3A6ND

The nucleosome containing a testis-specific histone variant, human h3t
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1t
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3a6nD00
5B0ZB 5B2JA 3AZHD 3TU4A 1BH8A 3B6FC 2BYMB 3B0BA 3REKC 5CPJC 1P3AB 3KUYA 3REIB 1M18A 4EO5B 3AFAA 4R8PB 3LELD 2YFVB 4H9QB 1P3KC 1S32B 3WAAD 3KXBA 3UTAA 3AN2A 4WU9C 1KX4C 3W99B 1A7WA 2YFWA 4CSRA 3AZHC 3LZ1A 3A6NB 4WU8B 4G92C 3W96B 4XZQA 4WNNA 4G91C 5B31A 4WV4B 5DNMD 2L5AA 3VH6T 3NQJA 1HQ3A 4H9NB 3LELC 1M1AB 3RELA 3X1VB 5B32A 2FJ7B 3WAAC 5E5AD 4LD9A 4X23D 5AY8B 1KX5A 5B2JD 4YM6B 3TU4D 5AVCB 4KUDB 1F66B 5GSUA 2CWEA 5AV8B 3AZKB 4J8UB 2BYKB 2HIOA 1P34A 1M18D 4ZBJC 3AFAD 4KHAB 3X1TA 5DNMC 3C1BC 5B1MD 5BO0B 3UTAD 1M19A 3AZNA 5GT3A 1KX4D 4H9SC 5E5AC 3AN2D 3W97B 4X23C 4Z5TA 5B2JC 3LZ1D 1EQZB 3AZGB 4XUJA 5B40B 1TZYB 1N1JB 3TU4C 1P3OB 4XZQD 1H3OB 5B31D 1P3ID 1AOIB 3AZEB 2F8NK 3AZLA 3KUYC 2F8NA 1M18C 1KX3A 3R45A 1P3MB 1P3BA 4LD9D 1KU5A 3V9RA 3KXBC 3UTAC 1KX5D 4H9OA 3AN2C 1P3PB 2HUEB 3WTPC 4ZUXB 3LZ1C 1B67A 5CPIB 3KWQA 5DNNB 5FUGA 3LZ0D 3AYWA 4XZQC 5CHLB 3REJB 1B6WA 2HIOD 5B31C 2NZDD 1P34D 3MNNB 5F99A 3X1TD 3MGQB 4J8VD 5B0YB 3WA9B 1HQ3C 5CPKB 3RELC 3VH5T 1BH9A 5B32C 1HTAA 3MVDA 1M19D 3AZND 4QLCA 5GT3D 4YS3B 4Z5TD 5B2IB 1ID3A 1KX5C 5BNVB 3C1CB 4XUJD 2CV5B 3AV1B 1P3GB 5GSUC 2HIOC 3WKJA 5B1LB 3AZLD 1P34C 2F8ND 3X1TC 3MGPC 4KGCB 5AVBB 1KX3D 2NQBD 3LJAA 1ZLAB 3B0CT 3W98A 2YFVA 1WWSA 1P3BD 1S32A 1M19C 3MGSA 3AZNC 5GT3C 5BS7A 4Z5TC 3W99A 3REKB 4XUJC 3KWQD 5CPJB 3AYWD 5F99D 1P3KB 5B33A 1P3LA 3AZLC 3UT9B 1KX3C 4WU9B 1KX4B 5C3IC 3MVDD 4QLCD 1P3BC 5B24B 1ID3D 4G92B 5G49B 4G91B 5B1MA 3AZIB 3AV2B 4NFTA 3KWQC 3AYWC 3LELB 3WKJD 3AZKA 4J8UA 2BYKA 5F99C 3WAAB 3LJAD 3B6GB 2IO5C 2PYOA 3W98D 4AWLB 3MVDC 1S32D 1P3IA 3MGSD 4QLCC 1ID3C 3W99D 5GT0A 5AV5A 3X1UB 4WU8D 4ZBJB 3W96D 4J8XA 5DNMB 3NQUB 3C1BB 3VH6W 4CAYB 5AV6B 5JA4B 1AOIA 5B33D 3AZEA 1P3LD 3WKJC 3REHA 4X23B 3LJAC 3LZ0A 3AZJA 1TAFA 3W98C 3O62A 2NZDA 3MGSC 5AY8D 3TU4B 1BH8B 4J8VA 5BS7C 1U35A 3AZMA 2AROA 4Z66B 5AVCD 4JJNB 4UUZA 4H9PB 5CPIA 3KUYB 1M18B 3AZKD 4J8UD 5B33C 1P3LC 3KXBB 3MGQA 4J8WB 2PYOD 5CPKA 3AZFA 3AN2B 3WTPB 2YFWB 4CSRB 3AFAC 5GT0D 4NE6A 5JRGA 2NQBA 4XZQB 5AV5D 3UTBA 4WNNB 5B1MC 5B31B 3C1CA 2CV5A 4J8XD 1R4VA 1P3OD 3NQJB 1HQ3B 3X1SA 4DRAA 3RELB 3AZED 1AOID 3AZKC 5B32B 4J8UC 3REHD 4Z2MG 1P3FB 3AZJD 2PYOC 1KX5B 5GXQB 4E44A 3O62D 1P3IC 5B31G 3MGRA 1U35D 3AZMD 5GT0C 5GSUB 2AROD 4H9RA 4ZUXD 5BNXA 5AV5C 5B32G 2HIOB 5CPID 1P34B 4LD9C 3X1TB 5AV9A 4J8XC 3MGPB 5B0ZA 1AOIC 3VH5W 3MGQD 1M19B 3AZNB 3REHC 5GT3B 5CP6B 3UT9A 5CPKD 3AZFD 3AZJC 2BYMA 3LZ0C 4Z5TB 3O62C 2NZDC 4YS3D 1P3AA 5B24A 3REIA 4J8VC 5JRGD 4R8PA 3UTBD 1U35C 2HUEC 3AZMC 3C1CD 5G49A 4H9QA 2AROC 2CV5D 4HGAC 3AV1D 3AZIA 5CPIC 3AV2A 2F8NB 3B6FB 1WWIA 3X1SD 1KX3B 5C3IB 3B0CW 3A6NA 1JFIB 3V9RB 3MGQC 4WU8A 3B6GA 4H9OB 3W96A 3AZFC 5CPKC 3MGRD 2RVQD 3KWQB 2F8NG 5FUGB 5JRGC 4H9NA 3AYWB 1M1AA 3UTBC 2NQBC 3X1VA 3C1CC 3X1UA 2CV5C 5KDMB 3AZHB 2FJ7A 5F99B 5AV9D 3WTPE 5AY8A 5B0ZD 3C1BA 4YM6A 3X1SC 5AV6A 1BH9B 5JA4A 3MVDB 4E45A 5AVCA 3UT9D 4KUDA 1ID3B 4WU9D 1F66A 5AV8A 3B0DC 1P3AD 3MGRC 5B24D 2RVQC 3REID 4KHAA 4R8PD 4DRBA 1BFMA 3AZID 3WKJB 5BO0A 4Z66A 3AV2D 4JJNA 4H9PA 5AV9C 3W97A 3LJAB 5B0ZC 3W98B 1EQZA 3A6ND 3AZGA 3MGSB 5B40A 1TZYA 1N1JA 3VH6A 3UT9C 3B6GD 4J8WA 1P3OA 1H3OA 3WTPA 4WZSB 1P3AC 5B24C 5E5AB 3REIC 4EO5C 1M1AD 4R8PC 2JSSA 3X1VD 5B2JB 3X1UD 2FJ7D 1P3MA 1S32C 3AZIC 5B33B 1P3LB 3AV2C 4M6BA 3C1BD 4YM6D 1P3PA 5AV6D 3W99C 4ZUXA 4KUDD 3A6NC 4WU8C 1P3FA 5DNNA 3AFAB 3W96C 1F66D 3B6GC 5AV8D 5GXQA 4AWLC 3REJA 5B1MB 3MNNA 3UTAB 5B0YA 3WA9A 1M1AC 3X1VC 4Z66D 3X1UC 4JJND 3LZ1B 2FJ7C 3KUYD 3W97D 4NE5A 4YS3A 5AY8C 5B2IA 3MGPA 4YM6C 2PYOB 1EQZD 5AV6C 5BNVA 3AZGD 1P3IB 5B40D 1TZYD 5AVCC 4Z2MH 3KXBD 3AV1A 1P3GA 4J8WD 4KUDC 5CP6A 1F66C 3WTPD 5GT0B 5AV8C 5AV5B 2LY8A 5B1LA 4LD9B 4KGCA 5AVBA 4J8XB 4NE3A 1ZLAA 1P3MD 4Z66C 4JJNC 3REHB 1P3PD 1HQ3D 3B6FA 3W97C 3AZJB 3LZ0B 3RELD 1TAFB 5B32D 1EQZC 3REKA 3AZGC 3O62B 2NZDB 5B40C 1TZYC 5DNND 5CPJA 1P3FD 1JFIA 4J8WC 1P3OC 4J8VB 5GXQD 1U35B 5BT1D 3REJD 3VH5A 3AZMB 3MNND 2AROB 3AZEC 4HGAB 1P3KA 5B0YD 3WA9D 4UUZB 5GSUD 4WU9A 1KX4A 1P3MC 5KDMA 3AZHA 4XUJB 3KSYA 5B2ID 3MGPD 1P3PC 3AZFB 4ZUXC 1P3GD 5CP6D 3AZLB 1P3FC 5DNNC 5JRGB 2NQBB 3R45B 5GXQC 5BT1C 3LELA 3REJC 3UTBB 5B1LD 3MNNC 1P3BB 3WAAA 5AVBD 5B0YC 2F8NH 3WA9C 4KGCD 1ZLAD 3X1SB 1F1EA 1ULYA 3B6FD 4YS3C 5B2IC 3REKD 3B0DB 3AV1C 5CPJD 3MGRB 1P3GC 5CP6C 5DNMA 3NQUA 2IO5B 4CAYA 4H9RB 5BNXB 1P3KD 5B1LC 4QLCB 1Q9CA 4H9SA 5AVBC 5E5AA 5AV9B 4KGCC 4X23A 1ZLAC
