AZJ B;  3MNN A;  1P3M A;  5B2J C;  5F99 C;  3REH B;  3KUY A;  1P3O D;  3AV2 D;  2BYM A;  2XD5 A;  2CV5 A;  2Y2M A;  2F8N D;  1TAF B;  3P5J B;  3WTP A;  3W98 D;  2ARO D;  1P34 D;  4H9N A;  2PYO A;  4KUD A;  5CP6 C;  3AFA A;  5AV9 B;  5BNX B;  3F6T A;  5B2I A;  2HUE C;  5B1M C;  3W97 B;  4YM6 D;  4X23 C;  3W99 D;  2F8N H;  5CPI D;  5B1L C;  5F99 D;  3REL D;  3AV1 C;  1TZY D;  4Z5T C;  5AV6 C;  4WZS B;  4HGA C;  3LJA D;  1P3B C;  4J8W B;  3AYW A;  2HIO A;  4EO5 B;  4XUJ D;  4WU9 D;  5DNN C;  3C1C A;  3AZM C;  5CPK D;  3B6F B;  3MGQ A;  5AV5 A;  5FUG A;  3X1T D;  2IO5 C;  5KDM A;  4KGC C;  3AV2 B;  5AVC A;  4X23 D;  3W98 B;  2ARO B;  1ULY A;  1P34 B;  4LD9 A;  4J8V A;  5GXQ C;  1HTA A;  2XD1 A;  5C3I C;  5JRG A;  3NQU B;  3X1V D;  1P3F C;  5DNN D;  4ZUX C;  3REI D;  1S32 B;  1P3G D;  1M19 C;  1AOI A;  5B0Y D;  4YM6 B;  3W99 B;  4Z2M G;  1EQZ C;  2BYK A;  5F99 B;  3REL B;  4WU8 D;  4R8P C;  1TZY B;  2ZY3 A;  3REK C;  5GSU A;  3LJA B;  1KX3 C;  1HQ3 A;  4WU9 B;  5BNV B;  4XZQ D;  3A6N A;  3VH6 A;  4J8U A;  5CP6 B;  5AV8 D;  4Z66 D;  1JFI B;  3MNN D;  3AZN C;  4JJN D;  3X1T B;  1P3F D;  4H9P A;  2HUE B;  2NZD A;  4KHA A;  3NQJ A;  1ID3 C;  4X23 B;  3MVD A;  3AZF A;  3AZE C;  2CV5 D;  3O62 A;  3LZ1 A;  1P3I D;  1KX3 D;  4HGA B;  2FJ7 D;  2YFV A;  3X1V B;  5B32 A;  4YS3 C;  1H3O A;  5DNN B;  3REI B;  3X1U C;  4NE6 A;  3W96 C;  1P3G B;  1WWI A;  5AY8 A;  5B33 A;  1ZLA C;  3UT9 A;  3EPJ A;  2IO5 B;  4QLC C;  1U35 D;  1KX5 A;  3AZJ C;  5G49 B;  4NE3 A;  4XZQ B;  5CHL B;  2HIO D;  3WKJ A;  3C1C D;  5GXQ B;  3MGQ D;  3TU4 D;  5C3I B;  5AV5 D;  3MNN B;  3UTA C;  4JJN B;  1P3F B;  2G5H C;  3B0C T;  5AV9 C;  2BYM B;  1ZLA D;  2CV5 B;  5AVC D;  1BH9 A;  1P3I B;  3MGS A;  3X1S A;  5B24 D;  1KX3 B;  2FJ7 B;  3AZL A;  2DQN C;  4J8V D;  3UTB A;  1P3P A;  3H0L C;  3KXB C;  3KWQ A;  4H9Q B;  5B40 A;  3IP4 C;  3A1K A;  1M1A A;  3AN2 A;  4UUZ A;  4UPK A;  4J8W C;  3UTA D;  3B6F C;  1U35 B;  3MGR D;  2Y2P A;  5B2J A;  2NQB A;  1A7W A;  1HQ3 D;  3VH5 W;  2HIO B;  3C1C B;  1P3O C;  3EPK A;  3MGQ B;  3WAA