3V9RB

Crystal structure of saccharomyces cerevisiae mhf complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
73
Chain Sequence
MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDILSHQDLERIVGLLLMDMLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Uncharacterized protein YOL086W-A
publication title Saccharomyces Cerevisiae MHF Complex Structurally Resembles the Histones (H3-H4)(2) Heterotetramer and Functions as a Heterotetramer
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 73
sequence length 84
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09415 CENP-X CENP-S associating Centromere protein X
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3v9rB00
4WNNB 5BNXA 5B31G 1N1JA 3V9RB 3W98C 5CP6B 4Z66D 4H9PB 5B1LC 5B0ZA 2CV5D 3AYWB 4R8PB 4J8UB 4ZBJC 1U35D 3W99B 3WA9B 3UTAA 1M18B 5CPJC 5CPKA 4XZQC 3MVDA 2L5AA 5DNNB 5AY8A 3AZHD 3REID 1KX4C 3AZGD 3LZ0B 4J8XC 4G92C 2F8NH 4WU9D 1KX3C 3AZMC 1M1AD 5BNXB 1N1JB 5AV6A 3A6NC 5GT3C 1HQ3C 3UT9D 1BH8A 5B0ZB 3REJA 2F8NA 5B2JC 4XUJC 1P3AA 3TU4C 3UTAB 3B6FC 5B31D 3LJAA 3AZFC 5CPKB 3MVDB 5AY8B 5AVBD 4KGCA 3MGQC 3X1TC 2FJ7C 3AZID 1ID3C 2HIOC 5BT1D 4AWLB 5E5AC 1P3KC 5AV6B 1F1EA 5F99A 1BH8B 3REJB 3AZJD 2F8NB 2NQBA 1S32D 3MNNA 3B0DC 1P3AB 4HGAC 3LJAB 3W96A 5AV9C 4X23D 3AZEC 1P3MA 4KGCB 3UTBA 3AZKD 3KXBA 3C1BA 4KHAA 1P3IC 4NE5A 4Z66C 1P3FD 3MGRD 1P3BD 4Z5TA 1BFMA 2CV5C 4JJND 3KSYA 3WTPE 5F99B 1U35C 2BYKA 3RELD 1P3GD 1A7WA 2NQBB 3MNNB 2PYOD 1P3PA 3B6GC 4H9QA 3W96B 4E45A 4UUZA 3AZGC 1M19A 3VH5W 4WU9C 1P3MB 1KX5B 4ZUXA 2AROA 3UTBB 1M1AC 3LZ1D 3KXBB 3REKA 3C1BB 5CP6D 4H9SA 4KHAB 1P34A 3UT9C 4Z5TB 4R8PD 3AN2C 3WA9D 2BYKB 3X1SC 1M18D 5B33C 2F8NK 4QLCD 1P3PB 5DNND 4KUDA 4H9QB 5B40D 4G91C 3C1CA 3LZ0D 4UUZB 5AVBC 1M19B 2F8NG 3NQJA 3AZIC 5BT1C 4ZUXB 2AROB 1AOID 4NE6A 3REKB 4J8WC 5B32A 5GXQA 2NZDD 1P34B 3WTPB 4Z2MH 1EQZA 3AZJC 1S32C 4LD9C 3UTAD 5CPIA 5GT0C 5CPKD 3AFAC 4KUDB 5AY8D 5GSUA 3C1CB 3X1VA 3NQJB 3AZLD 1P3LB 1F66D 4J8VA 1P3FC 5AV6D 5B32B 4JJNC 3O62A 5GXQB 5AVCD 3KUYC 1EQZB 1P3AD 2PYOC 3W97C 3LJAD 5CPIB 4YM6A 5DNMA 5GSUB 5B1MC 3X1VB 4KGCD 5B2IA 3LZ1C 5B1LA 5CP6C 3MGPC 4J8VB 3WAAC 3REHD 3O62B 5CPJA 1M18C 2HUEB 5C3IB 4QLCC 5B40C 4J8XA 4YM6B 3WKJD 1KX3A 1TZYD 5DNMB 3LZ0C 5JRGD 3AZMA 4YS3D 4CAYA 1P3MD 1KX5D 5B2IB 5B24C 5GT3A 3UTBD 1AOIC 4NFTA 1HQ3A 5B1LB 3C1BD 4EO5C 2NZDC 4ZBJB 5JA4A 4XUJA 5B2JA 3X1UC 1B6WA 3AZFA 5CPJB 3MGSD 2YFVA 1P3PD 5B32G 5AY8C 4J8XB 3MGQA 1KX3B 2FJ7A 1ID3A 3LELD 2HIOA 1M19D 2LY8A 3AZMB 5E5AA 4CAYB 3VH6A 3AZLC 4AWLC 5GT3B 1F66C 5AV6C 1P34D 5JA4B 5B2JB 4XUJB 5AVCC 3WTPD 5FUGA 1ZLAD 3AZFB 1P3AC 2YFVB 3LJAC 3AZEA 5AV8D 5BS7C 1P3BC 3MGQB 3C1CD 2FJ7B 1ID3B 2JSSA 2HIOB 4DRBA 4KGCC 5E5AB 3KWQD 1P3IA 4Z66A 3AV1A 1P3LD 2CV5A 5B32D 3REHC 2IO5C 5GXQD 1EQZD 3B0DB 4HGAB 5FUGB 3B6GA 3AZHC 5CPID 3REIC 4WU8A 3AZEB 3AZGA 3WKJC 1TZYC 5GSUD 5JRGC 1M1AA 4YS3C 3X1VD 1KX5C 1P3IB 4Z66B 3UT9A 3AV1B 3C1BC 2CV5B 3AYWD 3AN2A 4J8UD 5BO0A 3W99D 3X1SA 3O62D 3AZNA 5B31C 3MGSC 5B33A 3B6GB 4WU8B 5AVBA 4YM6D 3AZGB 3LELC 1M1AB 5B0YA 5B2ID 4J8WA 3UT9B 5B1LD 4H9SC 2YFWA 4DRAA 1BH9A 5B0ZD 3AN2B 5BO0B 3WTPC 4LD9A 3X1SB 5G49A 3AZNB 1ZLAC 5CPJD 5GT0A 1R4VA 3AV2A 5B33B 3MVDD 4X23C 3AFAA 4G91B 5AV8C 5AVBB 3AZKC 4E44A 1P3OA 4CSRA 3AZMD 5B0YB 3KWQC 1P3FA 4J8WB 3MGRC 5GT3D 1P3LC 4JJNA 3VH5A 3KUYA 5B32C 2YFWB 3REJD 1BH9B 3RELC 2F8ND 2RVQD 4XUJD 1P3GC 1EQZC 4LD9B 5G49B 3W97A 1WWIA 5AV5A 5GT0B 3AZFD 3AV2B 3AFAB 5CPIC 1JFIA 5B1MA 3W98A 3VH6T 2FJ7D 3LZ1A 3X1VC 1ID3D 1P3OB 4CSRB 5E5AD 3MGPA 1P3FB 3WAAA 4JJNB 3AYWC 4R8PC 5F99D 3KUYB 4J8UC 3W99C 3O62C 3WA9C 4XZQA 2NQBD 3MNND 4QLCA 3W97B 5DNNC 5AV5B 1KX4A 1HTAA 5B40A 3W96D 2HUEC 5C3IC 4YM6C 1JFIB 5B1MB 3W98B 5B24A 3A6NA 1AOIA 3LZ1B 3KXBD 5B2IC 1P3ID 3MGPB 2NZDA 3AV1D 3WAAB 4Z5TD 3X1UA 5B0ZC 3TU4A 3B6FA 3UTAC 4XZQB 5CPKC 4QLCB 3MVDC 3B6GD 1KX4B 5B40B 4G92B 3X1TA 4WU8D 4NE3A 1P3KA 1H3OA 5B24B 3AZLA 4ZUXD 2AROD 3A6NB 1AOIB 1F66A 1HQ3B 3REKD 4EO5B 2NZDB 4H9NA 1B67A 5AVCA 3X1UB 3REJC 3TU4B 4Z2MG 3AN2D 3B6FB 4H9OA 2RVQC 3X1SD 2BYMA 5AV9A 3AZND 5B33D 4KUDD 5BS7A 1P3BA 3X1TB 1P3KB 1H3OB 3AZLB 5B0YD 1F66B 4J8WD 3REHA 1U35A 5F99C 4H9NB 5AVCB 1Q9CA 4H9OB 2NQBC 4LD9D 3MNNC 4M6BA 2BYMB 5AV9B 3AZHA 5KDMA 5GT0D 3REIA 3AV2D 3W96C 3B0CT 1ULYA 3WKJA 3AFAD 4WU9A 1TZYA 1P3BB 