chains in the Genus database with same CATH superfamily
5B0ZB 5B2JA 3AZHD 3TU4A 1BH8A 3B6FC 2BYMB 3B0BA 3REKC 2UWXA 5CPJC 1P3AB 1W2EA 3KUYA 3REIB 1M18A 4EO5B 3AFAA 4R8PB 3LELD 2YFVB 4H9QB 1P3KC 1S32B 3WAAD 3KXBA 3UTAA 3AN2A 4WU9C 1KX4C 3W99B 1A7WA 2YFWA 4CSRA 3AZHC 3LZ1A 3A6NB 4WU8B 4G92C 3W96B 4XZQA 4WNNA 2Y2KA 4G91C 5B31A 4WV4B 5DNMD 2L5AA 3VH6T 3NQJA 1HQ3A 4H9NB 3LELC 1M1AB 3RELA 3X1VB 5B32A 2FJ7B 3WAAC 5E5AD 4LD9A 4X23D 5AY8B 1KX5A 5B2JD 4YM6B 3TU4D 5AVCB 4KUDB 2Y2QA 1F66B 5GSUA 3AL0C 2CWEA 5AV8B 3AZKB 4J8UB 2BYKB 2HIOA 1P34A 1M18D 4ZBJC 3AFAD 4KHAB 3X1TA 5DNMC 3C1BC 5B1MD 5BO0B 3UTAD 1M19A 3AZNA 5GT3A 1KX4D 4H9SC 5E5AC 3AN2D 3W97B 4X23C 4Z5TA 5B2JC 3LZ1D 1EQZB 3AZGB 4XUJA 5B40B 1TZYB 1N1JB 3TU4C 1P3OB 4XZQD 1H3OB 5B31D 1P3ID 2BG1A 1AOIB 3AZEB 2F8NK 3AZLA 2Y2OA 3KUYC 1M18C 2F8NA 1KX3A 3R45A 2DQNC 1P3MB 1P3BA 4LD9D 1KU5A 3V9RA 3KXBC 3UTAC 1KX5D 4H9OA 3AN2C 1P3PB 2HUEB 3WTPC 4ZUXB 2VQRA 3LZ1C 1B67A 5CPIB 3KWQA 5DNNB 5FUGA 3LZ0D 3AYWA 4XZQC 5CHLB 3REJB 1B6WA 2HIOD 5B31C 2NZDD 1P34D 3MNNB 5F99A 3X1TD 3MGQB 4J8VD 5B0YB 3WA9B 1PZRA 1HQ3C 5CPKB 3RELC 3VH5T 1BH9A 5B32C 1HTAA 3MVDA 1M19D 3AZND 4QLCA 5GT3D 4YS3B 4Z5TD 5B2IB 1ID3A 1KX5C 3H0RC 5BNVB 3C1CB 4XUJD 2CV5B 3AV1B 2ZY3A 1P3GB 2DF4C 5GSUC 2HIOC 3WKJA 5B1LB 3AZLD 1P34C 2F8ND 3X1TC 3MGPC 4KGCB 5AVBB 1KX3D 2NQBD 3LJAA 1ZLAB 3B0CT 3W98A 2YFVA 1WWSA 1P3BD 1S32A 1M19C 3MGSA 3AZNC 5GT3C 5BS7A 4Z5TC 3W99A 3REKB 4XUJC 3KWQD 5CPJB 3AYWD 4DQYB 2G5IC 5F99D 1P3KB 5B33A 1P3LA 3AZLC 3UT9B 1KX3C 4WU9B 1KX4B 5C3IC 3MVDD 4QLCD 1P3BC 5B24B 1ID3D 4G92B 5G49B 4G91B 5B1MA 3AZIB 3AV2B 4NFTA 3KWQC 3AYWC 3LELB 3WKJD 3AZKA 4J8UA 2BYKA 5F99C 3WAAB 3LJAD 3B6GB 2IO5C 2PYOA 3W98D 4AWLB 3EPHA 3MVDC 1S32D 1P3IA 3MGSD 4QLCC 1ID3C 3W99D 5GT0A 5AV5A 3X1UB 4WU8D 4ZBJB 3W96D 4J8XA 5DNMB 3NQUB 3C1BB 3VH6W 4CAYB 5AV6B 5JA4B 1AOIA 5B33D 3AZEA 1P3LD 3WKJC 2ZM5A 3REHA 3H0LC 4X23B 3LZ0A 3LJAC 1TAFA 3AZJA 3W98C 3O62A 2NZDA 3MGSC 5AY8D 3TU4B 1BH8B 4J8VA 5BS7C 1U35A 3AZMA 2XD5A 2AROA 4Z66B 5AVCD 4JJNB 4UUZA 4H9PB 5CPIA 3KUYB 1M18B 3AZKD 4J8UD 5B33C 1P3LC 3KXBB 3MGQA 2W8SA 4J8WB 2PYOD 5CPKA 3AZFA 3AN2B 3WTPB 2YFWB 4CSRB 2G5HC 2F2AC 3AFAC 5GT0D 3EG5B 4NE6A 5JRGA 2NQBA 4XZQB 5AV5D 3UTBA 2Y2JA 4WNNB 5B1MC 5B31B 3C1CA 2CV5A 4J8XD 1R4VA 1P3OD 3NQJB 1HQ3B 3X1SA 4DRAA 3RELB 3AZED 1AOID 3AZKC 5B32B 4J8UC 2Y2IA 3REHD 4Z2MG 1P3FB 3AZJD 2PYOC 3EPJA 1KX5B 5GXQB 4E44A 3O62D 1P3IC 5B31G 3MGRA 3IP4C 1U35D 3AZMD 2Y2LA 5GT0C 5GSUB 2AROD 4H9RA 4ZUXD 5BNXA 5AV5C 5B32G 2HIOB 5CPID 1P34B 4LD9C 3X1TB 5AV9A 4J8XC 3MGPB 2ZY4A 5B0ZA 3KFUG 1AOIC 3VH5W 3MGQD 1M19B 3AZNB 3REHC 5GT3B 5CP6B 3UT9A 5CPKD 3AZFD 3AZJC 2BYMA 3LZ0C 4Z5TB 2RIQA 3O62C 2NZDC 4YS3D 1P3AA 5B24A 3REIA 4J8VC 5JRGD 4R8PA 3UTBD 1U35C 2HUEC 3AZMC 3C1CD 5G49A 4H9QA 2AROC 2CV5D 4HGAC 3AV1D 3AZIA 5CPIC 3AV2A 2F8NB 3B6FB 1WWIA 3X1SD 1KX3B 5C3IB 3B0CW 3A6NA 1JFIB 3V9RB 3MGQC 4WU8A 3B6GA 4H9OB 3W96A 3AZFC 5CPKC 2JE5A 3MGRD 2RVQD 3KWQB 2F8NG 5FUGB 5JRGC 4H9NA 3AYWB 1M1AA 3UTBC 2NQBC 3X1VA 3F6TA 3C1CC 3X1UA 2CV5C 5KDMB 3AZHB 2FJ7A 5F99B 5AV9D 3WTPE 5AY8A 5B0ZD 3C1BA 4YM6A 3X1SC 5AV6A 1BH9B 5JA4A 3MVDB 4E45A 5AVCA 3UT9D 4KUDA 1ID3B 4WU9D 1F66A 5AV8A 3B0DC 1P3AD 2Y2MA 5B24D 2RVQC 3MGRC 3REID 4KHAA 2ZY2A 4R8PD 2J8PA 4DRBA 2Y2PA 1BFMA 3AZID 3WKJB 5BO0A 4Z66A 3AV2D 4JJNA 1T3UA 4H9PA 5AV9C 3W97A 3LJAB 2Y2GA 5B0ZC 3EPLA 3W98B 1EQZA 3A6ND 3AZGA 3MGSB 5B40A 1TZYA 1N1JA 3VH6A 3UT9C 3B6GD 4J8WA 1P3OA 1H3OA 3WTPA 4WZSB 1P3AC 5B24C 5E5AB 3REIC 4EO5C 1M1AD 4R8PC 2JSSA 3X1VD 5B2JB 3X1UD 2FJ7D 1P3MA 1S32C 3AZIC 5B33B 1P3LB 3AV2C 4M6BA 3C1BD 4YM6D 1P3PA 5AV6D 3W99C 4ZUXA 4KUDD 3A6NC 4WU8C 1P3FA 5DNNA 2XD1A 3W96C 3AFAB 1F66D 3B6GC 5AV8D 5GXQA 4AWLC 3REJA 5B1MB 3MNNA 3UTAB 5B0YA 3WA9A 3H0MC 1M1AC 3X1VC 4Z66D 3X1UC 4JJND 3LZ1B 2FJ7C 3KUYD 3W97D 4NE5A 4YS3A 5AY8C 5B2IA 3MGPA 4YM6C 2PYOB 1EQZD 5AV6C 5BNVA 3AZGD 4UPKA 1P3IB 5B40D 1TZYD 5AVCC 2Y2NA 4Z2MH 3KXBD 3AV1A 4J8WD 1P3GA 4KUDC 5CP6A 1F66C 3WTPD 5GT0B 5AV8C 5AV5B 2ZY5A 2LY8A 5B1LA 4LD9B 4KGCA 5AVBA 4J8XB 4NE3A 1ZLAA 1P3MD 4Z66C 2Y2HA 4JJNC 3REHB 1P3PD 1HQ3D 3B6FA 3W97C 3AZJB 3LZ0B 3RELD 1TAFB 5B32D 1EQZC 3REKA 3AZGC 3O62B 2NZDB 5B40C 1TZYC 5DNND 5CPJA 1P3FD 1JFIA 4J8WC 1P3OC 4J8VB 3FDDA 5GXQD 1U35B 5BT1D 3REJD 3VH5A 3AZMB 3MNND 1Z2CB 2AROB 3AZEC 4HGAB 1P3KA 5B0YD 3WA9D 4UUZB 5GSUD 4WU9A 1KX4A 1P3MC 5KDMA 3AZHA 4XUJB 3A1IA 3KSYA 5B2ID 3MGPD 1P3PC 3AZFB 3EPKA 4ZUXC 1P3GD 5CP6D 3AZLB 1P3FC 5DNNC 5JRGB 2NQBB 3R45B 5GXQC 5BT1C 2JCHA 3LELA 3REJC 5B1LD 3UTBB 3MNNC 1P3BB 3WAAA 5AVBD 5B0YC 2F8NH 3WA9C 4KGCD 1ZLAD 2FFFB 3X1SB 1F1EA 1ULYA 3B6FD 4YS3C 5B2IC 4WJ3C 3A1KA 3REKD 3B0DB 3AV1C 5CPJD 3MGRB 1P3GC 5CP6C 5DNMA 3NQUA 2IO5B 4CAYA 4H9RB 5BNXB 1P3KD 5B1LC 4QLCB 1Q9CA 4H9SA 5AVBC 5E5AA 5AV9B 4KGCC 4X23A 3P5JB 1ZLAC
