1KX5D

X-ray structure of the nucleosome core particle, ncp147, at 1.9 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
122
Chain Sequence
AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 122
sequence length 122
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx5D00
5BNVA 5DNNC 5DNMC 5B31B 4WU8A 5GT0D 3W99D 4Z5TA 5JRGA 4X23C 2NQBD 5GSUC 4KGCD 3O62A 1F66B 4LD9C 3MGPB 3C1CB 1P3KD 1TZYC 3X1UC 1U35B 3LJAA 5GT0B 5FUGB 2PYOC 4YS3B 4HGAB 4G92B 4KGCB 5B1LD 4XUJC 3AN2D 1P3AA 3X1VD 3B6FA 4Z66C 5AVCC 4YM6B 5B33A 1ULYA 4JJNC 4X23D 4J8WA 4R8PB 1S32C 4ZUXC 4XZQC 3AZIA 4LD9D 1P34A 5CPKC 4EO5B 1TAFB 3WTPE 4J8XA 3LZ1A 1P3BD 4WV4B 3WTPC 5DNNB 5DNMB 2CV5D 3W98A 3LELC 5B2JC 5B32G 3VH5T 4X23B 3AZJA 5GSUB 2FJ7D 5CPID 4H9SA 4J8VA 4LD9B 5CP6C 1TZYB 3X1UB 1BFMA 4Z66D 5G49A 2PYOB 5B1MA 1M18A 4DRBA 3AZMA 1Q9CA 4ZUXD 4XZQD 2HUEC 3X1SA 4XUJB 4H9NB 3UTAA 1AOIA 4Z66B 5AVCB 3LELD 5B2JD 4JJNB 2F8NB 2YFVA 5AVBD 3REKD 1P3FA 3AV1A 3MGRD 4J8UC 4ZUXB 4XZQB 5KDMB 5CP6D 5CPKB 3MGSC 3WTPB 4NE6A 3MGQA 4AWLC 3AV2A 3LELB 5B2JB 5GT3A 1KX4C 3NQJB 3REIA 1P3IA 4KUDC 5CP6B 5E5AA 4Z2MG 5F99C 1P3LD 1HTAA 5AV9C 3AZKC 1BH9A 3MVDA 1M19A 4H9QB 2HUEB 3MNNC 3VH6A 3MGSD 3UTBD 5BT1D 1P3MA 1H3OB 4Z2MH 3UT9C 1KX4D 3VH5W 4WU9A 4J8UB 1P3GA 3WA9A 3MGSB 1HQ3D 5F99D 4AWLB 3AZHA 1KX5A 1P3PC 1KX4B 4CAYA 4NFTA 3WAAA 4KUDB 3AYWC 5AY8D 2AROA 4WNNA 5B24A 5F99B 3TU4D 3AZKB 5B32A 1P3OA 1ID3C 3WKJC 1N1JA 3R45B 3W99C 2NQBC 3MNNB 2BYMB 5B2ID 2F8NG 3AZFD 5B40A 3AZEA 1P3KC 2YFWA 3UT9B 3NQUB 2HIOD 4KHAA 3W97D 4E44A 3AZGD 5BS7A 5B1LC 3REJD 3LJAC 3AN2C 3KXBA 3AFAA 3X1VC 1P3PB 1EQZD 3WKJD 2F8NH 3REHA 5B0ZA 3AYWB 3KUYD 1JFIB 4WU8D 1P3BC 5JA4B 1ID3B 1F66A 4Z5TD 5JRGD 3WKJB 2CV5C 3B0CT 5BNXB 3MGPA 3C1CA 3W99B 5CPJA 3O62D 1U35A 2NQBB 2FJ7C 5FUGA 1P34C 4YS3A 5CPIC 3LZ1C 4H9RA 3LJAD 5AV5A 1P3KB 4H9SC 4J8VC 3X1TA 4QLCC 4YM6A 1P3AD 5B1LB 4E45A 3LJAB 2F8NK 3B6FD 3AN2B 4R8PA 5B33D 3X1VB 2JSSA 5B1MC 4J8WD 5DNNA 5AVBC 5DNMA 3REKC 3AZID 1P34D 3MGRC 3W96A 4J8XD 3LZ1D 5GSUA 3A6NA 3RELC 3W98D 1P3BB 4NE3A 2CV5B 3AZJD 3AV1C 1TZYA 3X1UA 3REHB 4J8VD 2FJ7B 1P34B 2PYOA 4QLCD 3C1BA 5CPIB 5CHLB 4H9OB 3LZ1B 5B1MD 1P3LC 4XUJA 4H9NA 1M18D 3B6GA 3AZMD 4J8VB 5AVCA 3X1SD 3LZ0A 4QLCB 4NE5A 4JJNA 2F8NA 3RELD 3V9RB 3UTAD 1AOID 5B31G 5AV6A 1S32A 5G49B 5B1MB 5KDMA 3MVDC 1WWSA 5BT1C 3UTBC 5CPKA 3AV1D 1M19C 4CSRB 3WTPA 3B0CW 5AVBB 3REKB 3LELA 3MGRB 5C3IC 1BH8B 5GXQC 3RELB 3NQJA 3MGQD 3AV2D 5BO0B 3KWQA 1HQ3C 1M1AA 5GT3D 3AV1B 3REID 1P3ID 5B0YC 5E5AD 5AV8A 4WZSB 5AY8C 4H9QA 1P3LB 3MVDD 3TU4C 3VH6T 1M19D 3AZNA 5GXQD 4J8UA 5B2IC 1P3OC 3UTBB 3MVDB 1P3MD 1M19B 3AZFC 4WU9D 1P3GD 5B0YD 4UUZB 3WA9D 5C3IB 5GXQB 2HIOC 3W97C 2IO5C 3AZGC 3AZEC 1HQ3B 4KUDA 3REJC 3AZHD 2NZDA 1KX5D 5B0YB 1EQZC 3WAAD 5AV9A 3AZKA 1KX3A 1B6WA 2AROD 5B24D 5AY8B 5BS7C 3KUYC 3R45A 5B32D 1P3OD 3AFAC 3TU4B 3MNNA 4CAYB 3AZLA 4WU8C 2BYMA 4G91C 4Z5TC 5JRGC 5B0ZC 1ZLAA 3O62C 3UT9A 3B0BA 5B32B 5B40D 5B2IB 3AZED 1P3OB 3AZFB 1N1JB 5CPJC 2HIOB 1P3PA 5B31A 3W97B 2IO5B 3AZGB 3AZEB 1P3AC 5AV5C 3KXBD 3AFAD 3REJB 3AYWA 2YFWB 3B6FC 3REHD 5B33C 1EQZB 5B0ZD 4KHAB 3X1TC 4J8WC 5JA4A 1ID3A 4H9PB 3KUYB 3AZIC 5GT0A 5BNXA 3W99A 4J8XC 2BYKB 3AFAB 1F66D 2NQBA 5BNVB 4WU8B 3W98C 4KGCA 3MGPD 3C1CD 4G91B 4Z5TB 5CPJD 5JRGB 5B0ZB 1U35D 3AZJC 1P3KA 4YS3D 3O62B 3W96C 3A6NC 5AV5D 5B1LA 5CPJB 1M18C 3AN2A 1TAFA 3X1TD 4YM6D 1B67A 3C1BC 3AZMC 3X1VA 4H9RB 3X1SC 1P3AB 5AV5B 4R8PD 4X23A 3UTAC 1AOIC 3B6FB 4LD9A 5B33B 3B6GC 5DNND 5DNMD 1P3FC 3X1TB 3LZ0C 4J8WB 1P3BA 3W96D 3AZIB 2CV5A 3A6ND 5GSUD 4DRAA 5AV6C 4J8XB 2FJ7A 3MGQC 3AV2C 3W98B 5CPIA 1TZYD 4H9OA 3X1UD 3VH5A 3AZJB 5GT3C 2L5AA 2PYOD 3REIC 3C1BD 1P3IC 3W96B 4Z66A 3A6NB 5E5AC 3KWQC 1M1AC 4QLCA 4XUJD 4ZUXA 4XZQA 3B6GD 3V9RA 1M18B 1P3FD 5AVCD 3LZ0D 3C1BB 5AV8C 3AZMB 4JJND 1A7WA 2F8ND 3X1SB 5B2JA 4CSRA 5AV6D 1S32D 3REKA 5AVBA 3UTAB 1AOIB 3MGRA 5CPKD 1BH8A 3RELA 3B6GB 3WTPD 5CP6A 2YFVB 1P3MC 1P3FB 3LZ0B 3AZNC 5BO0A 2LY8A 4WU9C 1WWIA 1P3GC 3WA9C 5AV6B 1S32B 3KWQD 1M1AD 3MGQB 3AV2B 3AZHC 5GT3B 2CWEA 1KX5C 3REIB 1P3IB 5AV8D 1P3LA 3WAAC 5E5AB 2RVQC 1H3OA 2AROC 5B24C 3KWQB 1M1AB 2NZDC 1F1EA 1BH9B 5B32C 3AZND 3MGSA 5AV8B 1KX3C 3UTBA 3B0DC 4J8UD 4UUZA 1KX4A 5GXQA 5B40C 3AZLC 1P3MB 1KU5A 3AZNB 4WU9B 1P3GB 1HQ3A 5F99A 1ZLAC 4ZBJC 3WA9B 2RVQD 5B0YA 1R4VA 4KUDD 2NZDD 3KXBC 5AY8A 3AZHB 1KX5B 5AV9D 3AZKD 1KX3D 3REHC 3TU4A 3KSYA 3WAAB 5B31C 2AROB 5B24B 4WNNB 3NQUA 4M6BA 2NZDB 3MNND 3AZLD 1F66C 5AV9B 5B2IA 3MGPC 1KX3B 1ZLAD 3C1CC 1U35C 3UT9D 3AZFA 3B0DB 5GT0C 4YS3C 4HGAC 4G92C 2HIOA 5B40B 3AZLB 4KGCC 1JFIA 3W97A 3AZGA 1ZLAB 3VH6W 3REJA 1P3PD 4ZBJB 5B31D 4YM6C 1EQZA 3WKJA 3AYWD 4H9PA 4R8PC 3KXBB 3KUYA 4EO5C 2BYKA 1ID3D