5JRGA 4YS3A 4WZSB 1KX5A 1P3MC 3NQUA 3UTBC 1P3OD 3VH5T 1TAFA 3KXBC 4J8VD 3AV1C 4Z5TC 3REHB 2IO5B 1U35B 4WV4B 3KUYD 5B31A 3MGSA 5CHLB 3B0CW 4H9RA 3W97D 3AZHB 5KDMB 1P3PC 5AV5D 3REIB 3WKJB 4WU9B 1TZYB 5DNMD 3LELA 3AZIA 4WU8C 5JRGB 5B1MD 4YS3B 1M19C 3W98D 3NQUB 2AROC 4ZUXC 1TAFB 3REKC 3MGPD 1KU5A 3AZJA 1P34C 3WAAD 5BNVA 3WTPA 1S32A 1ZLAA 5B31B 3MGSB 4XZQD 4X23A 3AZNC 4H9RB 5AV8A 1KX4D 4KUDC 4J8XD 1KX3D 3AZKA 3C1CC 3LELB 3AZIB 3KWQA 5B24D 3MGRA 1P3LA 3A6ND 5B0YC 1HQ3D 5GXQC 3RELA 3AZJB 3X1UD 5B2JD 1P3GA 5BNVB 3TU4D 1S32B 2PYOA 3B6FD 1ZLAB 4X23B 3AV2C 3R45A 5AV8B 5GSUC 3X1TD 4WNNA 3MGQD 3AZKB 3V9RA 2HIOD 5CP6A 3KWQB 1P3KD 1P3OC 3MGRB 4H9PA 3AYWA 4R8PA 4J8VC 4J8UA 3B0BA 3W99A 3WA9A 3RELB 1M18A 1P3GB 2PYOB 5DNNA 5AV9D 3VH6W 5AV5C 3AZED 3R45B 3LZ0A 5DNMC 2CWEA 1WWSA
chains in the Genus database with same CATH superfamily
4WNNB 5BNXA 5B31G 1N1JA 3V9RB 3W98C 5CP6B 4Z66D 4H9PB 5B1LC 5B0ZA 2CV5D 3AYWB 4R8PB 4J8UB 4ZBJC 2Y2IA 1U35D 3W99B 3WA9B 3UTAA 1M18B 5CPJC 5CPKA 4XZQC 3MVDA 2L5AA 5DNNB 5AY8A 3AZHD 3REID 1KX4C 2ZY2A 3AZGD 3LZ0B 4J8XC 4G92C 2F8NH 4WU9D 1KX3C 3AZMC 1M1AD 5BNXB 1N1JB 2ZY5A 5AV6A 3A6NC 5GT3C 1HQ3C 3UT9D 1BH8A 5B0ZB 3REJA 2F8NA 5B2JC 4XUJC 1P3AA 3TU4C 3UTAB 3B6FC 5B31D 3LJAA 3AZFC 4DQYB 5CPKB 3MVDB 2ZY4A 5AY8B 3EPHA 5AVBD 2ZM5A 3MGQC 3X1TC 4KGCA 2FJ7C 3AZID 1ID3C 2HIOC 5BT1D 4AWLB 5E5AC 1P3KC 5AV6B 3AL0C 1F1EA 5F99A 1BH8B 3REJB 2BG1A 3AZJD 2F8NB 2NQBA 1S32D 3MNNA 3B0DC 1P3AB 4HGAC 3LJAB 3W96A 5AV9C 4X23D 3AZEC 1P3MA 4KGCB 3UTBA 3AZKD 3KXBA 3C1BA 4KHAA 1P3IC 4NE5A 4Z66C 1P3FD 3MGRD 1P3BD 4Z5TA 1BFMA 2CV5C 4JJND 3KSYA 3WTPE 5F99B 2Y2KA 1U35C 2BYKA 3RELD 1P3GD 1A7WA 2NQBB 3MNNB 2PYOD 1P3PA 3B6GC 4H9QA 3W96B 4E45A 2G5HC 4UUZA 3AZGC 1M19A 3VH5W 4WU9C 1P3MB 1KX5B 4ZUXA 2AROA 3UTBB 1M1AC 3LZ1D 3KXBB 3REKA 3C1BB 5CP6D 4H9SA 4KHAB 1P34A 3UT9C 4Z5TB 4R8PD 3AN2C 3WA9D 2BYKB 3X1SC 1M18D 5B33C 2F8NK 4QLCD 1P3PB 5DNND 4KUDA 4H9QB 5B40D 4G91C 3C1CA 3LZ0D 4UUZB 5AVBC 1M19B 2F8NG 3NQJA 3AZIC 5BT1C 4ZUXB 2AROB 1AOID 4NE6A 3REKB 4J8WC 5B32A 5GXQA 2NZDD 2Y2PA 1P34B 3EPKA 3WTPB 4Z2MH 1EQZA 3AZJC 1S32C 4LD9C 3UTAD 5CPIA 5GT0C 5CPKD 3KFUG 3AFAC 4KUDB 5AY8D 5GSUA 3H0LC 3C1CB 3X1VA 3EPJA 3NQJB 3AZLD 1P3LB 1F66D 4J8VA 1P3FC 5AV6D 5B32B 4JJNC 3O62A 5GXQB 5AVCD 3KUYC 1EQZB 1P3AD 2PYOC 3W97C 3LJAD 5CPIB 4YM6A 5DNMA 5GSUB 5B1MC 3X1VB 4KGCD 5B2IA 3LZ1C 5B1LA 5CP6C 3MGPC 2Y2NA 3EG5B 4J8VB 3WAAC 3REHD 1Z2CB 3O62B 5CPJA 1M18C 2HUEB 5C3IB 4QLCC 5B40C 4J8XA 4YM6B 3WKJD 2Y2JA 1KX3A 1TZYD 5DNMB 3LZ0C 5JRGD 3AZMA 2UWXA 4YS3D 2Y2HA 4CAYA 1P3MD 1KX5D 5B24C 5B2IB 5GT3A 3UTBD 1AOIC 4NFTA 1HQ3A 5B1LB 3C1BD 4EO5C 2NZDC 4ZBJB 5JA4A 4XUJA 5B2JA 3X1UC 1B6WA 3AZFA 5CPJB 3MGSD 2YFVA 1P3PD 5B32G 5AY8C 4J8XB 3MGQA 1KX3B 2FJ7A 1ID3A 3LELD 2HIOA 1M19D 2LY8A 3AZMB 5E5AA 4CAYB 3VH6A 3AZLC 4AWLC 5GT3B 1F66C 5AV6C 1P34D 2JCHA 5JA4B 5B2JB 4XUJB 5AVCC 3WTPD 5FUGA 1ZLAD 2ZY3A 3AZFB 1P3AC 3FDDA 2YFVB 3LJAC 3AZEA 5AV8D 5BS7C 2W8SA 3MGQB 1P3BC 3C1CD 2FJ7B 1ID3B 2JSSA 2HIOB 4DRBA 4KGCC 5E5AB 3KWQD 1P3IA 4Z66A 3AV1A 1P3LD 2CV5A 5B32D 3REHC 2IO5C 5GXQD 1EQZD 3B0DB 4HGAB 5FUGB 3B6GA 3AZHC 5CPID 3REIC 4WU8A 3AZEB 3AZGA 3WKJC 1TZYC 5GSUD 5JRGC 1M1AA 4YS3C 3X1VD 2F2AC 1KX5C 1P3IB 4Z66B 2XD5A 3UT9A 3AV1B 3C1BC 2CV5B 3AYWD 3AN2A 4J8UD 5BO0A 3W99D 3X1SA 3O62D 3AZNA 5B31C 3MGSC 5B33A 3B6GB 4WU8B 5AVBA 4YM6D 3AZGB 3LELC 1M1AB 5B0YA 5B2ID 4J8WA 4UPKA 3UT9B 5B1LD 2YFWA 4H9SC 4DRAA 1BH9A 5B0ZD 3AN2B 5BO0B 3WTPC 4LD9A 3X1SB 5G49A 3AZNB 1ZLAC 5CPJD 1PZRA 1R4VA 5GT0A 3AV2A 5B33B 3MVDD 4X23C 3AFAA 4G91B 5AV8C 5AVBB 3AZKC 4E44A 1P3OA 4CSRA 3AZMD 5B0YB 3KWQC 1P3FA 4J8WB 3MGRC 5GT3D 1P3LC 4JJNA 3VH5A 3KUYA 5B32C 2YFWB 3REJD 1BH9B 3RELC 2F8ND 2RVQD 4XUJD 1P3GC 1EQZC 4LD9B 5G49B 3W97A 1WWIA 5AV5A 5GT0B 3AZFD 3AV2B 3AFAB 5CPIC 1JFIA 5B1MA 3W98A 3VH6T 2FJ7D 3LZ1A 3X1VC 1ID3D 1P3OB 4CSRB 5E5AD 3MGPA 1P3FB 3WAAA 3EPLA 4JJNB 3AYWC 4R8PC 2G5IC 5F99D 3KUYB 4J8UC 3IP4C 3W99C 3O62C 3WA9C 4XZQA 1T3UA 2NQBD 3MNND 4QLCA 3W97B 5DNNC 5AV5B 1KX4A 1HTAA 5B40A 3W96D 2HUEC 5C3IC 4YM6C 1JFIB 5B1MB 3W98B 5B24A 3A1IA 3A6NA 1AOIA 3LZ1B 3KXBD 5B2IC 1P3ID 3MGPB 2NZDA 3AV1D 2J8PA 3WAAB 4Z5TD 3X1UA 5B0ZC 3TU4A 3B6FA 2FFFB 4XZQB 3UTAC 5CPKC 4QLCB 3MVDC 3B6GD 1KX4B 5B40B 4G92B 3X1TA 4WU8D 4NE3A 1P3KA 3F6TA 1H3OA 5B24B 3AZLA 4ZUXD 