chains in the Genus database with same CATH topology
5B0ZB 5B2JA 3AZHD 3TU4A 1BH8A 3B6FC 2BYMB 3B0BA 3REKC 2UWXA 5CPJC 1P3AB 1W2EA 3KUYA 3REIB 1M18A 4EO5B 3AFAA 4R8PB 3LELD 2YFVB 4H9QB 1P3KC 1S32B 3WAAD 3KXBA 3UTAA 3AN2A 4WU9C 1KX4C 3W99B 1A7WA 2YFWA 4CSRA 3AZHC 3LZ1A 3A6NB 4WU8B 4G92C 3W96B 4XZQA 4WNNA 2Y2KA 4G91C 5B31A 4WV4B 5DNMD 2L5AA 3VH6T 3NQJA 1HQ3A 4H9NB 3LELC 1M1AB 3RELA 3X1VB 5B32A 2FJ7B 3WAAC 5E5AD 4LD9A 4X23D 5AY8B 1KX5A 5B2JD 4YM6B 3TU4D 5AVCB 4KUDB 2Y2QA 1F66B 5GSUA 3AL0C 2CWEA 5AV8B 3AZKB 4J8UB 2BYKB 2HIOA 1P34A 1M18D 4ZBJC 3AFAD 4KHAB 3X1TA 5DNMC 3C1BC 5B1MD 5BO0B 3UTAD 1M19A 3AZNA 5GT3A 1KX4D 4H9SC 5E5AC 3AN2D 3W97B 4X23C 4Z5TA 5B2JC 3LZ1D 1EQZB 3AZGB 4XUJA 5B40B 1TZYB 1N1JB 3TU4C 1P3OB 4XZQD 1H3OB 5B31D 1P3ID 2BG1A 1AOIB 3AZEB 2F8NK 3AZLA 2Y2OA 3KUYC 1M18C 2F8NA 1KX3A 3R45A 2DQNC 1P3MB 1P3BA 4LD9D 1KU5A 3V9RA 3KXBC 3UTAC 1KX5D 4H9OA 3AN2C 1P3PB 2HUEB 3WTPC 4ZUXB 2VQRA 3LZ1C 1B67A 5CPIB 3KWQA 5DNNB 5FUGA 3LZ0D 3AYWA 4XZQC 5CHLB 3REJB 1B6WA 2HIOD 5B31C 2NZDD 1P34D 3MNNB 5F99A 3X1TD 3MGQB 4J8VD 5B0YB 3WA9B 1PZRA 1HQ3C 5CPKB 3RELC 3VH5T 1BH9A 5B32C 1HTAA 3MVDA 1M19D 3AZND 4QLCA 5GT3D 4YS3B 4Z5TD 5B2IB 1ID3A 1KX5C 3H0RC 5BNVB 3C1CB 4XUJD 2CV5B 3AV1B 2ZY3A 1P3GB 2DF4C 5GSUC 2HIOC 3WKJA 5B1LB 3AZLD 1P34C 2F8ND 3X1TC 3MGPC 4KGCB 5AVBB 1KX3D 2NQBD 3LJAA 1ZLAB 3B0CT 3W98A 2YFVA 1WWSA 1P3BD 1S32A 1M19C 3MGSA 3AZNC 5GT3C 5BS7A 4Z5TC 3W99A 3REKB 4XUJC 3KWQD 5CPJB 3AYWD 4DQYB 2G5IC 5F99D 1P3KB 5B33A 1P3LA 3AZLC 3UT9B 1KX3C 4WU9B 1KX4B 5C3IC 3MVDD 4QLCD 1P3BC 5B24B 1ID3D 4G92B 5G49B 4G91B 5B1MA 3AZIB 3AV2B 4NFTA 3KWQC 3AYWC 3LELB 3WKJD 3AZKA 4J8UA 2BYKA 5F99C 3WAAB 3LJAD 3B6GB 2IO5C 2PYOA 3W98D 4AWLB 3EPHA 3MVDC 1S32D 1P3IA 3MGSD 4QLCC 1ID3C 3W99D 5GT0A 5AV5A 3X1UB 4WU8D 4ZBJB 3W96D 4J8XA 5DNMB 3NQUB 3C1BB 3VH6W 4CAYB 5AV6B 5JA4B 1AOIA 5B33D 3AZEA 1P3LD 3WKJC 2ZM5A 3REHA 3H0LC 4X23B 3LZ0A 3LJAC 1TAFA 3AZJA 3W98C 3O62A 2NZDA 3MGSC 5AY8D 3TU4B 1BH8B 4J8VA 5BS7C 1U35A 3AZMA 2XD5A 2AROA 4Z66B 5AVCD 4JJNB 4UUZA 4H9PB 5CPIA 3KUYB 1M18B 3AZKD 4J8UD 5B33C 1P3LC 3KXBB 3MGQA 2W8SA 4J8WB 2PYOD 5CPKA 3AZFA 3AN2B 3WTPB 2YFWB 4CSRB 2G5HC 2F2AC 3AFAC 5GT0D 3EG5B 4NE6A 5JRGA 2NQBA 4XZQB 5AV5D 3UTBA 2Y2JA 4WNNB 5B1MC 5B31B 3C1CA 2CV5A 4J8XD 1R4VA 1P3OD 3NQJB 1HQ3B 3X1SA 4DRAA 3RELB 3AZED 1AOID 3AZKC 5B32B 4J8UC 2Y2IA 3REHD 4Z2MG 1P3FB 3AZJD 2PYOC 3EPJA 1KX5B 5GXQB 4E44A 3O62D 1P3IC 5B31G 3MGRA 3IP4C 1U35D 3AZMD 2Y2LA 5GT0C 5GSUB 2AROD 4H9RA 4ZUXD 5BNXA 5AV5C 5B32G 2HIOB 5CPID 1P34B 4LD9C 3X1TB 5AV9A 4J8XC 3MGPB 2ZY4A 5B0ZA 3KFUG 1AOIC 3VH5W 3MGQD 1M19B 3AZNB 3REHC 5GT3B 5CP6B 3UT9A 5CPKD 3AZFD 3AZJC 2BYMA 3LZ0C 4Z5TB 2RIQA 3O62C 2NZDC 4YS3D 1P3AA 5B24A 3REIA 4J8VC 5JRGD 4R8PA 3UTBD 1U35C 2HUEC 3AZMC 3C1CD 5G49A 4H9QA 2AROC 2CV5D 4HGAC 3AV1D 3AZIA 5CPIC 3AV2A 2F8NB 3B6FB 1WWIA 3X1SD 1KX3B 5C3IB 3B0CW 3A6NA 1JFIB 3V9RB 3MGQC 4WU8A 3B6GA 4H9OB 3W96A 3AZFC 5CPKC 2JE5A 3MGRD 2RVQD 3KWQB 2F8NG 5FUGB 5JRGC 4H9NA 3AYWB 1M1AA 3UTBC 2NQBC 3X1VA 3F6TA 3C1CC 3X1UA 2CV5C 5KDMB 3AZHB 2FJ7A 5F99B 5AV9D 3WTPE 5AY8A 5B0ZD 3C1BA 4YM6A 3X1SC 5AV6A 1BH9B 5JA4A 3MVDB 4E45A 5AVCA 3UT9D 4KUDA 1ID3B 4WU9D 1F66A 5AV8A 3B0DC 1P3AD 2Y2MA 5B24D 2RVQC 3MGRC 3REID 4KHAA 2ZY2A 4R8PD 2J8PA 4DRBA 2Y2PA 1BFMA 3AZID 3WKJB 5BO0A 4Z66A 3AV2D 4JJNA 1T3UA 4H9PA 5AV9C 3W97A 3LJAB 2Y2GA 5B0ZC 3EPLA 3W98B 1EQZA 3A6ND 3AZGA 3MGSB 5B40A 1TZYA 1N1JA 3VH6A 3UT9C 3B6GD 4J8WA 1P3OA 1H3OA 3WTPA 4WZSB 1P3AC 5B24C 5E5AB 3REIC 4EO5C 1M1AD 4R8PC 2JSSA 3X1VD 5B2JB 3X1UD 2FJ7D 1P3MA 1S32C 3AZIC 5B33B 1P3LB 3AV2C 4M6BA 3C1BD 4YM6D 1P3PA 5AV6D 3W99C 4ZUXA 4KUDD 3A6NC 4WU8C 1P3FA 5DNNA 2XD1A 3W96C 3AFAB 1F66D 3B6GC 5AV8D 5GXQA 4AWLC 3REJA 5B1MB 3MNNA 3UTAB 5B0YA 3WA9A 3H0MC 1M1AC 3X1VC 4Z66D 3X1UC 4JJND 3LZ1B 2FJ7C 3KUYD 