3A6ND

The nucleosome containing a testis-specific histone variant, human h3t
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
b'RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1t
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3a6nD00
3UTAD 3R45A 1P3PA 4CSRB 3VH5T 3KWQB 3W98B 3LZ0A 3AZLB 1P3GC 3X1VC 4YM6B 3W98D 1BH9A 3AZLD 4DRBA 2YFVB 4YM6D 4LD9C 1P34C 1KX3A 1M19A 3REKC 2F8NH 3X1VB 4NFTA 3AV1C 3X1SC 1Q9CA 3REHA 1HTAA 3X1VD 1P3GD 3X1TA 5AY8A 1EQZC 5JA4B 4LD9D 4Z2MH 4KGCC 5CP6C 3REKB 1BH8A 5B2JA 3REKD 5CPJB 3AV1B 1ID3C 1ZLAC 3AV1D 3WTPA 2AROC 4ZUXC 3AV2B 5GXQB 5JRGC 1EQZD 2NZDC 3VH5W 4R8PC 3AV2D 5AV6B 2IO5C 5CP6D 3MNNB 5AV6D 4Z5TC 3AFAB 1ZLAB 3LELA 4XUJC 1KX5B 3UTBB 2AROB 4ZUXB 5AVBB 3AFAD 5AV9C 5G49B 1P3FC 1ZLAD 1KX5D 3B6FC 3UTBD 5JRGB 2AROD 4ZUXD 5AVBD 2RVQD 1M1AA 3AZIC 5JRGD 2NZDD 1P3KB 4R8PD 5BS7A 1P3KD 4XUJB 4Z5TD 2NQBC 4XUJD 3B6FB 1N1JA 3KXBB 2HUEC 5AV9D 1P3FD 3B6FD 3W98A 3KXBD 3AZIB 3AZLA 4YM6A 3RELC 3W96A 3AZID 4J8XC 3WA9B 2CV5C 3TU4B 2YFVA 4UUZA 3TU4D 3AZFC 3AZMB 2HUEB 3O62B 3B6GC 3MGQB 1P3GA 3X1VA 3MGQD 4J8XB 4LD9A 4J8XD 1P34A 1HQ3B 5JA4A 1P3MC 1HQ3D 3X1UC 3AZFD 2BYKA 3REKA 3B6GD 4JJNC 3X1SA 3C1CC 5AV5C 1KX4B 5B24C 1P3BC 5AVCA 5BNXB 3VH6T 1EQZA 3W97B 1KX4D 1U35A 4KGCA 3W97D 5CP6A 5B33C 3C1BA 4H9OA 1P3MD 3AN2C 3MVDB 5CPIC 1ID3A 2BYMA 5AV5B 1ZLAA 1ULYA 5B1LA 1S32B 3NQUB 3C1CD 4E45A 5KDMB 4ZUXA 5AV5D 4EO5C 1P3BD 2F8NB 5JRGA 2F8ND 2NZDA 4QLCA 4R8PA 2FJ7B 3MGRB 3REIC 5B33D 1P3OB 2FJ7D 4Z5TA 4G91C 3MGRD 5B40C 3AZJA 5F99C 4WV4B 4XUJA 3WAAC 5AV9A 1P3FA 4KUDB 3MGSB 1P3AB 5B31C 5B32C 3MGSD 4ZBJC 5B0ZC 3REIB 4G92B 1P3AD 2PYOB 3W99A 4J8WB 4G91B 3LJAC 3REID 2PYOD 1B6WA 4KHAA 4XZQC 4J8WD 3A6NC 2NQBA 3WAAD 4ZBJB 2HIOA 3AZKA 4WU9B 3RELA 5B0ZD 4J8XA 4Z66C 2CV5A 4XZQB 4WU8B 3LJAD 3A6NB 3AZFA 4XZQD 3VH5A 3A6ND 3B6GA 5DNMB 3LZ1B 3KWQC 4Z66D 1M18C 1P3MA 3AYWC 3X1UA 4JJNA 5BNVB 4WZSB 3C1CA 5B24A 1P3BA 3NQUA 3AZEA 5KDMA 2F8NA 5C3IB 3V9RB 3KWQD 1M18B 3AYWB 5B33A 1M18D 5BT1C 3MGPB 3AYWD 3AZNC 3AN2A 5CPIA 3MGPD 3UT9C 5CPJC 3REIA 3AV2C 5GXQC 3AZNB 4H9PB 5BT1D 5B40A 5AV6C 4NE5A 3AZND 5F99A 3AZGB 3MNNC 5BO0B 3UT9B 3WAAA 3AFAC 3UT9D 5CPJD 1KX5C 3UTBC 5B31A 5AVBC 5B32A 2RVQC 5GT0B 2CWEA 5B0ZA 3WTPE 3LJAA 3NQJB 1A7WA 1TAFA 5GXQD 4XZQA 1P3KC 1WWIA 3MNND 1P3IB 1P3ID 3B0CT 3KXBC 4H9QA 3REJB 4Z66A 5B2IB 4J8UC 3REJD 1H3OA 3UTAA 5B2ID 4H9RB 3WA9C 3TU4C 4CSRA 4DRAA 3WKJB 3AZMC 3O62C 3WKJD 1JFIB 3KWQA 3MGQC 4J8UB 1P3LB 4J8VB 4J8UD 1P3LD 4J8VD 3AYWA 3WA9D 1HQ3C 5B1MB 4X23B 3VH6A 5B1MD 3AZMD 3O62D 4YS3C 1KX4C 3W97C 3B0CW 3KUYC 3AZNA 2YFWB 2F8NK 4YS3B 3MVDC 5BO0A 3UT9A 5CPJA 3AV1A 5CPKB 4YS3D 1S32C 2F8NG 3KUYB 3AV2A 5GXQA 4AWLC 3KUYD 5AV6A 4M6BA 2FJ7C 3MGRC 3MNNA 1P3OC 3AFAA 3MVDD 1WWSA 4Z2MG 1KX5A 3UTBA 2AROA 5AVBA 5GT3C 5G49A 1TZYB 4KUDC 1S32D 3MGSC 4AWLB 1P3AC 1TZYD 2PYOC 4G92C 1P3KA 4H9NB 4J8WC 4H9RA 1P3OD 5FUGB 5AV8B 5GSUB 5GT3B 3AZHB 1AOIB 3B6FA 5GSUD 5AV8D 3KXBA 5GT3D 4KUDD 5B31G 3R45B 5B32G 4E44A 4J8UA 3AZIA 1P3PB 5B0YC 4WU9C 3WA9A 3TU4A 3VH6W 2LY8A 4WU8C 3LZ0B 3AZMA 3O62A 1BH9B 3MGQA 5DNMC 5B0YB 3LZ1C 1KX3B 5B0YD 4WU9D 1M19B 1HQ3A 4WU8D 2YFWA 3REHB 2JSSA 4YS3A 5AY8B 5E5AC 1BFMA 5DNMD 3LZ1D 1KX4A 5AY8D 5BNXA 3W97A 5C3IC 5B2JB 5B2JD 3MGPC 3MVDA 5E5AB 5AV5A 5E5AD 1S32A 2FJ7A 3MGRA 1P3OA 3AZGC 1M1AB 4HGAB 4KUDA 3MGSA 1P3AA 3W96C 1M1AD 5GT0C 2PYOA 4J8WA 1N1JB 3AZGD 1F66C 3W96B 1P3IC 3W96D 5B0YA 4UUZB 5DNNC 4WU9A 5GT0D 3REJC 5B2IC 4WU8A 3A6NA 1F66B 1P3GB 1F66D 4H9SC 5DNMA 5AVCC 3WKJC 4LD9B 3LZ1A 5CHLB 5DNNB 1P34B 1U35C 5DNND 1P34D 1P3LC 2BYKB 3C1BC 4J8VC 1R4VA 1B67A 3X1SB 5AVCB 5B1LC 3X1SD 5B1MC 4X23C 1EQZB 5E5AA 5BNVA 5AVCD 1U35B 4KGCB 5CP6B 4QLCC 3C1BB 4H9OB 1U35D 4WNNB 3V9RA 1M18A 4KGCD 3C1BD 1ID3B 2BYMB 3AZJC 1ID3D 5B1LB 3MGPA 5B1LD 4X23D 2NZDB 4QLCB 4NE3A 4R8PB 4CAYB 2IO5B 3W99C 4QLCD 5CPKC 4Z5TB 3AZJB 3AZJD 4H9PA 5AV9B 1P3FB 4NE6A 3AZGA 3W99B 2HIOC 3AZKC 3W99D 5CPKD 4KHAB 5GT0A 1TZYC 2NQBB 3NQJA 2NQBD 1KU5A 1F66A 2HIOB 3AZKB 3RELB 5GSUC 5AV8C 1P3IA 2HIOD 3AZKD 2CV5B 3AZHC 1AOIC 3RELD 5DNNA 2CV5D 3AZFB 3REJA 5B2IA 1P3PC 3B6GB 4H9SA 3LZ0C 3WKJA 3AZEC 3AZHD 1AOID 1JFIA 1P3MB 3X1UB 1P3LA 4J8VA 4WNNA 1P3PD 1KX3C 3X1UD 4JJNB 1M19C 3C1CB 5B24B 1P3BB 4JJND 5B1MA 4X23A 3AZEB 5B24D 3LZ0D 3REHC 3B0DC 3AZED 5B33B 3X1TC 5AY8C 4CAYA 3AN2B 5CPIB 3KSYA 1KX3D 3AN2D 5CPID 1M19D 5B2JC 4EO5B 3B0DB 3WTPC 3X1TB 3REHD 5CPKA 3X1TD 5B40B 5F99B 3KUYA 1BH8B 5B40D 3WAAB 5F99D 3LELC 3WTPB 5B31B 5B32B 5B0ZB 3B0BA 3WTPD 5B31D 5B32D 3LJAB 1TAFB 1M1AC 4HGAC 1TZYA 3UTAC 5BS7C 1F1EA 3LELB 4H9NA 3LELD 2L5AA 4H9QB 5FUGA 5GSUA 5AV8A 4Z66B 3W98C 5GT3A 3AZHA 1AOIA 3UTAB 1H3OB 3AZLC 4YM6C