2AROD 3A6NB 1AOIB 1F66A 1HQ3B 3REKD 4EO5B 2NZDB 4H9NA 1B67A 5AVCA 3X1UB 3REJC 3TU4B 4Z2MG 3AN2D 3H0MC 4H9OA 3B6FB 2RVQC 3X1SD 2BYMA 5AV9A 3AZND 5B33D 4KUDD 5BS7A 1P3BA 3X1TB 1P3KB 1H3OB 3AZLB 5B0YD 1F66B 4J8WD 1W2EA 3REHA 1U35A 5F99C 4H9NB 5AVCB 1Q9CA 4H9OB 2NQBC 4LD9D 3MNNC 4M6BA 2BYMB 2JE5A 5AV9B 3AZHA 5KDMA 5GT0D 3REIA 3AV2D 3W96C 3B0CT 1ULYA 3WKJA 2Y2MA 3AFAD 4WU9A 1TZYA 1P3BB 5JRGA 4YS3A 4WZSB 1KX5A 1P3MC 3NQUA 3UTBC 1P3OD 3VH5T 1TAFA 3KXBC 4J8VD 3AV1C 4Z5TC 3REHB 2IO5B 1U35B 4WV4B 3KUYD 5B31A 3MGSA 5CHLB 3B0CW 4H9RA 2DF4C 3W97D 3AZHB 5KDMB 1P3PC 5AV5D 3REIB 4WJ3C 3WKJB 4WU9B 1TZYB 5DNMD 3LELA 3A1KA 3AZIA 2Y2OA 2XD1A 5B1MD 2RIQA 5JRGB 4WU8C 2Y2QA 4YS3B 1M19C 3W98D 3NQUB 2AROC 4ZUXC 1TAFB 3REKC 3MGPD 2Y2LA 1KU5A 3AZJA 1P34C 3WAAD 5BNVA 3H0RC 2Y2GA 3WTPA 1S32A 1ZLAA 5B31B 2DQNC 3MGSB 4XZQD 4X23A 3AZNC 4H9RB 5AV8A 1KX4D 4KUDC 4J8XD 1KX3D 3AZKA 3C1CC 2VQRA 3LELB 3AZIB 3KWQA 5B24D 3MGRA 1P3LA 3A6ND 5B0YC 1HQ3D 5GXQC 3RELA 3AZJB 3X1UD 5B2JD 1P3GA 5BNVB 3TU4D 1S32B 2PYOA 3B6FD 1ZLAB 3P5JB 4X23B 3AV2C 3R45A 5AV8B 5GSUC 3X1TD 4WNNA 3MGQD 3AZKB 3V9RA 2HIOD 5CP6A 3KWQB 1P3KD 1P3OC 3MGRB 4H9PA 3AYWA 4R8PA 4J8VC 4J8UA 3B0BA 3W99A 3WA9A 3RELB 1M18A 1P3GB 2PYOB 5DNNA 5AV9D 3VH6W 5AV5C 3AZED 3R45B 3LZ0A 5DNMC 2CWEA 1WWSA
chains in the Genus database with same CATH topology
4WNNB 5BNXA 5B31G 1N1JA 3V9RB 3W98C 5CP6B 4Z66D 4H9PB 5B1LC 5B0ZA 2CV5D 3AYWB 4R8PB 4J8UB 4ZBJC 2Y2IA 1U35D 3W99B 3WA9B 3UTAA 1M18B 5CPJC 5CPKA 4XZQC 3MVDA 2L5AA 5DNNB 5AY8A 3AZHD 3REID 1KX4C 2ZY2A 3AZGD 3LZ0B 4J8XC 4G92C 2F8NH 4WU9D 1KX3C 3AZMC 1M1AD 5BNXB 1N1JB 2ZY5A 5AV6A 3A6NC 5GT3C 1HQ3C 3UT9D 1BH8A 5B0ZB 3REJA 2F8NA 5B2JC 4XUJC 1P3AA 3TU4C 3UTAB 3B6FC 5B31D 3LJAA 3AZFC 4DQYB 5CPKB 3MVDB 2ZY4A 5AY8B 3EPHA 5AVBD 2ZM5A 3MGQC 3X1TC 4KGCA 2FJ7C 3AZID 1ID3C 2HIOC 5BT1D 4AWLB 5E5AC 1P3KC 5AV6B 3AL0C 1F1EA 5F99A 1BH8B 3REJB 2BG1A 3AZJD 2F8NB 2NQBA 1S32D 3MNNA 3B0DC 1P3AB 4HGAC 3LJAB 3W96A 5AV9C 4X23D 3AZEC 1P3MA 4KGCB 3UTBA 3AZKD 3KXBA 3C1BA 4KHAA 1P3IC 4NE5A 4Z66C 1P3FD 3MGRD 1P3BD 4Z5TA 1BFMA 2CV5C 4JJND 3KSYA 3WTPE 5F99B 2Y2KA 1U35C 2BYKA 3RELD 1P3GD 1A7WA 2NQBB 3MNNB 2PYOD 1P3PA 3B6GC 4H9QA 3W96B 4E45A 2G5HC 4UUZA 3AZGC 1M19A 3VH5W 4WU9C 1P3MB 1KX5B 4ZUXA 2AROA 3UTBB 1M1AC 3LZ1D 3KXBB 3REKA 3C1BB 5CP6D 4H9SA 4KHAB 1P34A 3UT9C 4Z5TB 4R8PD 3AN2C 3WA9D 2BYKB 3X1SC 1M18D 5B33C 2F8NK 4QLCD 1P3PB 5DNND 4KUDA 4H9QB 5B40D 4G91C 3C1CA 3LZ0D 4UUZB 5AVBC 1M19B 2F8NG 3NQJA 3AZIC 5BT1C 4ZUXB 2AROB 1AOID 4NE6A 3REKB 4J8WC 5B32A 5GXQA 2NZDD 2Y2PA 1P34B 3EPKA 3WTPB 4Z2MH 1EQZA 3AZJC 1S32C 4LD9C 3UTAD 5CPIA 5GT0C 5CPKD 3KFUG 3AFAC 4KUDB 5AY8D 5GSUA 3H0LC 3C1CB 3X1VA 3EPJA 3NQJB 3AZLD 1P3LB 1F66D 4J8VA 1P3FC 5AV6D 5B32B 4JJNC 3O62A 5GXQB 5AVCD 3KUYC 1EQZB 1P3AD 2PYOC 3W97C 3LJAD 5CPIB 4YM6A 5DNMA 5GSUB 5B1MC 3X1VB 4KGCD 5B2IA 3LZ1C 5B1LA 5CP6C 3MGPC 2Y2NA 3EG5B 4J8VB 3WAAC 3REHD 1Z2CB 3O62B 5CPJA 1M18C 2HUEB 5C3IB 4QLCC 5B40C 4J8XA 4YM6B 3WKJD 2Y2JA 1KX3A 1TZYD 5DNMB 3LZ0C 5JRGD 3AZMA 2UWXA 4YS3D 2Y2HA 4CAYA 1P3MD 1KX5D 5B24C 5B2IB 5GT3A 3UTBD 1AOIC 4NFTA 1HQ3A 5B1LB 3C1BD 4EO5C 2NZDC 4ZBJB 5JA4A 4XUJA 5B2JA 3X1UC 1B6WA 3AZFA 5CPJB 3MGSD 2YFVA 1P3PD 5B32G 5AY8C 4J8XB 3MGQA 1KX3B 2FJ7A 1ID3A 3LELD 2HIOA 1M19D 2LY8A 3AZMB 5E5AA 4CAYB 3VH6A 3AZLC 4AWLC 5GT3B 1F66C 5AV6C 1P34D 2JCHA 5JA4B 5B2JB 4XUJB 5AVCC 3WTPD 5FUGA 1ZLAD 2ZY3A 3AZFB 1P3AC 3FDDA 2YFVB 3LJAC 3AZEA 5AV8D 5BS7C 2W8SA 3MGQB 1P3BC 3C1CD 2FJ7B 1ID3B 2JSSA 2HIOB 4DRBA 4KGCC 5E5AB 3KWQD 1P3IA 4Z66A 3AV1A 1P3LD 2CV5A 5B32D 3REHC 2IO5C 5GXQD 1EQZD 3B0DB 4HGAB 5FUGB 3B6GA 3AZHC 5CPID 3REIC 4WU8A 3AZEB 3AZGA 3WKJC 1TZYC 5GSUD 5JRGC 1M1AA 4YS3C 3X1VD 2F2AC 1KX5C 1P3IB 4Z66B 2XD5A 3UT9A 3AV1B 3C1BC 2CV5B 3AYWD 3AN2A 4J8UD 5BO0A 3W99D 3X1SA 3O62D 3AZNA 5B31C 3MGSC 5B33A 3B6GB 4WU8B 5AVBA 4YM6D 3AZGB 3LELC 1M1AB 5B0YA 5B2ID 4J8WA 4UPKA 3UT9B 5B1LD 2YFWA 4H9SC 4DRAA 1BH9A 5B0ZD 3AN2B 5BO0B 3WTPC 4LD9A 3X1SB 5G49A 3AZNB 1ZLAC 5CPJD 1PZRA 1R4VA 5GT0A 3AV2A 5B33B 3MVDD 4X23C 3AFAA 4G91B 5AV8C 5AVBB 3AZKC 4E44A 1P3OA 4CSRA 3AZMD 5B0YB 3KWQC 1P3FA 4J8WB 3MGRC 5GT3D 1P3LC 4JJNA 3VH5A 3KUYA 5B32C 2YFWB 3REJD 1BH9B 3RELC 2F8ND 2RVQD 4XUJD 1P3GC 1EQZC 4LD9B 5G49B 3W97A 1WWIA 5AV5A 5GT0B 3AZFD 3AV2B 3AFAB 5CPIC 1JFIA 5B1MA 3W98A 3VH6T 2FJ7D 