3W97D 4NE5A 4YS3A 5AY8C 5B2IA 3MGPA 4YM6C 2PYOB 1EQZD 5AV6C 5BNVA 3AZGD 4UPKA 1P3IB 5B40D 1TZYD 5AVCC 2Y2NA 4Z2MH 3KXBD 3AV1A 4J8WD 1P3GA 4KUDC 5CP6A 1F66C 3WTPD 5GT0B 5AV8C 5AV5B 2ZY5A 2LY8A 5B1LA 4LD9B 4KGCA 5AVBA 4J8XB 4NE3A 1ZLAA 1P3MD 4Z66C 2Y2HA 4JJNC 3REHB 1P3PD 1HQ3D 3B6FA 3W97C 3AZJB 3LZ0B 3RELD 1TAFB 5B32D 1EQZC 3REKA 3AZGC 3O62B 2NZDB 5B40C 1TZYC 5DNND 5CPJA 1P3FD 1JFIA 4J8WC 1P3OC 4J8VB 3FDDA 5GXQD 1U35B 5BT1D 3REJD 3VH5A 3AZMB 3MNND 1Z2CB 2AROB 3AZEC 4HGAB 1P3KA 5B0YD 3WA9D 4UUZB 5GSUD 4WU9A 1KX4A 1P3MC 5KDMA 3AZHA 4XUJB 3A1IA 3KSYA 5B2ID 3MGPD 1P3PC 3AZFB 3EPKA 4ZUXC 1P3GD 5CP6D 3AZLB 1P3FC 5DNNC 5JRGB 2NQBB 3R45B 5GXQC 5BT1C 2JCHA 3LELA 3REJC 5B1LD 3UTBB 3MNNC 1P3BB 3WAAA 5AVBD 5B0YC 2F8NH 3WA9C 4KGCD 1ZLAD 2FFFB 3X1SB 1F1EA 1ULYA 3B6FD 4YS3C 5B2IC 4WJ3C 3A1KA 3REKD 3B0DB 3AV1C 5CPJD 3MGRB 1P3GC 5CP6C 5DNMA 3NQUA 2IO5B 4CAYA 4H9RB 5BNXB 1P3KD 5B1LC 4QLCB 1Q9CA 4H9SA 5AVBC 5E5AA 5AV9B 4KGCC 4X23A 3P5JB 1ZLAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Z B;  5B2J A;  3AZH D;  3TU4 A;  1BH8 A;  3B6F C;  2BYM B;  3B0B A;  3REK C;  5CPJ C;  1P3A B;  3KUY A;  3REI B;  1M18 A;  4EO5 B;  3AFA A;  4R8P B;  3LEL D;  2YFV B;  4H9Q B;  1P3K C;  1S32 B;  3WAA D;  3KXB A;  3UTA A;  3AN2 A;  4WU9 C;  1KX4 C;  3W99 B;  1A7W A;  2YFW A;  4CSR A;  3AZH C;  3LZ1 A;  3A6N B;  4WU8 B;  4G92 C;  3W96 B;  4XZQ A;  4WNN A;  4G91 C;  5B31 A;  4WV4 B;  5DNM D;  2L5A A;  3VH6 T;  3NQJ A;  1HQ3 A;  4H9N B;  3LEL C;  1M1A B;  3REL A;  3X1V B;  5B32 A;  2FJ7 B;  3WAA C;  5E5A D;  4LD9 A;  4X23 D;  5AY8 B;  1KX5 A;  5B2J D;  4YM6 B;  3TU4 D;  5AVC B;  4KUD B;  1F66 B;  5GSU A;  2CWE A;  5AV8 B;  3AZK B;  4J8U B;  2BYK B;  2HIO A;  1P34 A;  1M18 D;  4ZBJ C;  3AFA D;  4KHA B;  3X1T A;  5DNM C;  3C1B C;  5B1M D;  5BO0 B;  3UTA D;  1M19 A;  3AZN A;  5GT3 A;  1KX4 D;  4H9S C;  5E5A C;  3AN2 D;  3W97 B;  4X23 C;  4Z5T A;  5B2J C;  3LZ1 D;  1EQZ B;  3AZG B;  4XUJ A;  5B40 B;  1TZY B;  1N1J B;  3TU4 C;  1P3O B;  4XZQ D;  1H3O B;  5B31 D;  1P3I D;  1AOI B;  3AZE B;  2F8N K;  3AZL A;  3KUY C;  2F8N A;  1M18 C;  1KX3 A;  3R45 A;  1P3M B;  1P3B A;  4LD9 D;  1KU5 A;  3V9R A;  3KXB C;  3UTA C;  1KX5 D;  4H9O A;  3AN2 C;  1P3P B;  2HUE B;  3WTP C;  4ZUX B;  3LZ1 C;  1B67 A;  5CPI B;  3KWQ A;  5DNN B;  5FUG A;  3LZ0 D;  3AYW A;  4XZQ C;  5CHL B;  3REJ B;  1B6W A;  2HIO D;  5B31 C;  2NZD D;  1P34 D;  3MNN B;  5F99 A;  3X1T D;  3MGQ B;  4J8V D;  5B0Y B;  3WA9 B;  1HQ3 C;  5CPK B;  3REL C;  3VH5 T;  1BH9 A;  5B32 C;  1HTA A;  3MVD A;  1M19 D;  3AZN D;  4QLC A;  5GT3 D;  4YS3 B;  4Z5T D;  5B2I B;  1ID3 A;  1KX5 C;  5BNV B;  3C1C B;  4XUJ D;  2CV5 B;  3AV1 B;  1P3G B;  5GSU C;  2HIO C;  3WKJ A;  5B1L B;  3AZL D;  1P34 C;  2F8N D;  3X1T C;  3MGP C;  4KGC B;  5AVB B;  1KX3 D;  2NQB D;  3LJA A;  1ZLA B;  3B0C T;  3W98 A;  2YFV A;  1WWS A;  1P3B D;  1S32 A;  1M19 C;  3MGS A;  3AZN C;  5GT3 C;  5BS7 A;  4Z5T C;  3W99 A;  3REK B;  4XUJ C;  3KWQ D;  5CPJ B;  3AYW D;  5F99 D;  1P3K B;  5B33 A;  1P3L A;  3AZL C;  3UT9 B;  1KX3 C;  4WU9 B;  1KX4 B;  5C3I C;  3MVD D;  4QLC D;  1P3B C;  5B24 B;  1ID3 D;  4G92 B;  5G49 B;  4G91 B;  5B1M A;  3AZI B;  3AV2 B;  4NFT A;  3KWQ C;  3AYW C;  3LEL B;  3WKJ D;  3AZK A;  4J8U A;  2BYK A;  5F99 C;  3WAA B;  3LJA D;  3B6G B;  2IO5 C;  2PYO A;  3W98 D;  4AWL B;  3MVD C;  1S32 D;  1P3I A;  3MGS D;  4QLC C;  1ID3 C;  3W99 D;  5GT0 A;  5AV5 A;  3X1U B;  4WU8 D;  4ZBJ B;  3W96 D;  4J8X A;  5DNM B;  3NQU B;  3C1B B;  3VH6 W;  4CAY B;  5AV6 B;  5JA4 B;  1AOI A;  5B33 D;  3AZE A;  1P3L D;  3WKJ C;  3REH A;  4X23 B;  3LJA C;  3LZ0 A;  3AZJ A;  1TAF A;  3W98 C;  3O62 A;  2NZD A;  3MGS C;  5AY8 D;  3TU4 B;  1BH8 B;  4J8V A;  5BS7 C;  1U35 A;  3AZM A;  2ARO A;  4Z66 B;  5AVC D;  4JJN B;  4UUZ A;  4H9P B;  5CPI A;  3KUY B;  1M18 B;  3AZK D;  4J8U D;  5B33 C;  1P3L C;  3KXB B;  3MGQ A;  4J8W B;  2PYO D;  5CPK A;  3AZF A;  3AN2 B;  3WTP B;  2YFW B;  4CSR B;  3AFA C;  5GT0 D;  4NE6 A;  5JRG A;  2NQB A;  4XZQ B;  5AV5 D;  3UTB A;  4WNN B;  5B1M C;  5B31 B;  3C1C A;  2CV5 A;  4J8X D;  1R4V A;  1P3O D;  3NQJ B;  1HQ3 B;  3X1S A;  4DRA A;  3REL B;  3AZE D;  1AOI D;  3AZK C;  5B32 B;  4J8U C;  3REH D;  4Z2M G;  1P3F B;  3AZJ D;  2PYO C;  1KX5 B;  5GXQ B;  4E44 A;  3O62 D;  1P3I C;  5B31 G;  3MGR A;  1U35 D;  3AZM D;  5GT0 C;  