chains in the Genus database with same CATH superfamily
3UTAD 3R45A 1P3PA 4CSRB 3VH5T 3KWQB 3W98B 3LZ0A 3AZLB 1P3GC 3X1VC 4YM6B 3W98D 1BH9A 3AZLD 4DRBA 2YFVB 4YM6D 4LD9C 1P34C 1KX3A 1M19A 3REKC 2F8NH 3X1VB 4NFTA 3AV1C 3X1SC 1Q9CA 3REHA 1HTAA 3X1VD 1P3GD 3X1TA 5AY8A 1EQZC 5JA4B 4LD9D 4Z2MH 4KGCC 5CP6C 3REKB 1BH8A 5B2JA 3REKD 5CPJB 3AV1B 1ID3C 1ZLAC 3AV1D 3WTPA 2AROC 4ZUXC 3AV2B 5GXQB 5JRGC 1EQZD 2NZDC 3VH5W 4R8PC 3AV2D 5AV6B 2IO5C 5CP6D 3MNNB 5AV6D 4Z5TC 3AFAB 1ZLAB 3LELA 4XUJC 1KX5B 3UTBB 2AROB 2Y2NA 4ZUXB 5AVBB 5AV9C 5G49B 3AFAD 1P3FC 1KX5D 1ZLAD 3UTBD 5JRGB 2AROD 4ZUXD 5AVBD 2RVQD 1M1AA 3AZIC 5JRGD 2NZDD 1P3KB 4R8PD 5BS7A 1P3KD 4XUJB 4Z5TD 2NQBC 4XUJD 3B6FB 1N1JA 3KXBB 2HUEC 5AV9D 1P3FD 3B6FD 3W98A 3KXBD 3AZIB 3AZLA 4YM6A 3RELC 3W96A 3AZID 4J8XC 3WA9B 2CV5C 3TU4B 2YFVA 4UUZA 3TU4D 3AZFC 3AZMB 2HUEB 3O62B 3B6GC 2XD1A 3MGQB 1P3GA 3X1VA 3MGQD 4J8XB 4LD9A 4J8XD 1PZRA 1P34A 1HQ3B 5JA4A 1P3MC 1HQ3D 3X1UC 3AZFD 2BYKA 3REKA 3B6GD 4JJNC 3X1SA 3C1CC 5AV5C 1KX4B 5B24C 1P3BC 5AVCA 5BNXB 3VH6T 2ZY2A 1EQZA 3W97B 1KX4D 1U35A 4KGCA 3W97D 5CP6A 5B33C 3C1BA 4H9OA 1P3MD 3F6TA 3AN2C 3MVDB 5CPIC 1ID3A 2BYMA 5AV5B 1ZLAA 1ULYA 5B1LA 1S32B 3NQUB 3C1CD 5KDMB 4ZUXA 2F2AC 4E45A 4EO5C 5AV5D 1P3BD 2F8NB 5JRGA 2F8ND 2NZDA 4QLCA 4R8PA 2FJ7B 3MGRB 3REIC 5B33D 1P3OB 2FJ7D 4WJ3C 4Z5TA 4G91C 3MGRD 5B40C 3AZJA 5F99C 4WV4B 4XUJA 3WAAC 5AV9A 1P3FA 4KUDB 3MGSB 2Y2PA 1P3AB 3AL0C 5B31C 5B32C 3MGSD 4ZBJC 5B0ZC 3REIB 4G92B 1P3AD 2Y2QA 2PYOB 3W99A 4J8WB 4G91B 3LJAC 3REID 2PYOD 1B6WA 4KHAA 4XZQC 4J8WD 3A6NC 2NQBA 3H0RC 3WAAD 4ZBJB 2HIOA 3AZKA 4WU9B 3RELA 5B0ZD 4J8XA 4Z66C 2CV5A 4XZQB 4WU8B 3LJAD 3A6NB 3AZFA 4XZQD 3VH5A 3A6ND 2UWXA 2ZY5A 3B6GA 5DNMB 3LZ1B 3EPLA 3KWQC 2JCHA 4Z66D 1M18C 1P3MA 3AYWC 3X1UA 4JJNA 5BNVB 4WZSB 3C1CA 5B24A 1P3BA 3NQUA 3AZEA 5KDMA 2F8NA 5C3IB 3V9RB 3KWQD 1M18B 3AYWB 5B33A 1M18D 2Y2IA 5BT1C 3MGPB 3AYWD 3AZNC 3AN2A 5CPIA 2ZM5A 3MGPD 3UT9C 5CPJC 3REIA 3AV2C 5GXQC 3AZNB 4H9PB 5BT1D 5B40A 5AV6C 4NE5A 3AZND 5F99A 3AZGB 3MNNC 5BO0B 3UT9B 3WAAA 3IP4C 3AFAC 3UT9D 5CPJD 3EG5B 1KX5C 3UTBC 5B31A 5AVBC 5B32A 2RVQC 5GT0B 2CWEA 5B0ZA 3WTPE 3LJAA 1A7WA 3NQJB 1TAFA 5GXQD 4XZQA 1P3KC 1WWIA 2W8SA 3MNND 1P3IB 1P3ID 3B0CT 3KXBC 4H9QA 3REJB 4Z66A 5B2IB 4J8UC 3FDDA 2XD5A 3REJD 1H3OA 3UTAA 5B2ID 4H9RB 3WA9C 3TU4C 4DQYB 2Y2MA 4CSRA 4DRAA 3WKJB 3AZMC 3O62C 3WKJD 1JFIB 2ZY4A 3KWQA 3MGQC 4J8UB 1P3LB 4J8VB 4J8UD 1P3LD 4J8VD 3AYWA 3WA9D 1HQ3C 5B1MB 4X23B 3VH6A 2G5HC 5B1MD 3AZMD 3O62D 4YS3C 3A1KA 1KX4C 1T3UA 3W97C 3B0CW 3KUYC 3AZNA 2YFWB 2F8NK 4YS3B 3MVDC 5BO0A 3UT9A 5CPJA 3AV1A 5CPKB 4YS3D 2Y2OA 1S32C 2F8NG 3KUYB 3AV2A 5GXQA 4AWLC 3KUYD 5AV6A 4M6BA 2FJ7C 3MGRC 3MNNA 1P3OC 2J8PA 3AFAA 3MVDD 1WWSA 4Z2MG 1KX5A 3UTBA 2AROA 5AVBA 5GT3C 5G49A 1TZYB 4KUDC 1S32D 3MGSC 4AWLB 1P3AC 1TZYD 2Y2HA 2PYOC 4G92C 1P3KA 4H9NB 4J8WC 2BG1A 4H9RA 1P3OD 5FUGB 5AV8B 5GSUB 5GT3B 3AZHB 1AOIB 3B6FA 5GSUD 5AV8D 3KXBA 5GT3D 4KUDD 5B31G 3R45B 5B32G 4E44A 4J8UA 3AZIA 1P3PB 5B0YC 4WU9C 3WA9A 3TU4A 3VH6W 2LY8A 4WU8C 3LZ0B 3AZMA 3O62A 1BH9B 3MGQA 5DNMC 5B0YB 3LZ1C 1KX3B 5B0YD 4WU9D 1M19B 1HQ3A 4WU8D 2YFWA 3REHB 2JSSA 4YS3A 5AY8B 5E5AC 1BFMA 5DNMD 3LZ1D 1Z2CB 5AY8D 1KX4A 5BNXA 3W97A 5C3IC 5B2JB 2G5IC 2VQRA 5B2JD 3MGPC 3MVDA 5E5AB 5AV5A 5E5AD 1S32A 2FJ7A 3MGRA 1P3OA 3AZGC 1M1AB 4HGAB 4KUDA 3MGSA 1P3AA 3W96C 1M1AD 5GT0C 2PYOA 4J8WA 1N1JB 3H0LC 3AZGD 1F66C 2RIQA 3W96B 1P3IC 3W96D 5B0YA 4UUZB 5DNNC 4WU9A 5GT0D 3REJC 3A1IA 5B2IC 4WU8A 3A6NA 1F66B 1P3GB 1F66D 4H9SC 5DNMA 5AVCC 3WKJC 4LD9B 3LZ1A 5CHLB 5DNNB 1P34B 1U35C 5DNND 1P34D 2Y2JA 1P3LC 2BYKB 3C1BC 4J8VC 1R4VA 2DF4C 1B67A 3X1SB 2Y2LA 5AVCB 2Y2GA 5B1LC 5B1MC 3X1SD 4X23C 5E5AA 1EQZB 5BNVA 5AVCD 1U35B 4KGCB 5CP6B 3KFUG 4QLCC 3C1BB 4H9OB 1U35D 4WNNB 3V9RA 1M18A 4KGCD 3C1BD 1ID3B 2BYMB 2ZY3A 3AZJC 1ID3D 5B1LB 3MGPA 5B1LD 4X23D 2NZDB 4QLCB 4NE3A 4R8PB 4CAYB 2IO5B 3W99C 4QLCD 5CPKC 2Y2KA 4Z5TB 3AZJB 3H0MC 3AZJD 4H9PA 5AV9B 1P3FB 4NE6A 3EPKA 3AZGA 3EPJA 3W99B 2HIOC 3AZKC 3W99D 5CPKD 4KHAB 5GT0A 1TZYC 3EPHA 2NQBB 3NQJA 2NQBD 1KU5A 1F66A 2HIOB 3AZKB 3RELB 5GSUC 5AV8C 1P3IA 2HIOD 3AZKD 2CV5B 3AZHC 1AOIC 3RELD 5DNNA 2CV5D 3AZFB 3B6FC 3REJA 5B2IA 1P3PC 3B6GB 3P5JB 4H9SA 3LZ0C 3WKJA 3AZEC 3AZHD 1AOID 1JFIA 1P3MB 3X1UB 1P3LA 4J8VA 4WNNA 1P3PD 1KX3C 3X1UD 4JJNB 1M19C 3C1CB 2DQNC 5B24B 1P3BB 4JJND 5B1MA 4X23A 3AZEB 5B24D 3LZ0D 3REHC 3B0DC 3AZED 5B33B 3X1TC 5AY8C 4CAYA 3AN2B 5CPIB 3KSYA 1KX3D 3AN2D 5CPID 1M19D 5B2JC 4EO5B 3B0DB 3WTPC 3X1TB 3REHD 5CPKA 3X1TD 2JE5A 5B40B 5F99B 3KUYA 1BH8B 5B40D 3WAAB 5F99D 3LELC 3WTPB 5B31B 5B32B 5B0ZB 3B0BA 3WTPD 5B31D 5B32D 3LJAB 2FFFB 1TAFB 1M1AC 4HGAC 1TZYA 3UTAC 5BS7C 1W2EA 1F1EA 3LELB 4H9NA 3LELD 2L5AA 4H9QB 5FUGA 5GSUA 5AV8A 4Z66B 3W98C 5GT3A 3AZHA 1AOIA 3UTAB 1H3OB 3AZLC 4YM6C 4UPKA