3LZ1A 3X1VC 1ID3D 1P3OB 4CSRB 5E5AD 3MGPA 1P3FB 3WAAA 3EPLA 4JJNB 3AYWC 4R8PC 2G5IC 5F99D 3KUYB 4J8UC 3IP4C 3W99C 3O62C 3WA9C 4XZQA 1T3UA 2NQBD 3MNND 4QLCA 3W97B 5DNNC 5AV5B 1KX4A 1HTAA 5B40A 3W96D 2HUEC 5C3IC 4YM6C 1JFIB 5B1MB 3W98B 5B24A 3A1IA 3A6NA 1AOIA 3LZ1B 3KXBD 5B2IC 1P3ID 3MGPB 2NZDA 3AV1D 2J8PA 3WAAB 4Z5TD 3X1UA 5B0ZC 3TU4A 3B6FA 2FFFB 4XZQB 3UTAC 5CPKC 4QLCB 3MVDC 3B6GD 1KX4B 5B40B 4G92B 3X1TA 4WU8D 4NE3A 1P3KA 3F6TA 1H3OA 5B24B 3AZLA 4ZUXD 2AROD 3A6NB 1AOIB 1F66A 1HQ3B 3REKD 4EO5B 2NZDB 4H9NA 1B67A 5AVCA 3X1UB 3REJC 3TU4B 4Z2MG 3AN2D 3H0MC 4H9OA 3B6FB 2RVQC 3X1SD 2BYMA 5AV9A 3AZND 5B33D 4KUDD 5BS7A 1P3BA 3X1TB 1P3KB 1H3OB 3AZLB 5B0YD 1F66B 4J8WD 1W2EA 3REHA 1U35A 5F99C 4H9NB 5AVCB 1Q9CA 4H9OB 2NQBC 4LD9D 3MNNC 4M6BA 2BYMB 2JE5A 5AV9B 3AZHA 5KDMA 5GT0D 3REIA 3AV2D 3W96C 3B0CT 1ULYA 3WKJA 2Y2MA 3AFAD 4WU9A 1TZYA 1P3BB 5JRGA 4YS3A 4WZSB 1KX5A 1P3MC 3NQUA 3UTBC 1P3OD 3VH5T 1TAFA 3KXBC 4J8VD 3AV1C 4Z5TC 3REHB 2IO5B 1U35B 4WV4B 3KUYD 5B31A 3MGSA 5CHLB 3B0CW 4H9RA 2DF4C 3W97D 3AZHB 5KDMB 1P3PC 5AV5D 3REIB 4WJ3C 3WKJB 4WU9B 1TZYB 5DNMD 3LELA 3A1KA 3AZIA 2Y2OA 2XD1A 5B1MD 2RIQA 5JRGB 4WU8C 2Y2QA 4YS3B 1M19C 3W98D 3NQUB 2AROC 4ZUXC 1TAFB 3REKC 3MGPD 2Y2LA 1KU5A 3AZJA 1P34C 3WAAD 5BNVA 3H0RC 2Y2GA 3WTPA 1S32A 1ZLAA 5B31B 2DQNC 3MGSB 4XZQD 4X23A 3AZNC 4H9RB 5AV8A 1KX4D 4KUDC 4J8XD 1KX3D 3AZKA 3C1CC 2VQRA 3LELB 3AZIB 3KWQA 5B24D 3MGRA 1P3LA 3A6ND 5B0YC 1HQ3D 5GXQC 3RELA 3AZJB 3X1UD 5B2JD 1P3GA 5BNVB 3TU4D 1S32B 2PYOA 3B6FD 1ZLAB 3P5JB 4X23B 3AV2C 3R45A 5AV8B 5GSUC 3X1TD 4WNNA 3MGQD 3AZKB 3V9RA 2HIOD 5CP6A 3KWQB 1P3KD 1P3OC 3MGRB 4H9PA 3AYWA 4R8PA 4J8VC 4J8UA 3B0BA 3W99A 3WA9A 3RELB 1M18A 1P3GB 2PYOB 5DNNA 5AV9D 3VH6W 5AV5C 3AZED 3R45B 3LZ0A 5DNMC 2CWEA 1WWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNN B;  5BNX A;  5B31 G;  1N1J A;  3V9R B;  3W98 C;  5CP6 B;  4Z66 D;  4H9P B;  5B1L C;  5B0Z A;  2CV5 D;  3AYW B;  4R8P B;  4J8U B;  4ZBJ C;  1U35 D;  3W99 B;  3WA9 B;  3UTA A;  1M18 B;  5CPJ C;  5CPK A;  4XZQ C;  3MVD A;  2L5A A;  5DNN B;  5AY8 A;  3AZH D;  3REI D;  1KX4 C;  3AZG D;  3LZ0 B;  4J8X C;  4G92 C;  2F8N H;  4WU9 D;  1KX3 C;  3AZM C;  1M1A D;  5BNX B;  1N1J B;  5AV6 A;  3A6N C;  5GT3 C;  1HQ3 C;  3UT9 D;  1BH8 A;  5B0Z B;  3REJ A;  2F8N A;  5B2J C;  4XUJ C;  1P3A A;  3TU4 C;  3UTA B;  3B6F C;  5B31 D;  3LJA A;  3AZF C;  5CPK B;  3MVD B;  5AY8 B;  5AVB D;  4KGC A;  3MGQ C;  3X1T C;  2FJ7 C;  3AZI D;  1ID3 C;  2HIO C;  5BT1 D;  4AWL B;  5E5A C;  1P3K C;  5AV6 B;  1F1E A;  5F99 A;  1BH8 B;  3REJ B;  3AZJ D;  2F8N B;  2NQB A;  1S32 D;  3MNN A;  3B0D C;  1P3A B;  4HGA C;  3LJA B;  3W96 A;  5AV9 C;  4X23 D;  3AZE C;  1P3M A;  4KGC B;  3UTB A;  3AZK D;  3KXB A;  3C1B A;  4KHA A;  1P3I C;  4NE5 A;  4Z66 C;  1P3F D;  3MGR D;  1P3B D;  4Z5T A;  1BFM A;  2CV5 C;  4JJN D;  3KSY A;  3WTP E;  5F99 B;  1U35 C;  2BYK A;  3REL D;  1P3G D;  1A7W A;  2NQB B;  3MNN B;  2PYO D;  1P3P A;  3B6G C;  4H9Q A;  3W96 B;  4E45 A;  4UUZ A;  3AZG C;  1M19 A;  3VH5 W;  4WU9 C;  1P3M B;  1KX5 B;  4ZUX A;  2ARO A;  3UTB B;  1M1A C;  3LZ1 D;  3KXB B;  3REK A;  3C1B B;  5CP6 D;  4H9S A;  4KHA B;  1P34 A;  3UT9 C;  4Z5T B;  4R8P D;  3AN2 C;  3WA9 D;  2BYK B;  3X1S C;  1M18 D;  5B33 C;  2F8N K;  4QLC D;  1P3P B;  5DNN D;  4KUD A;  4H9Q B;  5B40 D;  4G91 C;  3C1C A;  3LZ0 D;  4UUZ B;  5AVB C;  1M19 B;  2F8N G;  3NQJ A;  3AZI C;  5BT1 C;  4ZUX B;  2ARO B;  1AOI D;  4NE6 A;  3REK B;  4J8W C;  5B32 A;  5GXQ A;  2NZD D;  1P34 B;  3WTP B;  4Z2M H;  1EQZ A;  3AZJ C;  1S32 C;  4LD9 C;  3UTA D;  5CPI A;  5GT0 C;  5CPK D;  3AFA C;  4KUD B;  5AY8 D;  5GSU A;  3C1C B;  3X1V A;  3NQJ B;  3AZL D;  1P3L B;  1F66 D;  4J8V A;  1P3F C;  5AV6 D;  5B32 B;  4JJN C;  3O62 A;  5GXQ B;  5AVC D;  3KUY C;  1EQZ B;  1P3A D;  2PYO C;  3W97 C;  3LJA D;  5CPI B;  4YM6 A;  5DNM A;  5GSU B;  5B1M C;  3X1V B;  4KGC D;  5B2I A;  3LZ1 C;  5B1L A;  5CP6 C;  3MGP C;  4J8V B;  3WAA C;  3REH D;  3O62 B;  5CPJ A;  1M18 C;  2HUE B;  5C3I B;  4QLC C;  5B40 C;  4J8X A;  4YM6 B;  3WKJ D;  1KX3 A;  1TZY D;  5DNM B;  3LZ0 C;  5JRG D;  3AZM A;  4YS3 D;  4CAY A;  1P3M D;  1KX5 D;  5B2I B;  5B24 C;  5GT3 A;  3UTB D;  1AOI C;  4NFT A;  1HQ3 A;  5B1L B;  3C1B D;  4EO5 C;  2NZD C;  4ZBJ B;  