5GSU B;  2ARO D;  4H9R A;  4ZUX D;  5BNX A;  5AV5 C;  5B32 G;  2HIO B;  5CPI D;  1P34 B;  4LD9 C;  3X1T B;  5AV9 A;  4J8X C;  3MGP B;  5B0Z A;  1AOI C;  3VH5 W;  3MGQ D;  1M19 B;  3AZN B;  3REH C;  5GT3 B;  5CP6 B;  3UT9 A;  5CPK D;  3AZF D;  3AZJ C;  2BYM A;  3LZ0 C;  4Z5T B;  3O62 C;  2NZD C;  4YS3 D;  1P3A A;  5B24 A;  3REI A;  4J8V C;  5JRG D;  4R8P A;  3UTB D;  1U35 C;  2HUE C;  3AZM C;  3C1C D;  5G49 A;  4H9Q A;  2ARO C;  2CV5 D;  4HGA C;  3AV1 D;  3AZI A;  5CPI C;  3AV2 A;  2F8N B;  3B6F B;  1WWI A;  3X1S D;  1KX3 B;  5C3I B;  3B0C W;  3A6N A;  1JFI B;  3V9R B;  3MGQ C;  4WU8 A;  3B6G A;  4H9O B;  3W96 A;  3AZF C;  5CPK C;  3MGR D;  2RVQ D;  3KWQ B;  2F8N G;  5FUG B;  5JRG C;  4H9N A;  3AYW B;  1M1A A;  3UTB C;  2NQB C;  3X1V A;  3C1C C;  3X1U A;  2CV5 C;  5KDM B;  3AZH B;  2FJ7 A;  5F99 B;  5AV9 D;  3WTP E;  5AY8 A;  5B0Z D;  3C1B A;  4YM6 A;  3X1S C;  5AV6 A;  1BH9 B;  5JA4 A;  3MVD B;  4E45 A;  5AVC A;  3UT9 D;  4KUD A;  1ID3 B;  4WU9 D;  1F66 A;  5AV8 A;  3B0D C;  1P3A D;  3MGR C;  5B24 D;  2RVQ C;  3REI D;  4KHA A;  4R8P D;  4DRB A;  1BFM A;  3AZI D;  3WKJ B;  5BO0 A;  4Z66 A;  3AV2 D;  4JJN A;  4H9P A;  5AV9 C;  3W97 A;  3LJA B;  5B0Z C;  3W98 B;  1EQZ A;  3A6N D;  3AZG A;  3MGS B;  5B40 A;  1TZY A;  1N1J A;  3VH6 A;  3UT9 C;  3B6G D;  4J8W A;  1P3O A;  1H3O A;  3WTP A;  4WZS B;  1P3A C;  5B24 C;  5E5A B;  3REI C;  4EO5 C;  1M1A D;  4R8P C;  2JSS A;  3X1V D;  5B2J B;  3X1U D;  2FJ7 D;  1P3M A;  1S32 C;  3AZI C;  5B33 B;  1P3L B;  3AV2 C;  4M6B A;  3C1B D;  4YM6 D;  1P3P A;  5AV6 D;  3W99 C;  4ZUX A;  4KUD D;  3A6N C;  4WU8 C;  1P3F A;  5DNN A;  3AFA B;  3W96 C;  1F66 D;  3B6G C;  5AV8 D;  5GXQ A;  4AWL C;  3REJ A;  5B1M B;  3MNN A;  3UTA B;  5B0Y A;  3WA9 A;  1M1A C;  3X1V C;  4Z66 D;  3X1U C;  4JJN D;  3LZ1 B;  2FJ7 C;  3KUY D;  3W97 D;  4NE5 A;  4YS3 A;  5AY8 C;  5B2I A;  3MGP A;  4YM6 C;  2PYO B;  1EQZ D;  5AV6 C;  5BNV A;  3AZG D;  1P3I B;  5B40 D;  1TZY D;  5AVC C;  4Z2M H;  3KXB D;  3AV1 A;  1P3G A;  4J8W D;  4KUD C;  5CP6 A;  1F66 C;  3WTP D;  5GT0 B;  5AV8 C;  5AV5 B;  2LY8 A;  5B1L A;  4LD9 B;  4KGC A;  5AVB A;  4J8X B;  4NE3 A;  1ZLA A;  1P3M D;  4Z66 C;  4JJN C;  3REH B;  1P3P D;  1HQ3 D;  3B6F A;  3W97 C;  3AZJ B;  3LZ0 B;  3REL D;  1TAF B;  5B32 D;  1EQZ C;  3REK A;  3AZG C;  3O62 B;  2NZD B;  5B40 C;  1TZY C;  5DNN D;  5CPJ A;  1P3F D;  1JFI A;  4J8W C;  1P3O C;  4J8V B;  5GXQ D;  1U35 B;  5BT1 D;  3REJ D;  3VH5 A;  3AZM B;  3MNN D;  2ARO B;  3AZE C;  4HGA B;  1P3K A;  5B0Y D;  3WA9 D;  4UUZ B;  5GSU D;  4WU9 A;  1KX4 A;  1P3M C;  5KDM A;  3AZH A;  4XUJ B;  3KSY A;  5B2I D;  3MGP D;  1P3P C;  3AZF B;  4ZUX C;  1P3G D;  5CP6 D;  3AZL B;  1P3F C;  5DNN C;  5JRG B;  2NQB B;  3R45 B;  5GXQ C;  5BT1 C;  3LEL A;  3REJ C;  3UTB B;  5B1L D;  3MNN C;  1P3B B;  3WAA A;  5AVB D;  5B0Y C;  2F8N H;  3WA9 C;  4KGC D;  1ZLA D;  3X1S B;  1F1E A;  1ULY A;  3B6F D;  4YS3 C;  5B2I C;  3REK D;  3B0D B;  3AV1 C;  5CPJ D;  3MGR B;  1P3G C;  5CP6 C;  5DNM A;  3NQU A;  2IO5 B;  4CAY A;  4H9R B;  5BNX B;  1P3K D;  5B1L C;  4QLC B;  1Q9C A;  4H9S A;  5AVB C;  5E5A A;  5AV9 B;  4KGC C;  4X23 A;  1ZLA C; 
#chains in the Genus database with same CATH topology
 5B0Z B;  5B2J A;  3AZH D;  3TU4 A;  1BH8 A;  3B6F C;  2BYM B;  3B0B A;  3REK C;  2UWX A;  5CPJ C;  1P3A B;  1W2E A;  3KUY A;  3REI B;  1M18 A;  4EO5 B;  3AFA A;  4R8P B;  3LEL D;  2YFV B;  4H9Q B;  1P3K C;  1S32 B;  3WAA D;  3KXB A;  3UTA A;  3AN2 A;  4WU9 C;  1KX4 C;  3W99 B;  1A7W A;  2YFW A;  4CSR A;  3AZH C;  3LZ1 A;  3A6N B;  4WU8 B;  4G92 C;  3W96 B;  4XZQ A;  4WNN A;  2Y2K A;  4G91 C;  5B31 A;  4WV4 B;  5DNM D;  2L5A A;  3VH6 T;  3NQJ A;  1HQ3 A;  4H9N B;  3LEL C;  1M1A B;  3REL A;  3X1V B;  5B32 A;  2FJ7 B;  3WAA C;  5E5A D;  4LD9 A;  4X23 D;  5AY8 B;  1KX5 A;  5B2J D;  4YM6 B;  3TU4 D;  5AVC B;  4KUD B;  2Y2Q A;  1F66 B;  5GSU A;  3AL0 C;  2CWE A;  5AV8 B;  3AZK B;  4J8U B;  2BYK B;  2HIO A;  1P34 A;  1M18 D;  4ZBJ C;  3AFA D;  4KHA B;  3X1T A;  5DNM C;  3C1B C;  5B1M D;  5BO0 B;  3UTA D;  1M19 A;  3AZN A;  5GT3 A;  1KX4 D;  4H9S C;  5E5A C;  3AN2 D;  3W97 B;  4X23 C;  4Z5T A;  5B2J C;  3LZ1 D;  1EQZ B;  3AZG B;  4XUJ A;  5B40 B;  1TZY B;  1N1J B;  3TU4 C;  1P3O B;  4XZQ D;  1H3O B;  5B31 D;  1P3I D;  2BG1 A;  1AOI B;  3AZE B;  2F8N K;  3AZL