3A6ND

The nucleosome containing a testis-specific histone variant, human h3t
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1t
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3a6nD00
2HIOB 2AROA 1KX4A 3W96A 1KX4C 3W96C 4X23A 3AZNA 3REJC 4Z66B 1M18A 5G49B 5AV6B 1M1AB 3WTPE 3AZJA 4G92B 5B33D 3AZJC 1ZLAB 3MVDD 3AZIB 5B2JC 3UTAD 4KGCA 4KGCC 3AN2C 1P3GD 5DNND 3AZEB 4JJNB 5CPID 3MNND 3VH5A 4H9OB 3X1VD 4J8UC 3B6GD 2LY8A 3AZMB 3AV2C 3AZKA 3AZKC 1A7WA 1B67A 2RVQD 3R45B 1P3LA 4E45A 2BYKB 1P3OD 5AVBD 3O62D 3UTBD 5AV9D 3LZ1A 3KXBC 3AZFD 3WA9B 3MGPA 3MGPC 4WU8A 3KWQD 5B31A 5GT3D 1ID3D 2BYMA 2IO5C 1U35B 1F66B 4J8XA 5B40B 3REHB 1AOIA 2F8ND 2PYOD 5AV5A 4QLCB 5AV5C 3C1BA 3REIA 5BNXB 3REIC 4YM6A 4ZBJB 1P3PD 1S32B 1KX3D 4H9NB 5BNVA 5B32A 3LJAB 1BH8A 5B32C 3AZLA 3AYWB 4LD9A 3RELD 5JA4A 2L5AA 1P3KB 5CPJD 5B0YA 1R4VA 1P3IA 5B24A 1P3BB 2AROD 3AZGA 1TZYB 3AFAA 4WU9B 3AFAC 5FUGA 4WNNB 4X23D 1HQ3D 3TU4B 3AZND 1M18D 1HTAA 5BO0B 3W97D 5CPKB 4J8VD 5B33A 5B33C 3WAAB 1KX4B 4H9RA 3MVDC 3W96B 3W98A 3B0DC 3UTAA 3REJB 3UTAC 1P3GA 1P3GC 5DNNC 3AV1C 3AZJB 3KUYD 3C1CA 5CPIC 5CPIA 3MNNA 3MNNC 5B2JB 2YFWA 5GT0A 3X1TD 3X1VC 3AN2B 3X1VA 4KGCB 3B6GA 3B6GC 1H3OB 5BS7A 4HGAC 5BS7C 5B0ZD 2RVQC 4J8UB 2F8NH 1P3OC 5AVBA 5AVBC 4NE5A 3O62A 3UTBA 3AV2B 3LZ1D 5AV9A 5AV9C 5AY8D 3AZKB 5E5AA 4H9PA 5AV8D 2NQBA 1BFMA 3AZFA 4WU8D 5B1MD 3AZFC 2YFVA 5B31D 3KWQA 3KWQC 5C3IC 5GT3A 5GT3C 5F99D 1ID3C 4XZQA 3KXBB 4J8XD 5B2ID 3MGPB 3C1BD 2PYOA 2PYOC 4H9SA 2IO5B 3REKD 1P3PC 1KX3C 3AZLD 5AV5B 1M19A 3REIB 5B0YD 3RELA 3RELC 1JFIB 5CPJC 5KDMB 1P3ID 3AZGD 5B32B 1P3FC 2AROC 1KX5A 5AVCD 4X23C 1HQ3A 1HQ3C 2HUEC 4CAYA 3AZNC 1M18C 3VH6T 3W97A 3W97C 3AFAB 4J8VA 4J8VC 3W98D 3B6FA 3WTPA 5B33B 3C1CD 1P3AD 3MVDB 4H9RB 4XUJA 3KUYA 3KUYC 3B0DB 3NQJB 5GT0D 1P34D 3UTAB 3X1TA 3X1TC 5CP6A 1P3MA 1P3GB 5DNNB 3AZHA 3AV1B 5CPIB 3A6ND 3V9RB 3MNNB 1Q9CA 2YFWB 1P3LC 5B0ZA 5B0ZC 3LELD 3B6GB 1EQZA 5E5AD 3LZ1C 5AY8A 5AY8C 2NQBD 4E44A 5AV8A 5AV8C 4ZUXD 3WKJA 2CV5A 1P3OB 5B1MA 4WU8C 5AVBB 1N1JA 5B1MC 5B31C 4AWLC 5AV9B 2F8NK 4R8PD 4XZQD 1F1EA 4H9PB 5F99A 5F99C 4J8XC 3AZFB 5B2IA 2YFVB 5B2IC 3KWQB 3MGSA 1AOIC 5C3IB 5GT3B 3C1BC 4CSRA 1ID3B 4YM6C 3REKA 4DRBA 1KU5A 1TAFA 2F8NB 1M19D 2PYOB 3AZLC 3X1SA 4LD9C 3REHD 5B0YC 1P3PB 1P3IC 5B24C 1KX3B 3AZGC 1KX5D 5AVCA 5AVCC 3VH6W 3RELB 2CWEA 5CPJB 2NZDB 1P3FB 2AROB 3B6FD 5BT1D 4X23B 3W98C 1HQ3B 2HUEB 3WTPD 5B1LD 4CAYB 3AZNB 1M18B 2HIOA 1BH9A 3UT9D 3W97B 4YS3D 4J8VB 4XUJD 3C1CC 1P3AC 3MGRD 1P3AA 5B32G 5G49A 4Z5TD 1P34A 5GT0C 5CP6D 1P34C 1P3MD 1ZLAA 3WAAD 3AZHD 4G91C 3REJD 4WZSB 3KUYB 3A6NA 3A6NC 3X1TB 3NQUA 4Z2MH 3LELA 1EQZD 3LELC 4KUDD 3MGQD 3O62C 3UTBC 5E5AC 5GXQD 4EO5C 3WKJD 2NQBC 3AZMA 4ZUXA 2CV5D 4ZUXC 1P3LB 1ULYA 3LZ1B 5AY8B 4R8PA 4R8PC 4XZQC 5AV8B 4H9QA 5B1MB 4WU8B 1N1JB 3MGSD 5B31B 4AWLB 4H9SC 3WA9A 2BYMB 4KHAA 5F99B 3B0BA 4J8XB 5B2IB 4J8WD 1AOIB 5JRGD 3KXBD 3C1BB 1M19C 3X1SD 4CSRB 5B40A 5GSUD 4YM6B 3REHA 3X1UD 5BNVB 3W99D 1TAFB 1BH8B 3AZLB 1KX5C 3VH6A 2FJ7D 4LD9B 5JA4B 5B0YB 3LZ0D 3AYWA 1P3IB 5B24B 3AZGB 4NE3A 5FUGB 5AVCB 5DNMD 5BT1C 3B6FC 2F8NG 4UUZA 4Z2MG 5B1LA 3WTPC 2HIOD 5B1LC 1P3BA 1TZYA 4WNNA 3UT9A 3UT9C 4YS3A 4YS3C 3TU4A 4Z66D 3W98B 4NFTA 4XUJC 2JSSA 5AV6D 5BO0A 3MGRA 3MGRC 1M1AD 5CPKA 4Z5TA 4Z5TC 1ZLAD 5CP6C 1P3MC 1BH9B 3WAAA 3WAAC 3AZID 3AZHC 3REJA 3C1CB 1P3AB 3AZED 4JJND 5GT0B 3X1VB 1P34B 1EQZC 5B2JA 3MGQA 4G91B 3MGQC 4KUDA 4KUDC 3AN2A 3B0CT 3A6NB 3AV1D 5GXQA 4HGAB 5GXQC 3AZMD 3WKJC 3NQUB 2CV5C 3LELB 1H3OA 3O62B 3UTBB 4J8UA 5E5AB 2NQBB 3VH5T 4EO5B 4ZUXB 3AV2A 3MGSC 3WA9D 4R8PB 4XZQB 3REKC 4H9QB 4J8WA 4WV4B 4J8WC 5JRGA 5JRGC 1U35D 3KXBA 1F66D 5B40D 3X1SC 4KHAB 5GSUA 5GSUC 4QLCD 3X1UA 4M6BA 3X1UC 3W99A 3W99C 1M19B 1S32D 1B6WA 5B31G 2FJ7A 2FJ7C 3LJAD 3AYWD 1WWSA 3LZ0A 3LZ0C 1P3KD 1JFIA 1KX5B 5KDMA 5DNMA 5DNMC 4DRAA 1P3BD 4WU9D 1TZYD 2HIOC 3TU4D 4Z66A 3B6FB 4NE6A 4Z66C 4UUZB 5AV6A 5AV6C 3KSYA 5CPKD 1M1AA 3WTPB 5B1LB 1P3FD 1M1AC 2NZDD 4G92C 1KX4D 1ZLAC 3W96D 3AZIA 3UT9B 3AZIC 4YS3B 4XUJB 3MGRB 3AZEA 3AZEC 4JJNA 4JJNC 4Z5TB 3AZJD 5CP6B 1P3MB 3B0CW 3MVDA 3AZHB 5B2JD 4H9OA 3NQJA 4KGCD 3AN2D 5DNNA 3AV1A 3AZMC 5B0ZB 1EQZB 3V9RA 3VH5W 4KUDB 3MGQB 4J8UD 3R45A 2BYKA 5GXQB 3AV2D 3WKJB 2CV5B 3AZKD 1P3LD 3WA9C 1WWIA 1P3OA 3MGSB 1U35A 1U35C 1F66A 3MGPD 1F66C 5B40C 3REKB 3REHC 4QLCA 4QLCC 5BNXA 4J8WB 1ID3A 5JRGB 4ZBJC 3X1SB 1S32C 1S32A 4H9NA 1AOID 5GSUB 3LJAA 5AV5D 3LJAC 2F8NA 3AYWC 3REID 3X1UB 2NZDC 4YM6D 3W99B 1P3KA 1P3KC 5CHLB 1P3PA 2FJ7B 1KX3A 5B32D 4WU9A 1P3BC 4WU9C 1TZYC 3LZ0B 4LD9D 3TU4C 5CPJA 5DNMB 5B24D 5CPKC 2NZDA 1P3FA 3AFAD