chains in the Genus database with same CATH superfamily
5BNVA 5DNNC 5DNMC 5B31B 4WU8A 5GT0D 3W99D 4Z5TA 5JRGA 3IP4C 4X23C 2NQBD 5GSUC 4KGCD 3EPHA 3O62A 1F66B 4LD9C 3MGPB 3C1CB 1P3KD 1TZYC 3X1UC 1U35B 3LJAA 5GT0B 5FUGB 3H0MC 2PYOC 4YS3B 4HGAB 4G92B 4KGCB 5B1LD 2RIQA 4XUJC 3AN2D 1P3AA 3X1VD 3B6FA 4Z66C 5AVCC 4YM6B 5B33A 1ULYA 4JJNC 4X23D 2ZY3A 4J8WA 2Y2PA 4R8PB 4ZUXC 4XZQC 3AZIA 1S32C 4LD9D 1P34A 5CPKC 4EO5B 1TAFB 3WTPE 4J8XA 3LZ1A 1P3BD 4WV4B 3WTPC 5DNNB 5DNMB 2CV5D 3W98A 3LELC 5B2JC 5B32G 3VH5T 4X23B 3AZJA 5GSUB 2FJ7D 5CPID 4H9SA 3FDDA 4J8VA 4LD9B 5CP6C 1TZYB 3X1UB 1BFMA 4Z66D 5G49A 2PYOB 5B1MA 1M18A 4DRBA 3F6TA 3AZMA 1Q9CA 4ZUXD 4XZQD 2HUEC 3X1SA 4XUJB 4H9NB 1W2EA 3UTAA 1AOIA 4Z66B 5AVCB 3LELD 5B2JD 2UWXA 4JJNB 2F8NB 2YFVA 5AVBD 3REKD 1P3FA 3AV1A 3MGRD 2Y2MA 4J8UC 4ZUXB 4XZQB 5KDMB 5CP6D 5CPKB 3MGSC 3WTPB 4NE6A 3MGQA 4AWLC 3AV2A 3LELB 5B2JB 5GT3A 1KX4C 3NQJB 3REIA 1P3IA 4KUDC 5CP6B 5E5AA 4Z2MG 5F99C 1P3LD 1HTAA 5AV9C 3AZKC 1BH9A 3MVDA 1M19A 4H9QB 2HUEB 4WJ3C 3MNNC 3VH6A 3MGSD 3UTBD 5BT1D 1P3MA 1H3OB 4Z2MH 3UT9C 1KX4D 3VH5W 4WU9A 4J8UB 1P3GA 3WA9A 3MGSB 1HQ3D 5F99D 4AWLB 2ZY2A 3AZHA 1KX5A 1P3PC 3H0RC 4CAYA 1KX4B 4NFTA 3WAAA 4KUDB 3AYWC 5AY8D 2AROA 4WNNA 5B24A 5F99B 2Y2QA 3TU4D 3AZKB 5B32A 1P3OA 1ID3C 3WKJC 1N1JA 3R45B 2JCHA 3W99C 2NQBC 3MNNB 2BYMB 5B2ID 2F8NG 3AZFD 5B40A 3AZEA 1P3KC 2YFWA 3UT9B 3NQUB 2HIOD 4KHAA 3W97D 4E44A 3AZGD 5BS7A 5B1LC 3REJD 3LJAC 3AN2C 3KXBA 3AFAA 3X1VC 1P3PB 1EQZD 3WKJD 2F8NH 3REHA 5B0ZA 3AYWB 3KUYD 1JFIB 4WU8D 1P3BC 5JA4B 1ID3B 1F66A 4Z5TD 5JRGD 3WKJB 2CV5C 3B0CT 5BNXB 3MGPA 3C1CA 3W99B 5CPJA 4UPKA 3O62D 1U35A 2NQBB 2FJ7C 5FUGA 1P34C 2ZY5A 4YS3A 2G5HC 5CPIC 3LZ1C 4H9RA 3LJAD 5AV5A 1P3KB 4H9SC 4J8VC 3X1TA 4QLCC 4YM6A 1P3AD 2ZM5A 5B1LB 4E45A 3LJAB 2F8NK 3B6FD 2Y2NA 3AN2B 4R8PA 5B33D 3X1VB 2JSSA 5B1MC 4J8WD 5DNNA 5AVBC 5DNMA 3REKC 3AZID 1P34D 3MGRC 3W96A 4J8XD 3LZ1D 5GSUA 3A6NA 3RELC 2XD1A 3W98D 1P3BB 4NE3A 2CV5B 3AZJD 3AV1C 1TZYA 3X1UA 3REHB 4J8VD 2FJ7B 1P34B 2PYOA 4QLCD 2J8PA 3C1BA 5CPIB 5CHLB 4H9OB 3LZ1B 3EG5B 5B1MD 1P3LC 4XUJA 4H9NA 1M18D 3B6GA 3AZMD 4J8VB 5AVCA 3X1SD 3LZ0A 4QLCB 3AL0C 4NE5A 4JJNA 2F8NA 3RELD 3V9RB 3UTAD 1AOID 5B31G 5AV6A 1S32A 5G49B 2G5IC 5B1MB 5KDMA 3MVDC 1WWSA 5BT1C 3UTBC 5CPKA 3AV1D 1M19C 4CSRB 3EPKA 3WTPA 3B0CW 5AVBB 3REKB 3LELA 3MGRB 2ZY4A 5C3IC 1BH8B 5GXQC 3RELB 3NQJA 3MGQD 3AV2D 2FFFB 5BO0B 3KWQA 1HQ3C 1M1AA 5GT3D 3AV1B 3REID 1P3ID 5B0YC 5E5AD 5AV8A 4DQYB 4WZSB 5AY8C 4H9QA 1P3LB 3MVDD 3TU4C 3VH6T 1M19D 3AZNA 5GXQD 4J8UA 5B2IC 1P3OC 3UTBB 3MVDB 1P3MD 1M19B 2DQNC 3AZFC 4WU9D 1P3GD 5B0YD 4UUZB 3WA9D 5C3IB 5GXQB 2HIOC 3W97C 2F2AC 2IO5C 3AZGC 3AZEC 1HQ3B 4KUDA 3REJC 3AZHD 2W8SA 2NZDA 1KX5D 5B0YB 1EQZC 3WAAD 5AV9A 3AZKA 1KX3A 1B6WA 2AROD 5B24D 5AY8B 5BS7C 3KUYC 3R45A 5B32D 1P3OD 3AFAC 3TU4B 3MNNA 4CAYB 3AZLA 4WU8C 2BYMA 4G91C 4Z5TC 5JRGC 5B0ZC 1ZLAA 1PZRA 3O62C 3UT9A 3B0BA 5B32B 5B40D 5B2IB 3AZED 1P3OB 3AZFB 1N1JB 2Y2JA 5CPJC 2HIOB 1P3PA 3KFUG 5B31A 3W97B 2IO5B 3AZGB 3AZEB 1P3AC 5AV5C 3KXBD 3AFAD 3REJB 3AYWA 2YFWB 3B6FC 3REHD 5B33C 1EQZB 5B0ZD 4KHAB 3X1TC 4J8WC 5JA4A 1ID3A 3A1KA 4H9PB 3KUYB 3AZIC 5GT0A 5BNXA 3W99A 4J8XC 2BYKB 3AFAB 1F66D 2NQBA 5BNVB 4WU8B 3W98C 4KGCA 3MGPD 3C1CD 2DF4C 4G91B 4Z5TB 5CPJD 5JRGB 5B0ZB 1U35D 3AZJC 3P5JB 1P3KA 4YS3D 3O62B 3W96C 3A6NC 5AV5D 5B1LA 1T3UA 5CPJB 3A1IA 1M18C 3AN2A 1TAFA 3X1TD 4YM6D 1B67A 3C1BC 3AZMC 3X1VA 4H9RB 3X1SC 1P3AB 5AV5B 4R8PD 4X23A 3UTAC 1AOIC 3B6FB 4LD9A 5B33B 3B6GC 2Y2IA 5DNND 5DNMD 1P3FC 3X1TB 3LZ0C 4J8WB 1P3BA 3W96D 3AZIB 2CV5A 2BG1A 3A6ND 5GSUD 4DRAA 5AV6C 4J8XB 2FJ7A 3H0LC 1Z2CB 3MGQC 3AV2C 3W98B 5CPIA 1TZYD 4H9OA 3X1UD 3VH5A 3AZJB 5GT3C 2L5AA 2PYOD 3REIC 3C1BD 1P3IC 3W96B 4Z66A 3A6NB 5E5AC 2Y2LA 3KWQC 1M1AC 4QLCA 4XUJD 4ZUXA 4XZQA 3B6GD 3V9RA 1M18B 1P3FD 5AVCD 3LZ0D 3C1BB 5AV8C 2VQRA 2Y2OA 4JJND 1A7WA 3AZMB 2F8ND 3X1SB 5B2JA 4CSRA 2XD5A 5AV6D 1S32D 3REKA 5AVBA 3UTAB 1AOIB 3MGRA 5CPKD 1BH8A 3RELA 3B6GB 3WTPD 5CP6A 2YFVB 1P3MC 1P3FB 3LZ0B 3AZNC 5BO0A 2LY8A 3EPLA 4WU9C 1WWIA 1P3GC 3WA9C 5AV6B 1S32B 3KWQD 1M1AD 3MGQB 3AV2B 3AZHC 5GT3B 2CWEA 1KX5C 3REIB 1P3IB 5AV8D 1P3LA 3WAAC 5E5AB 2RVQC 1H3OA 2AROC 5B24C 3KWQB 1M1AB 2NZDC 1F1EA 1BH9B 5B32C 3AZND 3MGSA 5AV8B 1KX3C 3UTBA 3B0DC 4J8UD 4UUZA 1KX4A 5GXQA 5B40C 3AZLC 1P3MB 1KU5A 3AZNB 2Y2GA 2Y2KA 4WU9B 1P3GB 1HQ3A 5F99A 1ZLAC 4ZBJC 3WA9B 2RVQD 5B0YA 1R4VA 4KUDD 2NZDD 3KXBC 5AY8A 3AZHB 1KX5B 5AV9D 2JE5A 3AZKD 1KX3D 3REHC 3TU4A 3KSYA 3WAAB 5B31C 2AROB 4WNNB 5B24B 3NQUA 4M6BA 2NZDB 3MNND 3AZLD 1F66C 5AV9B 5B2IA 3MGPC 3EPJA 1KX3B 3C1CC 1ZLAD 1U35C 3UT9D 3AZFA 3B0DB 5GT0C 4YS3C 4HGAC 4G92C 2HIOA 5B40B 3AZLB 4KGCC 1JFIA 3W97A 3AZGA 1ZLAB 3VH6W 3REJA 1P3PD 2Y2HA 4ZBJB 5B31D 4YM6C 1EQZA 3WKJA 3AYWD 4H9PA 4R8PC 3KXBB 3KUYA 4EO5C 2BYKA 1ID3D