A;  2Y2O A;  3KUY C;  1M18 C;  2F8N A;  1KX3 A;  3R45 A;  2DQN C;  1P3M B;  1P3B A;  4LD9 D;  1KU5 A;  3V9R A;  3KXB C;  3UTA C;  1KX5 D;  4H9O A;  3AN2 C;  1P3P B;  2HUE B;  3WTP C;  4ZUX B;  2VQR A;  3LZ1 C;  1B67 A;  5CPI B;  3KWQ A;  5DNN B;  5FUG A;  3LZ0 D;  3AYW A;  4XZQ C;  5CHL B;  3REJ B;  1B6W A;  2HIO D;  5B31 C;  2NZD D;  1P34 D;  3MNN B;  5F99 A;  3X1T D;  3MGQ B;  4J8V D;  5B0Y B;  3WA9 B;  1PZR A;  1HQ3 C;  5CPK B;  3REL C;  3VH5 T;  1BH9 A;  5B32 C;  1HTA A;  3MVD A;  1M19 D;  3AZN D;  4QLC A;  5GT3 D;  4YS3 B;  4Z5T D;  5B2I B;  1ID3 A;  1KX5 C;  3H0R C;  5BNV B;  3C1C B;  4XUJ D;  2CV5 B;  3AV1 B;  2ZY3 A;  1P3G B;  2DF4 C;  5GSU C;  2HIO C;  3WKJ A;  5B1L B;  3AZL D;  1P34 C;  2F8N D;  3X1T C;  3MGP C;  4KGC B;  5AVB B;  1KX3 D;  2NQB D;  3LJA A;  1ZLA B;  3B0C T;  3W98 A;  2YFV A;  1WWS A;  1P3B D;  1S32 A;  1M19 C;  3MGS A;  3AZN C;  5GT3 C;  5BS7 A;  4Z5T C;  3W99 A;  3REK B;  4XUJ C;  3KWQ D;  5CPJ B;  3AYW D;  4DQY B;  2G5I C;  5F99 D;  1P3K B;  5B33 A;  1P3L A;  3AZL C;  3UT9 B;  1KX3 C;  4WU9 B;  1KX4 B;  5C3I C;  3MVD D;  4QLC D;  1P3B C;  5B24 B;  1ID3 D;  4G92 B;  5G49 B;  4G91 B;  5B1M A;  3AZI B;  3AV2 B;  4NFT A;  3KWQ C;  3AYW C;  3LEL B;  3WKJ D;  3AZK A;  4J8U A;  2BYK A;  5F99 C;  3WAA B;  3LJA D;  3B6G B;  2IO5 C;  2PYO A;  3W98 D;  4AWL B;  3EPH A;  3MVD C;  1S32 D;  1P3I A;  3MGS D;  4QLC C;  1ID3 C;  3W99 D;  5GT0 A;  5AV5 A;  3X1U B;  4WU8 D;  4ZBJ B;  3W96 D;  4J8X A;  5DNM B;  3NQU B;  3C1B B;  3VH6 W;  4CAY B;  5AV6 B;  5JA4 B;  1AOI A;  5B33 D;  3AZE A;  1P3L D;  3WKJ C;  2ZM5 A;  3REH A;  3H0L C;  4X23 B;  3LZ0 A;  3LJA C;  1TAF A;  3AZJ A;  3W98 C;  3O62 A;  2NZD A;  3MGS C;  5AY8 D;  3TU4 B;  1BH8 B;  4J8V A;  5BS7 C;  1U35 A;  3AZM A;  2XD5 A;  2ARO A;  4Z66 B;  5AVC D;  4JJN B;  4UUZ A;  4H9P B;  5CPI A;  3KUY B;  1M18 B;  3AZK D;  4J8U D;  5B33 C;  1P3L C;  3KXB B;  3MGQ A;  2W8S A;  4J8W B;  2PYO D;  5CPK A;  3AZF A;  3AN2 B;  3WTP B;  2YFW B;  4CSR B;  2G5H C;  2F2A C;  3AFA C;  5GT0 D;  3EG5 B;  4NE6 A;  5JRG A;  2NQB A;  4XZQ B;  5AV5 D;  3UTB A;  2Y2J A;  4WNN B;  5B1M C;  5B31 B;  3C1C A;  2CV5 A;  4J8X D;  1R4V A;  1P3O D;  3NQJ B;  1HQ3 B;  3X1S A;  4DRA A;  3REL B;  3AZE D;  1AOI D;  3AZK C;  5B32 B;  4J8U C;  2Y2I A;  3REH D;  4Z2M G;  1P3F B;  3AZJ D;  2PYO C;  3EPJ A;  1KX5 B;  5GXQ B;  4E44 A;  3O62 D;  1P3I C;  5B31 G;  3MGR A;  3IP4 C;  1U35 D;  3AZM D;  2Y2L A;  5GT0 C;  5GSU B;  2ARO D;  4H9R A;  4ZUX D;  5BNX A;  5AV5 C;  5B32 G;  2HIO B;  5CPI D;  1P34 B;  4LD9 C;  3X1T B;  5AV9 A;  4J8X C;  3MGP B;  2ZY4 A;  5B0Z A;  3KFU G;  1AOI C;  3VH5 W;  3MGQ D;  1M19 B;  3AZN B;  3REH C;  5GT3 B;  5CP6 B;  3UT9 A;  5CPK D;  3AZF D;  3AZJ C;  2BYM A;  3LZ0 C;  4Z5T B;  2RIQ A;  3O62 C;  2NZD C;  4YS3 D;  1P3A A;  5B24 A;  3REI A;  4J8V C;  5JRG D;  4R8P A;  3UTB D;  1U35 C;  2HUE C;  3AZM C;  3C1C D;  5G49 A;  4H9Q A;  2ARO C;  2CV5 D;  4HGA C;  3AV1 D;  3AZI A;  5CPI C;  3AV2 A;  2F8N B;  3B6F B;  1WWI A;  3X1S D;  1KX3 B;  5C3I B;  3B0C W;  3A6N A;  1JFI B;  3V9R B;  3MGQ C;  4WU8 A;  3B6G A;  4H9O B;  3W96 A;  3AZF C;  5CPK C;  2JE5 A;  3MGR D;  2RVQ D;  3KWQ B;  2F8N G;  5FUG B;  5JRG C;  4H9N A;  3AYW B;  1M1A A;  3UTB C;  2NQB C;  3X1V A;  3F6T A;  3C1C C;  3X1U A;  2CV5 C;  5KDM B;  3AZH B;  2FJ7 A;  5F99 B;  5AV9 D;  3WTP E;  5AY8 A;  5B0Z D;  3C1B A;  4YM6 A;  3X1S C;  5AV6 A;  1BH9 B;  5JA4 A;  3MVD B;  4E45 A;  5AVC A;  3UT9 D;  4KUD A;  1ID3 B;  4WU9 D;  1F66 A;  5AV8 A;  3B0D C;  1P3A D;  2Y2M A;  5B24 D;  2RVQ C;  3MGR C;  3REI D;  4KHA A;  2ZY2 A;  4R8P D;  2J8P A;  4DRB A;  2Y2P A;  1BFM A;  3AZI D;  3WKJ B;  5BO0 A;  4Z66 A;  3AV2 D;  4JJN A;  1T3U A;  4H9P A;  5AV9 C;  3W97 A;  3LJA B;  2Y2G A;  5B0Z C;  3EPL A;  3W98 B;  1EQZ A;  3A6N D;  3AZG A;  3MGS B;  5B40 A;  1TZY A;  1N1J A;  3VH6 A;  3UT9 C;  3B6G D;  4J8W A;  1P3O A;  1H3O A;  3WTP A;  4WZS B;  1P3A C;  5B24 C;  5E5A B;  3REI C;  4EO5 C;  1M1A D;  4R8P C;  2JSS A;  3X1V D;  5B2J B;  3X1U D;  2FJ7 D;  1P3M A;  1S32 C;  3AZI C;  5B33 B;  1P3L B;  3AV2 C;  4M6B A;  3C1B D;  4YM6 D;  1P3P A;  5AV6 D;  3W99 C;  4ZUX A;  4KUD D;  3A6N C;  4WU8 C;  1P3F A;  5DNN A;  2XD1 A;  3W96 C;  3AFA B;  1F66 D;  3B6G C;  5AV8 D;  5GXQ A;  4AWL C;  3REJ A;  5B1M B;  3MNN A;  3UTA B;  