chains in the Genus database with same CATH topology
3UTAD 3R45A 1P3PA 4CSRB 3VH5T 3KWQB 3W98B 3LZ0A 3AZLB 1P3GC 3X1VC 4YM6B 3W98D 1BH9A 3AZLD 4DRBA 2YFVB 4YM6D 4LD9C 1P34C 1KX3A 1M19A 3REKC 2F8NH 3X1VB 4NFTA 3AV1C 3X1SC 1Q9CA 3REHA 1HTAA 3X1VD 1P3GD 3X1TA 5AY8A 1EQZC 5JA4B 4LD9D 4Z2MH 4KGCC 5CP6C 3REKB 1BH8A 5B2JA 3REKD 5CPJB 3AV1B 1ID3C 1ZLAC 3AV1D 3WTPA 2AROC 4ZUXC 3AV2B 5GXQB 5JRGC 1EQZD 2NZDC 3VH5W 4R8PC 3AV2D 5AV6B 2IO5C 5CP6D 3MNNB 5AV6D 4Z5TC 3AFAB 1ZLAB 3LELA 4XUJC 1KX5B 3UTBB 2AROB 2Y2NA 4ZUXB 5AVBB 5AV9C 5G49B 3AFAD 1P3FC 1KX5D 1ZLAD 3UTBD 5JRGB 2AROD 4ZUXD 5AVBD 2RVQD 1M1AA 3AZIC 5JRGD 2NZDD 1P3KB 4R8PD 5BS7A 1P3KD 4XUJB 4Z5TD 2NQBC 4XUJD 3B6FB 1N1JA 3KXBB 2HUEC 5AV9D 1P3FD 3B6FD 3W98A 3KXBD 3AZIB 3AZLA 4YM6A 3RELC 3W96A 3AZID 4J8XC 3WA9B 2CV5C 3TU4B 2YFVA 4UUZA 3TU4D 3AZFC 3AZMB 2HUEB 3O62B 3B6GC 2XD1A 3MGQB 1P3GA 3X1VA 3MGQD 4J8XB 4LD9A 4J8XD 1PZRA 1P34A 1HQ3B 5JA4A 1P3MC 1HQ3D 3X1UC 3AZFD 2BYKA 3REKA 3B6GD 4JJNC 3X1SA 3C1CC 5AV5C 1KX4B 5B24C 1P3BC 5AVCA 5BNXB 3VH6T 2ZY2A 1EQZA 3W97B 1KX4D 1U35A 4KGCA 3W97D 5CP6A 5B33C 3C1BA 4H9OA 1P3MD 3F6TA 3AN2C 3MVDB 5CPIC 1ID3A 2BYMA 5AV5B 1ZLAA 1ULYA 5B1LA 1S32B 3NQUB 3C1CD 5KDMB 4ZUXA 2F2AC 4E45A 4EO5C 5AV5D 1P3BD 2F8NB 5JRGA 2F8ND 2NZDA 4QLCA 4R8PA 2FJ7B 3MGRB 3REIC 5B33D 1P3OB 2FJ7D 4WJ3C 4Z5TA 4G91C 3MGRD 5B40C 3AZJA 5F99C 4WV4B 4XUJA 3WAAC 5AV9A 1P3FA 4KUDB 3MGSB 2Y2PA 1P3AB 3AL0C 5B31C 5B32C 3MGSD 4ZBJC 5B0ZC 3REIB 4G92B 1P3AD 2Y2QA 2PYOB 3W99A 4J8WB 4G91B 3LJAC 3REID 2PYOD 1B6WA 4KHAA 4XZQC 4J8WD 3A6NC 2NQBA 3H0RC 3WAAD 4ZBJB 2HIOA 3AZKA 4WU9B 3RELA 5B0ZD 4J8XA 4Z66C 2CV5A 4XZQB 4WU8B 3LJAD 3A6NB 3AZFA 4XZQD 3VH5A 3A6ND 2UWXA 2ZY5A 3B6GA 5DNMB 3LZ1B 3EPLA 3KWQC 2JCHA 4Z66D 1M18C 1P3MA 3AYWC 3X1UA 4JJNA 5BNVB 4WZSB 3C1CA 5B24A 1P3BA 3NQUA 3AZEA 5KDMA 2F8NA 5C3IB 3V9RB 3KWQD 1M18B 3AYWB 5B33A 1M18D 2Y2IA 5BT1C 3MGPB 3AYWD 3AZNC 3AN2A 5CPIA 2ZM5A 3MGPD 3UT9C 5CPJC 3REIA 3AV2C 5GXQC 3AZNB 4H9PB 5BT1D 5B40A 5AV6C 4NE5A 3AZND 5F99A 3AZGB 3MNNC 5BO0B 3UT9B 3WAAA 3IP4C 3AFAC 3UT9D 5CPJD 3EG5B 1KX5C 3UTBC 5B31A 5AVBC 5B32A 2RVQC 5GT0B 2CWEA 5B0ZA 3WTPE 3LJAA 1A7WA 3NQJB 1TAFA 5GXQD 4XZQA 1P3KC 1WWIA 2W8SA 3MNND 1P3IB 1P3ID 3B0CT 3KXBC 4H9QA 3REJB 4Z66A 5B2IB 4J8UC 3FDDA 2XD5A 3REJD 1H3OA 3UTAA 5B2ID 4H9RB 3WA9C 3TU4C 4DQYB 2Y2MA 4CSRA 4DRAA 3WKJB 3AZMC 3O62C 3WKJD 1JFIB 2ZY4A 3KWQA 3MGQC 4J8UB 1P3LB 4J8VB 4J8UD 1P3LD 4J8VD 3AYWA 3WA9D 1HQ3C 5B1MB 4X23B 3VH6A 2G5HC 5B1MD 3AZMD 3O62D 4YS3C 3A1KA 1KX4C 1T3UA 3W97C 3B0CW 3KUYC 3AZNA 2YFWB 2F8NK 4YS3B 3MVDC 5BO0A 3UT9A 5CPJA 3AV1A 5CPKB 4YS3D 2Y2OA 1S32C 2F8NG 3KUYB 3AV2A 5GXQA 4AWLC 3KUYD 5AV6A 4M6BA 2FJ7C 3MGRC 3MNNA 1P3OC 2J8PA 3AFAA 3MVDD 1WWSA 4Z2MG 1KX5A 3UTBA 2AROA 5AVBA 5GT3C 5G49A 1TZYB 4KUDC 1S32D 3MGSC 4AWLB 1P3AC 1TZYD 2Y2HA 2PYOC 4G92C 1P3KA 4H9NB 4J8WC 2BG1A 4H9RA 1P3OD 5FUGB 5AV8B 5GSUB 5GT3B 3AZHB 1AOIB 3B6FA 5GSUD 5AV8D 3KXBA 5GT3D 4KUDD 5B31G 3R45B 5B32G 4E44A 4J8UA 3AZIA 1P3PB 5B0YC 4WU9C 3WA9A 3TU4A 3VH6W 2LY8A 4WU8C 3LZ0B 3AZMA 3O62A 1BH9B 3MGQA 5DNMC 5B0YB 3LZ1C 1KX3B 5B0YD 4WU9D 1M19B 1HQ3A 4WU8D 2YFWA 3REHB 2JSSA 4YS3A 5AY8B 5E5AC 1BFMA 5DNMD 3LZ1D 1Z2CB 5AY8D 1KX4A 5BNXA 3W97A 5C3IC 5B2JB 2G5IC 2VQRA 5B2JD 3MGPC 3MVDA 5E5AB 5AV5A 5E5AD 1S32A 2FJ7A 3MGRA 1P3OA 3AZGC 1M1AB 4HGAB 4KUDA 3MGSA 1P3AA 3W96C 1M1AD 5GT0C 2PYOA 4J8WA 1N1JB 3H0LC 3AZGD 1F66C 2RIQA 3W96B 1P3IC 3W96D 5B0YA 4UUZB 5DNNC 4WU9A 5GT0D 3REJC 3A1IA 5B2IC 4WU8A 3A6NA 1F66B 1P3GB 1F66D 4H9SC 5DNMA 5AVCC 3WKJC 4LD9B 3LZ1A 5CHLB 5DNNB 1P34B 1U35C 5DNND 1P34D 2Y2JA 1P3LC 2BYKB 3C1BC 4J8VC 1R4VA 2DF4C 1B67A 3X1SB 2Y2LA 5AVCB 2Y2GA 5B1LC 5B1MC 3X1SD 4X23C 5E5AA 1EQZB 5BNVA 5AVCD 1U35B 4KGCB 5CP6B 3KFUG 4QLCC 3C1BB 4H9OB 1U35D 4WNNB 3V9RA 