D;  3TU4 B;  2RIQ A;  5AV5 B;  4J8U D;  2Y2N A;  3LZ0 A;  3W98 C;  1N1J A;  3KXB D;  2F8N G;  1P34 C;  3B0B A;  5KDM B;  5BS7 C;  4CSR B;  5CPJ C;  5B1M A;  1ZLA B;  5B31 A;  5B0Z A;  5AVC B;  3MVD D;  1B6W A;  4G91 B;  1WWS A;  5B24 B;  5B1L A;  3LZ1 D;  1P3A D;  4YM6 C;  3W99 C;  5CPI C;  3REL C;  2Y2I A;  1TZY C;  3V9R A;  3LJA C;  3WA9 D;  3H0R C;  5AY8 D;  3UTA B;  4XUJ C;  5B33 D;  4WU9 C;  3MGR B;  5CPK C;  5BO0 A;  4KGC A;  5AVB C;  5CPJ D;  3VH5 T;  1M18 D;  5JA4 A;  3X1T C;  1F66 A;  3KSY A;  1P3K A;  3WAA B;  1W2E A;  4H9O A;  3WKJ D;  4H9R A;  3WTP E;  3C1B A;  3KXB B;  1BFM A;  3LEL D;  1M19 A;  3NQJ B;  3X1V C;  3MVD B;  5GT3 D;  3REI C;  1P3G C;  3AZH A;  5B0Y C;  1P3A B;  3MGS D;  5AVB D;  3X1S D;  1Z2C B;  3REK A;  3AZG D;  4AWL B;  4WU8 C;  3B6G D;  3UTB D;  3KWQ D;  4NE5 A;  1P3O B;  2YFW B;  3WA9 B;  2F8N B;  1M1A D;  3AN2 D;  5B33 B;  4XZQ C;  2F8N K;  3R45 A;  5DNM C;  5AV8 C;  4Z66 C;  5CPJ B;  1M18 B;  3MNN C;  2NQB D;  4JJN C;  1ID3 A;  3AZE A;  1BH8 A;  3AZI D;  5CPI B;  2CV5 C;  3MGP D;  1P3I C;  3LEL B;  4YS3 A;  2FJ7 C;  3X1U A;  3W96 A;  4KUD C;  1KX4 A;  1PZR A;  4XUJ B;  5CPK B;  5GT3 B;  5B31 D;  5B0Z D;  5B2I C;  5E5A A;  4J8X A;  3MGS B;  4QLC A;  4WNN B;  5DNM D;  5AVB B;  3X1S B;  3AZG B;  3B6G B;  1U35 C;  1P3M D;  3KWQ B;  1M1A B;  3KUY D;  2UWX A;  3REH A;  2JSS A;  3EG5 B;  3B0C W;  3AYW C;  2HIO C;  3WTP D;  3C1C C;  3MGQ C;  3TU4 C;  2PYO D;  1KU5 A;  5AV5 C;  4KUD D;  2NQB B;  1Q9C A;  3AFA D;  1P3L A;  5AV9 A;  4H9S A;  5B2I D;  5B0Y B;  1P3K D;  3W97 A;  3AZI B;  3MGP B;  5AVC C;  4WU8 B;  2LY8 A;  4G91 C;  3C1B D;  5B24 C;  3REJ A;  4J8V C;  5JRG C;  5B31 B;  5B0Z B;  3AYW D;  5DNM B;  5AV8 B;  4Z66 B;  4G92 C;  3B6F A;  3EPL A;  3AZK A;  4WV4 B;  3MGR C;  1P3M B;  3KUY B;  5GSU C;  3AV2 A;  1HQ3 C;  3WTP B;  2ARO A;  3WAA C;  5BO0 B;  5GT0 A;  4H9N B;  2PYO B;  4KUD B;  4J8U C;  4LD9 D;  2RVQ C;  3AFA B;  5JRG D;  5B2I B;  1AOI D;  2VQR A;  1S32 A;  4YM6 A;  3MVD C;  3C1B B;  3W99 A;  3LZ1 C;  1P3A C;  5F99 A;  3REL A;  1TZY A;  