chains in the Genus database with same CATH superfamily
2HIOB 2AROA 1KX4A 3W96A 1KX4C 3W96C 4X23A 3AZNA 3REJC 4Z66B 1M18A 5G49B 5AV6B 1M1AB 3WTPE 3AZJA 4G92B 5B33D 3AZJC 1ZLAB 3MVDD 2F2AC 3AZIB 5B2JC 3UTAD 4KGCA 4KGCC 2ZY4A 3AN2C 1P3GD 5DNND 3AZEB 4JJNB 5CPID 3MNND 3VH5A 4H9OB 3X1VD 4J8UC 3B6GD 2LY8A 3AZMB 3AV2C 3H0MC 3AZKA 3AZKC 1A7WA 1B67A 2RVQD 3R45B 1P3LA 4E45A 2BYKB 1P3OD 5AVBD 3O62D 3UTBD 5AV9D 3F6TA 3LZ1A 3KXBC 3AZFD 3WA9B 3MGPA 3MGPC 4WU8A 3KWQD 5B31A 2Y2KA 5GT3D 1ID3D 2BYMA 2IO5C 1U35B 1F66B 4J8XA 5B40B 3REHB 1AOIA 2F8ND 2PYOD 5AV5A 4QLCB 5AV5C 3C1BA 3REIA 5BNXB 3REIC 3EPHA 4YM6A 4ZBJB 1P3PD 1S32B 2Y2OA 1KX3D 4H9NB 5BNVA 5B32A 3LJAB 1BH8A 5B32C 3AZLA 3AYWB 4LD9A 3RELD 5JA4A 2L5AA 1P3KB 5CPJD 5B0YA 1R4VA 1P3IA 5B24A 1P3BB 2AROD 3AZGA 1TZYB 3AFAA 4WU9B 3AFAC 5FUGA 4WNNB 2DQNC 4X23D 1HQ3D 3TU4B 3AZND 1M18D 2Y2JA 1HTAA 5BO0B 3W97D 5CPKB 2UWXA 4J8VD 1Z2CB 5B33A 5B33C 3WAAB 1KX4B 4H9RA 3MVDC 3W96B 3W98A 3B0DC 3UTAA 3REJB 3UTAC 3EPKA 1P3GA 1P3GC 5DNNC 3AV1C 3AZJB 3KUYD 3C1CA 5CPIC 5CPIA 3MNNA 3EPJA 3MNNC 5B2JB 2YFWA 5GT0A 3X1TD 3X1VC 3AN2B 3X1VA 4KGCB 3B6GA 3B6GC 1H3OB 5BS7A 4HGAC 5BS7C 5B0ZD 2RVQC 4J8UB 2F8NH 1P3OC 2VQRA 5AVBA 5AVBC 4NE5A 3O62A 3UTBA 3AV2B 3LZ1D 5AV9A 5AV9C 5AY8D 3AZKB 5E5AA 4H9PA 5AV8D 2NQBA 1BFMA 3AZFA 4WU8D 5B1MD 3AZFC 2YFVA 5B31D 3KWQA 3KWQC 5C3IC 5GT3A 5GT3C 5F99D 1ID3C 4XZQA 2G5IC 3KXBB 4J8XD 5B2ID 3MGPB 3C1BD 2PYOA 2PYOC 4H9SA 4WJ3C 2IO5B 3REKD 2Y2IA 1P3PC 2JCHA 1KX3C 3AZLD 3KFUG 5AV5B 1M19A 3REIB 2Y2HA 5B0YD 3RELA 3RELC 1JFIB 5CPJC 5KDMB 1P3ID 3AZGD 5B32B 1P3FC 2AROC 1KX5A 2ZY3A 5AVCD 4X23C 1HQ3A 1HQ3C 2HUEC 4CAYA 3AZNC 1M18C 3VH6T 3W97A 3W97C 3AFAB 4J8VA 4J8VC 3W98D 3B6FA 3WTPA 2ZM5A 3EG5B 5B33B 3C1CD 1P3AD 3MVDB 4H9RB 4XUJA 3KUYA 3KUYC 3B0DB 3NQJB 5GT0D 1P34D 3UTAB 3X1TA 3X1TC 5CP6A 1P3MA 1W2EA 2XD5A 1P3GB 5DNNB 3AZHA 3AV1B 5CPIB 3A6ND 3V9RB 3MNNB 1Q9CA 2YFWB 1P3LC 5B0ZA 5B0ZC 3LELD 3B6GB 1EQZA 5E5AD 3LZ1C 3EPLA 5AY8A 2RIQA 5AY8C 2NQBD 4E44A 5AV8A 4ZUXD 5AV8C 3WKJA 2XD1A 2CV5A 1P3OB 5B1MA 4WU8C 5AVBB 5B1MC 1N1JA 5B31C 4AWLC 1PZRA 5AV9B 2F8NK 4R8PD 4XZQD 1F1EA 4H9PB 5F99A 5F99C 4J8XC 3AZFB 5B2IA 2YFVB 5B2IC 3KWQB 3MGSA 1AOIC 5C3IB 5GT3B 3C1BC 4CSRA 1ID3B 4YM6C 3REKA 4DRBA 1KU5A 3FDDA 1TAFA 2F8NB 1M19D 2PYOB 3AZLC 3X1SA 4LD9C 3REHD 5B0YC 1P3PB 1P3IC 5B24C 1KX3B 3AZGC 1KX5D 5AVCA 5AVCC 3VH6W 3RELB 2CWEA 5CPJB 2NZDB 1P3FB 2AROB 2Y2MA 3B6FD 5BT1D 2ZY2A 4X23B 3W98C 1HQ3B 2HUEB 3WTPD 5B1LD 4CAYB 3AZNB 1M18B 2HIOA 1BH9A 3UT9D 3W97B 4YS3D 4J8VB 4XUJD 3C1CC 1P3AC 3MGRD 1P3AA 5B32G 5G49A 4Z5TD 1P34A 5GT0C 5CP6D 1P34C 1P3MD 2J8PA 1ZLAA 3WAAD 3AZHD 4G91C 3REJD 4WZSB 3KUYB 3A6NA 3A6NC 3X1TB 3NQUA 4Z2MH 3LELA 1EQZD 3LELC 4KUDD 3MGQD 3O62C 3UTBC 5E5AC 2FFFB 3H0LC 5GXQD 4EO5C 3WKJD 2NQBC 3AZMA 4ZUXA 2CV5D 4ZUXC 1P3LB 1ULYA 3LZ1B 5AY8B 4R8PA 4R8PC 4XZQC 5AV8B 4H9QA 5B1MB 4WU8B 1N1JB 3MGSD 5B31B 4AWLB 4H9SC 3WA9A 2BYMB 4KHAA 5F99B 3B0BA 4J8XB 5B2IB 4J8WD 1AOIB 5JRGD 3KXBD 3C1BB 1M19C 3X1SD 4CSRB 5B40A 2G5HC 5GSUD 4YM6B 3REHA 3X1UD 5BNVB 3W99D 1TAFB 1BH8B 3A1IA 3AZLB 1KX5C 3VH6A 2FJ7D 4LD9B 5JA4B 1T3UA 5B0YB 3LZ0D 3AYWA 1P3IB 5B24B 3AZGB 4NE3A 5FUGB 5AVCB 5DNMD 5BT1C 3B6FC 2F8NG 4UUZA 4Z2MG 5B1LA 3WTPC 2HIOD 5B1LC 1P3BA 1TZYA 4WNNA 3UT9A 3UT9C 4YS3A 4YS3C 3TU4A 4Z66D 3W98B 4NFTA 4XUJC 2JSSA 5AV6D 5BO0A 3MGRA 3MGRC 1M1AD 5CPKA 4Z5TA 4Z5TC 1ZLAD 5CP6C 1P3MC 1BH9B 3WAAA 3WAAC 3AZID 3AZHC 3REJA 3C1CB 1P3AB 3AZED 4JJND 5GT0B 3X1VB 1P34B 4DQYB 1EQZC 5B2JA 3MGQA 4G91B 3MGQC 4KUDA 4KUDC 3AN2A 3B0CT 3A6NB 3AV1D 5GXQA 4HGAB 5GXQC 3AZMD 3WKJC 3NQUB 2CV5C 3LELB 1H3OA 3O62B 3UTBB 4J8UA 5E5AB 2NQBB 3VH5T 4EO5B 4ZUXB 3AV2A 2Y2NA 3MGSC 3WA9D 4R8PB 4XZQB 3REKC 4H9QB 2Y2QA 4J8WA 4WV4B 4J8WC 5JRGA 5JRGC 1U35D 3KXBA 1F66D 5B40D 3X1SC 4KHAB 5GSUA 5GSUC 4QLCD 3X1UA 4M6BA 3X1UC 3W99A 3W99C 1M19B 1S32D 1B6WA 5B31G 2FJ7A 2FJ7C 3LJAD 3AYWD 1WWSA 3LZ0A 3LZ0C 1P3KD 2JE5A 1JFIA 1KX5B 5KDMA 5DNMA 5DNMC 4DRAA 1P3BD 4WU9D 1TZYD 2HIOC 3TU4D 4Z66A 3B6FB 4NE6A 4Z66C 4UUZB 5AV6A 5AV6C 3KSYA 5CPKD 1M1AA 3WTPB 5B1LB 3H0RC 1P3FD 1M1AC 4G92C 2NZDD 1KX4D 1ZLAC 3W96D 3AZIA 3UT9B 3AZIC 4YS3B 4XUJB 4UPKA 3MGRB 3AZEA 2Y2GA 4JJNA 3AZEC 4JJNC 4Z5TB 3AZJD 5CP6B 1P3MB 3B0CW 3MVDA 3AZHB 5B2JD 4H9OA 3NQJA 4KGCD 2Y2LA 3AN2D 5DNNA 3AV1A 3IP4C 3P5JB 3AZMC 5B0ZB 1EQZB 3V9RA 3VH5W 4KUDB 3MGQB 4J8UD 3R45A 2BG1A 2BYKA 2DF4C 5GXQB 3AV2D 3WKJB 2CV5B 3AZKD 1P3LD 2ZY5A 3WA9C 1WWIA 1P3OA 3MGSB 3A1KA 1U35A 1U35C 1F66A 3MGPD 1F66C 5B40C 3REKB 3REHC 4QLCA 4QLCC 5BNXA 4J8WB 1ID3A 3AL0C 5JRGB 4ZBJC 3X1SB 1S32C 1S32A 2W8SA 4H9NA 1AOID 5GSUB 3LJAA 5AV5D 3LJAC 2F8NA 3AYWC 3REID 3X1UB 2Y2PA 2NZDC 4YM6D 3W99B 1P3KA 1P3KC 5CHLB 1P3PA 2FJ7B 1KX3A 5B32D 4WU9A 1P3BC 4WU9C 1TZYC 3LZ0B 4LD9D 3TU4C 5CPJA 5DNMB 5B24D 5CPKC 2NZDA 1P3FA 3AFAD