chains in the Genus database with same CATH topology
5BNVA 5DNNC 5DNMC 5B31B 4WU8A 5GT0D 3W99D 4Z5TA 5JRGA 3IP4C 4X23C 2NQBD 5GSUC 4KGCD 3EPHA 3O62A 1F66B 4LD9C 3MGPB 3C1CB 1P3KD 1TZYC 3X1UC 1U35B 3LJAA 5GT0B 5FUGB 3H0MC 2PYOC 4YS3B 4HGAB 4G92B 4KGCB 5B1LD 2RIQA 4XUJC 3AN2D 1P3AA 3X1VD 3B6FA 4Z66C 5AVCC 4YM6B 5B33A 1ULYA 4JJNC 4X23D 2ZY3A 4J8WA 2Y2PA 4R8PB 4ZUXC 4XZQC 3AZIA 1S32C 4LD9D 1P34A 5CPKC 4EO5B 1TAFB 3WTPE 4J8XA 3LZ1A 1P3BD 4WV4B 3WTPC 5DNNB 5DNMB 2CV5D 3W98A 3LELC 5B2JC 5B32G 3VH5T 4X23B 3AZJA 5GSUB 2FJ7D 5CPID 4H9SA 3FDDA 4J8VA 4LD9B 5CP6C 1TZYB 3X1UB 1BFMA 4Z66D 5G49A 2PYOB 5B1MA 1M18A 4DRBA 3F6TA 3AZMA 1Q9CA 4ZUXD 4XZQD 2HUEC 3X1SA 4XUJB 4H9NB 1W2EA 3UTAA 1AOIA 4Z66B 5AVCB 3LELD 5B2JD 2UWXA 4JJNB 2F8NB 2YFVA 5AVBD 3REKD 1P3FA 3AV1A 3MGRD 2Y2MA 4J8UC 4ZUXB 4XZQB 5KDMB 5CP6D 5CPKB 3MGSC 3WTPB 4NE6A 3MGQA 4AWLC 3AV2A 3LELB 5B2JB 5GT3A 1KX4C 3NQJB 3REIA 1P3IA 4KUDC 5CP6B 5E5AA 4Z2MG 5F99C 1P3LD 1HTAA 5AV9C 3AZKC 1BH9A 3MVDA 1M19A 4H9QB 2HUEB 4WJ3C 3MNNC 3VH6A 3MGSD 3UTBD 5BT1D 1P3MA 1H3OB 4Z2MH 3UT9C 1KX4D 3VH5W 4WU9A 4J8UB 1P3GA 3WA9A 3MGSB 1HQ3D 5F99D 4AWLB 2ZY2A 3AZHA 1KX5A 1P3PC 3H0RC 4CAYA 1KX4B 4NFTA 3WAAA 4KUDB 3AYWC 5AY8D 2AROA 4WNNA 5B24A 5F99B 2Y2QA 3TU4D 3AZKB 5B32A 1P3OA 1ID3C 3WKJC 1N1JA 3R45B 2JCHA 3W99C 2NQBC 3MNNB 2BYMB 5B2ID 2F8NG 3AZFD 5B40A 3AZEA 1P3KC 2YFWA 3UT9B 3NQUB 2HIOD 4KHAA 3W97D 4E44A 3AZGD 5BS7A 5B1LC 3REJD 3LJAC 3AN2C 3KXBA 3AFAA 3X1VC 1P3PB 1EQZD 3WKJD 2F8NH 3REHA 5B0ZA 3AYWB 3KUYD 1JFIB 4WU8D 1P3BC 5JA4B 1ID3B 1F66A 4Z5TD 5JRGD 3WKJB 2CV5C 3B0CT 5BNXB 3MGPA 3C1CA 3W99B 5CPJA 4UPKA 3O62D 1U35A 2NQBB 2FJ7C 5FUGA 1P34C 2ZY5A 4YS3A 2G5HC 5CPIC 3LZ1C 4H9RA 3LJAD 5AV5A 1P3KB 4H9SC 4J8VC 3X1TA 4QLCC 4YM6A 1P3AD 2ZM5A 5B1LB 4E45A 3LJAB 2F8NK 3B6FD 2Y2NA 3AN2B 4R8PA 5B33D 3X1VB 2JSSA 5B1MC 4J8WD 5DNNA 5AVBC 5DNMA 3REKC 3AZID 1P34D 3MGRC 3W96A 4J8XD 3LZ1D 5GSUA 3A6NA 3RELC 2XD1A 3W98D 1P3BB 4NE3A 2CV5B 3AZJD 3AV1C 1TZYA 3X1UA 3REHB 4J8VD 2FJ7B 1P34B 2PYOA 4QLCD 2J8PA 3C1BA 5CPIB 5CHLB 4H9OB 3LZ1B 3EG5B 5B1MD 1P3LC 4XUJA 4H9NA 1M18D 3B6GA 3AZMD 4J8VB 5AVCA 3X1SD 3LZ0A 4QLCB 3AL0C 4NE5A 4JJNA 2F8NA 3RELD 3V9RB 3UTAD 1AOID 5B31G 5AV6A 1S32A 5G49B 2G5IC 5B1MB 5KDMA 3MVDC 1WWSA 5BT1C 3UTBC 5CPKA 3AV1D 1M19C 4CSRB 3EPKA 3WTPA 3B0CW 5AVBB 3REKB 3LELA 3MGRB 2ZY4A 5C3IC 1BH8B 5GXQC 3RELB 3NQJA 3MGQD 3AV2D 2FFFB 5BO0B 3KWQA 1HQ3C 1M1AA 5GT3D 3AV1B 3REID 1P3ID 5B0YC 5E5AD 5AV8A 4DQYB 4WZSB 5AY8C 4H9QA 1P3LB 3MVDD 3TU4C 3VH6T 1M19D 3AZNA 5GXQD 4J8UA 5B2IC 1P3OC 3UTBB 3MVDB 1P3MD 1M19B 2DQNC 3AZFC 4WU9D 1P3GD 5B0YD 4UUZB 3WA9D 5C3IB 5GXQB 2HIOC 3W97C 2F2AC 2IO5C 3AZGC 3AZEC 1HQ3B 4KUDA 3REJC 3AZHD 2W8SA 2NZDA 1KX5D 5B0YB 1EQZC 3WAAD 5AV9A 3AZKA 1KX3A 1B6WA 2AROD 5B24D 5AY8B 5BS7C 3KUYC 3R45A 5B32D 1P3OD 3AFAC 3TU4B 3MNNA 4CAYB 3AZLA 4WU8C 2BYMA 4G91C 4Z5TC 5JRGC 5B0ZC 1ZLAA 1PZRA 3O62C 3UT9A 3B0BA 5B32B 5B40D 5B2IB 3AZED 1P3OB 3AZFB 1N1JB 2Y2JA 5CPJC 2HIOB 1P3PA 3KFUG 5B31A 3W97B 2IO5B 3AZGB 3AZEB 1P3AC 5AV5C 3KXBD 3AFAD 3REJB 3AYWA 2YFWB 3B6FC 3REHD 5B33C 1EQZB 5B0ZD 4KHAB 3X1TC 4J8WC 5JA4A 1ID3A 3A1KA 4H9PB 3KUYB 3AZIC 5GT0A 5BNXA 3W99A 4J8XC 2BYKB 3AFAB 1F66D 2NQBA 5BNVB 4WU8B 3W98C 4KGCA 3MGPD 3C1CD 2DF4C 4G91B 4Z5TB 5CPJD 5JRGB 5B0ZB 1U35D 3AZJC 3P5JB 1P3KA 4YS3D 3O62B 3W96C 3A6NC 5AV5D 5B1LA 1T3UA 5CPJB 3A1IA 1M18C 3AN2A 1TAFA 3X1TD 4YM6D 1B67A 3C1BC 3AZMC 3X1VA 4H9RB 3X1SC 1P3AB 5AV5B 4R8PD 4X23A 3UTAC 1AOIC 3B6FB 4LD9A 5B33B 3B6GC 2Y2IA 5DNND 5DNMD 1P3FC 3X1TB 3LZ0C 4J8WB 1P3BA 3W96D 3AZIB 2CV5A 2BG1A 3A6ND 5GSUD 4DRAA 5AV6C 4J8XB 2FJ7A 3H0LC 1Z2CB 3MGQC 3AV2C 3W98B 5CPIA 1TZYD 4H9OA 3X1UD 3VH5A 3AZJB 5GT3C 2L5AA 2PYOD 3REIC 3C1BD 1P3IC 3W96B 4Z66A 3A6NB 5E5AC 2Y2LA 3KWQC 