5GSU D;  3LJA A;  2G5I C;  5B32 C;  4AWL C;  3AYW B;  4WJ3 C;  1T3U A;  4WU9 A;  3WA9 C;  5BNV A;  3A6N D;  5E5A D;  4J8X D;  5AY8 C;  5FUG B;  2RVQ D;  5CP6 A;  5B33 C;  2ZM5 A;  1JFI A;  3X1T A;  1KX5 C;  2NZD D;  1M18 C;  3REH D;  3AZF D;  4X23 A;  2ZY5 A;  3O62 D;  3R45 B;  3WKJ C;  4LD9 B;  4J8V B;  3AV1 A;  3EPH A;  2W8S A;  4Z5T A;  5AV6 A;  1P3B A;  4DRA A;  5JRG B;  5B32 D;  3X1V A;  2J8P A;  1P3L D;  1AOI B;  3VH5 A;  3LEL C;  5DNN A;  4G92 B;  3AZM A;  1P3G A;  1BH8 B;  5GT3 C;  2BYK B;  3UT9 D;  3KFU G;  3MGS C;  1KX5 D;  3X1S C;  2JCH A;  5GSU B;  3REJ D;  3AZG C;  3AZL C;  1HQ3 B;  3B6G C;  3UTB C;  2Y2G A;  2FFF B;  3KWQ C;  4XZQ A;  3A6N B;  5B40 C;  4J8X B;  4J8U B;  1M1A C;  3A1I A;  3AN2 C;  5GXQ A;  2F2A C;  3AZK D;  1P3F A;  4H9P B;  4JJN A;  2NZD B;  4KHA B;  4ZUX A;  2NQB C;  3AZF B;  3O62 B;  3LZ1 B;  1EQZ A;  4CAY A;  4R8P A;  1P3I A;  5GT0 D;  3AZI C;  1KX3 A;  3AZL D;  2YFV B;  3MGP C;  5B32 B;  2FJ7 A;  1P3P D;  3LZ0 C;  1P3L B;  1H3O B;  5B40 D;  4H9Q A;  5AY8 B;  1S32 D;  3B0D C;  5B31 C;  5B0Z C;  3UT9 B;  3AZN A;  1KX5 B;  5B31 G;  1U35 A;  3REJ B;  5B2J D;  1P3M C;  3WKJ B;  3KUY C;  3AZK B;  3TU4 A;  3WTP C;  5CP6 D;  3LZ0 D;  4E44 A; 
#chains in the Genus database with same CATH homology
 2PYO C;  4CSR A;  3AFA C;  5B1M D;  4ZBJ B;  1ZLA A;  1F66 C;  1BH9 B;  4DRB A;  2CWE A;  1P3K C;  5B1L D;  3VH6 W;  5GT0 B;  5B24 A;  3AZJ A;  3AZL B;  3AV1 D;  3UTB B;  1P3P B;  4Z5T D;  5AV6 D;  3C1B C;  1P3B D;  5B40 B;  3AZM D;  3AN2 B;  4UUZ B;  1TAF A;  2ZY2 A;  3UTA A;  3MGR A;  3AZH C;  5B2J B;  2Y2Q A;  4KGC D;  2BG1 A;  5BNX A;  1F66 D;  3WAA A;  2JE5 A;  5GXQ D;  3LZ0 B;  1N1J B;  3KXB A;  4DQY B;  4LD9 C;  5B1M B;  4ZUX D;  1M19 D;  3B0D B;  2L5A A;  4J8W A;  2Y2K A;  3VH6 T;  1AOI C;  3AZH D;  1EQZ D;  5B1L B;  1P3A A;  4M6B A;  4R8P D;  3AV1 B;  4Z5T B;  5AV6 B;  3REK D;  1P3B B;  4NFT A;  3V9R B;  3AZM B;  1P3O A;  2YFW A;  3WA9 A;  1KX4 C;  2F8N A;  4Z2M H;  3W98 A;  3FDD A;  3A6N C;  1P34 A;  5E5A C;  4J8X C;  2Y2O A;  3AZN D;  5BS7 A;  4KGC