chains in the Genus database with same CATH topology
2HIOB 2AROA 1KX4A 3W96A 1KX4C 3W96C 4X23A 3AZNA 3REJC 4Z66B 1M18A 5G49B 5AV6B 1M1AB 3WTPE 3AZJA 4G92B 5B33D 3AZJC 1ZLAB 3MVDD 2F2AC 3AZIB 5B2JC 3UTAD 4KGCA 4KGCC 2ZY4A 3AN2C 1P3GD 5DNND 3AZEB 4JJNB 5CPID 3MNND 3VH5A 4H9OB 3X1VD 4J8UC 3B6GD 2LY8A 3AZMB 3AV2C 3H0MC 3AZKA 3AZKC 1A7WA 1B67A 2RVQD 3R45B 1P3LA 4E45A 2BYKB 1P3OD 5AVBD 3O62D 3UTBD 5AV9D 3F6TA 3LZ1A 3KXBC 3AZFD 3WA9B 3MGPA 3MGPC 4WU8A 3KWQD 5B31A 2Y2KA 5GT3D 1ID3D 2BYMA 2IO5C 1U35B 1F66B 4J8XA 5B40B 3REHB 1AOIA 2F8ND 2PYOD 5AV5A 4QLCB 5AV5C 3C1BA 3REIA 5BNXB 3REIC 3EPHA 4YM6A 4ZBJB 1P3PD 1S32B 2Y2OA 1KX3D 4H9NB 5BNVA 5B32A 3LJAB 1BH8A 5B32C 3AZLA 3AYWB 4LD9A 3RELD 5JA4A 2L5AA 1P3KB 5CPJD 5B0YA 1R4VA 1P3IA 5B24A 1P3BB 2AROD 3AZGA 1TZYB 3AFAA 4WU9B 3AFAC 5FUGA 4WNNB 2DQNC 4X23D 1HQ3D 3TU4B 3AZND 1M18D 2Y2JA 1HTAA 5BO0B 3W97D 5CPKB 2UWXA 4J8VD 1Z2CB 5B33A 5B33C 3WAAB 1KX4B 4H9RA 3MVDC 3W96B 3W98A 3B0DC 3UTAA 3REJB 3UTAC 3EPKA 1P3GA 1P3GC 5DNNC 3AV1C 3AZJB 3KUYD 3C1CA 5CPIC 5CPIA 3MNNA 3EPJA 3MNNC 5B2JB 2YFWA 5GT0A 3X1TD 3X1VC 3AN2B 3X1VA 4KGCB 3B6GA 3B6GC 1H3OB 5BS7A 4HGAC 5BS7C 5B0ZD 2RVQC 4J8UB 2F8NH 1P3OC 2VQRA 5AVBA 5AVBC 4NE5A 3O62A 3UTBA 3AV2B 3LZ1D 5AV9A 5AV9C 5AY8D 3AZKB 5E5AA 4H9PA 5AV8D 2NQBA 1BFMA 3AZFA 4WU8D 5B1MD 3AZFC 2YFVA 5B31D 3KWQA 3KWQC 5C3IC 5GT3A 5GT3C 5F99D 1ID3C 4XZQA 2G5IC 3KXBB 4J8XD 5B2ID 3MGPB 3C1BD 2PYOA 2PYOC 4H9SA 4WJ3C 2IO5B 3REKD 2Y2IA 1P3PC 2JCHA 1KX3C 3AZLD 3KFUG 5AV5B 1M19A 3REIB 2Y2HA 5B0YD 3RELA 3RELC 1JFIB 5CPJC 5KDMB 1P3ID 3AZGD 5B32B 1P3FC 2AROC 1KX5A 2ZY3A 5AVCD 4X23C 1HQ3A 1HQ3C 2HUEC 4CAYA 3AZNC 1M18C 3VH6T 3W97A 3W97C 3AFAB 4J8VA 4J8VC 3W98D 3B6FA 3WTPA 2ZM5A 3EG5B 5B33B 3C1CD 1P3AD 3MVDB 4H9RB 4XUJA 3KUYA 3KUYC 3B0DB 3NQJB 5GT0D 1P34D 3UTAB 3X1TA 3X1TC 5CP6A 1P3MA 1W2EA 2XD5A 1P3GB 5DNNB 3AZHA 3AV1B 5CPIB 3A6ND 3V9RB 3MNNB 1Q9CA 2YFWB 1P3LC 5B0ZA 5B0ZC 3LELD 3B6GB 1EQZA 5E5AD 3LZ1C 3EPLA 5AY8A 2RIQA 5AY8C 2NQBD 4E44A 5AV8A 4ZUXD 5AV8C 3WKJA 2XD1A 2CV5A 1P3OB 5B1MA 4WU8C 5AVBB 5B1MC 1N1JA 5B31C 4AWLC 1PZRA 5AV9B 2F8NK 4R8PD 4XZQD 1F1EA 4H9PB 5F99A 5F99C 4J8XC 3AZFB 5B2IA 2YFVB 5B2IC 3KWQB 3MGSA 1AOIC 5C3IB 5GT3B 3C1BC 4CSRA 1ID3B 4YM6C 3REKA 4DRBA 1KU5A 3FDDA 1TAFA 2F8NB 1M19D 2PYOB 3AZLC 3X1SA 4LD9C 3REHD 5B0YC 1P3PB 1P3IC 5B24C 1KX3B 3AZGC 1KX5D 5AVCA 5AVCC 3VH6W 3RELB 2CWEA 5CPJB 2NZDB 1P3FB 2AROB 2Y2MA 3B6FD 5BT1D 2ZY2A 4X23B 3W98C 1HQ3B 2HUEB 3WTPD 5B1LD 4CAYB 3AZNB 1M18B 2HIOA 1BH9A 3UT9D 3W97B 4YS3D 4J8VB 4XUJD 3C1CC 1P3AC 3MGRD 1P3AA 5B32G 5G49A 4Z5TD 1P34A 5GT0C 5CP6D 1P34C 1P3MD 2J8PA 1ZLAA 3WAAD 3AZHD 4G91C 3REJD 4WZSB 3KUYB 3A6NA 3A6NC 3X1TB 3NQUA 4Z2MH 3LELA 1EQZD 3LELC 4KUDD 3MGQD 3O62C 3UTBC 5E5AC 2FFFB 3H0LC 5GXQD 4EO5C 3WKJD 2NQBC 3AZMA 4ZUXA 2CV5D 4ZUXC 1P3LB 1ULYA 3LZ1B 5AY8B 4R8PA 4R8PC 4XZQC 5AV8B 4H9QA 5B1MB 4WU8B 1N1JB 3MGSD 5B31B 4AWLB 4H9SC 3WA9A 2BYMB 4KHAA 5F99B 3B0BA 4J8XB 5B2IB 4J8WD 1AOIB 5JRGD 3KXBD 3C1BB 1M19C 3X1SD 4CSRB 5B40A 2G5HC 5GSUD 4YM6B 3REHA 3X1UD 5BNVB 3W99D 1TAFB 1BH8B 3A1IA 3AZLB 1KX5C 3VH6A 2FJ7D 4LD9B 5JA4B 1T3UA 5B0YB 3LZ0D 3AYWA 1P3IB 5B24B 3AZGB 4NE3A 5FUGB 5AVCB 5DNMD 5BT1C 3B6FC 2F8NG 4UUZA 4Z2MG 5B1LA 3WTPC 2HIOD 5B1LC 1P3BA 1TZYA 4WNNA 3UT9A 3UT9C 4YS3A 4YS3C 3TU4A 4Z66D 3W98B 4NFTA 4XUJC 2JSSA 5AV6D 5BO0A 3MGRA 3MGRC 1M1AD 5CPKA 4Z5TA 4Z5TC 1ZLAD 5CP6C 1P3MC 1BH9B 3WAAA 3WAAC 3AZID 3AZHC 3REJA 3C1CB 1P3AB 3AZED 4JJND 5GT0B 3X1VB 1P34B 4DQYB 1EQZC 5B2JA 3MGQA 4G91B 3MGQC 4KUDA 4KUDC 3AN2A 3B0CT 3A6NB 3AV1D 5GXQA 4HGAB 5GXQC 3AZMD 3WKJC 3NQUB 2CV5C 3LELB 1H3OA 3O62B 3UTBB 4J8UA 5E5AB 2NQBB 3VH5T 4EO5B 4ZUXB 3AV2A 2Y2NA 3MGSC 3WA9D 4R8PB 4XZQB 3REKC 4H9QB 2Y2QA 4J8WA 4WV4B 4J8WC 5JRGA 5JRGC 1U35D 3KXBA 1F66D 5B40D 3X1SC 4KHAB 5GSUA 5GSUC 4QLCD 3X1UA 