1M1AC 4QLCA 4XUJD 4ZUXA 4XZQA 3B6GD 3V9RA 1M18B 1P3FD 5AVCD 3LZ0D 3C1BB 5AV8C 2VQRA 2Y2OA 4JJND 1A7WA 3AZMB 2F8ND 3X1SB 5B2JA 4CSRA 2XD5A 5AV6D 1S32D 3REKA 5AVBA 3UTAB 1AOIB 3MGRA 5CPKD 1BH8A 3RELA 3B6GB 3WTPD 5CP6A 2YFVB 1P3MC 1P3FB 3LZ0B 3AZNC 5BO0A 2LY8A 3EPLA 4WU9C 1WWIA 1P3GC 3WA9C 5AV6B 1S32B 3KWQD 1M1AD 3MGQB 3AV2B 3AZHC 5GT3B 2CWEA 1KX5C 3REIB 1P3IB 5AV8D 1P3LA 3WAAC 5E5AB 2RVQC 1H3OA 2AROC 5B24C 3KWQB 1M1AB 2NZDC 1F1EA 1BH9B 5B32C 3AZND 3MGSA 5AV8B 1KX3C 3UTBA 3B0DC 4J8UD 4UUZA 1KX4A 5GXQA 5B40C 3AZLC 1P3MB 1KU5A 3AZNB 2Y2GA 2Y2KA 4WU9B 1P3GB 1HQ3A 5F99A 1ZLAC 4ZBJC 3WA9B 2RVQD 5B0YA 1R4VA 4KUDD 2NZDD 3KXBC 5AY8A 3AZHB 1KX5B 5AV9D 2JE5A 3AZKD 1KX3D 3REHC 3TU4A 3KSYA 3WAAB 5B31C 2AROB 4WNNB 5B24B 3NQUA 4M6BA 2NZDB 3MNND 3AZLD 1F66C 5AV9B 5B2IA 3MGPC 3EPJA 1KX3B 3C1CC 1ZLAD 1U35C 3UT9D 3AZFA 3B0DB 5GT0C 4YS3C 4HGAC 4G92C 2HIOA 5B40B 3AZLB 4KGCC 1JFIA 3W97A 3AZGA 1ZLAB 3VH6W 3REJA 1P3PD 2Y2HA 4ZBJB 5B31D 4YM6C 1EQZA 3WKJA 3AYWD 4H9PA 4R8PC 3KXBB 3KUYA 4EO5C 2BYKA 1ID3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNV A;  5DNN C;  5DNM C;  5B31 B;  4WU8 A;  5GT0 D;  3W99 D;  4Z5T A;  5JRG A;  4X23 C;  2NQB D;  5GSU C;  4KGC D;  3O62 A;  1F66 B;  4LD9 C;  3MGP B;  3C1C B;  1P3K D;  1TZY C;  3X1U C;  1U35 B;  3LJA A;  5GT0 B;  5FUG B;  2PYO C;  4YS3 B;  4HGA B;  4G92 B;  4KGC B;  5B1L D;  4XUJ C;  3AN2 D;  1P3A A;  3X1V D;  3B6F A;  4Z66 C;  5AVC C;  4YM6 B;  5B33 A;  1ULY A;  4JJN C;  4X23 D;  4J8W A;  4R8P B;  1S32 C;  4ZUX C;  4XZQ C;  3AZI A;  4LD9 D;  1P34 A;  5CPK C;  4EO5 B;  1TAF B;  3WTP E;  4J8X A;  3LZ1 A;  1P3B D;  4WV4 B;  3WTP C;  5DNN B;  5DNM B;  2CV5 D;  3W98 A;  3LEL C;  5B2J C;  5B32 G;  3VH5 T;  4X23 B;  3AZJ A;  5GSU B;  2FJ7 D;  5CPI D;  4H9S A;  4J8V A;  4LD9 B;  5CP6 C;  1TZY B;  3X1U B;  1BFM A;  4Z66 D;  5G49 A;  2PYO B;  5B1M A;  1M18 A;  4DRB A;  3AZM A;  1Q9C A;  4ZUX D;  4XZQ D;  2HUE C;  3X1S A;  4XUJ B;  4H9N B;  3UTA A;  1AOI A;  4Z66 B;  5AVC B;  3LEL D;  5B2J D;  4JJN B;  2F8N B;  2YFV A;  5AVB D;  3REK D;  1P3F A;  3AV1 A;  3MGR D;  4J8U C;  4ZUX B;  4XZQ B;  5KDM B;  5CP6 D;  5CPK B;  3MGS C;  3WTP B;  4NE6 A;  3MGQ A;  4AWL C;  3AV2 A;  3LEL B;  5B2J B;  5GT3 A;  1KX4 C;  3NQJ B;  3REI A;  1P3I A;  4KUD C;  5CP6 B;  5E5A A;  4Z2M G;  5F99 C;  1P3L D;  1HTA A;  5AV9 C;  3AZK C;  1BH9 A;  3MVD A;  1M19 A;  4H9Q B;  2HUE B;  3MNN C;  3VH6 A;  3MGS D;  3UTB D;  5BT1 D;  1P3M A;  1H3O B;  4Z2M H;  3UT9 C;  1KX4 D;  3VH5 W;  4WU9 A;  4J8U B;  1P3G A;  3WA9 A;  3MGS B;  1HQ3 D;  5F99 D;  4AWL B;  3AZH A;  1KX5 A;  1P3P C;  1KX4 B;  4CAY A;  4NFT A;  3WAA A;  4KUD B;  3AYW C;  5AY8 D;  2ARO A;  4WNN A;  5B24 A;  5F99 B;  3TU4 D;  3AZK B;  5B32 A;  1P3O A;  1ID3 C;  3WKJ C;  1N1J A;  3R45 B;  3W99 C;  2NQB C;  3MNN B;  2BYM B;  5B2I D;  2F8N G;  3AZF D;  5B40 A;  3AZE A;  1P3K C;  2YFW A;  3UT9 B;  3NQU B;  2HIO D;  4KHA A;  3W97 D;  4E44 A;  3AZG D;  5BS7 A;  5B1L C;  3REJ D;  3LJA C;  3AN2 C;  3KXB A;  3AFA A;  3X1V C;  1P3P B;  1EQZ D;  3WKJ D;  2F8N H;  3REH A;  5B0Z A;  3AYW B;  3KUY D;  1JFI B;  4WU8 D;  1P3B C;  5JA4 B;  1ID3 B;  1F66 A;  4Z5T D;  5JRG D;  3WKJ B;  2CV5 C;  3B0C T;  5BNX B;  3MGP A;  3C1C A;  3W99 B;  5CPJ A;  3O62 D;  1U35 A;  2NQB B;  2FJ7 C;  5FUG A;  1P34 C;  4YS3 A;  5CPI C;  3LZ1 C;  4H9R A;  3LJA D;  5AV5 A;  1P3K B;  4H9S C;  4J8V C;  3X1T A;  4QLC C;  4YM6 A;  1P3A D;  5B1L B;  4E45 A;  3LJA B;  2F8N K;  3B6F D;  3AN2 B;  4R8P A;  5B33 D;  3X1V B;  2JSS A;  5B1M C;  4J8W D;  5DNN A;  5AVB C;  5DNM A;  3REK C;  3AZI D;  1P34 D;  3MGR C;  3W96 A;  4J8X D;  3LZ1 D;  5GSU A;  3A6N A;  3REL C;  3W98 D;  1P3B B;  4NE3 A;  2CV5 B;  3AZJ D;  3AV1 C;  1TZY A;  3X1U A;  3REH B;  4J8V D;  2FJ7 B;  1P34 B;  2PYO A;  4QLC D;  3C1B A;  5CPI B;  5CHL B;  4H9O B;  3LZ1 B;  5B1M D;  1P3L C;  4XUJ A;  4H9N A;  1M18 D;  3B6G A;  3AZM D;  4J8V B;  5AVC A;  3X1S D;  3LZ0 A;  4QLC B;  4NE5 A;  4JJN A;  2F8N A;  3REL D;  3V9R B;  3UTA D;  1AOI D;  5B31 G;  5AV6 A;  1S32 A;  5G49 B;  5B1M B;  5KDM A;  3MVD C;  1WWS A;  5BT1 C;  3UTB C;  5CPK A;  3AV1 D;  1M19 C;  4CSR B;  3WTP A;  3B0C W;  5AVB B;  3REK B;  3LEL A;  3MGR B;  5C3I C;  1BH8 B;  5GXQ C;  3REL B;  3NQJ A;  3MGQ D;  3AV2 D;  5BO0 B;  3KWQ A;  1HQ3 C;  1M1A A;  5GT3 D;  3AV1 B;  3REI D;  1P3I D;  5B0Y C;  5E5A