1M18A 4KGCD 3C1BD 1ID3B 2BYMB 2ZY3A 3AZJC 1ID3D 5B1LB 3MGPA 5B1LD 4X23D 2NZDB 4QLCB 4NE3A 4R8PB 4CAYB 2IO5B 3W99C 4QLCD 5CPKC 2Y2KA 4Z5TB 3AZJB 3H0MC 3AZJD 4H9PA 5AV9B 1P3FB 4NE6A 3EPKA 3AZGA 3EPJA 3W99B 2HIOC 3AZKC 3W99D 5CPKD 4KHAB 5GT0A 1TZYC 3EPHA 2NQBB 3NQJA 2NQBD 1KU5A 1F66A 2HIOB 3AZKB 3RELB 5GSUC 5AV8C 1P3IA 2HIOD 3AZKD 2CV5B 3AZHC 1AOIC 3RELD 5DNNA 2CV5D 3AZFB 3B6FC 3REJA 5B2IA 1P3PC 3B6GB 3P5JB 4H9SA 3LZ0C 3WKJA 3AZEC 3AZHD 1AOID 1JFIA 1P3MB 3X1UB 1P3LA 4J8VA 4WNNA 1P3PD 1KX3C 3X1UD 4JJNB 1M19C 3C1CB 2DQNC 5B24B 1P3BB 4JJND 5B1MA 4X23A 3AZEB 5B24D 3LZ0D 3REHC 3B0DC 3AZED 5B33B 3X1TC 5AY8C 4CAYA 3AN2B 5CPIB 3KSYA 1KX3D 3AN2D 5CPID 1M19D 5B2JC 4EO5B 3B0DB 3WTPC 3X1TB 3REHD 5CPKA 3X1TD 2JE5A 5B40B 5F99B 3KUYA 1BH8B 5B40D 3WAAB 5F99D 3LELC 3WTPB 5B31B 5B32B 5B0ZB 3B0BA 3WTPD 5B31D 5B32D 3LJAB 2FFFB 1TAFB 1M1AC 4HGAC 1TZYA 3UTAC 5BS7C 1W2EA 1F1EA 3LELB 4H9NA 3LELD 2L5AA 4H9QB 5FUGA 5GSUA 5AV8A 4Z66B 3W98C 5GT3A 3AZHA 1AOIA 3UTAB 1H3OB 3AZLC 4YM6C 4UPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTA D;  3R45 A;  1P3P A;  4CSR B;  3VH5 T;  3KWQ B;  3W98 B;  3LZ0 A;  3AZL B;  1P3G C;  3X1V C;  4YM6 B;  3W98 D;  1BH9 A;  3AZL D;  4DRB A;  2YFV B;  4YM6 D;  4LD9 C;  1P34 C;  1KX3 A;  1M19 A;  3REK C;  2F8N H;  3X1V B;  4NFT A;  3AV1 C;  3X1S C;  1Q9C A;  3REH A;  1HTA A;  3X1V D;  1P3G D;  3X1T A;  5AY8 A;  1EQZ C;  5JA4 B;  4LD9 D;  4Z2M H;  4KGC C;  5CP6 C;  3REK B;  1BH8 A;  5B2J A;  3REK D;  5CPJ B;  3AV1 B;  1ID3 C;  1ZLA C;  3AV1 D;  3WTP A;  2ARO C;  4ZUX C;  3AV2 B;  5GXQ B;  5JRG C;  1EQZ D;  2NZD C;  3VH5 W;  4R8P C;  3AV2 D;  5AV6 B;  2IO5 C;  5CP6 D;  3MNN B;  5AV6 D;  4Z5T C;  3AFA B;  1ZLA B;  3LEL A;  4XUJ C;  1KX5 B;  3UTB B;  2ARO B;  4ZUX B;  5AVB B;  3AFA D;  5AV9 C;  5G49 B;  1P3F C;  1ZLA D;  1KX5 D;  3B6F C;  3UTB D;  5JRG B;  2ARO D;  4ZUX D;  5AVB D;  2RVQ D;  1M1A A;  3AZI C;  5JRG D;  2NZD D;  1P3K B;  4R8P D;  5BS7 A;  1P3K D;  4XUJ B;  4Z5T D;  2NQB C;  4XUJ D;  3B6F B;  1N1J A;  3KXB B;  2HUE C;  5AV9 D;  1P3F D;  3B6F D;  3W98 A;  3KXB D;  3AZI B;  3AZL A;  4YM6 A;  3REL C;  3W96 A;  3AZI D;  4J8X C;  3WA9 B;  2CV5 C;  3TU4 B;  2YFV A;  4UUZ A;  3TU4 D;  3AZF C;  3AZM B;  2HUE B;  3O62 B;  3B6G C;  3MGQ B;  1P3G A;  3X1V A;  3MGQ D;  4J8X B;  4LD9 A;  4J8X D;  1P34 A;  1HQ3 B;  5JA4 A;  1P3M C;  1HQ3 D;  3X1U C;  3AZF D;  2BYK A;  3REK A;  3B6G D;  4JJN C;  3X1S A;  3C1C C;  5AV5 C;  1KX4 B;  5B24 C;  1P3B C;  5AVC A;  5BNX B;  3VH6 T;  1EQZ A;  3W97 B;  1KX4 D;  1U35 A;  4KGC A;  3W97 D;  5CP6 A;  5B33 C;  3C1B A;  4H9O A;  1P3M D;  3AN2 C;  3MVD B;  5CPI C;  1ID3 A;  2BYM A;  5AV5 B;  1ZLA A;  1ULY A;  5B1L A;  1S32 B;  3NQU B;  3C1C D;  4E45 A;  5KDM B;  4ZUX A;  5AV5 D;  4EO5 C;  1P3B D;  2F8N B;  5JRG A;  2F8N D;  2NZD A;  4QLC A;  4R8P A;  2FJ7 B;  3MGR B;  3REI C;  5B33 D;  1P3O B;  2FJ7 D;  4Z5T A;  4G91 C;  3MGR D;  5B40 C;  3AZJ A;  5F99 C;  4WV4 B;  4XUJ A;  3WAA C;  5AV9 A;  1P3F A;  4KUD B;  3MGS B;  1P3A B;  5B31 C;  5B32 C;  3MGS D;  4ZBJ C;  5B0Z C;  3REI B;  4G92 B;  1P3A D;  2PYO B;  3W99 A;  4J8W B;  4G91 B;  3LJA C;  3REI D;  2PYO D;  1B6W A;  4KHA A;  4XZQ C;  4J8W D;  3A6N C;  2NQB A;  3WAA D;  4ZBJ B;  2HIO A;  3AZK A;  4WU9 B;  3REL A;  5B0Z D;  4J8X A;  4Z66 C;  2CV5 A;  4XZQ B;  4WU8 B;  3LJA D;  3A6N B;  3AZF A;  4XZQ D;  3VH5 A;  3A6N D;  3B6G A;  5DNM B;  3LZ1 B;  3KWQ C;  4Z66 D;  1M18 C;  1P3M A;  3AYW C;  3X1U A;  4JJN A;  5BNV B;  4WZS B;  3C1C A;  5B24 A;  1P3B A;  3NQU A;  3AZE A;  5KDM A;  2F8N A;  5C3I B;  3V9R B;  3KWQ D;  1M18 B;  3AYW B;  5B33 A;  1M18 D;  5BT1 C;  3MGP B;  3AYW D;  3AZN C;  3AN2 A;  5CPI A;  3MGP D;  3UT9 C;  5CPJ C;  3REI A;  3AV2 C;  5GXQ C;  3AZN B;  4H9P B;  5BT1 D;  5B40 A;  5AV6 C;  4NE5 A;  3AZN D;  5F99 A;  3AZG B;  3MNN C;  5BO0 B;  3UT9 B;  3WAA A;  3AFA C;  3UT9 D;  5CPJ D;  1KX5 C;  3UTB C;  5B31 A;  5AVB C;  5B32 A;  2RVQ C;  5GT0 B;  2CWE A;  5B0Z A;  3WTP E;  3LJA A;  3NQJ B;  1A7W A;  1TAF A;  5GXQ D;  4XZQ A;  1P3K C;  1WWI A;  3MNN D;  1P3I B;  1P3I D;  3B0C T;  3KXB C;  4H9Q A;  3REJ B;  4Z66 A;  5B2I B;  4J8U C;  3REJ D;  1H3O A;  3UTA A;  5B2I D;  4H9R B;  3WA9 C;  3TU4 C;  4CSR A;  4DRA A;  3WKJ B;  3AZM C;  3O62 C;  3WKJ D;  1JFI B;  3KWQ A;  3MGQ C;  4J8U B;  1P3L B;  4J8V B;  4J8U D;  1P3L D;  