5JA4 A;  4XUJ A;  5B2J A;  3X1U C;  1B6W A;  3AZF A;  5CPJ B;  3MGS D;  2YFV A;  1P3P D;  5B32 G;  5AY8 C;  4J8X B;  3MGQ A;  1KX3 B;  2FJ7 A;  1ID3 A;  3LEL D;  2HIO A;  1M19 D;  2LY8 A;  3AZM B;  5E5A A;  4CAY B;  3VH6 A;  3AZL C;  4AWL C;  5GT3 B;  1F66 C;  5AV6 C;  1P34 D;  5JA4 B;  5B2J B;  4XUJ B;  5AVC C;  3WTP D;  5FUG A;  1ZLA D;  3AZF B;  1P3A C;  2YFV B;  3LJA C;  3AZE A;  5AV8 D;  5BS7 C;  1P3B C;  3MGQ B;  3C1C D;  2FJ7 B;  1ID3 B;  2JSS A;  2HIO B;  4DRB A;  4KGC C;  5E5A B;  3KWQ D;  1P3I A;  4Z66 A;  3AV1 A;  1P3L D;  2CV5 A;  5B32 D;  3REH C;  2IO5 C;  5GXQ D;  1EQZ D;  3B0D B;  4HGA B;  5FUG B;  3B6G A;  3AZH C;  5CPI D;  3REI C;  4WU8 A;  3AZE B;  3AZG A;  3WKJ C;  1TZY C;  5GSU D;  5JRG C;  1M1A A;  4YS3 C;  3X1V D;  1KX5 C;  1P3I B;  4Z66 B;  3UT9 A;  3AV1 B;  3C1B C;  2CV5 B;  3AYW D;  3AN2 A;  4J8U D;  5BO0 A;  3W99 D;  3X1S A;  3O62 D;  3AZN A;  5B31 C;  3MGS C;  5B33 A;  3B6G B;  4WU8 B;  5AVB A;  4YM6 D;  3AZG B;  3LEL C;  1M1A B;  5B0Y A;  5B2I D;  4J8W A;  3UT9 B;  5B1L D;  4H9S C;  2YFW A;  4DRA A;  1BH9 A;  5B0Z D;  3AN2 B;  5BO0 B;  3WTP C;  4LD9 A;  3X1S B;  5G49 A;  3AZN B;  1ZLA C;  5CPJ D;  5GT0 A;  1R4V A;  3AV2 A;  5B33 B;  3MVD D;  4X23 C;  3AFA A;  4G91 B;  5AV8 C;  5AVB B;  3AZK C;  4E44 A;  1P3O A;  4CSR A;  3AZM D;  5B0Y B;  3KWQ C;  1P3F A;  4J8W B;  3MGR C;  5GT3 D;  1P3L C;  4JJN A;  3VH5 A;  3KUY A;  5B32 C;  2YFW B;  3REJ D;  1BH9 B;  3REL C;  2F8N D;  2RVQ D;  4XUJ D;  1P3G C;  1EQZ C;  4LD9 B;  5G49 B;  3W97 A;  1WWI A;  5AV5 A;  5GT0 B;  3AZF D;  3AV2 B;  3AFA B;  5CPI C;  1JFI A;  5B1M A;  3W98 A;  3VH6 T;  2FJ7 D;  3LZ1 A;  3X1V C;  1ID3 D;  1P3O B;  4CSR B;  5E5A D;  3MGP A;  1P3F B;  3WAA A;  4JJN B;  3AYW C;  4R8P C;  5F99 D;  3KUY B;  4J8U C;  3W99 C;  3O62 C;  3WA9 C;  4XZQ A;  2NQB D;  3MNN D;  4QLC A;  3W97 B;  5DNN C;  5AV5 B;  1KX4 A;  1HTA A;  5B40 A;  3W96 D;  2HUE C;  5C3I C;  4YM6 C;  1JFI B;  5B1M B;  3W98 B;  5B24 A;  3A6N A;  1AOI A;  3LZ1 B;  3KXB D;  5B2I C;  1P3I D;  3MGP B;  2NZD A;  3AV1 D;  3WAA B;  4Z5T D;  3X1U A;  5B0Z C;  3TU4 A;  3B6F A;  3UTA C;  4XZQ B;  5CPK C;  4QLC B;  3MVD C;  3B6G D;  1KX4 B;  5B40 B;  4G92 B;  3X1T A;  4WU8 D;  4NE3 A;  1P3K A;  1H3O A;  5B24 B;  3AZL A;  4ZUX D;  2ARO D;  3A6N B;  1AOI B;  1F66 A;  1HQ3 B;  3REK D;  4EO5 B;  2NZD B;  4H9N A;  1B67 A;  5AVC A;  3X1U B;  3REJ C;  3TU4 B;  4Z2M G;  3AN2 D;  3B6F B;  4H9O A;  2RVQ C;  3X1S D;  2BYM A;  5AV9 A;  3AZN D;  5B33 D;  4KUD D;  5BS7 A;  1P3B A;  3X1T B;  1P3K B;  1H3O B;  3AZL B;  5B0Y D;  1F66 B;  4J8W D;  3REH A;  1U35 A;  5F99 C;  4H9N B;  5AVC B;  1Q9C A;  4H9O B;  2NQB C;  4LD9 D;  3MNN C;  4M6B A;  2BYM B;  5AV9 B;  3AZH A;  5KDM A;  5GT0 D;  3REI A;  3AV2 D;  3W96 C;  3B0C T;  1ULY A;  3WKJ A;  3AFA D;  4WU9 A;  1TZY A;  1P3B B;  5JRG A;  4YS3 A;  4WZS B;  1KX5 A;  1P3M C;  3NQU A;  3UTB C;  1P3O D;  3VH5 T;  1TAF A;  3KXB C;  4J8V D;  3AV1 C;  4Z5T C;  3REH B;  2IO5 B;  1U35 B;  4WV4 B;  3KUY D;  5B31 A;  3MGS A;  5CHL B;  3B0C W;  4H9R A;  3W97 D;  3AZH B;  5KDM B;  1P3P C;  5AV5 D;  3REI B;  3WKJ B;  4WU9 B;  1TZY B;  5DNM D;  3LEL A;  3AZI A;  4WU8 C;  5JRG B;  5B1M D;  4YS3 B;  1M19 C;  3W98 D;  3NQU B;  2ARO C;  4ZUX C;  1TAF B;  3REK C;  3MGP D;  1KU5 A;  3AZJ A;  1P34 C;  3WAA D;  5BNV A;  3WTP A;  1S32 A;  1ZLA A;  5B31 B;  3MGS B;  4XZQ D;  4X23 A;  3AZN C;  4H9R B;  5AV8 A;  1KX4 D;  4KUD C;  4J8X D;  1KX3 D;  3AZK A;  3C1C C;  3LEL B;  3AZI B;  3KWQ A;  5B24 D;  3MGR A;  1P3L A;  3A6N D;  5B0Y C;  1HQ3 D;  5GXQ C;  3REL A;  3AZJ B;  3X1U D;  5B2J D;  1P3G A;  5BNV B;  3TU4 D;  1S32 B;  2PYO A;  3B6F D;  1ZLA B;  4X23 B;  3AV2 C;  3R45 A;  5AV8 B;  5GSU C;  3X1T D;  4WNN A;  3MGQ D;  3AZK B;  3V9R A;  2HIO D;  5CP6 A;  3KWQ B;  1P3K D;  1P3O C;  3MGR B;  4H9P A;  3AYW A;  4R8P A;  4J8V C;  4J8U A;  3B0B A;  3W99 A;  3WA9 A;  3REL B;  1M18 A;  1P3G B;  2PYO B;  5DNN A;  5AV9 D;  3VH6 W;  5AV5 C;  3AZE D;  3R45 B;  3LZ0 A;  5DNM C;  2CWE A;  1WWS A; 
#chains in the Genus database with same CATH topology