4M6BA 3X1UC 3W99A 3W99C 1M19B 1S32D 1B6WA 5B31G 2FJ7A 2FJ7C 3LJAD 3AYWD 1WWSA 3LZ0A 3LZ0C 1P3KD 2JE5A 1JFIA 1KX5B 5KDMA 5DNMA 5DNMC 4DRAA 1P3BD 4WU9D 1TZYD 2HIOC 3TU4D 4Z66A 3B6FB 4NE6A 4Z66C 4UUZB 5AV6A 5AV6C 3KSYA 5CPKD 1M1AA 3WTPB 5B1LB 3H0RC 1P3FD 1M1AC 4G92C 2NZDD 1KX4D 1ZLAC 3W96D 3AZIA 3UT9B 3AZIC 4YS3B 4XUJB 4UPKA 3MGRB 3AZEA 2Y2GA 4JJNA 3AZEC 4JJNC 4Z5TB 3AZJD 5CP6B 1P3MB 3B0CW 3MVDA 3AZHB 5B2JD 4H9OA 3NQJA 4KGCD 2Y2LA 3AN2D 5DNNA 3AV1A 3IP4C 3P5JB 3AZMC 5B0ZB 1EQZB 3V9RA 3VH5W 4KUDB 3MGQB 4J8UD 3R45A 2BG1A 2BYKA 2DF4C 5GXQB 3AV2D 3WKJB 2CV5B 3AZKD 1P3LD 2ZY5A 3WA9C 1WWIA 1P3OA 3MGSB 3A1KA 1U35A 1U35C 1F66A 3MGPD 1F66C 5B40C 3REKB 3REHC 4QLCA 4QLCC 5BNXA 4J8WB 1ID3A 3AL0C 5JRGB 4ZBJC 3X1SB 1S32C 1S32A 2W8SA 4H9NA 1AOID 5GSUB 3LJAA 5AV5D 3LJAC 2F8NA 3AYWC 3REID 3X1UB 2Y2PA 2NZDC 4YM6D 3W99B 1P3KA 1P3KC 5CHLB 1P3PA 2FJ7B 1KX3A 5B32D 4WU9A 1P3BC 4WU9C 1TZYC 3LZ0B 4LD9D 3TU4C 5CPJA 5DNMB 5B24D 5CPKC 2NZDA 1P3FA 3AFAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIO B;  2ARO A;  1KX4 A;  3W96 A;  1KX4 C;  3W96 C;  4X23 A;  3AZN A;  3REJ C;  4Z66 B;  1M18 A;  5G49 B;  5AV6 B;  1M1A B;  3WTP E;  3AZJ A;  4G92 B;  5B33 D;  3AZJ C;  1ZLA B;  3MVD D;  3AZI B;  5B2J C;  3UTA D;  4KGC A;  4KGC C;  3AN2 C;  1P3G D;  5DNN D;  3AZE B;  4JJN B;  5CPI D;  3MNN D;  3VH5 A;  4H9O B;  3X1V D;  4J8U C;  3B6G D;  2LY8 A;  3AZM B;  3AV2 C;  3AZK A;  3AZK C;  1A7W A;  1B67 A;  2RVQ D;  3R45 B;  1P3L A;  4E45 A;  2BYK B;  1P3O D;  5AVB D;  3O62 D;  3UTB D;  5AV9 D;  3LZ1 A;  3KXB C;  3AZF D;  3WA9 B;  3MGP A;  3MGP C;  4WU8 A;  3KWQ D;  5B31 A;  5GT3 D;  1ID3 D;  2BYM A;  2IO5 C;  1U35 B;  1F66 B;  4J8X A;  5B40 B;  3REH B;  1AOI A;  2F8N D;  2PYO D;  5AV5 A;  4QLC B;  5AV5 C;  3C1B A;  3REI A;  5BNX B;  3REI C;  4YM6 A;  4ZBJ B;  1P3P D;  1S32 B;  1KX3 D;  4H9N B;  5BNV A;  5B32 A;  3LJA B;  1BH8 A;  5B32 C;  3AZL A;  3AYW B;  4LD9 A;  3REL D;  5JA4 A;  2L5A A;  1P3K B;  5CPJ D;  5B0Y A;  1R4V A;  1P3I A;  5B24 A;  1P3B B;  2ARO D;  3AZG A;  1TZY B;  3AFA A;  4WU9 B;  3AFA C;  5FUG A;  4WNN B;  4X23 D;  1HQ3 D;  3TU4 B;  3AZN D;  1M18 D;  1HTA A;  5BO0 B;  3W97 D;  5CPK B;  4J8V D;  5B33 A;  5B33 C;  3WAA B;  1KX4 B;  4H9R A;  3MVD C;  3W96 B;  3W98 A;  3B0D C;  3UTA A;  3REJ B;  3UTA C;  1P3G A;  1P3G C;  5DNN C;  3AV1 C;  3AZJ B;  3KUY D;  3C1C A;  5CPI C;  5CPI A;  3MNN A;  3MNN C;  5B2J B;  2YFW A;  5GT0 A;  3X1T D;  3X1V C;  3AN2 B;  3X1V A;  4KGC B;  3B6G A;  3B6G C;  1H3O B;  5BS7 A;  4HGA C;  5BS7 C;  5B0Z D;  2RVQ C;  4J8U B;  2F8N H;  1P3O C;  5AVB A;  5AVB C;  4NE5 A;  3O62 A;  3UTB A;  3AV2 B;  3LZ1 D;  5AV9 A;  5AV9 C;  5AY8 D;  3AZK B;  5E5A A;  4H9P A;  5AV8 D;  2NQB A;  1BFM A;  3AZF A;  4WU8 D;  5B1M D;  3AZF C;  2YFV A;  5B31 D;  3KWQ A;  3KWQ C;  5C3I C;  5GT3 A;  5GT3 C;  5F99 D;  1ID3 C;  4XZQ A;  3KXB B;  4J8X D;  5B2I D;  3MGP B;  3C1B D;  2PYO A;  2PYO C;  4H9S A;  2IO5 B;  3REK D;  1P3P C;  1KX3 C;  3AZL D;  5AV5 B;  1M19 A;  3REI B;  5B0Y D;  3REL A;  3REL C;  1JFI B;  5CPJ C;  5KDM B;  1P3I D;  3AZG D;  5B32 B;  1P3F C;  2ARO C;  1KX5 A;  5AVC D;  4X23 C;  1HQ3 A;  1HQ3 C;  2HUE C;  4CAY A;  3AZN C;  1M18 C;  3VH6 T;  3W97 A;  3W97 C;  3AFA B;  4J8V A;  4J8V C;  3W98 D;  3B6F A;  3WTP A;  5B33 B;  3C1C D;  1P3A D;  3MVD B;  4H9R B;  4XUJ A;  3KUY A;  3KUY C;  3B0D B;  3NQJ B;  5GT0 D;  1P34 D;  3UTA B;  3X1T A;  3X1T C;  5CP6 A;  1P3M A;  1P3G B;  5DNN B;  3AZH A;  3AV1 B;  5CPI B;  3A6N D;  3V9R B;  3MNN B;  1Q9C A;  2YFW B;  1P3L C;  5B0Z A;  5B0Z C;  3LEL D;  3B6G B;  1EQZ A;  5E5A D;  3LZ1 C;  5AY8 A;  5AY8 C;  2NQB D;  4E44 A;  5AV8 A;  5AV8 C;  4ZUX D;  3WKJ A;  2CV5 A;  1P3O B;  5B1M A;  4WU8 C;  5AVB B;  1N1J A;  5B1M C;  5B31 C;  4AWL C;  5AV9 B;  2F8N K;  4R8P D;  4XZQ D;  1F1E A;  4H9P B;  5F99 A;  5F99 C;  4J8X C;  3AZF B;  5B2I A;  2YFV B;  5B2I C;  3KWQ B;  3MGS A;  1AOI C;  5C3I B;  5GT3 B;  3C1B C;  4CSR A;  1ID3 B;  4YM6 C;  3REK A;  4DRB A;  1KU5 A;  1TAF A;  2F8N B;  1M19 D;  2PYO B;  3AZL C;  3X1S A;  4LD9 C;  3REH D;  5B0Y C;  1P3P B;  1P3I C;  5B24 C;  1KX3 B;  3AZG C;  1KX5 D;  5AVC A;  5AVC C;  3VH6 W;  3REL B;  2CWE A;  5CPJ B;  2NZD B;  1P3F B;  2ARO B;  3B6F D;  5BT1 D;  4X23 B;  3W98 C;  1HQ3 B;  2HUE B;  3WTP D;  5B1L D;  4CAY B;  3AZN B;  1M18 B;  2HIO A;  