D;  5AV8 A;  4WZS B;  5AY8 C;  4H9Q A;  1P3L B;  3MVD D;  3TU4 C;  3VH6 T;  1M19 D;  3AZN A;  5GXQ D;  4J8U A;  5B2I C;  1P3O C;  3UTB B;  3MVD B;  1P3M D;  1M19 B;  3AZF C;  4WU9 D;  1P3G D;  5B0Y D;  4UUZ B;  3WA9 D;  5C3I B;  5GXQ B;  2HIO C;  3W97 C;  2IO5 C;  3AZG C;  3AZE C;  1HQ3 B;  4KUD A;  3REJ C;  3AZH D;  2NZD A;  1KX5 D;  5B0Y B;  1EQZ C;  3WAA D;  5AV9 A;  3AZK A;  1KX3 A;  1B6W A;  2ARO D;  5B24 D;  5AY8 B;  5BS7 C;  3KUY C;  3R45 A;  5B32 D;  1P3O D;  3AFA C;  3TU4 B;  3MNN A;  4CAY B;  3AZL A;  4WU8 C;  2BYM A;  4G91 C;  4Z5T C;  5JRG C;  5B0Z C;  1ZLA A;  3O62 C;  3UT9 A;  3B0B A;  5B32 B;  5B40 D;  5B2I B;  3AZE D;  1P3O B;  3AZF B;  1N1J B;  5CPJ C;  2HIO B;  1P3P A;  5B31 A;  3W97 B;  2IO5 B;  3AZG B;  3AZE B;  1P3A C;  5AV5 C;  3KXB D;  3AFA D;  3REJ B;  3AYW A;  2YFW B;  3B6F C;  3REH D;  5B33 C;  1EQZ B;  5B0Z D;  4KHA B;  3X1T C;  4J8W C;  5JA4 A;  1ID3 A;  4H9P B;  3KUY B;  3AZI C;  5GT0 A;  5BNX A;  3W99 A;  4J8X C;  2BYK B;  3AFA B;  1F66 D;  2NQB A;  5BNV B;  4WU8 B;  3W98 C;  4KGC A;  3MGP D;  3C1C D;  4G91 B;  4Z5T B;  5CPJ D;  5JRG B;  5B0Z B;  1U35 D;  3AZJ C;  1P3K A;  4YS3 D;  3O62 B;  3W96 C;  3A6N C;  5AV5 D;  5B1L A;  5CPJ B;  1M18 C;  3AN2 A;  1TAF A;  3X1T D;  4YM6 D;  1B67 A;  3C1B C;  3AZM C;  3X1V A;  4H9R B;  3X1S C;  1P3A B;  5AV5 B;  4R8P D;  4X23 A;  3UTA C;  1AOI C;  3B6F B;  4LD9 A;  5B33 B;  3B6G C;  5DNN D;  5DNM D;  1P3F C;  3X1T B;  3LZ0 C;  4J8W B;  1P3B A;  3W96 D;  3AZI B;  2CV5 A;  3A6N D;  5GSU D;  4DRA A;  5AV6 C;  4J8X B;  2FJ7 A;  3MGQ C;  3AV2 C;  3W98 B;  5CPI A;  1TZY D;  4H9O A;  3X1U D;  3VH5 A;  3AZJ B;  5GT3 C;  2L5A A;  2PYO D;  3REI C;  3C1B D;  1P3I C;  3W96 B;  4Z66 A;  3A6N B;  5E5A C;  3KWQ C;  1M1A C;  4QLC A;  4XUJ D;  4ZUX A;  4XZQ A;  3B6G D;  3V9R A;  1M18 B;  1P3F D;  5AVC D;  3LZ0 D;  3C1B B;  5AV8 C;  3AZM B;  4JJN D;  1A7W A;  2F8N D;  3X1S B;  5B2J A;  4CSR A;  5AV6 D;  1S32 D;  3REK A;  5AVB A;  3UTA B;  1AOI B;  3MGR A;  5CPK D;  1BH8 A;  3REL A;  3B6G B;  3WTP D;  5CP6 A;  2YFV B;  1P3M C;  1P3F B;  3LZ0 B;  3AZN C;  5BO0 A;  2LY8 A;  4WU9 C;  1WWI A;  1P3G C;  3WA9 C;  5AV6 B;  1S32 B;  3KWQ D;  1M1A D;  3MGQ B;  3AV2 B;  3AZH C;  5GT3 B;  2CWE A;  1KX5 C;  3REI B;  1P3I B;  5AV8 D;  1P3L A;  3WAA C;  5E5A B;  2RVQ C;  1H3O A;  2ARO C;  5B24 C;  3KWQ B;  1M1A B;  2NZD C;  1F1E A;  1BH9 B;  5B32 C;  3AZN D;  3MGS A;  5AV8 B;  1KX3 C;  3UTB A;  3B0D C;  4J8U D;  4UUZ A;  1KX4 A;  5GXQ A;  5B40 C;  3AZL C;  1P3M B;  1KU5 A;  3AZN B;  4WU9 B;  1P3G B;  1HQ3 A;  5F99 A;  1ZLA C;  4ZBJ C;  3WA9 B;  2RVQ D;  5B0Y A;  1R4V A;  4KUD D;  2NZD D;  3KXB C;  5AY8 A;  3AZH B;  1KX5 B;  5AV9 D;  3AZK D;  1KX3 D;  3REH C;  3TU4 A;  3KSY A;  3WAA B;  5B31 C;  2ARO B;  5B24 B;  4WNN B;  3NQU A;  4M6B A;  2NZD B;  3MNN D;  3AZL D;  1F66 C;  5AV9 B;  5B2I A;  3MGP C;  1KX3 B;  1ZLA D;  3C1C C;  1U35 C;  3UT9 D;  3AZF A;  3B0D B;  5GT0 C;  4YS3 C;  4HGA C;  4G92 C;  2HIO A;  5B40 B;  3AZL B;  4KGC C;  1JFI A;  3W97 A;  3AZG A;  1ZLA B;  3VH6 W;  3REJ A;  1P3P D;  4ZBJ B;  5B31 D;  4YM6 C;  1EQZ A;  3WKJ A;  3AYW D;  4H9P A;  4R8P C;  3KXB B;  3KUY A;  4EO5 C;  2BYK A;  1ID3 D; 
#chains in the Genus database with same CATH topology
 5BNV A;  5DNN C;  5DNM C;  5B31 B;  4WU8 A;  5GT0 D;  3W99 D;  4Z5T A;  5JRG A;  3IP4 C;  4X23 C;  2NQB D;  5GSU C;  4KGC D;  3EPH A;  3O62 A;  1F66 B;  4LD9 C;  3MGP B;  3C1C B;  1P3K D;  1TZY C;  3X1U C;  1U35 B;  3LJA A;  5GT0 B;  5FUG B;  3H0M C;  2PYO C;  4YS3 B;  4HGA B;  4G92 B;  4KGC B;  5B1L D;  2RIQ A;  4XUJ C;  3AN2 D;  1P3A A;  3X1V D;  3B6F A;  4Z66 C;  5AVC C;  4YM6 B;  5B33 A;  1ULY A;  4JJN C;  4X23 D;  2ZY3 A;  4J8W A;  2Y2P A;  4R8P B;  4ZUX C;  4XZQ C;  3AZI A;  1S32 C;  4LD9 D;  1P34 A;  5CPK C;  4EO5 B;  1TAF B;  3WTP E;  4J8X A;  3LZ1 A;  1P3B D;  4WV4 B;  3WTP C;  5DNN B;  5DNM B;  2CV5 D;  3W98 A;  3LEL C;  5B2J C;  5B32 G;  3VH5 T;  4X23 B;  3AZJ A;  5GSU B;  2FJ7 D;  5CPI D;  4H9S A;  3FDD A;  4J8V A;  4LD9 B;  5CP6 C;  1TZY B;  3X1U B;  1BFM A;  4Z66 D;  5G49 A;  2PYO B;  5B1M A;  1M18 A;  4DRB A;  3F6T A;  3AZM A;  1Q9C A;  4ZUX D;  4XZQ D;  2HUE C;  3X1S A;  4XUJ B;  4H9N B;  1W2E A;  3UTA A;  1AOI A;  4Z66 B;  5AVC B;  3LEL D;  5B2J D;  2UWX A;  4JJN B;  2F8N B;  2YFV A;  5AVB D;  3REK D;  