 4WNN B;  5BNX A;  5B31 G;  1N1J A;  3V9R B;  3W98 C;  5CP6 B;  4Z66 D;  4H9P B;  5B1L C;  5B0Z A;  2CV5 D;  3AYW B;  4R8P B;  4J8U B;  4ZBJ C;  2Y2I A;  1U35 D;  3W99 B;  3WA9 B;  3UTA A;  1M18 B;  5CPJ C;  5CPK A;  4XZQ C;  3MVD A;  2L5A A;  5DNN B;  5AY8 A;  3AZH D;  3REI D;  1KX4 C;  2ZY2 A;  3AZG D;  3LZ0 B;  4J8X C;  4G92 C;  2F8N H;  4WU9 D;  1KX3 C;  3AZM C;  1M1A D;  5BNX B;  1N1J B;  2ZY5 A;  5AV6 A;  3A6N C;  5GT3 C;  1HQ3 C;  3UT9 D;  1BH8 A;  5B0Z B;  3REJ A;  2F8N A;  5B2J C;  4XUJ C;  1P3A A;  3TU4 C;  3UTA B;  3B6F C;  5B31 D;  3LJA A;  3AZF C;  4DQY B;  5CPK B;  3MVD B;  2ZY4 A;  5AY8 B;  3EPH A;  5AVB D;  2ZM5 A;  3MGQ C;  3X1T C;  4KGC A;  2FJ7 C;  3AZI D;  1ID3 C;  2HIO C;  5BT1 D;  4AWL B;  5E5A C;  1P3K C;  5AV6 B;  3AL0 C;  1F1E A;  5F99 A;  1BH8 B;  3REJ B;  2BG1 A;  3AZJ D;  2F8N B;  2NQB A;  1S32 D;  3MNN A;  3B0D C;  1P3A B;  4HGA C;  3LJA B;  3W96 A;  5AV9 C;  4X23 D;  3AZE C;  1P3M A;  4KGC B;  3UTB A;  3AZK D;  3KXB A;  3C1B A;  4KHA A;  1P3I C;  4NE5 A;  4Z66 C;  1P3F D;  3MGR D;  1P3B D;  4Z5T A;  1BFM A;  2CV5 C;  4JJN D;  3KSY A;  3WTP E;  5F99 B;  2Y2K A;  1U35 C;  2BYK A;  3REL D;  1P3G D;  1A7W A;  2NQB B;  3MNN B;  2PYO D;  1P3P A;  3B6G C;  4H9Q A;  3W96 B;  4E45 A;  2G5H C;  4UUZ A;  3AZG C;  1M19 A;  3VH5 W;  4WU9 C;  1P3M B;  1KX5 B;  4ZUX A;  2ARO A;  3UTB B;  1M1A C;  3LZ1 D;  3KXB B;  3REK A;  3C1B B;  5CP6 D;  4H9S A;  4KHA B;  1P34 A;  3UT9 C;  4Z5T B;  4R8P D;  3AN2 C;  3WA9 D;  2BYK B;  3X1S C;  1M18 D;  5B33 C;  2F8N K;  4QLC D;  1P3P B;  5DNN D;  4KUD A;  4H9Q B;  5B40 D;  4G91 C;  3C1C A;  3LZ0 D;  4UUZ B;  5AVB C;  1M19 B;  2F8N G;  3NQJ A;  3AZI C;  5BT1 C;  4ZUX B;  2ARO B;  1AOI D;  4NE6 A;  3REK B;  4J8W C;  5B32 A;  5GXQ A;  2NZD D;  2Y2P A;  1P34 B;  3EPK A;  3WTP B;  4Z2M H;  1EQZ A;  3AZJ C;  1S32 C;  4LD9 C;  3UTA D;  5CPI A;  5GT0 C;  5CPK D;  3KFU G;  3AFA C;  4KUD B;  5AY8 D;  5GSU A;  3H0L C;  3C1C B;  3X1V A;  3EPJ A;  3NQJ B;  3AZL D;  1P3L B;  1F66 D;  4J8V A;  1P3F C;  5AV6 D;  5B32 B;  4JJN C;  3O62 A;  5GXQ B;  5AVC D;  3KUY C;  1EQZ B;  1P3A D;  2PYO C;  3W97 C;  3LJA D;  5CPI B;  4YM6 A;  5DNM A;  5GSU B;  5B1M C;  3X1V B;  4KGC D;  5B2I A;  3LZ1 C;  5B1L A;  5CP6 C;  3MGP C;  2Y2N A;  3EG5 B;  4J8V B;  3WAA C;  3REH D;  1Z2C B;  3O62 B;  5CPJ A;  1M18 C;  2HUE B;  5C3I B;  4QLC C;  5B40 C;  4J8X A;  4YM6 B;  3WKJ D;  2Y2J A;  1KX3 A;  1TZY D;  5DNM B;  3LZ0 C;  5JRG D;  3AZM A;  2UWX A;  4YS3 D;  2Y2H A;  4CAY A;  1P3M D;  1KX5 D;  5B24 C;  5B2I B;  5GT3 A;  3UTB D;  1AOI C;  4NFT A;  1HQ3 A;  5B1L B;  3C1B D;  4EO5 C;  2NZD C;  4ZBJ B;  5JA4 A;  4XUJ A;  5B2J A;  3X1U C;  1B6W A;  3AZF A;  5CPJ B;  3MGS D;  2YFV A;  1P3P D;  5B32 G;  5AY8 C;  4J8X B;  3MGQ A;  1KX3 B;  2FJ7 A;  1ID3 A;  3LEL D;  2HIO A;  1M19 D;  2LY8 A;  3AZM B;  5E5A A;  4CAY B;  3VH6 A;  3AZL C;  4AWL C;  5GT3 B;  1F66 C;  5AV6 C;  1P34 D;  2JCH A;  5JA4 B;  5B2J B;  4XUJ B;  5AVC C;  3WTP D;  5FUG A;  1ZLA D;  2ZY3 A;  3AZF B;  1P3A C;  3FDD A;  2YFV B;  3LJA C;  3AZE A;  5AV8 D;  5BS7 C;  2W8S A;  3MGQ B;  1P3B C;  3C1C D;  2FJ7 B;  1ID3 B;  2JSS A;  2HIO B;  4DRB A;  4KGC C;  5E5A B;  3KWQ D;  1P3I A;  4Z66 A;  3AV1 A;  1P3L D;  2CV5 A;  5B32 D;  3REH C;  2IO5 C;  5GXQ D;  1EQZ D;  3B0D B;  4HGA B;  5FUG B;  3B6G A;  3AZH C;  5CPI D;  3REI C;  4WU8 A;  3AZE B;  3AZG A;  3WKJ C;  1TZY C;  5GSU D;  5JRG C;  1M1A A;  4YS3 C;  3X1V D;  2F2A C;  1KX5 C;  1P3I B;  4Z66 B;  2XD5 A;  3UT9 A;  3AV1 B;  3C1B C;  2CV5 B;  3AYW D;  3AN2 A;  4J8U D;  5BO0 A;  3W99 D;  3X1S A;  3O62 D;  3AZN A;  5B31 C;  3MGS C;  5B33 A;  3B6G B;  4WU8 B;  5AVB A;  4YM6 D;  3AZG B;  3LEL C;  1M1A B;  5B0Y A;  5B2I D;  4J8W A;  4UPK A;  3UT9 B;  5B1L D;  2YFW A;  4H9S C;  4DRA A;  1BH9 A;  5B0Z D;  3AN2 B;  5BO0 B;  3WTP C;  4LD9 A;  3X1S B;  5G49 A;  3AZN B;  1ZLA C;  5CPJ D;  1PZR A;  1R4V A;  5GT0 A;  3AV2 A;  5B33 B;  3MVD D;  4X23 C;  3AFA A;  4G91 B;  5AV8 C;  5AVB B;  3AZK C;  4E44 A;  1P3O A;  4CSR A;  3AZM D;  5B0Y B;  3KWQ C;  1P3F A;  4J8W B;  3MGR C;  5GT3 D;  1P3L C;  4JJN A;  3VH5 A;  3KUY A;  5B32 C;  2YFW B;  3REJ D;  1BH9 B;  3REL C;  2F8N D;  2RVQ D;  4XUJ D;  1P3G C;  1EQZ C;  4LD9 B;  5G49 B;  3W97 A;  1WWI A;  5AV5 A;  5GT0 B;  3AZF D;  3AV2 B;  3AFA B;  5CPI C;  1JFI A;  5B1M A;  3W98 A;  3VH6 T;  2FJ7 D;  3LZ1 A;  3X1V