B;  1R4V A;  5CPJ A;  2Y2J A;  5JA4 B;  1M18 A;  3NQU A;  1F66 B;  1P3K B;  1ID3 D;  2NZD C;  3H0M C;  3AZE D;  2Y2H A;  4H9O B;  3REH C;  4H9R B;  3AZF C;  3O62 C;  5CPI A;  3AL0 C;  4YS3 D;  4ZUX B;  3LEL A;  3X1U D;  1M19 B;  3W96 D;  1KX4 D;  1P3L C;  4XUJ A;  4H9S C;  5B32 G;  5GT3 A;  3AZH B;  5CPK A;  1EQZ B;  4CAY B;  4QLC D;  4R8P B;  4WNN A;  5AVB A;  3W97 C;  3AZJ D;  3REK B;  3UT9 C;  3AZG A;  3B6G A;  5BT1 C;  3REJ C;  1F1E A;  4EO5 C;  3AZN B;  3AZK C;  1ID3 B;  5AV9 D;  2ZY4 A;  3REI A;  2DF4 C;  3AZE B;  5B0Y A;  4ZBJ C;  3W97 D;  3AV2 C;  3AZI A;  3MGP A;  4WU8 A;  4E45 A;  5BT1 D;  2ARO C;  4YS3 B;  5GT0 C;  3X1U B;  3W96 B;  1KX4 B;  1B67 A;  2Y2L A;  1P3P C;  5G49 A;  4J8W D;  5E5A B;  4QLC B;  3B6F D;  5DNM A;  5AV8 A;  4Z66 A;  1S32 C;  3AZJ B;  3MNN A;  1P3M A;  5B2J C;  5F99 C;  3REH B;  3KUY A;  1P3O D;  3AV2 D;  2BYM A;  2XD5 A;  2CV5 A;  2Y2M A;  2F8N D;  1TAF B;  3P5J B;  3WTP A;  3W98 D;  2ARO D;  1P34 D;  4H9N A;  2PYO A;  4KUD A;  5CP6 C;  3AFA A;  5AV9 B;  5BNX B;  3F6T A;  5B2I A;  2HUE C;  5B1M C;  3W97 B;  4YM6 D;  4X23 C;  3W99 D;  2F8N H;  5CPI D;  5B1L C;  5F99 D;  3REL D;  3AV1 C;  1TZY D;  4Z5T C;  5AV6 C;  4WZS B;  4HGA C;  3LJA D;  1P3B C;  4J8W B;  3AYW A;  2HIO A;  4EO5 B;  4XUJ D;  4WU9 D;  5DNN C;  3C1C A;  3AZM C;  5CPK D;  3B6F B;  3MGQ A;  5AV5 A;  5FUG A;  3X1T D;  2IO5 C;  5KDM A;  4KGC C;  3AV2 B;  5AVC A;  4X23 D;  3W98 B;  2ARO B;  1ULY A;  1P34 B;  4LD9 A;  4J8V A;  5GXQ C;  1HTA A;  2XD1 A;  5C3I C;  5JRG A;  3NQU B;  3X1V D;  1P3F C;  5DNN D;  4ZUX C;  3REI D;  1S32 B;  1P3G D;  1M19 C;  1AOI A;  5B0Y D;  4YM6 B;  3W99 B;  4Z2M G;  1EQZ C;  2BYK A;  5F99 B;  3REL B;  4WU8 D;  4R8P C;  1TZY B;  2ZY3 A;  3REK C;  5GSU A;  3LJA B;  1KX3 C;  1HQ3 A;  4WU9 B;  5BNV B;  4XZQ D;  3A6N A;  3VH6 A;  4J8U A;  5CP6 B;  5AV8 D;  4Z66 D;  1JFI B;  3MNN D;  3AZN C;  4JJN D;  3X1T B;  1P3F D;  4H9P A;  2HUE B;  2NZD A;  4KHA A;  3NQJ A;  1ID3 C;  4X23 B;  3MVD A;  3AZF A;  3AZE C;  2CV5 D;  3O62 A;  3LZ1 A;  1P3I D;  1KX3 D;  4HGA