1P3F A;  3AV1 A;  3MGR D;  2Y2M A;  4J8U C;  4ZUX B;  4XZQ B;  5KDM B;  5CP6 D;  5CPK B;  3MGS C;  3WTP B;  4NE6 A;  3MGQ A;  4AWL C;  3AV2 A;  3LEL B;  5B2J B;  5GT3 A;  1KX4 C;  3NQJ B;  3REI A;  1P3I A;  4KUD C;  5CP6 B;  5E5A A;  4Z2M G;  5F99 C;  1P3L D;  1HTA A;  5AV9 C;  3AZK C;  1BH9 A;  3MVD A;  1M19 A;  4H9Q B;  2HUE B;  4WJ3 C;  3MNN C;  3VH6 A;  3MGS D;  3UTB D;  5BT1 D;  1P3M A;  1H3O B;  4Z2M H;  3UT9 C;  1KX4 D;  3VH5 W;  4WU9 A;  4J8U B;  1P3G A;  3WA9 A;  3MGS B;  1HQ3 D;  5F99 D;  4AWL B;  2ZY2 A;  3AZH A;  1KX5 A;  1P3P C;  3H0R C;  4CAY A;  1KX4 B;  4NFT A;  3WAA A;  4KUD B;  3AYW C;  5AY8 D;  2ARO A;  4WNN A;  5B24 A;  5F99 B;  2Y2Q A;  3TU4 D;  3AZK B;  5B32 A;  1P3O A;  1ID3 C;  3WKJ C;  1N1J A;  3R45 B;  2JCH A;  3W99 C;  2NQB C;  3MNN B;  2BYM B;  5B2I D;  2F8N G;  3AZF D;  5B40 A;  3AZE A;  1P3K C;  2YFW A;  3UT9 B;  3NQU B;  2HIO D;  4KHA A;  3W97 D;  4E44 A;  3AZG D;  5BS7 A;  5B1L C;  3REJ D;  3LJA C;  3AN2 C;  3KXB A;  3AFA A;  3X1V C;  1P3P B;  1EQZ D;  3WKJ D;  2F8N H;  3REH A;  5B0Z A;  3AYW B;  3KUY D;  1JFI B;  4WU8 D;  1P3B C;  5JA4 B;  1ID3 B;  1F66 A;  4Z5T D;  5JRG D;  3WKJ B;  2CV5 C;  3B0C T;  5BNX B;  3MGP A;  3C1C A;  3W99 B;  5CPJ A;  4UPK A;  3O62 D;  1U35 A;  2NQB B;  2FJ7 C;  5FUG A;  1P34 C;  2ZY5 A;  4YS3 A;  2G5H C;  5CPI C;  3LZ1 C;  4H9R A;  3LJA D;  5AV5 A;  1P3K B;  4H9S C;  4J8V C;  3X1T A;  4QLC C;  4YM6 A;  1P3A D;  2ZM5 A;  5B1L B;  4E45 A;  3LJA B;  2F8N K;  3B6F D;  2Y2N A;  3AN2 B;  4R8P A;  5B33 D;  3X1V B;  2JSS A;  5B1M C;  4J8W D;  5DNN A;  5AVB C;  5DNM A;  3REK C;  3AZI D;  1P34 D;  3MGR C;  3W96 A;  4J8X D;  3LZ1 D;  5GSU A;  3A6N A;  3REL C;  2XD1 A;  3W98 D;  1P3B B;  4NE3 A;  2CV5 B;  3AZJ D;  3AV1 C;  1TZY A;  3X1U A;  3REH B;  4J8V D;  2FJ7 B;  1P34 B;  2PYO A;  4QLC D;  2J8P A;  3C1B A;  5CPI B;  5CHL B;  4H9O B;  3LZ1 B;  3EG5 B;  5B1M D;  1P3L C;  4XUJ A;  4H9N A;  1M18 D;  3B6G A;  3AZM D;  4J8V B;  5AVC A;  3X1S D;  3LZ0 A;  4QLC B;  3AL0 C;  4NE5 A;  4JJN A;  2F8N A;  3REL D;  3V9R B;  3UTA D;  1AOI D;  5B31 G;  5AV6 A;  1S32 A;  5G49 B;  2G5I C;  5B1M B;  5KDM A;  3MVD C;  1WWS A;  5BT1 C;  3UTB C;  5CPK A;  3AV1 D;  1M19 C;  4CSR B;  3EPK A;  3WTP A;  3B0C W;  5AVB B;  3REK B;  3LEL A;  3MGR B;  2ZY4 A;  5C3I C;  1BH8 B;  5GXQ C;  3REL B;  3NQJ A;  3MGQ D;  3AV2 D;  2FFF B;  5BO0 B;  3KWQ A;  1HQ3 C;  1M1A A;  5GT3 D;  3AV1 B;  3REI D;  1P3I D;  5B0Y C;  5E5A D;  5AV8 A;  4DQY B;  4WZS B;  5AY8 C;  4H9Q A;  1P3L B;  3MVD D;  3TU4 C;  3VH6 T;  1M19 D;  3AZN A;  5GXQ D;  4J8U A;  5B2I C;  1P3O C;  3UTB B;  3MVD B;  1P3M D;  1M19 B;  2DQN C;  3AZF C;  4WU9 D;  1P3G D;  5B0Y D;  4UUZ B;  3WA9 D;  5C3I B;  5GXQ B;  2HIO C;  3W97 C;  2F2A C;  2IO5 C;  3AZG C;  3AZE C;  1HQ3 B;  4KUD A;  3REJ C;  3AZH D;  2W8S A;  2NZD A;  1KX5 D;  5B0Y B;  1EQZ C;  3WAA D;  5AV9 A;  3AZK A;  1KX3 A;  1B6W A;  2ARO D;  5B24 D;  5AY8 B;  5BS7 C;  3KUY C;  3R45 A;  5B32 D;  1P3O D;  3AFA C;  3TU4 B;  3MNN A;  4CAY B;  3AZL A;  4WU8 C;  2BYM A;  4G91 C;  4Z5T C;  5JRG C;  5B0Z C;  1ZLA A;  1PZR A;  3O62 C;  3UT9 A;  3B0B A;  5B32 B;  5B40 D;  5B2I B;  3AZE D;  1P3O B;  3AZF B;  1N1J B;  2Y2J A;  5CPJ C;  2HIO B;  1P3P A;  3KFU G;  5B31 A;  3W97 B;  2IO5 B;  3AZG B;  3AZE B;  1P3A C;  5AV5 C;  3KXB D;  3AFA D;  3REJ B;  3AYW A;  2YFW B;  3B6F C;  3REH D;  5B33 C;  1EQZ B;  5B0Z D;  4KHA B;  3X1T C;  4J8W C;  5JA4 A;  1ID3 A;  3A1K A;  4H9P B;  3KUY B;  3AZI C;  5GT0 A;  5BNX A;  3W99 A;  4J8X C;  2BYK B;  3AFA B;  1F66 D;  2NQB A;  5BNV B;  4WU8 B;  3W98 C;  4KGC A;  3MGP D;  3C1C D;  2DF4 C;  4G91 B;  4Z5T B;  5CPJ D;  5JRG B;  5B0Z B;  1U35 D;  3AZJ C;  3P5J B;  1P3K A;  4YS3 D;  3O62 B;  3W96 C;  3A6N C;  5AV5 D;  5B1L A;  1T3U A;  5CPJ B;  3A1I A;  1M18 C;  3AN2 A;  1TAF A;  3X1T D;  4YM6 D;  1B67 A;  3C1B C;  3AZM C;  3X1V A;  4H9R B;  3X1S C;  1P3A B;  5AV5 B;  4R8P D;  4X23 A;  3UTA C;  1AOI C;  3B6F B;  4LD9 A;  5B33 B;  3B6G C;  2Y2I A;  5DNN D;  5DNM D;  1P3F C;  3X1T B;  3LZ0 C;  4J8W B;  1P3B A;  3W96 D;  3AZI B;  2CV5 A;  2BG1 A;  3A6N D;  5GSU D;  4DRA A;  5AV6 C;  4J8X B;  2FJ7 A;  3H0L C;  1Z2C B;  3MGQ C;  3AV2 C;  3W98 B;  5CPI A;  1TZY D;  4H9O A;  3X1U D;  3VH5 A;  3AZJ B;  5GT3 C;  2L5A A;  2PYO D;  3REI C;  3C1B D;  1P3I C;  3W96 B;  4Z66 