1BH9 A;  3UT9 D;  3W97 B;  4YS3 D;  4J8V B;  4XUJ D;  3C1C C;  1P3A C;  3MGR D;  1P3A A;  5B32 G;  5G49 A;  4Z5T D;  1P34 A;  5GT0 C;  5CP6 D;  1P34 C;  1P3M D;  1ZLA A;  3WAA D;  3AZH D;  4G91 C;  3REJ D;  4WZS B;  3KUY B;  3A6N A;  3A6N C;  3X1T B;  3NQU A;  4Z2M H;  3LEL A;  1EQZ D;  3LEL C;  4KUD D;  3MGQ D;  3O62 C;  3UTB C;  5E5A C;  5GXQ D;  4EO5 C;  3WKJ D;  2NQB C;  3AZM A;  4ZUX A;  2CV5 D;  4ZUX C;  1P3L B;  1ULY A;  3LZ1 B;  5AY8 B;  4R8P A;  4R8P C;  4XZQ C;  5AV8 B;  4H9Q A;  5B1M B;  4WU8 B;  1N1J B;  3MGS D;  5B31 B;  4AWL B;  4H9S C;  3WA9 A;  2BYM B;  4KHA A;  5F99 B;  3B0B A;  4J8X B;  5B2I B;  4J8W D;  1AOI B;  5JRG D;  3KXB D;  3C1B B;  1M19 C;  3X1S D;  4CSR B;  5B40 A;  5GSU D;  4YM6 B;  3REH A;  3X1U D;  5BNV B;  3W99 D;  1TAF B;  1BH8 B;  3AZL B;  1KX5 C;  3VH6 A;  2FJ7 D;  4LD9 B;  5JA4 B;  5B0Y B;  3LZ0 D;  3AYW A;  1P3I B;  5B24 B;  3AZG B;  4NE3 A;  5FUG B;  5AVC B;  5DNM D;  5BT1 C;  3B6F C;  2F8N G;  4UUZ A;  4Z2M G;  5B1L A;  3WTP C;  2HIO D;  5B1L C;  1P3B A;  1TZY A;  4WNN A;  3UT9 A;  3UT9 C;  4YS3 A;  4YS3 C;  3TU4 A;  4Z66 D;  3W98 B;  4NFT A;  4XUJ C;  2JSS A;  5AV6 D;  5BO0 A;  3MGR A;  3MGR C;  1M1A D;  5CPK A;  4Z5T A;  4Z5T C;  1ZLA D;  5CP6 C;  1P3M C;  1BH9 B;  3WAA A;  3WAA C;  3AZI D;  3AZH C;  3REJ A;  3C1C B;  1P3A B;  3AZE D;  4JJN D;  5GT0 B;  3X1V B;  1P34 B;  1EQZ C;  5B2J A;  3MGQ A;  4G91 B;  3MGQ C;  4KUD A;  4KUD C;  3AN2 A;  3B0C T;  3A6N B;  3AV1 D;  5GXQ A;  4HGA B;  5GXQ C;  3AZM D;  3WKJ C;  3NQU B;  2CV5 C;  3LEL B;  1H3O A;  3O62 B;  3UTB B;  4J8U A;  5E5A B;  2NQB B;  3VH5 T;  4EO5 B;  4ZUX B;  3AV2 A;  3MGS C;  3WA9 D;  4R8P B;  4XZQ B;  3REK C;  4H9Q B;  4J8W A;  4WV4 B;  4J8W C;  5JRG A;  5JRG C;  1U35 D;  3KXB A;  1F66 D;  5B40 D;  3X1S C;  4KHA B;  5GSU A;  5GSU C;  4QLC D;  3X1U A;  4M6B A;  3X1U C;  3W99 A;  3W99 C;  1M19 B;  1S32 D;  1B6W A;  5B31 G;  2FJ7 A;  2FJ7 C;  3LJA D;  3AYW D;  1WWS A;  3LZ0 A;  3LZ0 C;  1P3K D;  1JFI A;  1KX5 B;  5KDM A;  5DNM A;  5DNM C;  4DRA A;  1P3B D;  4WU9 D;  1TZY D;  2HIO C;  3TU4 D;  4Z66 A;  3B6F B;  4NE6 A;  4Z66 C;  4UUZ B;  5AV6 A;  5AV6 C;  3KSY A;  5CPK D;  1M1A A;  3WTP B;  5B1L B;  1P3F D;  1M1A C;  2NZD D;  4G92 C;  1KX4 D;  1ZLA C;  3W96 D;  3AZI A;  3UT9 B;  3AZI C;  4YS3 B;  4XUJ B;  3MGR B;  3AZE A;  3AZE C;  4JJN A;  4JJN C;  4Z5T B;  3AZJ D;  5CP6 B;  1P3M B;  3B0C W;  3MVD A;  3AZH B;  5B2J D;  4H9O A;  3NQJ A;  4KGC D;  3AN2 D;  5DNN A;  3AV1 A;  3AZM C;  5B0Z B;  1EQZ B;  3V9R A;  3VH5 W;  4KUD B;  3MGQ B;  4J8U D;  3R45 A;  2BYK A;  5GXQ B;  3AV2 D;  3WKJ B;  2CV5 B;  3AZK D;  1P3L D;  3WA9 C;  1WWI A;  1P3O A;  3MGS B;  1U35 A;  1U35 C;  1F66 A;  3MGP D;  1F66 C;  5B40 C;  3REK B;  3REH C;  4QLC A;  4QLC C;  5BNX A;  4J8W B;  1ID3 A;  5JRG B;  4ZBJ C;  3X1S B;  1S32 C;  1S32 A;  4H9N A;  1AOI D;  5GSU B;  3LJA A;  5AV5 D;  3LJA C;  2F8N A;  3AYW C;  3REI D;  3X1U B;  2NZD C;  4YM6 D;  3W99 B;  1P3K A;  1P3K C;  5CHL B;  1P3P A;  2FJ7 B;  1KX3 A;  5B32 D;  4WU9 A;  1P3B C;  4WU9 C;  1TZY C;  3LZ0 B;  4LD9 D;  3TU4 C;  5CPJ A;  5DNM B;  5B24 D;  5CPK C;  2NZD A;  1P3F A;  3AFA D; 
#chains in the Genus database with same CATH topology
 2HIO B;  2ARO A;  1KX4 A;  3W96 A;  1KX4 C;  3W96 C;  4X23 A;  3AZN A;  3REJ C;  4Z66 B;  1M18 A;  5G49 B;  5AV6 B;  1M1A B;  3WTP E;  3AZJ A;  4G92 B;  5B33 D;  3AZJ C;  1ZLA B;  3MVD D;  2F2A C;  3AZI B;  5B2J C;  3UTA D;  4KGC A;  4KGC C;  2ZY4 A;  3AN2 C;  1P3G D;  5DNN D;  3AZE B;  4JJN B;  5CPI D;  3MNN D;  3VH5 A;  4H9O B;  3X1V D;  4J8U C;  3B6G D;  2LY8 A;  3AZM B;  3AV2 C;  3H0M C;  3AZK A;  3AZK C;  1A7W A;  1B67 A;  2RVQ D;  3R45 B;  1P3L A;  4E45 A;  2BYK B;  1P3O D;  5AVB D;  3O62 D;  3UTB D;  5AV9 D;  3F6T A;  3LZ1 A;  3KXB C;  3AZF D;  3WA9 B;  3MGP A;  3MGP C;  4WU8 A;  3KWQ D;  5B31 A;  2Y2K A;  5GT3 D;  1ID3 D;  2BYM A;  2IO5 C;  1U35 B;  1F66 B;  4J8X A;  5B40 B;  3REH B;  1AOI A;  2F8N D;  2PYO D;  5AV5 A;  4QLC B;  5AV5 C;  3C1B A;  3REI A;  5BNX B;  3REI C;  3EPH A;  4YM6 A;  4ZBJ B;  1P3P D;  1S32 B;  2Y2O A;  1KX3 D;  4H9N B;  5BNV A;  5B32 A;  3LJA B;  1BH8 A;  5B32 C;  3AZL A;  3AYW B;  4LD9 A;  3REL D;  5JA4 A;  2L5A A;  1P3K B;  5CPJ D;  5B0Y A;  1R4V A;  1P3I A;  5B24 A;  1P3B B;  2ARO D;  3AZG A;  1TZY B;  3AFA A;  4WU9 