C;  1ID3 D;  1P3O B;  4CSR B;  5E5A D;  3MGP A;  1P3F B;  3WAA A;  3EPL A;  4JJN B;  3AYW C;  4R8P C;  2G5I C;  5F99 D;  3KUY B;  4J8U C;  3IP4 C;  3W99 C;  3O62 C;  3WA9 C;  4XZQ A;  1T3U A;  2NQB D;  3MNN D;  4QLC A;  3W97 B;  5DNN C;  5AV5 B;  1KX4 A;  1HTA A;  5B40 A;  3W96 D;  2HUE C;  5C3I C;  4YM6 C;  1JFI B;  5B1M B;  3W98 B;  5B24 A;  3A1I A;  3A6N A;  1AOI A;  3LZ1 B;  3KXB D;  5B2I C;  1P3I D;  3MGP B;  2NZD A;  3AV1 D;  2J8P A;  3WAA B;  4Z5T D;  3X1U A;  5B0Z C;  3TU4 A;  3B6F A;  2FFF B;  4XZQ B;  3UTA C;  5CPK C;  4QLC B;  3MVD C;  3B6G D;  1KX4 B;  5B40 B;  4G92 B;  3X1T A;  4WU8 D;  4NE3 A;  1P3K A;  3F6T A;  1H3O A;  5B24 B;  3AZL A;  4ZUX D;  2ARO D;  3A6N B;  1AOI B;  1F66 A;  1HQ3 B;  3REK D;  4EO5 B;  2NZD B;  4H9N A;  1B67 A;  5AVC A;  3X1U B;  3REJ C;  3TU4 B;  4Z2M G;  3AN2 D;  3H0M C;  4H9O A;  3B6F B;  2RVQ C;  3X1S D;  2BYM A;  5AV9 A;  3AZN D;  5B33 D;  4KUD D;  5BS7 A;  1P3B A;  3X1T B;  1P3K B;  1H3O B;  3AZL B;  5B0Y D;  1F66 B;  4J8W D;  1W2E A;  3REH A;  1U35 A;  5F99 C;  4H9N B;  5AVC B;  1Q9C A;  4H9O B;  2NQB C;  4LD9 D;  3MNN C;  4M6B A;  2BYM B;  2JE5 A;  5AV9 B;  3AZH A;  5KDM A;  5GT0 D;  3REI A;  3AV2 D;  3W96 C;  3B0C T;  1ULY A;  3WKJ A;  2Y2M A;  3AFA D;  4WU9 A;  1TZY A;  1P3B B;  5JRG A;  4YS3 A;  4WZS B;  1KX5 A;  1P3M C;  3NQU A;  3UTB C;  1P3O D;  3VH5 T;  1TAF A;  3KXB C;  4J8V D;  3AV1 C;  4Z5T C;  3REH B;  2IO5 B;  1U35 B;  4WV4 B;  3KUY D;  5B31 A;  3MGS A;  5CHL B;  3B0C W;  4H9R A;  2DF4 C;  3W97 D;  3AZH B;  5KDM B;  1P3P C;  5AV5 D;  3REI B;  4WJ3 C;  3WKJ B;  4WU9 B;  1TZY B;  5DNM D;  3LEL A;  3A1K A;  3AZI A;  2Y2O A;  2XD1 A;  5B1M D;  2RIQ A;  5JRG B;  4WU8 C;  2Y2Q A;  4YS3 B;  1M19 C;  3W98 D;  3NQU B;  2ARO C;  4ZUX C;  1TAF B;  3REK C;  3MGP D;  2Y2L A;  1KU5 A;  3AZJ A;  1P34 C;  3WAA D;  5BNV A;  3H0R C;  2Y2G A;  3WTP A;  1S32 A;  1ZLA A;  5B31 B;  2DQN C;  3MGS B;  4XZQ D;  4X23 A;  3AZN C;  4H9R B;  5AV8 A;  1KX4 D;  4KUD C;  4J8X D;  1KX3 D;  3AZK A;  3C1C C;  2VQR A;  3LEL B;  3AZI B;  3KWQ A;  5B24 D;  3MGR A;  1P3L A;  3A6N D;  5B0Y C;  1HQ3 D;  5GXQ C;  3REL A;  3AZJ B;  3X1U D;  5B2J D;  1P3G A;  5BNV B;  3TU4 D;  1S32 B;  2PYO A;  3B6F D;  1ZLA B;  3P5J B;  4X23 B;  3AV2 C;  3R45 A;  5AV8 B;  5GSU C;  3X1T D;  4WNN A;  3MGQ D;  3AZK B;  3V9R A;  2HIO D;  5CP6 A;  3KWQ B;  1P3K D;  1P3O C;  3MGR B;  4H9P A;  3AYW A;  4R8P A;  4J8V C;  4J8U A;  3B0B A;  3W99 A;  3WA9 A;  3REL B;  1M18 A;  1P3G B;  2PYO B;  5DNN A;  5AV9 D;  3VH6 W;  5AV5 C;  3AZE D;  3R45 B;  3LZ0 A;  5DNM C;  2CWE A;  1WWS A; 
#chains in the Genus database with same CATH homology
 4WNN B;  5BNX A;  5B31 G;  1N1J A;  3V9R B;  3W98 C;  5CP6 B;  4Z66 D;  4H9P B;  5B1L C;  5B0Z A;  2CV5 D;  3AYW B;  4R8P B;  4J8U B;  4ZBJ C;  2Y2I A;  1U35 D;  3W99 B;  3WA9 B;  3UTA A;  1M18 B;  5CPJ C;  5CPK A;  4XZQ C;  3MVD A;  2L5A A;  5DNN B;  5AY8 A;  3AZH D;  3REI D;  1KX4 C;  2ZY2 A;  3AZG D;  3LZ0 B;  4J8X C;  4G92 C;  2F8N H;  4WU9 D;  1KX3 C;  3AZM C;  1M1A D;  5BNX B;  1N1J B;  2ZY5 A;  5AV6 A;  3A6N C;  5GT3 C;  1HQ3 C;  3UT9 D;  1BH8 A;  5B0Z B;  3REJ A;  2F8N A;  5B2J C;  4XUJ C;  1P3A A;  3TU4 C;  3UTA B;  3B6F C;  5B31 D;  3LJA A;  3AZF C;  4DQY B;  5CPK B;  3MVD B;  2ZY4 A;  5AY8 B;  3EPH A;  5AVB D;  2ZM5 A;  3MGQ C;  3X1T C;  4KGC A;  2FJ7 C;  3AZI D;  1ID3 C;  2HIO C;  5BT1 D;  4AWL B;  5E5A C;  1P3K C;  5AV6 B;  3AL0 C;  1F1E A;  5F99 A;  1BH8 B;  3REJ B;  2BG1 A;  3AZJ D;  2F8N B;  2NQB A;  1S32 D;  3MNN A;  3B0D C;  1P3A B;  4HGA C;  3LJA B;  3W96 A;  5AV9 C;  4X23 D;  3AZE C;  1P3M A;  4KGC B;  3UTB A;  3AZK D;  3KXB A;  3C1B A;  4KHA A;  1P3I C;  4NE5 A;  4Z66 C;  1P3F D;  3MGR D;  1P3B D;  4Z5T A;  1BFM A;  2CV5 C;  4JJN D;  3KSY A;  3WTP E;  5F99 B;  2Y2K A;  1U35 C;  2BYK A;  3REL D;  1P3G D;  1A7W A;  2NQB B;  3MNN B;  2PYO D;  1P3P A;  3B6G C;  4H9Q A;  3W96 B;  4E45 A;  2G5H C;  4UUZ A;  3AZG C;  1M19 A;  3VH5 W;  4WU9 C;  1P3M B;  1KX5 B;  4ZUX A;  2ARO A;  3UTB B;  1M1A C;  3LZ1 D;  3KXB B;  3REK A;  3C1B B;  5CP6 D;  4H9S A;  4KHA B;  1P34 A;  3UT9 C;  4Z5T B;  4R8P D;  3AN2 C;  3WA9 D;  2BYK B;  3X1S C;  1M18 D;  5B33 C;  2F8N K;  4QLC D;  1P3P B;  5DNN D;  4KUD