A;  3A6N B;  5E5A C;  2Y2L A;  3KWQ C;  1M1A C;  4QLC A;  4XUJ D;  4ZUX A;  4XZQ A;  3B6G D;  3V9R A;  1M18 B;  1P3F D;  5AVC D;  3LZ0 D;  3C1B B;  5AV8 C;  2VQR A;  2Y2O A;  4JJN D;  1A7W A;  3AZM B;  2F8N D;  3X1S B;  5B2J A;  4CSR A;  2XD5 A;  5AV6 D;  1S32 D;  3REK A;  5AVB A;  3UTA B;  1AOI B;  3MGR A;  5CPK D;  1BH8 A;  3REL A;  3B6G B;  3WTP D;  5CP6 A;  2YFV B;  1P3M C;  1P3F B;  3LZ0 B;  3AZN C;  5BO0 A;  2LY8 A;  3EPL A;  4WU9 C;  1WWI A;  1P3G C;  3WA9 C;  5AV6 B;  1S32 B;  3KWQ D;  1M1A D;  3MGQ B;  3AV2 B;  3AZH C;  5GT3 B;  2CWE A;  1KX5 C;  3REI B;  1P3I B;  5AV8 D;  1P3L A;  3WAA C;  5E5A B;  2RVQ C;  1H3O A;  2ARO C;  5B24 C;  3KWQ B;  1M1A B;  2NZD C;  1F1E A;  1BH9 B;  5B32 C;  3AZN D;  3MGS A;  5AV8 B;  1KX3 C;  3UTB A;  3B0D C;  4J8U D;  4UUZ A;  1KX4 A;  5GXQ A;  5B40 C;  3AZL C;  1P3M B;  1KU5 A;  3AZN B;  2Y2G A;  2Y2K A;  4WU9 B;  1P3G B;  1HQ3 A;  5F99 A;  1ZLA C;  4ZBJ C;  3WA9 B;  2RVQ D;  5B0Y A;  1R4V A;  4KUD D;  2NZD D;  3KXB C;  5AY8 A;  3AZH B;  1KX5 B;  5AV9 D;  2JE5 A;  3AZK D;  1KX3 D;  3REH C;  3TU4 A;  3KSY A;  3WAA B;  5B31 C;  2ARO B;  4WNN B;  5B24 B;  3NQU A;  4M6B A;  2NZD B;  3MNN D;  3AZL D;  1F66 C;  5AV9 B;  5B2I A;  3MGP C;  3EPJ A;  1KX3 B;  3C1C C;  1ZLA D;  1U35 C;  3UT9 D;  3AZF A;  3B0D B;  5GT0 C;  4YS3 C;  4HGA C;  4G92 C;  2HIO A;  5B40 B;  3AZL B;  4KGC C;  1JFI A;  3W97 A;  3AZG A;  1ZLA B;  3VH6 W;  3REJ A;  1P3P D;  2Y2H A;  4ZBJ B;  5B31 D;  4YM6 C;  1EQZ A;  3WKJ A;  3AYW D;  4H9P A;  4R8P C;  3KXB B;  3KUY A;  4EO5 C;  2BYK A;  1ID3 D; 
#chains in the Genus database with same CATH homology
 5BNV A;  5DNN C;  5DNM C;  5B31 B;  4WU8 A;  5GT0 D;  3W99 D;  4Z5T A;  5JRG A;  3IP4 C;  4X23 C;  2NQB D;  5GSU C;  4KGC D;  3EPH A;  3O62 A;  1F66 B;  4LD9 C;  3MGP B;  3C1C B;  1P3K D;  1TZY C;  3X1U C;  1U35 B;  3LJA A;  5GT0 B;  5FUG B;  3H0M C;  2PYO C;  4YS3 B;  4HGA B;  4G92 B;  4KGC B;  5B1L D;  2RIQ A;  4XUJ C;  3AN2 D;  1P3A A;  3X1V D;  3B6F A;  4Z66 C;  5AVC C;  4YM6 B;  5B33 A;  1ULY A;  4JJN C;  4X23 D;  2ZY3 A;  4J8W A;  2Y2P A;  4R8P B;  4ZUX C;  4XZQ C;  3AZI A;  1S32 C;  4LD9 D;  1P34 A;  5CPK C;  4EO5 B;  1TAF B;  3WTP E;  4J8X A;  3LZ1 A;  1P3B D;  4WV4 B;  3WTP C;  5DNN B;  5DNM B;  2CV5 D;  3W98 A;  3LEL C;  5B2J C;  5B32 G;  3VH5 T;  4X23 B;  3AZJ A;  5GSU B;  2FJ7 D;  5CPI D;  4H9S A;  3FDD A;  4J8V A;  4LD9 B;  5CP6 C;  1TZY B;  3X1U B;  1BFM A;  4Z66 D;  5G49 A;  2PYO B;  5B1M A;  1M18 A;  4DRB A;  3F6T A;  3AZM A;  1Q9C A;  4ZUX D;  4XZQ D;  2HUE C;  3X1S A;  4XUJ B;  4H9N B;  1W2E A;  3UTA A;  1AOI A;  4Z66 B;  5AVC B;  3LEL D;  5B2J D;  2UWX A;  4JJN B;  2F8N B;  2YFV A;  5AVB D;  3REK D;  1P3F A;  3AV1 A;  3MGR D;  2Y2M A;  4J8U C;  4ZUX B;  4XZQ B;  5KDM B;  5CP6 D;  5CPK B;  3MGS C;  3WTP B;  4NE6 A;  3MGQ A;  4AWL C;  3AV2 A;  3LEL B;  5B2J B;  5GT3 A;  1KX4 C;  3NQJ B;  3REI A;  1P3I A;  4KUD C;  5CP6 B;  5E5A A;  4Z2M G;  5F99 C;  1P3L D;  1HTA A;  5AV9 C;  3AZK C;  1BH9 A;  3MVD A;  1M19 A;  4H9Q B;  2HUE B;  4WJ3 C;  3MNN C;  3VH6 A;  3MGS D;  3UTB D;  5BT1 D;  1P3M A;  1H3O B;  4Z2M H;  3UT9 C;  1KX4 D;  3VH5 W;  4WU9 A;  4J8U B;  1P3G A;  3WA9 A;  3MGS B;  1HQ3 D;  5F99 D;  4AWL B;  2ZY2 A;  3AZH A;  1KX5 A;  1P3P C;  3H0R C;  4CAY A;  1KX4 B;  4NFT A;  3WAA A;  4KUD B;  3AYW C;  5AY8 D;  2ARO A;  4WNN A;  5B24 A;  5F99 B;  2Y2Q A;  3TU4 D;  3AZK B;  5B32 A;  1P3O A;  1ID3 C;  3WKJ C;  1N1J A;  3R45 B;  2JCH A;  3W99 C;  2NQB C;  3MNN B;  2BYM B;  5B2I D;  2F8N G;  3AZF D;  5B40 A;  3AZE A;  1P3K C;  2YFW A;  3UT9 B;  3NQU B;  2HIO D;  4KHA A;  3W97 D;  4E44 A;  3AZG D;  5BS7 A;  5B1L C;  3REJ D;  3LJA C;  3AN2 C;  3KXB A;  3AFA A;  3X1V C;  1P3P B;  1EQZ D;  3WKJ D;  2F8N H;  3REH A;  5B0Z A;  3AYW B;  3KUY D;  1JFI B;  4WU8 D;  1P3B C;  5JA4 B;  1ID3 B;  1F66 A;  4Z5T D;  5JRG D;  3WKJ B;  2CV5 C;  3B0C T;  5BNX B;  3MGP A;  3C1C A;  3W99 B;  5CPJ A;  4UPK A;  3O62 D;  1U35 A;  2NQB B;  2FJ7 C;  5FUG A;  1P34 C;  2ZY5 A;  4YS3 A;  2G5H C;  5CPI C;  3LZ1 C;  4H9R A;  3LJA D;  5AV5 A;  1P3K B;  4H9S C;  4J8V C;  3X1T A;  4QLC C;  4YM6 A;  1P3A D;  2ZM5 A;  5B1L B;  4E45 A;  3LJA B;  2F8N K;  3B6F D;  2Y2N A;  3AN2 B;  4R8P A;  5B33 D;  3X1V B;  2JSS A;  5B1M C;  4J8W D;  5DNN A;  5AVB C;  5DNM A;  3REK C;  3AZI D;  1P34 D;  