B;  3AFA C;  5FUG A;  4WNN B;  2DQN C;  4X23 D;  1HQ3 D;  3TU4 B;  3AZN D;  1M18 D;  2Y2J A;  1HTA A;  5BO0 B;  3W97 D;  5CPK B;  2UWX A;  4J8V D;  1Z2C B;  5B33 A;  5B33 C;  3WAA B;  1KX4 B;  4H9R A;  3MVD C;  3W96 B;  3W98 A;  3B0D C;  3UTA A;  3REJ B;  3UTA C;  3EPK A;  1P3G A;  1P3G C;  5DNN C;  3AV1 C;  3AZJ B;  3KUY D;  3C1C A;  5CPI C;  5CPI A;  3MNN A;  3EPJ A;  3MNN C;  5B2J B;  2YFW A;  5GT0 A;  3X1T D;  3X1V C;  3AN2 B;  3X1V A;  4KGC B;  3B6G A;  3B6G C;  1H3O B;  5BS7 A;  4HGA C;  5BS7 C;  5B0Z D;  2RVQ C;  4J8U B;  2F8N H;  1P3O C;  2VQR A;  5AVB A;  5AVB C;  4NE5 A;  3O62 A;  3UTB A;  3AV2 B;  3LZ1 D;  5AV9 A;  5AV9 C;  5AY8 D;  3AZK B;  5E5A A;  4H9P A;  5AV8 D;  2NQB A;  1BFM A;  3AZF A;  4WU8 D;  5B1M D;  3AZF C;  2YFV A;  5B31 D;  3KWQ A;  3KWQ C;  5C3I C;  5GT3 A;  5GT3 C;  5F99 D;  1ID3 C;  4XZQ A;  2G5I C;  3KXB B;  4J8X D;  5B2I D;  3MGP B;  3C1B D;  2PYO A;  2PYO C;  4H9S A;  4WJ3 C;  2IO5 B;  3REK D;  2Y2I A;  1P3P C;  2JCH A;  1KX3 C;  3AZL D;  3KFU G;  5AV5 B;  1M19 A;  3REI B;  2Y2H A;  5B0Y D;  3REL A;  3REL C;  1JFI B;  5CPJ C;  5KDM B;  1P3I D;  3AZG D;  5B32 B;  1P3F C;  2ARO C;  1KX5 A;  2ZY3 A;  5AVC D;  4X23 C;  1HQ3 A;  1HQ3 C;  2HUE C;  4CAY A;  3AZN C;  1M18 C;  3VH6 T;  3W97 A;  3W97 C;  3AFA B;  4J8V A;  4J8V C;  3W98 D;  3B6F A;  3WTP A;  2ZM5 A;  3EG5 B;  5B33 B;  3C1C D;  1P3A D;  3MVD B;  4H9R B;  4XUJ A;  3KUY A;  3KUY C;  3B0D B;  3NQJ B;  5GT0 D;  1P34 D;  3UTA B;  3X1T A;  3X1T C;  5CP6 A;  1P3M A;  1W2E A;  2XD5 A;  1P3G B;  5DNN B;  3AZH A;  3AV1 B;  5CPI B;  3A6N D;  3V9R B;  3MNN B;  1Q9C A;  2YFW B;  1P3L C;  5B0Z A;  5B0Z C;  3LEL D;  3B6G B;  1EQZ A;  5E5A D;  3LZ1 C;  3EPL A;  5AY8 A;  2RIQ A;  5AY8 C;  2NQB D;  4E44 A;  5AV8 A;  4ZUX D;  5AV8 C;  3WKJ A;  2XD1 A;  2CV5 A;  1P3O B;  5B1M A;  4WU8 C;  5AVB B;  5B1M C;  1N1J A;  5B31 C;  4AWL C;  1PZR A;  5AV9 B;  2F8N K;  4R8P D;  4XZQ D;  1F1E A;  4H9P B;  5F99 A;  5F99 C;  4J8X C;  3AZF B;  5B2I A;  2YFV B;  5B2I C;  3KWQ B;  3MGS A;  1AOI C;  5C3I B;  5GT3 B;  3C1B C;  4CSR A;  1ID3 B;  4YM6 C;  3REK A;  4DRB A;  1KU5 A;  3FDD A;  1TAF A;  2F8N B;  1M19 D;  2PYO B;  3AZL C;  3X1S A;  4LD9 C;  3REH D;  5B0Y C;  1P3P B;  1P3I C;  5B24 C;  1KX3 B;  3AZG C;  1KX5 D;  5AVC A;  5AVC C;  3VH6 W;  3REL B;  2CWE A;  5CPJ B;  2NZD B;  1P3F B;  2ARO B;  2Y2M A;  3B6F D;  5BT1 D;  2ZY2 A;  4X23 B;  3W98 C;  1HQ3 B;  2HUE B;  3WTP D;  5B1L D;  4CAY B;  3AZN B;  1M18 B;  2HIO A;  1BH9 A;  3UT9 D;  3W97 B;  4YS3 D;  4J8V B;  4XUJ D;  3C1C C;  1P3A C;  3MGR D;  1P3A A;  5B32 G;  5G49 A;  4Z5T D;  1P34 A;  5GT0 C;  5CP6 D;  1P34 C;  1P3M D;  2J8P A;  1ZLA A;  3WAA D;  3AZH D;  4G91 C;  3REJ D;  4WZS B;  3KUY B;  3A6N A;  3A6N C;  3X1T B;  3NQU A;  4Z2M H;  3LEL A;  1EQZ D;  3LEL C;  4KUD D;  3MGQ D;  3O62 C;  3UTB C;  5E5A C;  2FFF B;  3H0L C;  5GXQ D;  4EO5 C;  3WKJ D;  2NQB C;  3AZM A;  4ZUX A;  2CV5 D;  4ZUX C;  1P3L B;  1ULY A;  3LZ1 B;  5AY8 B;  4R8P A;  4R8P C;  4XZQ C;  5AV8 B;  4H9Q A;  5B1M B;  4WU8 B;  1N1J B;  3MGS D;  5B31 B;  4AWL B;  4H9S C;  3WA9 A;  2BYM B;  4KHA A;  5F99 B;  3B0B A;  4J8X B;  5B2I B;  4J8W D;  1AOI B;  5JRG D;  3KXB D;  3C1B B;  1M19 C;  3X1S D;  4CSR B;  5B40 A;  2G5H C;  5GSU D;  4YM6 B;  3REH A;  3X1U D;  5BNV B;  3W99 D;  1TAF B;  1BH8 B;  3A1I A;  3AZL B;  1KX5 C;  3VH6 A;  2FJ7 D;  4LD9 B;  5JA4 B;  1T3U A;  5B0Y B;  3LZ0 D;  3AYW A;  1P3I B;  5B24 B;  3AZG B;  4NE3 A;  5FUG B;  5AVC B;  5DNM D;  5BT1 C;  3B6F C;  2F8N G;  4UUZ A;  4Z2M G;  5B1L A;  3WTP C;  2HIO D;  5B1L C;  1P3B A;  1TZY A;  4WNN A;  3UT9 A;  3UT9 C;  4YS3 A;  4YS3 C;  3TU4 A;  4Z66 D;  3W98 B;  4NFT A;  4XUJ C;  2JSS A;  5AV6 D;  5BO0 A;  3MGR A;  3MGR C;  1M1A D;  5CPK A;  4Z5T A;  4Z5T C;  1ZLA D;  5CP6 C;  1P3M C;  1BH9 B;  3WAA A;  3WAA C;  3AZI D;  3AZH C;  3REJ A;  3C1C B;  1P3A B;  3AZE D;  4JJN D;  5GT0 B;  3X1V B;  1P34 B;  4DQY B;  1EQZ C;  5B2J A;  3MGQ A;  4G91 B;  3MGQ C;  4KUD A;  4KUD C;  3AN2 A;  3B0C T;  3A6N B;  3AV1 D;  5GXQ A;  4HGA B;  5GXQ C;  3AZM D;  3WKJ C;  3NQU B;  2CV5 C;  3LEL B;  1H3O A;  3O62 B;  3UTB B;  4J8U A;  5E5A B;  2NQB B;  3VH5 T;  4EO5 B;  4ZUX B;  3AV2 A;  2Y2N A;  3MGS C;  3WA9 D;  4R8P B;  4XZQ B;  3REK C;  4H9Q B;  2Y2Q A;  4J8W A;  4WV4 B;  4J8W C;  5JRG A;  