4J8V D;  3AYW A;  3WA9 D;  1HQ3 C;  5B1M B;  4X23 B;  3VH6 A;  5B1M D;  3AZM D;  3O62 D;  4YS3 C;  1KX4 C;  3W97 C;  3B0C W;  3KUY C;  3AZN A;  2YFW B;  2F8N K;  4YS3 B;  3MVD C;  5BO0 A;  3UT9 A;  5CPJ A;  3AV1 A;  5CPK B;  4YS3 D;  1S32 C;  2F8N G;  3KUY B;  3AV2 A;  5GXQ A;  4AWL C;  3KUY D;  5AV6 A;  4M6B A;  2FJ7 C;  3MGR C;  3MNN A;  1P3O C;  3AFA A;  3MVD D;  1WWS A;  4Z2M G;  1KX5 A;  3UTB A;  2ARO A;  5AVB A;  5GT3 C;  5G49 A;  1TZY B;  4KUD C;  1S32 D;  3MGS C;  4AWL B;  1P3A C;  1TZY D;  2PYO C;  4G92 C;  1P3K A;  4H9N B;  4J8W C;  4H9R A;  1P3O D;  5FUG B;  5AV8 B;  5GSU B;  5GT3 B;  3AZH B;  1AOI B;  3B6F A;  5GSU D;  5AV8 D;  3KXB A;  5GT3 D;  4KUD D;  5B31 G;  3R45 B;  5B32 G;  4E44 A;  4J8U A;  3AZI A;  1P3P B;  5B0Y C;  4WU9 C;  3WA9 A;  3TU4 A;  3VH6 W;  2LY8 A;  4WU8 C;  3LZ0 B;  3AZM A;  3O62 A;  1BH9 B;  3MGQ A;  5DNM C;  5B0Y B;  3LZ1 C;  1KX3 B;  5B0Y D;  4WU9 D;  1M19 B;  1HQ3 A;  4WU8 D;  2YFW A;  3REH B;  2JSS A;  4YS3 A;  5AY8 B;  5E5A C;  1BFM A;  5DNM D;  3LZ1 D;  1KX4 A;  5AY8 D;  5BNX A;  3W97 A;  5C3I C;  5B2J B;  5B2J D;  3MGP C;  3MVD A;  5E5A B;  5AV5 A;  5E5A D;  1S32 A;  2FJ7 A;  3MGR A;  1P3O A;  3AZG C;  1M1A B;  4HGA B;  4KUD A;  3MGS A;  1P3A A;  3W96 C;  1M1A D;  5GT0 C;  2PYO A;  4J8W A;  1N1J B;  3AZG D;  1F66 C;  3W96 B;  1P3I C;  3W96 D;  5B0Y A;  4UUZ B;  5DNN C;  4WU9 A;  5GT0 D;  3REJ C;  5B2I C;  4WU8 A;  3A6N A;  1F66 B;  1P3G B;  1F66 D;  4H9S C;  5DNM A;  5AVC C;  3WKJ C;  4LD9 B;  3LZ1 A;  5CHL B;  5DNN B;  1P34 B;  1U35 C;  5DNN D;  1P34 D;  1P3L C;  2BYK B;  3C1B C;  4J8V C;  1R4V A;  1B67 A;  3X1S B;  5AVC B;  5B1L C;  3X1S D;  5B1M C;  4X23 C;  1EQZ B;  5E5A A;  5BNV A;  5AVC D;  1U35 B;  4KGC B;  5CP6 B;  4QLC C;  3C1B B;  4H9O B;  1U35 D;  4WNN B;  3V9R A;  1M18 A;  4KGC D;  3C1B D;  1ID3 B;  2BYM B;  3AZJ C;  1ID3 D;  5B1L B;  3MGP A;  5B1L D;  4X23 D;  2NZD B;  4QLC B;  4NE3 A;  4R8P B;  4CAY B;  2IO5 B;  3W99 C;  4QLC D;  5CPK C;  4Z5T B;  3AZJ B;  3AZJ D;  4H9P A;  5AV9 B;  1P3F B;  4NE6 A;  3AZG A;  3W99 B;  2HIO C;  3AZK C;  3W99 D;  5CPK D;  4KHA B;  5GT0 A;  1TZY C;  2NQB B;  3NQJ A;  2NQB D;  1KU5 A;  1F66 A;  2HIO B;  3AZK B;  3REL B;  5GSU C;  5AV8 C;  1P3I A;  2HIO D;  3AZK D;  2CV5 B;  3AZH C;  1AOI C;  3REL D;  5DNN A;  2CV5 D;  3AZF B;  3REJ A;  5B2I A;  1P3P C;  3B6G B;  4H9S A;  3LZ0 C;  3WKJ A;  3AZE C;  3AZH D;  1AOI D;  1JFI A;  1P3M B;  3X1U B;  1P3L A;  4J8V A;  4WNN A;  1P3P D;  1KX3 C;  3X1U D;  4JJN B;  1M19 C;  3C1C B;  5B24 B;  1P3B B;  4JJN D;  5B1M A;  4X23 A;  3AZE B;  5B24 D;  3LZ0 D;  3REH C;  3B0D C;  3AZE D;  5B33 B;  3X1T C;  5AY8 C;  4CAY A;  3AN2 B;  5CPI B;  3KSY A;  1KX3 D;  3AN2 D;  5CPI D;  1M19 D;  5B2J C;  4EO5 B;  3B0D B;  3WTP C;  3X1T B;  3REH D;  5CPK A;  3X1T D;  5B40 B;  5F99 B;  3KUY A;  1BH8 B;  5B40 D;  3WAA B;  5F99 D;  3LEL C;  3WTP B;  5B31 B;  5B32 B;  5B0Z B;  3B0B A;  3WTP D;  5B31 D;  5B32 D;  3LJA B;  1TAF B;  1M1A C;  4HGA C;  1TZY A;  3UTA C;  5BS7 C;  1F1E A;  3LEL B;  4H9N A;  3LEL D;  2L5A A;  4H9Q B;  5FUG A;  5GSU A;  5AV8 A;  4Z66 B;  3W98 C;  5GT3 A;  3AZH A;  1AOI A;  3UTA B;  1H3O B;  3AZL C;  4YM6 C; 
#chains in the Genus database with same CATH topology
 3UTA D;  3R45 A;  1P3P A;  4CSR B;  3VH5 T;  3KWQ B;  3W98 B;  3LZ0 A;  3AZL B;  1P3G C;  3X1V C;  4YM6 B;  3W98 D;  1BH9 A;  3AZL D;  4DRB A;  2YFV B;  4YM6 D;  4LD9 C;  1P34 C;  1KX3 A;  1M19 A;  3REK C;  2F8N H;  3X1V B;  4NFT A;  3AV1 C;  3X1S C;  1Q9C A;  3REH A;  1HTA A;  3X1V D;  1P3G D;  3X1T A;  5AY8 A;  1EQZ C;  5JA4 B;  4LD9 D;  4Z2M H;  4KGC C;  5CP6 C;  3REK B;  1BH8 A;  5B2J A;  3REK D;  5CPJ B;  3AV1 B;  1ID3 C;  1ZLA C;  3AV1 D;  3WTP A;  2ARO C;  4ZUX C;  3AV2 B;  5GXQ B;  5JRG C;  1EQZ D;  2NZD C;  3VH5 W;  4R8P C;  3AV2 D;  5AV6 B;  2IO5 C;  5CP6 D;  3MNN B;  5AV6 D;  4Z5T C;  3AFA B;  1ZLA B;  3LEL A;  4XUJ C;  1KX5 B;  3UTB B;  2ARO B;  2Y2N A;  4ZUX B;  5AVB B;  5AV9 C;  5G49 B;  3AFA D;  1P3F C;  1KX5 D;  1ZLA D;  3UTB D;  5JRG B;  2ARO D;  4ZUX D;  5AVB D;  2RVQ D;  1M1A A;  3AZI C;  5JRG D;  2NZD D;  1P3K B;  4R8P D;  5BS7 A;  1P3K D;  4XUJ B;  4Z5T D;  2NQB C;  4XUJ D;  3B6F B;  1N1J A;  3KXB B;  2HUE C;  5AV9 D;  1P3F D;  3B6F D;  3W98 A;  3KXB D;  3AZI B;  3AZL A;  4YM6 A;  3REL C;  3W96 A;  3AZI D;  