3MGR C;  3W96 A;  4J8X D;  3LZ1 D;  5GSU A;  3A6N A;  3REL C;  2XD1 A;  3W98 D;  1P3B B;  4NE3 A;  2CV5 B;  3AZJ D;  3AV1 C;  1TZY A;  3X1U A;  3REH B;  4J8V D;  2FJ7 B;  1P34 B;  2PYO A;  4QLC D;  2J8P A;  3C1B A;  5CPI B;  5CHL B;  4H9O B;  3LZ1 B;  3EG5 B;  5B1M D;  1P3L C;  4XUJ A;  4H9N A;  1M18 D;  3B6G A;  3AZM D;  4J8V B;  5AVC A;  3X1S D;  3LZ0 A;  4QLC B;  3AL0 C;  4NE5 A;  4JJN A;  2F8N A;  3REL D;  3V9R B;  3UTA D;  1AOI D;  5B31 G;  5AV6 A;  1S32 A;  5G49 B;  2G5I C;  5B1M B;  5KDM A;  3MVD C;  1WWS A;  5BT1 C;  3UTB C;  5CPK A;  3AV1 D;  1M19 C;  4CSR B;  3EPK A;  3WTP A;  3B0C W;  5AVB B;  3REK B;  3LEL A;  3MGR B;  2ZY4 A;  5C3I C;  1BH8 B;  5GXQ C;  3REL B;  3NQJ A;  3MGQ D;  3AV2 D;  2FFF B;  5BO0 B;  3KWQ A;  1HQ3 C;  1M1A A;  5GT3 D;  3AV1 B;  3REI D;  1P3I D;  5B0Y C;  5E5A D;  5AV8 A;  4DQY B;  4WZS B;  5AY8 C;  4H9Q A;  1P3L B;  3MVD D;  3TU4 C;  3VH6 T;  1M19 D;  3AZN A;  5GXQ D;  4J8U A;  5B2I C;  1P3O C;  3UTB B;  3MVD B;  1P3M D;  1M19 B;  2DQN C;  3AZF C;  4WU9 D;  1P3G D;  5B0Y D;  4UUZ B;  3WA9 D;  5C3I B;  5GXQ B;  2HIO C;  3W97 C;  2F2A C;  2IO5 C;  3AZG C;  3AZE C;  1HQ3 B;  4KUD A;  3REJ C;  3AZH D;  2W8S A;  2NZD A;  1KX5 D;  5B0Y B;  1EQZ C;  3WAA D;  5AV9 A;  3AZK A;  1KX3 A;  1B6W A;  2ARO D;  5B24 D;  5AY8 B;  5BS7 C;  3KUY C;  3R45 A;  5B32 D;  1P3O D;  3AFA C;  3TU4 B;  3MNN A;  4CAY B;  3AZL A;  4WU8 C;  2BYM A;  4G91 C;  4Z5T C;  5JRG C;  5B0Z C;  1ZLA A;  1PZR A;  3O62 C;  3UT9 A;  3B0B A;  5B32 B;  5B40 D;  5B2I B;  3AZE D;  1P3O B;  3AZF B;  1N1J B;  2Y2J A;  5CPJ C;  2HIO B;  1P3P A;  3KFU G;  5B31 A;  3W97 B;  2IO5 B;  3AZG B;  3AZE B;  1P3A C;  5AV5 C;  3KXB D;  3AFA D;  3REJ B;  3AYW A;  2YFW B;  3B6F C;  3REH D;  5B33 C;  1EQZ B;  5B0Z D;  4KHA B;  3X1T C;  4J8W C;  5JA4 A;  1ID3 A;  3A1K A;  4H9P B;  3KUY B;  3AZI C;  5GT0 A;  5BNX A;  3W99 A;  4J8X C;  2BYK B;  3AFA B;  1F66 D;  2NQB A;  5BNV B;  4WU8 B;  3W98 C;  4KGC A;  3MGP D;  3C1C D;  2DF4 C;  4G91 B;  4Z5T B;  5CPJ D;  5JRG B;  5B0Z B;  1U35 D;  3AZJ C;  3P5J B;  1P3K A;  4YS3 D;  3O62 B;  3W96 C;  3A6N C;  5AV5 D;  5B1L A;  1T3U A;  5CPJ B;  3A1I A;  1M18 C;  3AN2 A;  1TAF A;  3X1T D;  4YM6 D;  1B67 A;  3C1B C;  3AZM C;  3X1V A;  4H9R B;  3X1S C;  1P3A B;  5AV5 B;  4R8P D;  4X23 A;  3UTA C;  1AOI C;  3B6F B;  4LD9 A;  5B33 B;  3B6G C;  2Y2I A;  5DNN D;  5DNM D;  1P3F C;  3X1T B;  3LZ0 C;  4J8W B;  1P3B A;  3W96 D;  3AZI B;  2CV5 A;  2BG1 A;  3A6N D;  5GSU D;  4DRA A;  5AV6 C;  4J8X B;  2FJ7 A;  3H0L C;  1Z2C B;  3MGQ C;  3AV2 C;  3W98 B;  5CPI A;  1TZY D;  4H9O A;  3X1U D;  3VH5 A;  3AZJ B;  5GT3 C;  2L5A A;  2PYO D;  3REI C;  3C1B D;  1P3I C;  3W96 B;  4Z66 A;  3A6N B;  5E5A C;  2Y2L A;  3KWQ C;  1M1A C;  4QLC A;  4XUJ D;  4ZUX A;  4XZQ A;  3B6G D;  3V9R A;  1M18 B;  1P3F D;  5AVC D;  3LZ0 D;  3C1B B;  5AV8 C;  2VQR A;  2Y2O A;  4JJN D;  1A7W A;  3AZM B;  2F8N D;  3X1S B;  5B2J A;  4CSR A;  2XD5 A;  5AV6 D;  1S32 D;  3REK A;  5AVB A;  3UTA B;  1AOI B;  3MGR A;  5CPK D;  1BH8 A;  3REL A;  3B6G B;  3WTP D;  5CP6 A;  2YFV B;  1P3M C;  1P3F B;  3LZ0 B;  3AZN C;  5BO0 A;  2LY8 A;  3EPL A;  4WU9 C;  1WWI A;  1P3G C;  3WA9 C;  5AV6 B;  1S32 B;  3KWQ D;  1M1A D;  3MGQ B;  3AV2 B;  3AZH C;  5GT3 B;  2CWE A;  1KX5 C;  3REI B;  1P3I B;  5AV8 D;  1P3L A;  3WAA C;  5E5A B;  2RVQ C;  1H3O A;  2ARO C;  5B24 C;  3KWQ B;  1M1A B;  2NZD C;  1F1E A;  1BH9 B;  5B32 C;  3AZN D;  3MGS A;  5AV8 B;  1KX3 C;  3UTB A;  3B0D C;  4J8U D;  4UUZ A;  1KX4 A;  5GXQ A;  5B40 C;  3AZL C;  1P3M B;  1KU5 A;  3AZN B;  2Y2G A;  2Y2K A;  4WU9 B;  1P3G B;  1HQ3 A;  5F99 A;  1ZLA C;  4ZBJ C;  3WA9 B;  2RVQ D;  5B0Y A;  1R4V A;  4KUD D;  2NZD D;  3KXB C;  5AY8 A;  3AZH B;  1KX5 B;  5AV9 D;  2JE5 A;  3AZK D;  1KX3 D;  3REH C;  3TU4 A;  3KSY A;  3WAA B;  5B31 C;  2ARO B;  4WNN B;  5B24 B;  3NQU A;  4M6B A;  2NZD B;  3MNN D;  3AZL D;  1F66 C;  5AV9 B;  5B2I A;  3MGP C;  3EPJ A;  1KX3 B;  3C1C C;  1ZLA D;  1U35 C;  3UT9 D;  3AZF A;  3B0D B;  5GT0 C;  4YS3 C;  4HGA C;  4G92 C;  2HIO A;  5B40 B;  3AZL B;  4KGC C;  1JFI A;  3W97 A;  3AZG A;  1ZLA B;  3VH6 W;  3REJ A;  1P3P D;  2Y2H A;  4ZBJ B;  5B31 D;  4YM6 C;  1EQZ A;  3WKJ A;  3AYW D;  4H9P A;  4R8P C;  3KXB B;  3KUY A;  4EO5 C;  2BYK A;  1ID3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...