B;  2FJ7 D;  2YFV A;  3X1V B;  5B32 A;  4YS3 C;  1H3O A;  5DNN B;  3REI B;  3X1U C;  4NE6 A;  3W96 C;  1P3G B;  1WWI A;  5AY8 A;  5B33 A;  1ZLA C;  3UT9 A;  3EPJ A;  2IO5 B;  4QLC C;  1U35 D;  1KX5 A;  3AZJ C;  5G49 B;  4NE3 A;  4XZQ B;  5CHL B;  2HIO D;  3WKJ A;  3C1C D;  5GXQ B;  3MGQ D;  3TU4 D;  5C3I B;  5AV5 D;  3MNN B;  3UTA C;  4JJN B;  1P3F B;  2G5H C;  3B0C T;  5AV9 C;  2BYM B;  1ZLA D;  2CV5 B;  5AVC D;  1BH9 A;  1P3I B;  3MGS A;  3X1S A;  5B24 D;  1KX3 B;  2FJ7 B;  3AZL A;  2DQN C;  4J8V D;  3UTB A;  1P3P A;  3H0L C;  3KXB C;  3KWQ A;  4H9Q B;  5B40 A;  3IP4 C;  3A1K A;  1M1A A;  3AN2 A;  4UUZ A;  4UPK A;  4J8W C;  3UTA D;  3B6F C;  1U35 B;  3MGR D;  2Y2P A;  5B2J A;  2NQB A;  1A7W A;  1HQ3 D;  3VH5 W;  2HIO B;  3C1C B;  1P3O C;  3EPK A;  3MGQ B;  3WAA D;  3TU4 B;  2RIQ A;  5AV5 B;  4J8U D;  2Y2N A;  3LZ0 A;  3W98 C;  1N1J A;  3KXB D;  2F8N G;  1P34 C;  3B0B A;  5KDM B;  5BS7 C;  4CSR B;  5CPJ C;  5B1M A;  1ZLA B;  5B31 A;  5B0Z A;  5AVC B;  3MVD D;  1B6W A;  4G91 B;  1WWS A;  5B24 B;  5B1L A;  3LZ1 D;  1P3A D;  4YM6 C;  3W99 C;  5CPI C;  3REL C;  2Y2I A;  1TZY C;  3V9R A;  3LJA C;  3WA9 D;  3H0R C;  5AY8 D;  3UTA B;  4XUJ C;  5B33 D;  4WU9 C;  3MGR B;  5CPK C;  5BO0 A;  4KGC A;  5AVB C;  5CPJ D;  3VH5 T;  1M18 D;  5JA4 A;  3X1T C;  1F66 A;  3KSY A;  1P3K A;  3WAA B;  1W2E A;  4H9O A;  3WKJ D;  4H9R A;  3WTP E;  3C1B A;  3KXB B;  1BFM A;  3LEL D;  1M19 A;  3NQJ B;  3X1V C;  3MVD B;  5GT3 D;  3REI C;  1P3G C;  3AZH A;  5B0Y C;  1P3A B;  3MGS D;  5AVB D;  3X1S D;  1Z2C B;  3REK A;  3AZG D;  4AWL B;  4WU8 C;  3B6G D;  3UTB D;  3KWQ D;  4NE5 A;  1P3O B;  2YFW B;  3WA9 B;  2F8N B;  1M1A D;  3AN2 D;  5B33 B;  4XZQ C;  2F8N K;  3R45 A;  5DNM C;  5AV8 C;  4Z66 C;  5CPJ B;  1M18 B;  3MNN C;  2NQB D;  4JJN C;  1ID3 A;  3AZE A;  1BH8 A;  3AZI D;  5CPI B;  2CV5 C;  3MGP D;  1P3I C;  3LEL B;  4YS3 A;  2FJ7 C;  3X1U A;  3W96 A;  4KUD C;  1KX4 A;  1PZR A;  4XUJ B;  5CPK B;  5GT3 B;  5B31 D;  5B0Z D;  5B2I C;  5E5A A;  4J8X A;  3MGS B;  4QLC A;  4WNN B;  5DNM D;  5AVB B;  3X1S B;  