4J8X C;  3WA9 B;  2CV5 C;  3TU4 B;  2YFV A;  4UUZ A;  3TU4 D;  3AZF C;  3AZM B;  2HUE B;  3O62 B;  3B6G C;  2XD1 A;  3MGQ B;  1P3G A;  3X1V A;  3MGQ D;  4J8X B;  4LD9 A;  4J8X D;  1PZR A;  1P34 A;  1HQ3 B;  5JA4 A;  1P3M C;  1HQ3 D;  3X1U C;  3AZF D;  2BYK A;  3REK A;  3B6G D;  4JJN C;  3X1S A;  3C1C C;  5AV5 C;  1KX4 B;  5B24 C;  1P3B C;  5AVC A;  5BNX B;  3VH6 T;  2ZY2 A;  1EQZ A;  3W97 B;  1KX4 D;  1U35 A;  4KGC A;  3W97 D;  5CP6 A;  5B33 C;  3C1B A;  4H9O A;  1P3M D;  3F6T A;  3AN2 C;  3MVD B;  5CPI C;  1ID3 A;  2BYM A;  5AV5 B;  1ZLA A;  1ULY A;  5B1L A;  1S32 B;  3NQU B;  3C1C D;  5KDM B;  4ZUX A;  2F2A C;  4E45 A;  4EO5 C;  5AV5 D;  1P3B D;  2F8N B;  5JRG A;  2F8N D;  2NZD A;  4QLC A;  4R8P A;  2FJ7 B;  3MGR B;  3REI C;  5B33 D;  1P3O B;  2FJ7 D;  4WJ3 C;  4Z5T A;  4G91 C;  3MGR D;  5B40 C;  3AZJ A;  5F99 C;  4WV4 B;  4XUJ A;  3WAA C;  5AV9 A;  1P3F A;  4KUD B;  3MGS B;  2Y2P A;  1P3A B;  3AL0 C;  5B31 C;  5B32 C;  3MGS D;  4ZBJ C;  5B0Z C;  3REI B;  4G92 B;  1P3A D;  2Y2Q A;  2PYO B;  3W99 A;  4J8W B;  4G91 B;  3LJA C;  3REI D;  2PYO D;  1B6W A;  4KHA A;  4XZQ C;  4J8W D;  3A6N C;  2NQB A;  3H0R C;  3WAA D;  4ZBJ B;  2HIO A;  3AZK A;  4WU9 B;  3REL A;  5B0Z D;  4J8X A;  4Z66 C;  2CV5 A;  4XZQ B;  4WU8 B;  3LJA D;  3A6N B;  3AZF A;  4XZQ D;  3VH5 A;  3A6N D;  2UWX A;  2ZY5 A;  3B6G A;  5DNM B;  3LZ1 B;  3EPL A;  3KWQ C;  2JCH A;  4Z66 D;  1M18 C;  1P3M A;  3AYW C;  3X1U A;  4JJN A;  5BNV B;  4WZS B;  3C1C A;  5B24 A;  1P3B A;  3NQU A;  3AZE A;  5KDM A;  2F8N A;  5C3I B;  3V9R B;  3KWQ D;  1M18 B;  3AYW B;  5B33 A;  1M18 D;  2Y2I A;  5BT1 C;  3MGP B;  3AYW D;  3AZN C;  3AN2 A;  5CPI A;  2ZM5 A;  3MGP D;  3UT9 C;  5CPJ C;  3REI A;  3AV2 C;  5GXQ C;  3AZN B;  4H9P B;  5BT1 D;  5B40 A;  5AV6 C;  4NE5 A;  3AZN D;  5F99 A;  3AZG B;  3MNN C;  5BO0 B;  3UT9 B;  3WAA A;  3IP4 C;  3AFA C;  3UT9 D;  5CPJ D;  3EG5 B;  1KX5 C;  3UTB C;  5B31 A;  5AVB C;  5B32 A;  2RVQ C;  5GT0 B;  2CWE A;  5B0Z A;  3WTP E;  3LJA A;  1A7W A;  3NQJ B;  1TAF A;  5GXQ D;  4XZQ A;  1P3K C;  1WWI A;  2W8S A;  3MNN D;  1P3I B;  1P3I D;  3B0C T;  3KXB C;  4H9Q A;  3REJ B;  4Z66 A;  5B2I B;  4J8U C;  3FDD A;  2XD5 A;  3REJ D;  1H3O A;  3UTA A;  5B2I D;  4H9R B;  3WA9 C;  3TU4 C;  4DQY B;  2Y2M A;  4CSR A;  4DRA A;  3WKJ B;  3AZM C;  3O62 C;  3WKJ D;  1JFI B;  2ZY4 A;  3KWQ A;  3MGQ C;  4J8U B;  1P3L B;  4J8V B;  4J8U D;  1P3L D;  4J8V D;  3AYW A;  3WA9 D;  1HQ3 C;  5B1M B;  4X23 B;  3VH6 A;  2G5H C;  5B1M D;  3AZM D;  3O62 D;  4YS3 C;  3A1K A;  1KX4 C;  1T3U A;  3W97 C;  3B0C W;  3KUY C;  3AZN A;  2YFW B;  2F8N K;  4YS3 B;  3MVD C;  5BO0 A;  3UT9 A;  5CPJ A;  3AV1 A;  5CPK B;  4YS3 D;  2Y2O A;  1S32 C;  2F8N G;  3KUY B;  3AV2 A;  5GXQ A;  4AWL C;  3KUY D;  5AV6 A;  4M6B A;  2FJ7 C;  3MGR C;  3MNN A;  1P3O C;  2J8P A;  3AFA A;  3MVD D;  1WWS A;  4Z2M G;  1KX5 A;  3UTB A;  2ARO A;  5AVB A;  5GT3 C;  5G49 A;  1TZY B;  4KUD C;  1S32 D;  3MGS C;  4AWL B;  1P3A C;  1TZY D;  2Y2H A;  2PYO C;  4G92 C;  1P3K A;  4H9N B;  4J8W C;  2BG1 A;  4H9R A;  1P3O D;  5FUG B;  5AV8 B;  5GSU B;  5GT3 B;  3AZH B;  1AOI B;  3B6F A;  5GSU D;  5AV8 D;  3KXB A;  5GT3 D;  4KUD D;  5B31 G;  3R45 B;  5B32 G;  4E44 A;  4J8U A;  3AZI A;  1P3P B;  5B0Y C;  4WU9 C;  3WA9 A;  3TU4 A;  3VH6 W;  2LY8 A;  4WU8 C;  3LZ0 B;  3AZM A;  3O62 A;  1BH9 B;  3MGQ A;  5DNM C;  5B0Y B;  3LZ1 C;  1KX3 B;  5B0Y D;  4WU9 D;  1M19 B;  1HQ3 A;  4WU8 D;  2YFW A;  3REH B;  2JSS A;  4YS3 A;  5AY8 B;  5E5A C;  1BFM A;  5DNM D;  3LZ1 D;  1Z2C B;  5AY8 D;  1KX4 A;  5BNX A;  3W97 A;  5C3I C;  5B2J B;  2G5I C;  2VQR A;  5B2J D;  3MGP C;  3MVD A;  5E5A B;  5AV5 A;  5E5A D;  1S32 A;  2FJ7 A;  3MGR A;  1P3O A;  3AZG C;  1M1A B;  4HGA B;  4KUD A;  3MGS A;  1P3A A;  3W96 C;  1M1A D;  5GT0 C;  2PYO A;  4J8W A;  1N1J B;  3H0L C;  3AZG D;  1F66 C;  2RIQ A;  3W96 B;  1P3I C;  3W96 D;  5B0Y A;  4UUZ B;  5DNN C;  4WU9 A;  5GT0 D;  3REJ C;  3A1I A;  5B2I C;  4WU8 A;  3A6N A;  1F66 B;  1P3G B;  1F66 D;  4H9S C;  5DNM A;  5AVC C;  3WKJ C;  4LD9 B;  3LZ1 A;  5CHL B;  5DNN B;  1P34 B;  1U35 C;  5DNN D;  1P34 D;  2Y2J A;  1P3L C;  2BYK B;  3C1B C;  4J8V C;  1R4V A;  2DF4 C;  1B67 A;  3X1S B;  2Y2L A;  5AVC B;  2Y2G A;  5B1L C;  5B1M C;  3X1S D;  4X23 C;  5E5A A;  1EQZ B;  5BNV A;  5AVC D;  1U35 B;  4KGC B;  5CP6 B;  