5B0Y A;  3WA9 A;  3H0M C;  1M1A C;  3X1V C;  4Z66 D;  3X1U C;  4JJN D;  3LZ1 B;  2FJ7 C;  3KUY D;  3W97 D;  4NE5 A;  4YS3 A;  5AY8 C;  5B2I A;  3MGP A;  4YM6 C;  2PYO B;  1EQZ D;  5AV6 C;  5BNV A;  3AZG D;  4UPK A;  1P3I B;  5B40 D;  1TZY D;  5AVC C;  2Y2N A;  4Z2M H;  3KXB D;  3AV1 A;  4J8W D;  1P3G A;  4KUD C;  5CP6 A;  1F66 C;  3WTP D;  5GT0 B;  5AV8 C;  5AV5 B;  2ZY5 A;  2LY8 A;  5B1L A;  4LD9 B;  4KGC A;  5AVB A;  4J8X B;  4NE3 A;  1ZLA A;  1P3M D;  4Z66 C;  2Y2H A;  4JJN C;  3REH B;  1P3P D;  1HQ3 D;  3B6F A;  3W97 C;  3AZJ B;  3LZ0 B;  3REL D;  1TAF B;  5B32 D;  1EQZ C;  3REK A;  3AZG C;  3O62 B;  2NZD B;  5B40 C;  1TZY C;  5DNN D;  5CPJ A;  1P3F D;  1JFI A;  4J8W C;  1P3O C;  4J8V B;  3FDD A;  5GXQ D;  1U35 B;  5BT1 D;  3REJ D;  3VH5 A;  3AZM B;  3MNN D;  1Z2C B;  2ARO B;  3AZE C;  4HGA B;  1P3K A;  5B0Y D;  3WA9 D;  4UUZ B;  5GSU D;  4WU9 A;  1KX4 A;  1P3M C;  5KDM A;  3AZH A;  4XUJ B;  3A1I A;  3KSY A;  5B2I D;  3MGP D;  1P3P C;  3AZF B;  3EPK A;  4ZUX C;  1P3G D;  5CP6 D;  3AZL B;  1P3F C;  5DNN C;  5JRG B;  2NQB B;  3R45 B;  5GXQ C;  5BT1 C;  2JCH A;  3LEL A;  3REJ C;  5B1L D;  3UTB B;  3MNN C;  1P3B B;  3WAA A;  5AVB D;  5B0Y C;  2F8N H;  3WA9 C;  4KGC D;  1ZLA D;  2FFF B;  3X1S B;  1F1E A;  1ULY A;  3B6F D;  4YS3 C;  5B2I C;  4WJ3 C;  3A1K A;  3REK D;  3B0D B;  3AV1 C;  5CPJ D;  3MGR B;  1P3G C;  5CP6 C;  5DNM A;  3NQU A;  2IO5 B;  4CAY A;  4H9R B;  5BNX B;  1P3K D;  5B1L C;  4QLC B;  1Q9C A;  4H9S A;  5AVB C;  5E5A A;  5AV9 B;  4KGC C;  4X23 A;  3P5J B;  1ZLA C; 
#chains in the Genus database with same CATH homology
 5B0Z B;  5B2J A;  3AZH D;  3TU4 A;  1BH8 A;  3B6F C;  2BYM B;  3B0B A;  3REK C;  2UWX A;  5CPJ C;  1P3A B;  1W2E A;  3KUY A;  3REI B;  1M18 A;  4EO5 B;  3AFA A;  4R8P B;  3LEL D;  2YFV B;  4H9Q B;  1P3K C;  1S32 B;  3WAA D;  3KXB A;  3UTA A;  3AN2 A;  4WU9 C;  1KX4 C;  3W99 B;  1A7W A;  2YFW A;  4CSR A;  3AZH C;  3LZ1 A;  3A6N B;  4WU8 B;  4G92 C;  3W96 B;  4XZQ A;  4WNN A;  2Y2K A;  4G91 C;  5B31 A;  4WV4 B;  5DNM D;  2L5A A;  3VH6 T;  3NQJ A;  1HQ3 A;  4H9N B;  3LEL C;  1M1A B;  3REL A;  3X1V B;  5B32 A;  2FJ7 B;  3WAA C;  5E5A D;  4LD9 A;  4X23 D;  5AY8 B;  1KX5 A;  5B2J D;  4YM6 B;  3TU4 D;  5AVC B;  4KUD B;  2Y2Q A;  1F66 B;  5GSU A;  3AL0 C;  2CWE A;  5AV8 B;  3AZK B;  4J8U B;  2BYK B;  2HIO A;  1P34 A;  1M18 D;  4ZBJ C;  3AFA D;  4KHA B;  3X1T A;  5DNM C;  3C1B C;  5B1M D;  5BO0 B;  3UTA D;  1M19 A;  3AZN A;  5GT3 A;  1KX4 D;  4H9S C;  5E5A C;  3AN2 D;  3W97 B;  4X23 C;  4Z5T A;  5B2J C;  3LZ1 D;  1EQZ B;  3AZG B;  4XUJ A;  5B40 B;  1TZY B;  1N1J B;  3TU4 C;  1P3O B;  4XZQ D;  1H3O B;  5B31 D;  1P3I D;  2BG1 A;  1AOI B;  3AZE B;  2F8N K;  3AZL A;  2Y2O A;  3KUY C;  1M18 C;  2F8N A;  1KX3 A;  3R45 A;  2DQN C;  1P3M B;  1P3B A;  4LD9 D;  1KU5 A;  3V9R A;  3KXB C;  3UTA C;  1KX5 D;  4H9O A;  3AN2 C;  1P3P B;  2HUE B;  3WTP C;  4ZUX B;  2VQR A;  3LZ1 C;  1B67 A;  5CPI B;  3KWQ A;  5DNN B;  5FUG A;  3LZ0 D;  3AYW A;  4XZQ C;  5CHL B;  3REJ B;  1B6W A;  2HIO D;  5B31 C;  2NZD D;  1P34 D;  3MNN B;  5F99 A;  3X1T D;  3MGQ B;  4J8V D;  5B0Y B;  3WA9 B;  1PZR A;  1HQ3 C;  5CPK B;  3REL C;  3VH5 T;  1BH9 A;  5B32 C;  1HTA A;  3MVD A;  1M19 D;  3AZN D;  4QLC A;  5GT3 D;  4YS3 B;  4Z5T D;  5B2I B;  1ID3 A;  1KX5 C;  3H0R C;  5BNV B;  3C1C B;  4XUJ D;  2CV5 B;  3AV1 B;  2ZY3 A;  1P3G B;  2DF4 C;  5GSU C;  2HIO C;  3WKJ A;  5B1L B;  3AZL D;  1P34 C;  2F8N D;  3X1T C;  3MGP C;  4KGC B;  5AVB B;  1KX3 D;  2NQB D;  3LJA A;  1ZLA B;  3B0C T;  3W98 A;  2YFV A;  1WWS A;  1P3B D;  1S32 A;  1M19 C;  3MGS A;  3AZN C;  5GT3 C;  5BS7 A;  4Z5T C;  3W99 A;  3REK B;  4XUJ C;  3KWQ D;  5CPJ B;  3AYW D;  4DQY B;  2G5I C;  5F99 D;  1P3K B;  5B33 A;  1P3L A;  3AZL C;  3UT9 B;  1KX3 C;  4WU9 B;  1KX4 B;  5C3I C;  3MVD D;  4QLC D;  1P3B C;  5B24 B;  1ID3 D;  4G92 B;  5G49 B;  4G91 B;  5B1M A;  3AZI B;  3AV2 B;  4NFT A;  3KWQ C;  3AYW C;  3LEL B;  3WKJ D;  3AZK A;  4J8U A;  2BYK A;  5F99 C;  3WAA B;  3LJA D;  3B6G B;  2IO5 C;  2PYO A;  3W98 D;  4AWL B;  3EPH A;  3MVD C;  1S32 D;  1P3I A;  3MGS D;  4QLC C;  1ID3 C;  3W99 D;  5GT0 A;  5AV5 A;  3X1U B;  4WU8 D;  4ZBJ B;  3W96 D;  4J8X A;  5DNM B;  3NQU B;  3C1B B;  3VH6 W;  4CAY B;  5AV6 B;  5JA4 B;  1AOI A;  5B33 D;  3AZE A;  1P3L D;  3WKJ C;  2ZM5 A;  