5JRG C;  1U35 D;  3KXB A;  1F66 D;  5B40 D;  3X1S C;  4KHA B;  5GSU A;  5GSU C;  4QLC D;  3X1U A;  4M6B A;  3X1U C;  3W99 A;  3W99 C;  1M19 B;  1S32 D;  1B6W A;  5B31 G;  2FJ7 A;  2FJ7 C;  3LJA D;  3AYW D;  1WWS A;  3LZ0 A;  3LZ0 C;  1P3K D;  2JE5 A;  1JFI A;  1KX5 B;  5KDM A;  5DNM A;  5DNM C;  4DRA A;  1P3B D;  4WU9 D;  1TZY D;  2HIO C;  3TU4 D;  4Z66 A;  3B6F B;  4NE6 A;  4Z66 C;  4UUZ B;  5AV6 A;  5AV6 C;  3KSY A;  5CPK D;  1M1A A;  3WTP B;  5B1L B;  3H0R C;  1P3F D;  1M1A C;  4G92 C;  2NZD D;  1KX4 D;  1ZLA C;  3W96 D;  3AZI A;  3UT9 B;  3AZI C;  4YS3 B;  4XUJ B;  4UPK A;  3MGR B;  3AZE A;  2Y2G A;  4JJN A;  3AZE C;  4JJN C;  4Z5T B;  3AZJ D;  5CP6 B;  1P3M B;  3B0C W;  3MVD A;  3AZH B;  5B2J D;  4H9O A;  3NQJ A;  4KGC D;  2Y2L A;  3AN2 D;  5DNN A;  3AV1 A;  3IP4 C;  3P5J B;  3AZM C;  5B0Z B;  1EQZ B;  3V9R A;  3VH5 W;  4KUD B;  3MGQ B;  4J8U D;  3R45 A;  2BG1 A;  2BYK A;  2DF4 C;  5GXQ B;  3AV2 D;  3WKJ B;  2CV5 B;  3AZK D;  1P3L D;  2ZY5 A;  3WA9 C;  1WWI A;  1P3O A;  3MGS B;  3A1K A;  1U35 A;  1U35 C;  1F66 A;  3MGP D;  1F66 C;  5B40 C;  3REK B;  3REH C;  4QLC A;  4QLC C;  5BNX A;  4J8W B;  1ID3 A;  3AL0 C;  5JRG B;  4ZBJ C;  3X1S B;  1S32 C;  1S32 A;  2W8S A;  4H9N A;  1AOI D;  5GSU B;  3LJA A;  5AV5 D;  3LJA C;  2F8N A;  3AYW C;  3REI D;  3X1U B;  2Y2P A;  2NZD C;  4YM6 D;  3W99 B;  1P3K A;  1P3K C;  5CHL B;  1P3P A;  2FJ7 B;  1KX3 A;  5B32 D;  4WU9 A;  1P3B C;  4WU9 C;  1TZY C;  3LZ0 B;  4LD9 D;  3TU4 C;  5CPJ A;  5DNM B;  5B24 D;  5CPK C;  2NZD A;  1P3F A;  3AFA D; 
#chains in the Genus database with same CATH homology
 2HIO B;  2ARO A;  1KX4 A;  3W96 A;  1KX4 C;  3W96 C;  4X23 A;  3AZN A;  3REJ C;  4Z66 B;  1M18 A;  5G49 B;  5AV6 B;  1M1A B;  3WTP E;  3AZJ A;  4G92 B;  5B33 D;  3AZJ C;  1ZLA B;  3MVD D;  2F2A C;  3AZI B;  5B2J C;  3UTA D;  4KGC A;  4KGC C;  2ZY4 A;  3AN2 C;  1P3G D;  5DNN D;  3AZE B;  4JJN B;  5CPI D;  3MNN D;  3VH5 A;  4H9O B;  3X1V D;  4J8U C;  3B6G D;  2LY8 A;  3AZM B;  3AV2 C;  3H0M C;  3AZK A;  3AZK C;  1A7W A;  1B67 A;  2RVQ D;  3R45 B;  1P3L A;  4E45 A;  2BYK B;  1P3O D;  5AVB D;  3O62 D;  3UTB D;  5AV9 D;  3F6T A;  3LZ1 A;  3KXB C;  3AZF D;  3WA9 B;  3MGP A;  3MGP C;  4WU8 A;  3KWQ D;  5B31 A;  2Y2K A;  5GT3 D;  1ID3 D;  2BYM A;  2IO5 C;  1U35 B;  1F66 B;  4J8X A;  5B40 B;  3REH B;  1AOI A;  2F8N D;  2PYO D;  5AV5 A;  4QLC B;  5AV5 C;  3C1B A;  3REI A;  5BNX B;  3REI C;  3EPH A;  4YM6 A;  4ZBJ B;  1P3P D;  1S32 B;  2Y2O A;  1KX3 D;  4H9N B;  5BNV A;  5B32 A;  3LJA B;  1BH8 A;  5B32 C;  3AZL A;  3AYW B;  4LD9 A;  3REL D;  5JA4 A;  2L5A A;  1P3K B;  5CPJ D;  5B0Y A;  1R4V A;  1P3I A;  5B24 A;  1P3B B;  2ARO D;  3AZG A;  1TZY B;  3AFA A;  4WU9 B;  3AFA C;  5FUG A;  4WNN B;  2DQN C;  4X23 D;  1HQ3 D;  3TU4 B;  3AZN D;  1M18 D;  2Y2J A;  1HTA A;  5BO0 B;  3W97 D;  5CPK B;  2UWX A;  4J8V D;  1Z2C B;  5B33 A;  5B33 C;  3WAA B;  1KX4 B;  4H9R A;  3MVD C;  3W96 B;  3W98 A;  3B0D C;  3UTA A;  3REJ B;  3UTA C;  3EPK A;  1P3G A;  1P3G C;  5DNN C;  3AV1 C;  3AZJ B;  3KUY D;  3C1C A;  5CPI C;  5CPI A;  3MNN A;  3EPJ A;  3MNN C;  5B2J B;  2YFW A;  5GT0 A;  3X1T D;  3X1V C;  3AN2 B;  3X1V A;  4KGC B;  3B6G A;  3B6G C;  1H3O B;  5BS7 A;  4HGA C;  5BS7 C;  5B0Z D;  2RVQ C;  4J8U B;  2F8N H;  1P3O C;  2VQR A;  5AVB A;  5AVB C;  4NE5 A;  3O62 A;  3UTB A;  3AV2 B;  3LZ1 D;  5AV9 A;  5AV9 C;  5AY8 D;  3AZK B;  5E5A A;  4H9P A;  5AV8 D;  2NQB A;  1BFM A;  3AZF A;  4WU8 D;  5B1M D;  3AZF C;  2YFV A;  5B31 D;  3KWQ A;  3KWQ C;  5C3I C;  5GT3 A;  5GT3 C;  5F99 D;  1ID3 C;  4XZQ A;  2G5I C;  3KXB B;  4J8X D;  5B2I D;  3MGP B;  3C1B D;  2PYO A;  2PYO C;  4H9S A;  4WJ3 C;  2IO5 B;  3REK D;  2Y2I A;  1P3P C;  2JCH A;  1KX3 C;  3AZL D;  3KFU G;  5AV5 B;  1M19 A;  3REI B;  2Y2H A;  5B0Y D;  3REL A;  3REL C;  1JFI B;  5CPJ C;  5KDM B;  1P3I D;  3AZG D;  5B32 B;  1P3F C;  2ARO C;  1KX5 A;  2ZY3 A;  5AVC D;  4X23 C;  1HQ3 A;  1HQ3 C;  2HUE C;  4CAY A;  3AZN C;  1M18 C;  3VH6 T;  3W97 A;  3W97 C;  3AFA B;  4J8V A;  4J8V C;  3W98 D;  3B6F A;  3WTP A;  2ZM5 A;  3EG5 B;  5B33 B;  3C1C D;  1P3A D;  3MVD B;  4H9R B;  4XUJ A;  3KUY A;  3KUY C;  3B0D B;  3NQJ B;  5GT0 D;  1P34 D;  3UTA B;  3X1T A;  3X1T C;  5CP6 A;  1P3M A;  1W2E A;  2XD5 A;  1P3G B;  5DNN B;  3AZH A;  3AV1 B;  5CPI B;  3A6N D;  3V9R B;  