3KFU G;  4QLC C;  3C1B B;  4H9O B;  1U35 D;  4WNN B;  3V9R A;  1M18 A;  4KGC D;  3C1B D;  1ID3 B;  2BYM B;  2ZY3 A;  3AZJ C;  1ID3 D;  5B1L B;  3MGP A;  5B1L D;  4X23 D;  2NZD B;  4QLC B;  4NE3 A;  4R8P B;  4CAY B;  2IO5 B;  3W99 C;  4QLC D;  5CPK C;  2Y2K A;  4Z5T B;  3AZJ B;  3H0M C;  3AZJ D;  4H9P A;  5AV9 B;  1P3F B;  4NE6 A;  3EPK A;  3AZG A;  3EPJ A;  3W99 B;  2HIO C;  3AZK C;  3W99 D;  5CPK D;  4KHA B;  5GT0 A;  1TZY C;  3EPH A;  2NQB B;  3NQJ A;  2NQB D;  1KU5 A;  1F66 A;  2HIO B;  3AZK B;  3REL B;  5GSU C;  5AV8 C;  1P3I A;  2HIO D;  3AZK D;  2CV5 B;  3AZH C;  1AOI C;  3REL D;  5DNN A;  2CV5 D;  3AZF B;  3B6F C;  3REJ A;  5B2I A;  1P3P C;  3B6G B;  3P5J B;  4H9S A;  3LZ0 C;  3WKJ A;  3AZE C;  3AZH D;  1AOI D;  1JFI A;  1P3M B;  3X1U B;  1P3L A;  4J8V A;  4WNN A;  1P3P D;  1KX3 C;  3X1U D;  4JJN B;  1M19 C;  3C1C B;  2DQN C;  5B24 B;  1P3B B;  4JJN D;  5B1M A;  4X23 A;  3AZE B;  5B24 D;  3LZ0 D;  3REH C;  3B0D C;  3AZE D;  5B33 B;  3X1T C;  5AY8 C;  4CAY A;  3AN2 B;  5CPI B;  3KSY A;  1KX3 D;  3AN2 D;  5CPI D;  1M19 D;  5B2J C;  4EO5 B;  3B0D B;  3WTP C;  3X1T B;  3REH D;  5CPK A;  3X1T D;  2JE5 A;  5B40 B;  5F99 B;  3KUY A;  1BH8 B;  5B40 D;  3WAA B;  5F99 D;  3LEL C;  3WTP B;  5B31 B;  5B32 B;  5B0Z B;  3B0B A;  3WTP D;  5B31 D;  5B32 D;  3LJA B;  2FFF B;  1TAF B;  1M1A C;  4HGA C;  1TZY A;  3UTA C;  5BS7 C;  1W2E A;  1F1E A;  3LEL B;  4H9N A;  3LEL D;  2L5A A;  4H9Q B;  5FUG A;  5GSU A;  5AV8 A;  4Z66 B;  3W98 C;  5GT3 A;  3AZH A;  1AOI A;  3UTA B;  1H3O B;  3AZL C;  4YM6 C;  4UPK A; 
#chains in the Genus database with same CATH homology
 3UTA D;  3R45 A;  1P3P A;  4CSR B;  3VH5 T;  3KWQ B;  3W98 B;  3LZ0 A;  3AZL B;  1P3G C;  3X1V C;  4YM6 B;  3W98 D;  1BH9 A;  3AZL D;  4DRB A;  2YFV B;  4YM6 D;  4LD9 C;  1P34 C;  1KX3 A;  1M19 A;  3REK C;  2F8N H;  3X1V B;  4NFT A;  3AV1 C;  3X1S C;  1Q9C A;  3REH A;  1HTA A;  3X1V D;  1P3G D;  3X1T A;  5AY8 A;  1EQZ C;  5JA4 B;  4LD9 D;  4Z2M H;  4KGC C;  5CP6 C;  3REK B;  1BH8 A;  5B2J A;  3REK D;  5CPJ B;  3AV1 B;  1ID3 C;  1ZLA C;  3AV1 D;  3WTP A;  2ARO C;  4ZUX C;  3AV2 B;  5GXQ B;  5JRG C;  1EQZ D;  2NZD C;  3VH5 W;  4R8P C;  3AV2 D;  5AV6 B;  2IO5 C;  5CP6 D;  3MNN B;  5AV6 D;  4Z5T C;  3AFA B;  1ZLA B;  3LEL A;  4XUJ C;  1KX5 B;  3UTB B;  2ARO B;  2Y2N A;  4ZUX B;  5AVB B;  5AV9 C;  5G49 B;  3AFA D;  1P3F C;  1KX5 D;  1ZLA D;  3UTB D;  5JRG B;  2ARO D;  4ZUX D;  5AVB D;  2RVQ D;  1M1A A;  3AZI C;  5JRG D;  2NZD D;  1P3K B;  4R8P D;  5BS7 A;  1P3K D;  4XUJ B;  4Z5T D;  2NQB C;  4XUJ D;  3B6F B;  1N1J A;  3KXB B;  2HUE C;  5AV9 D;  1P3F D;  3B6F D;  3W98 A;  3KXB D;  3AZI B;  3AZL A;  4YM6 A;  3REL C;  3W96 A;  3AZI D;  4J8X C;  3WA9 B;  2CV5 C;  3TU4 B;  2YFV A;  4UUZ A;  3TU4 D;  3AZF C;  3AZM B;  2HUE B;  3O62 B;  3B6G C;  2XD1 A;  3MGQ B;  1P3G A;  3X1V A;  3MGQ D;  4J8X B;  4LD9 A;  4J8X D;  1PZR A;  1P34 A;  1HQ3 B;  5JA4 A;  1P3M C;  1HQ3 D;  3X1U C;  3AZF D;  2BYK A;  3REK A;  3B6G D;  4JJN C;  3X1S A;  3C1C C;  5AV5 C;  1KX4 B;  5B24 C;  1P3B C;  5AVC A;  5BNX B;  3VH6 T;  2ZY2 A;  1EQZ A;  3W97 B;  1KX4 D;  1U35 A;  4KGC A;  3W97 D;  5CP6 A;  5B33 C;  3C1B A;  4H9O A;  1P3M D;  3F6T A;  3AN2 C;  3MVD B;  5CPI C;  1ID3 A;  2BYM A;  5AV5 B;  1ZLA A;  1ULY A;  5B1L A;  1S32 B;  3NQU B;  3C1C D;  5KDM B;  4ZUX A;  2F2A C;  4E45 A;  4EO5 C;  5AV5 D;  1P3B D;  2F8N B;  5JRG A;  2F8N D;  2NZD A;  4QLC A;  4R8P A;  2FJ7 B;  3MGR B;  3REI C;  5B33 D;  1P3O B;  2FJ7 D;  4WJ3 C;  4Z5T A;  4G91 C;  3MGR D;  5B40 C;  3AZJ A;  5F99 C;  4WV4 B;  4XUJ A;  3WAA C;  5AV9 A;  1P3F A;  4KUD B;  3MGS B;  2Y2P A;  1P3A B;  3AL0 C;  5B31 C;  5B32 C;  3MGS D;  4ZBJ C;  5B0Z C;  3REI B;  4G92 B;  1P3A D;  2Y2Q A;  2PYO B;  3W99 A;  4J8W B;  4G91 B;  3LJA C;  3REI D;  2PYO D;  1B6W A;  4KHA A;  4XZQ C;  4J8W D;  3A6N C;  2NQB A;  3H0R C;  3WAA D;  4ZBJ B;  2HIO A;  3AZK A;  4WU9 B;  3REL A;  5B0Z D;  4J8X A;  4Z66 C;  2CV5 A;  4XZQ B;  4WU8 B;  3LJA D;  3A6N B;  3AZF A;  4XZQ D;  3VH5 A;  3A6N D;  2UWX A;  2ZY5 A;  3B6G A;  5DNM B;  3LZ1 B;  3EPL A;  3KWQ C;  2JCH A;  4Z66 D;  1M18 C;  1P3M A;  3AYW C;  3X1U A;  4JJN A;  5BNV B;  4WZS B;  3C1C A;  5B24 A;  1P3B A;  3NQU A;  3AZE A;  5KDM A;  2F8N A;  5C3I B;  3V9R B;  3KWQ D;  1M18 B;  3AYW B;  5B33 A;  1M18 D;  2Y2I A;  5BT1 