3REH A;  3H0L C;  4X23 B;  3LZ0 A;  3LJA C;  1TAF A;  3AZJ A;  3W98 C;  3O62 A;  2NZD A;  3MGS C;  5AY8 D;  3TU4 B;  1BH8 B;  4J8V A;  5BS7 C;  1U35 A;  3AZM A;  2XD5 A;  2ARO A;  4Z66 B;  5AVC D;  4JJN B;  4UUZ A;  4H9P B;  5CPI A;  3KUY B;  1M18 B;  3AZK D;  4J8U D;  5B33 C;  1P3L C;  3KXB B;  3MGQ A;  2W8S A;  4J8W B;  2PYO D;  5CPK A;  3AZF A;  3AN2 B;  3WTP B;  2YFW B;  4CSR B;  2G5H C;  2F2A C;  3AFA C;  5GT0 D;  3EG5 B;  4NE6 A;  5JRG A;  2NQB A;  4XZQ B;  5AV5 D;  3UTB A;  2Y2J A;  4WNN B;  5B1M C;  5B31 B;  3C1C A;  2CV5 A;  4J8X D;  1R4V A;  1P3O D;  3NQJ B;  1HQ3 B;  3X1S A;  4DRA A;  3REL B;  3AZE D;  1AOI D;  3AZK C;  5B32 B;  4J8U C;  2Y2I A;  3REH D;  4Z2M G;  1P3F B;  3AZJ D;  2PYO C;  3EPJ A;  1KX5 B;  5GXQ B;  4E44 A;  3O62 D;  1P3I C;  5B31 G;  3MGR A;  3IP4 C;  1U35 D;  3AZM D;  2Y2L A;  5GT0 C;  5GSU B;  2ARO D;  4H9R A;  4ZUX D;  5BNX A;  5AV5 C;  5B32 G;  2HIO B;  5CPI D;  1P34 B;  4LD9 C;  3X1T B;  5AV9 A;  4J8X C;  3MGP B;  2ZY4 A;  5B0Z A;  3KFU G;  1AOI C;  3VH5 W;  3MGQ D;  1M19 B;  3AZN B;  3REH C;  5GT3 B;  5CP6 B;  3UT9 A;  5CPK D;  3AZF D;  3AZJ C;  2BYM A;  3LZ0 C;  4Z5T B;  2RIQ A;  3O62 C;  2NZD C;  4YS3 D;  1P3A A;  5B24 A;  3REI A;  4J8V C;  5JRG D;  4R8P A;  3UTB D;  1U35 C;  2HUE C;  3AZM C;  3C1C D;  5G49 A;  4H9Q A;  2ARO C;  2CV5 D;  4HGA C;  3AV1 D;  3AZI A;  5CPI C;  3AV2 A;  2F8N B;  3B6F B;  1WWI A;  3X1S D;  1KX3 B;  5C3I B;  3B0C W;  3A6N A;  1JFI B;  3V9R B;  3MGQ C;  4WU8 A;  3B6G A;  4H9O B;  3W96 A;  3AZF C;  5CPK C;  2JE5 A;  3MGR D;  2RVQ D;  3KWQ B;  2F8N G;  5FUG B;  5JRG C;  4H9N A;  3AYW B;  1M1A A;  3UTB C;  2NQB C;  3X1V A;  3F6T A;  3C1C C;  3X1U A;  2CV5 C;  5KDM B;  3AZH B;  2FJ7 A;  5F99 B;  5AV9 D;  3WTP E;  5AY8 A;  5B0Z D;  3C1B A;  4YM6 A;  3X1S C;  5AV6 A;  1BH9 B;  5JA4 A;  3MVD B;  4E45 A;  5AVC A;  3UT9 D;  4KUD A;  1ID3 B;  4WU9 D;  1F66 A;  5AV8 A;  3B0D C;  1P3A D;  2Y2M A;  5B24 D;  2RVQ C;  3MGR C;  3REI D;  4KHA A;  2ZY2 A;  4R8P D;  2J8P A;  4DRB A;  2Y2P A;  1BFM A;  3AZI D;  3WKJ B;  5BO0 A;  4Z66 A;  3AV2 D;  4JJN A;  1T3U A;  4H9P A;  5AV9 C;  3W97 A;  3LJA B;  2Y2G A;  5B0Z C;  3EPL A;  3W98 B;  1EQZ A;  3A6N D;  3AZG A;  3MGS B;  5B40 A;  1TZY A;  1N1J A;  3VH6 A;  3UT9 C;  3B6G D;  4J8W A;  1P3O A;  1H3O A;  3WTP A;  4WZS B;  1P3A C;  5B24 C;  5E5A B;  3REI C;  4EO5 C;  1M1A D;  4R8P C;  2JSS A;  3X1V D;  5B2J B;  3X1U D;  2FJ7 D;  1P3M A;  1S32 C;  3AZI C;  5B33 B;  1P3L B;  3AV2 C;  4M6B A;  3C1B D;  4YM6 D;  1P3P A;  5AV6 D;  3W99 C;  4ZUX A;  4KUD D;  3A6N C;  4WU8 C;  1P3F A;  5DNN A;  2XD1 A;  3W96 C;  3AFA B;  1F66 D;  3B6G C;  5AV8 D;  5GXQ A;  4AWL C;  3REJ A;  5B1M B;  3MNN A;  3UTA B;  5B0Y A;  3WA9 A;  3H0M C;  1M1A C;  3X1V C;  4Z66 D;  3X1U C;  4JJN D;  3LZ1 B;  2FJ7 C;  3KUY D;  3W97 D;  4NE5 A;  4YS3 A;  5AY8 C;  5B2I A;  3MGP A;  4YM6 C;  2PYO B;  1EQZ D;  5AV6 C;  5BNV A;  3AZG D;  4UPK A;  1P3I B;  5B40 D;  1TZY D;  5AVC C;  2Y2N A;  4Z2M H;  3KXB D;  3AV1 A;  4J8W D;  1P3G A;  4KUD C;  5CP6 A;  1F66 C;  3WTP D;  5GT0 B;  5AV8 C;  5AV5 B;  2ZY5 A;  2LY8 A;  5B1L A;  4LD9 B;  4KGC A;  5AVB A;  4J8X B;  4NE3 A;  1ZLA A;  1P3M D;  4Z66 C;  2Y2H A;  4JJN C;  3REH B;  1P3P D;  1HQ3 D;  3B6F A;  3W97 C;  3AZJ B;  3LZ0 B;  3REL D;  1TAF B;  5B32 D;  1EQZ C;  3REK A;  3AZG C;  3O62 B;  2NZD B;  5B40 C;  1TZY C;  5DNN D;  5CPJ A;  1P3F D;  1JFI A;  4J8W C;  1P3O C;  4J8V B;  3FDD A;  5GXQ D;  1U35 B;  5BT1 D;  3REJ D;  3VH5 A;  3AZM B;  3MNN D;  1Z2C B;  2ARO B;  3AZE C;  4HGA B;  1P3K A;  5B0Y D;  3WA9 D;  4UUZ B;  5GSU D;  4WU9 A;  1KX4 A;  1P3M C;  5KDM A;  3AZH A;  4XUJ B;  3A1I A;  3KSY A;  5B2I D;  3MGP D;  1P3P C;  3AZF B;  3EPK A;  4ZUX C;  1P3G D;  5CP6 D;  3AZL B;  1P3F C;  5DNN C;  5JRG B;  2NQB B;  3R45 B;  5GXQ C;  5BT1 C;  2JCH A;  3LEL A;  3REJ C;  5B1L D;  3UTB B;  3MNN C;  1P3B B;  3WAA A;  5AVB D;  5B0Y C;  2F8N H;  3WA9 C;  4KGC D;  1ZLA D;  2FFF B;  3X1S B;  1F1E A;  1ULY A;  3B6F D;  4YS3 C;  5B2I C;  4WJ3 C;  3A1K A;  3REK D;  3B0D B;  3AV1 C;  5CPJ D;  3MGR B;  1P3G C;  5CP6 C;  5DNM A;  3NQU A;  2IO5 B;  4CAY A;  4H9R B;  5BNX B;  1P3K D;  5B1L C;  4QLC B;  1Q9C A;  4H9S A;  5AVB C;  5E5A A;  5AV9 B;  4KGC C;  4X23 A;  3P5J B;  1ZLA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...