3MNN B;  1Q9C A;  2YFW B;  1P3L C;  5B0Z A;  5B0Z C;  3LEL D;  3B6G B;  1EQZ A;  5E5A D;  3LZ1 C;  3EPL A;  5AY8 A;  2RIQ A;  5AY8 C;  2NQB D;  4E44 A;  5AV8 A;  4ZUX D;  5AV8 C;  3WKJ A;  2XD1 A;  2CV5 A;  1P3O B;  5B1M A;  4WU8 C;  5AVB B;  5B1M C;  1N1J A;  5B31 C;  4AWL C;  1PZR A;  5AV9 B;  2F8N K;  4R8P D;  4XZQ D;  1F1E A;  4H9P B;  5F99 A;  5F99 C;  4J8X C;  3AZF B;  5B2I A;  2YFV B;  5B2I C;  3KWQ B;  3MGS A;  1AOI C;  5C3I B;  5GT3 B;  3C1B C;  4CSR A;  1ID3 B;  4YM6 C;  3REK A;  4DRB A;  1KU5 A;  3FDD A;  1TAF A;  2F8N B;  1M19 D;  2PYO B;  3AZL C;  3X1S A;  4LD9 C;  3REH D;  5B0Y C;  1P3P B;  1P3I C;  5B24 C;  1KX3 B;  3AZG C;  1KX5 D;  5AVC A;  5AVC C;  3VH6 W;  3REL B;  2CWE A;  5CPJ B;  2NZD B;  1P3F B;  2ARO B;  2Y2M A;  3B6F D;  5BT1 D;  2ZY2 A;  4X23 B;  3W98 C;  1HQ3 B;  2HUE B;  3WTP D;  5B1L D;  4CAY B;  3AZN B;  1M18 B;  2HIO A;  1BH9 A;  3UT9 D;  3W97 B;  4YS3 D;  4J8V B;  4XUJ D;  3C1C C;  1P3A C;  3MGR D;  1P3A A;  5B32 G;  5G49 A;  4Z5T D;  1P34 A;  5GT0 C;  5CP6 D;  1P34 C;  1P3M D;  2J8P A;  1ZLA A;  3WAA D;  3AZH D;  4G91 C;  3REJ D;  4WZS B;  3KUY B;  3A6N A;  3A6N C;  3X1T B;  3NQU A;  4Z2M H;  3LEL A;  1EQZ D;  3LEL C;  4KUD D;  3MGQ D;  3O62 C;  3UTB C;  5E5A C;  2FFF B;  3H0L C;  5GXQ D;  4EO5 C;  3WKJ D;  2NQB C;  3AZM A;  4ZUX A;  2CV5 D;  4ZUX C;  1P3L B;  1ULY A;  3LZ1 B;  5AY8 B;  4R8P A;  4R8P C;  4XZQ C;  5AV8 B;  4H9Q A;  5B1M B;  4WU8 B;  1N1J B;  3MGS D;  5B31 B;  4AWL B;  4H9S C;  3WA9 A;  2BYM B;  4KHA A;  5F99 B;  3B0B A;  4J8X B;  5B2I B;  4J8W D;  1AOI B;  5JRG D;  3KXB D;  3C1B B;  1M19 C;  3X1S D;  4CSR B;  5B40 A;  2G5H C;  5GSU D;  4YM6 B;  3REH A;  3X1U D;  5BNV B;  3W99 D;  1TAF B;  1BH8 B;  3A1I A;  3AZL B;  1KX5 C;  3VH6 A;  2FJ7 D;  4LD9 B;  5JA4 B;  1T3U A;  5B0Y B;  3LZ0 D;  3AYW A;  1P3I B;  5B24 B;  3AZG B;  4NE3 A;  5FUG B;  5AVC B;  5DNM D;  5BT1 C;  3B6F C;  2F8N G;  4UUZ A;  4Z2M G;  5B1L A;  3WTP C;  2HIO D;  5B1L C;  1P3B A;  1TZY A;  4WNN A;  3UT9 A;  3UT9 C;  4YS3 A;  4YS3 C;  3TU4 A;  4Z66 D;  3W98 B;  4NFT A;  4XUJ C;  2JSS A;  5AV6 D;  5BO0 A;  3MGR A;  3MGR C;  1M1A D;  5CPK A;  4Z5T A;  4Z5T C;  1ZLA D;  5CP6 C;  1P3M C;  1BH9 B;  3WAA A;  3WAA C;  3AZI D;  3AZH C;  3REJ A;  3C1C B;  1P3A B;  3AZE D;  4JJN D;  5GT0 B;  3X1V B;  1P34 B;  4DQY B;  1EQZ C;  5B2J A;  3MGQ A;  4G91 B;  3MGQ C;  4KUD A;  4KUD C;  3AN2 A;  3B0C T;  3A6N B;  3AV1 D;  5GXQ A;  4HGA B;  5GXQ C;  3AZM D;  3WKJ C;  3NQU B;  2CV5 C;  3LEL B;  1H3O A;  3O62 B;  3UTB B;  4J8U A;  5E5A B;  2NQB B;  3VH5 T;  4EO5 B;  4ZUX B;  3AV2 A;  2Y2N A;  3MGS C;  3WA9 D;  4R8P B;  4XZQ B;  3REK C;  4H9Q B;  2Y2Q A;  4J8W A;  4WV4 B;  4J8W C;  5JRG A;  5JRG C;  1U35 D;  3KXB A;  1F66 D;  5B40 D;  3X1S C;  4KHA B;  5GSU A;  5GSU C;  4QLC D;  3X1U A;  4M6B A;  3X1U C;  3W99 A;  3W99 C;  1M19 B;  1S32 D;  1B6W A;  5B31 G;  2FJ7 A;  2FJ7 C;  3LJA D;  3AYW D;  1WWS A;  3LZ0 A;  3LZ0 C;  1P3K D;  2JE5 A;  1JFI A;  1KX5 B;  5KDM A;  5DNM A;  5DNM C;  4DRA A;  1P3B D;  4WU9 D;  1TZY D;  2HIO C;  3TU4 D;  4Z66 A;  3B6F B;  4NE6 A;  4Z66 C;  4UUZ B;  5AV6 A;  5AV6 C;  3KSY A;  5CPK D;  1M1A A;  3WTP B;  5B1L B;  3H0R C;  1P3F D;  1M1A C;  4G92 C;  2NZD D;  1KX4 D;  1ZLA C;  3W96 D;  3AZI A;  3UT9 B;  3AZI C;  4YS3 B;  4XUJ B;  4UPK A;  3MGR B;  3AZE A;  2Y2G A;  4JJN A;  3AZE C;  4JJN C;  4Z5T B;  3AZJ D;  5CP6 B;  1P3M B;  3B0C W;  3MVD A;  3AZH B;  5B2J D;  4H9O A;  3NQJ A;  4KGC D;  2Y2L A;  3AN2 D;  5DNN A;  3AV1 A;  3IP4 C;  3P5J B;  3AZM C;  5B0Z B;  1EQZ B;  3V9R A;  3VH5 W;  4KUD B;  3MGQ B;  4J8U D;  3R45 A;  2BG1 A;  2BYK A;  2DF4 C;  5GXQ B;  3AV2 D;  3WKJ B;  2CV5 B;  3AZK D;  1P3L D;  2ZY5 A;  3WA9 C;  1WWI A;  1P3O A;  3MGS B;  3A1K A;  1U35 A;  1U35 C;  1F66 A;  3MGP D;  1F66 C;  5B40 C;  3REK B;  3REH C;  4QLC A;  4QLC C;  5BNX A;  4J8W B;  1ID3 A;  3AL0 C;  5JRG B;  4ZBJ C;  3X1S B;  1S32 C;  1S32 A;  2W8S A;  4H9N A;  1AOI D;  5GSU B;  3LJA A;  5AV5 D;  3LJA C;  2F8N A;  3AYW C;  3REI D;  3X1U B;  2Y2P A;  2NZD C;  4YM6 D;  3W99 B;  1P3K A;  1P3K C;  5CHL B;  1P3P A;  2FJ7 B;  1KX3 A;  5B32 D;  4WU9 A;  1P3B C;  4WU9 C;  1TZY C;  3LZ0 B;  4LD9 D;  3TU4 C;  5CPJ A;  5DNM B;  5B24 D;  5CPK C;  2NZD A;  1P3F A;  3AFA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...