C;  3MGP B;  3AYW D;  3AZN C;  3AN2 A;  5CPI A;  2ZM5 A;  3MGP D;  3UT9 C;  5CPJ C;  3REI A;  3AV2 C;  5GXQ C;  3AZN B;  4H9P B;  5BT1 D;  5B40 A;  5AV6 C;  4NE5 A;  3AZN D;  5F99 A;  3AZG B;  3MNN C;  5BO0 B;  3UT9 B;  3WAA A;  3IP4 C;  3AFA C;  3UT9 D;  5CPJ D;  3EG5 B;  1KX5 C;  3UTB C;  5B31 A;  5AVB C;  5B32 A;  2RVQ C;  5GT0 B;  2CWE A;  5B0Z A;  3WTP E;  3LJA A;  1A7W A;  3NQJ B;  1TAF A;  5GXQ D;  4XZQ A;  1P3K C;  1WWI A;  2W8S A;  3MNN D;  1P3I B;  1P3I D;  3B0C T;  3KXB C;  4H9Q A;  3REJ B;  4Z66 A;  5B2I B;  4J8U C;  3FDD A;  2XD5 A;  3REJ D;  1H3O A;  3UTA A;  5B2I D;  4H9R B;  3WA9 C;  3TU4 C;  4DQY B;  2Y2M A;  4CSR A;  4DRA A;  3WKJ B;  3AZM C;  3O62 C;  3WKJ D;  1JFI B;  2ZY4 A;  3KWQ A;  3MGQ C;  4J8U B;  1P3L B;  4J8V B;  4J8U D;  1P3L D;  4J8V D;  3AYW A;  3WA9 D;  1HQ3 C;  5B1M B;  4X23 B;  3VH6 A;  2G5H C;  5B1M D;  3AZM D;  3O62 D;  4YS3 C;  3A1K A;  1KX4 C;  1T3U A;  3W97 C;  3B0C W;  3KUY C;  3AZN A;  2YFW B;  2F8N K;  4YS3 B;  3MVD C;  5BO0 A;  3UT9 A;  5CPJ A;  3AV1 A;  5CPK B;  4YS3 D;  2Y2O A;  1S32 C;  2F8N G;  3KUY B;  3AV2 A;  5GXQ A;  4AWL C;  3KUY D;  5AV6 A;  4M6B A;  2FJ7 C;  3MGR C;  3MNN A;  1P3O C;  2J8P A;  3AFA A;  3MVD D;  1WWS A;  4Z2M G;  1KX5 A;  3UTB A;  2ARO A;  5AVB A;  5GT3 C;  5G49 A;  1TZY B;  4KUD C;  1S32 D;  3MGS C;  4AWL B;  1P3A C;  1TZY D;  2Y2H A;  2PYO C;  4G92 C;  1P3K A;  4H9N B;  4J8W C;  2BG1 A;  4H9R A;  1P3O D;  5FUG B;  5AV8 B;  5GSU B;  5GT3 B;  3AZH B;  1AOI B;  3B6F A;  5GSU D;  5AV8 D;  3KXB A;  5GT3 D;  4KUD D;  5B31 G;  3R45 B;  5B32 G;  4E44 A;  4J8U A;  3AZI A;  1P3P B;  5B0Y C;  4WU9 C;  3WA9 A;  3TU4 A;  3VH6 W;  2LY8 A;  4WU8 C;  3LZ0 B;  3AZM A;  3O62 A;  1BH9 B;  3MGQ A;  5DNM C;  5B0Y B;  3LZ1 C;  1KX3 B;  5B0Y D;  4WU9 D;  1M19 B;  1HQ3 A;  4WU8 D;  2YFW A;  3REH B;  2JSS A;  4YS3 A;  5AY8 B;  5E5A C;  1BFM A;  5DNM D;  3LZ1 D;  1Z2C B;  5AY8 D;  1KX4 A;  5BNX A;  3W97 A;  5C3I C;  5B2J B;  2G5I C;  2VQR A;  5B2J D;  3MGP C;  3MVD A;  5E5A B;  5AV5 A;  5E5A D;  1S32 A;  2FJ7 A;  3MGR A;  1P3O A;  3AZG C;  1M1A B;  4HGA B;  4KUD A;  3MGS A;  1P3A A;  3W96 C;  1M1A D;  5GT0 C;  2PYO A;  4J8W A;  1N1J B;  3H0L C;  3AZG D;  1F66 C;  2RIQ A;  3W96 B;  1P3I C;  3W96 D;  5B0Y A;  4UUZ B;  5DNN C;  4WU9 A;  5GT0 D;  3REJ C;  3A1I A;  5B2I C;  4WU8 A;  3A6N A;  1F66 B;  1P3G B;  1F66 D;  4H9S C;  5DNM A;  5AVC C;  3WKJ C;  4LD9 B;  3LZ1 A;  5CHL B;  5DNN B;  1P34 B;  1U35 C;  5DNN D;  1P34 D;  2Y2J A;  1P3L C;  2BYK B;  3C1B C;  4J8V C;  1R4V A;  2DF4 C;  1B67 A;  3X1S B;  2Y2L A;  5AVC B;  2Y2G A;  5B1L C;  5B1M C;  3X1S D;  4X23 C;  5E5A A;  1EQZ B;  5BNV A;  5AVC D;  1U35 B;  4KGC B;  5CP6 B;  3KFU G;  4QLC C;  3C1B B;  4H9O B;  1U35 D;  4WNN B;  3V9R A;  1M18 A;  4KGC D;  3C1B D;  1ID3 B;  2BYM B;  2ZY3 A;  3AZJ C;  1ID3 D;  5B1L B;  3MGP A;  5B1L D;  4X23 D;  2NZD B;  4QLC B;  4NE3 A;  4R8P B;  4CAY B;  2IO5 B;  3W99 C;  4QLC D;  5CPK C;  2Y2K A;  4Z5T B;  3AZJ B;  3H0M C;  3AZJ D;  4H9P A;  5AV9 B;  1P3F B;  4NE6 A;  3EPK A;  3AZG A;  3EPJ A;  3W99 B;  2HIO C;  3AZK C;  3W99 D;  5CPK D;  4KHA B;  5GT0 A;  1TZY C;  3EPH A;  2NQB B;  3NQJ A;  2NQB D;  1KU5 A;  1F66 A;  2HIO B;  3AZK B;  3REL B;  5GSU C;  5AV8 C;  1P3I A;  2HIO D;  3AZK D;  2CV5 B;  3AZH C;  1AOI C;  3REL D;  5DNN A;  2CV5 D;  3AZF B;  3B6F C;  3REJ A;  5B2I A;  1P3P C;  3B6G B;  3P5J B;  4H9S A;  3LZ0 C;  3WKJ A;  3AZE C;  3AZH D;  1AOI D;  1JFI A;  1P3M B;  3X1U B;  1P3L A;  4J8V A;  4WNN A;  1P3P D;  1KX3 C;  3X1U D;  4JJN B;  1M19 C;  3C1C B;  2DQN C;  5B24 B;  1P3B B;  4JJN D;  5B1M A;  4X23 A;  3AZE B;  5B24 D;  3LZ0 D;  3REH C;  3B0D C;  3AZE D;  5B33 B;  3X1T C;  5AY8 C;  4CAY A;  3AN2 B;  5CPI B;  3KSY A;  1KX3 D;  3AN2 D;  5CPI D;  1M19 D;  5B2J C;  4EO5 B;  3B0D B;  3WTP C;  3X1T B;  3REH D;  5CPK A;  3X1T D;  2JE5 A;  5B40 B;  5F99 B;  3KUY A;  1BH8 B;  5B40 D;  3WAA B;  5F99 D;  3LEL C;  3WTP B;  5B31 B;  5B32 B;  5B0Z B;  3B0B A;  3WTP D;  5B31 D;  5B32 D;  3LJA B;  2FFF B;  1TAF B;  1M1A C;  4HGA C;  1TZY A;  3UTA C;  5BS7 C;  1W2E A;  1F1E A;  3LEL B;  4H9N A;  3LEL D;  2L5A A;  4H9Q B;  5FUG A;  5GSU A;  5AV8 A;  4Z66 B;  3W98 C;  5GT3 A;  3AZH A;  1AOI A;  3UTA B;  1H3O B;  3AZL C;  4YM6 C;  4UPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...