3AZG B;  3B6G B;  1U35 C;  1P3M D;  3KWQ B;  1M1A B;  3KUY D;  2UWX A;  3REH A;  2JSS A;  3EG5 B;  3B0C W;  3AYW C;  2HIO C;  3WTP D;  3C1C C;  3MGQ C;  3TU4 C;  2PYO D;  1KU5 A;  5AV5 C;  4KUD D;  2NQB B;  1Q9C A;  3AFA D;  1P3L A;  5AV9 A;  4H9S A;  5B2I D;  5B0Y B;  1P3K D;  3W97 A;  3AZI B;  3MGP B;  5AVC C;  4WU8 B;  2LY8 A;  4G91 C;  3C1B D;  5B24 C;  3REJ A;  4J8V C;  5JRG C;  5B31 B;  5B0Z B;  3AYW D;  5DNM B;  5AV8 B;  4Z66 B;  4G92 C;  3B6F A;  3EPL A;  3AZK A;  4WV4 B;  3MGR C;  1P3M B;  3KUY B;  5GSU C;  3AV2 A;  1HQ3 C;  3WTP B;  2ARO A;  3WAA C;  5BO0 B;  5GT0 A;  4H9N B;  2PYO B;  4KUD B;  4J8U C;  4LD9 D;  2RVQ C;  3AFA B;  5JRG D;  5B2I B;  1AOI D;  2VQR A;  1S32 A;  4YM6 A;  3MVD C;  3C1B B;  3W99 A;  3LZ1 C;  1P3A C;  5F99 A;  3REL A;  1TZY A;  5GSU D;  3LJA A;  2G5I C;  5B32 C;  4AWL C;  3AYW B;  4WJ3 C;  1T3U A;  4WU9 A;  3WA9 C;  5BNV A;  3A6N D;  5E5A D;  4J8X D;  5AY8 C;  5FUG B;  2RVQ D;  5CP6 A;  5B33 C;  2ZM5 A;  1JFI A;  3X1T A;  1KX5 C;  2NZD D;  1M18 C;  3REH D;  3AZF D;  4X23 A;  2ZY5 A;  3O62 D;  3R45 B;  3WKJ C;  4LD9 B;  4J8V B;  3AV1 A;  3EPH A;  2W8S A;  4Z5T A;  5AV6 A;  1P3B A;  4DRA A;  5JRG B;  5B32 D;  3X1V A;  2J8P A;  1P3L D;  1AOI B;  3VH5 A;  3LEL C;  5DNN A;  4G92 B;  3AZM A;  1P3G A;  1BH8 B;  5GT3 C;  2BYK B;  3UT9 D;  3KFU G;  3MGS C;  1KX5 D;  3X1S C;  2JCH A;  5GSU B;  3REJ D;  3AZG C;  3AZL C;  1HQ3 B;  3B6G C;  3UTB C;  2Y2G A;  2FFF B;  3KWQ C;  4XZQ A;  3A6N B;  5B40 C;  4J8X B;  4J8U B;  1M1A C;  3A1I A;  3AN2 C;  5GXQ A;  2F2A C;  3AZK D;  1P3F A;  4H9P B;  4JJN A;  2NZD B;  4KHA B;  4ZUX A;  2NQB C;  3AZF B;  3O62 B;  3LZ1 B;  1EQZ A;  4CAY A;  4R8P A;  1P3I A;  5GT0 D;  3AZI C;  1KX3 A;  3AZL D;  2YFV B;  3MGP C;  5B32 B;  2FJ7 A;  1P3P D;  3LZ0 C;  1P3L B;  1H3O B;  5B40 D;  4H9Q A;  5AY8 B;  1S32 D;  3B0D C;  5B31 C;  5B0Z C;  3UT9 B;  3AZN A;  1KX5 B;  5B31 G;  1U35 A;  3REJ B;  5B2J D;  1P3M C;  3WKJ B;  3KUY C;  3AZK B;  3TU4 A;  3WTP C;  5CP6 D;  3LZ0 D;  4E44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...