A;  4H9Q B;  5B40 D;  4G91 C;  3C1C A;  3LZ0 D;  4UUZ B;  5AVB C;  1M19 B;  2F8N G;  3NQJ A;  3AZI C;  5BT1 C;  4ZUX B;  2ARO B;  1AOI D;  4NE6 A;  3REK B;  4J8W C;  5B32 A;  5GXQ A;  2NZD D;  2Y2P A;  1P34 B;  3EPK A;  3WTP B;  4Z2M H;  1EQZ A;  3AZJ C;  1S32 C;  4LD9 C;  3UTA D;  5CPI A;  5GT0 C;  5CPK D;  3KFU G;  3AFA C;  4KUD B;  5AY8 D;  5GSU A;  3H0L C;  3C1C B;  3X1V A;  3EPJ A;  3NQJ B;  3AZL D;  1P3L B;  1F66 D;  4J8V A;  1P3F C;  5AV6 D;  5B32 B;  4JJN C;  3O62 A;  5GXQ B;  5AVC D;  3KUY C;  1EQZ B;  1P3A D;  2PYO C;  3W97 C;  3LJA D;  5CPI B;  4YM6 A;  5DNM A;  5GSU B;  5B1M C;  3X1V B;  4KGC D;  5B2I A;  3LZ1 C;  5B1L A;  5CP6 C;  3MGP C;  2Y2N A;  3EG5 B;  4J8V B;  3WAA C;  3REH D;  1Z2C B;  3O62 B;  5CPJ A;  1M18 C;  2HUE B;  5C3I B;  4QLC C;  5B40 C;  4J8X A;  4YM6 B;  3WKJ D;  2Y2J A;  1KX3 A;  1TZY D;  5DNM B;  3LZ0 C;  5JRG D;  3AZM A;  2UWX A;  4YS3 D;  2Y2H A;  4CAY A;  1P3M D;  1KX5 D;  5B24 C;  5B2I B;  5GT3 A;  3UTB D;  1AOI C;  4NFT A;  1HQ3 A;  5B1L B;  3C1B D;  4EO5 C;  2NZD C;  4ZBJ B;  5JA4 A;  4XUJ A;  5B2J A;  3X1U C;  1B6W A;  3AZF A;  5CPJ B;  3MGS D;  2YFV A;  1P3P D;  5B32 G;  5AY8 C;  4J8X B;  3MGQ A;  1KX3 B;  2FJ7 A;  1ID3 A;  3LEL D;  2HIO A;  1M19 D;  2LY8 A;  3AZM B;  5E5A A;  4CAY B;  3VH6 A;  3AZL C;  4AWL C;  5GT3 B;  1F66 C;  5AV6 C;  1P34 D;  2JCH A;  5JA4 B;  5B2J B;  4XUJ B;  5AVC C;  3WTP D;  5FUG A;  1ZLA D;  2ZY3 A;  3AZF B;  1P3A C;  3FDD A;  2YFV B;  3LJA C;  3AZE A;  5AV8 D;  5BS7 C;  2W8S A;  3MGQ B;  1P3B C;  3C1C D;  2FJ7 B;  1ID3 B;  2JSS A;  2HIO B;  4DRB A;  4KGC C;  5E5A B;  3KWQ D;  1P3I A;  4Z66 A;  3AV1 A;  1P3L D;  2CV5 A;  5B32 D;  3REH C;  2IO5 C;  5GXQ D;  1EQZ D;  3B0D B;  4HGA B;  5FUG B;  3B6G A;  3AZH C;  5CPI D;  3REI C;  4WU8 A;  3AZE B;  3AZG A;  3WKJ C;  1TZY C;  5GSU D;  5JRG C;  1M1A A;  4YS3 C;  3X1V D;  2F2A C;  1KX5 C;  1P3I B;  4Z66 B;  2XD5 A;  3UT9 A;  3AV1 B;  3C1B C;  2CV5 B;  3AYW D;  3AN2 A;  4J8U D;  5BO0 A;  3W99 D;  3X1S A;  3O62 D;  3AZN A;  5B31 C;  3MGS C;  5B33 A;  3B6G B;  4WU8 B;  5AVB A;  4YM6 D;  3AZG B;  3LEL C;  1M1A B;  5B0Y A;  5B2I D;  4J8W A;  4UPK A;  3UT9 B;  5B1L D;  2YFW A;  4H9S C;  4DRA A;  1BH9 A;  5B0Z D;  3AN2 B;  5BO0 B;  3WTP C;  4LD9 A;  3X1S B;  5G49 A;  3AZN B;  1ZLA C;  5CPJ D;  1PZR A;  1R4V A;  5GT0 A;  3AV2 A;  5B33 B;  3MVD D;  4X23 C;  3AFA A;  4G91 B;  5AV8 C;  5AVB B;  3AZK C;  4E44 A;  1P3O A;  4CSR A;  3AZM D;  5B0Y B;  3KWQ C;  1P3F A;  4J8W B;  3MGR C;  5GT3 D;  1P3L C;  4JJN A;  3VH5 A;  3KUY A;  5B32 C;  2YFW B;  3REJ D;  1BH9 B;  3REL C;  2F8N D;  2RVQ D;  4XUJ D;  1P3G C;  1EQZ C;  4LD9 B;  5G49 B;  3W97 A;  1WWI A;  5AV5 A;  5GT0 B;  3AZF D;  3AV2 B;  3AFA B;  5CPI C;  1JFI A;  5B1M A;  3W98 A;  3VH6 T;  2FJ7 D;  3LZ1 A;  3X1V C;  1ID3 D;  1P3O B;  4CSR B;  5E5A D;  3MGP A;  1P3F B;  3WAA A;  3EPL A;  4JJN B;  3AYW C;  4R8P C;  2G5I C;  5F99 D;  3KUY B;  4J8U C;  3IP4 C;  3W99 C;  3O62 C;  3WA9 C;  4XZQ A;  1T3U A;  2NQB D;  3MNN D;  4QLC A;  3W97 B;  5DNN C;  5AV5 B;  1KX4 A;  1HTA A;  5B40 A;  3W96 D;  2HUE C;  5C3I C;  4YM6 C;  1JFI B;  5B1M B;  3W98 B;  5B24 A;  3A1I A;  3A6N A;  1AOI A;  3LZ1 B;  3KXB D;  5B2I C;  1P3I D;  3MGP B;  2NZD A;  3AV1 D;  2J8P A;  3WAA B;  4Z5T D;  3X1U A;  5B0Z C;  3TU4 A;  3B6F A;  2FFF B;  4XZQ B;  3UTA C;  5CPK C;  4QLC B;  3MVD C;  3B6G D;  1KX4 B;  5B40 B;  4G92 B;  3X1T A;  4WU8 D;  4NE3 A;  1P3K A;  3F6T A;  1H3O A;  5B24 B;  3AZL A;  4ZUX D;  2ARO D;  3A6N B;  1AOI B;  1F66 A;  1HQ3 B;  3REK D;  4EO5 B;  2NZD B;  4H9N A;  1B67 A;  5AVC A;  3X1U B;  3REJ C;  3TU4 B;  4Z2M G;  3AN2 D;  3H0M C;  4H9O A;  3B6F B;  2RVQ C;  3X1S D;  2BYM A;  5AV9 A;  3AZN D;  5B33 D;  4KUD D;  5BS7 A;  1P3B A;  3X1T B;  1P3K B;  1H3O B;  3AZL B;  5B0Y D;  1F66 B;  4J8W D;  1W2E A;  3REH A;  1U35 A;  5F99 C;  4H9N B;  5AVC B;  1Q9C A;  4H9O B;  2NQB C;  4LD9 D;  3MNN C;  4M6B A;  2BYM B;  2JE5 A;  5AV9 B;  3AZH A;  5KDM A;  5GT0 D;  3REI A;  3AV2 D;  3W96 C;  3B0C T;  1ULY A;  3WKJ A;  2Y2M A;  3AFA D;  4WU9 A;  1TZY A;  1P3B B;  5JRG A;  4YS3 A;  4WZS B;  1KX5 A;  1P3M C;  3NQU A;  3UTB C;  1P3O D;  3VH5 T;  1TAF A;  3KXB C;  4J8V D;  3AV1 C;  4Z5T C;  3REH B;  2IO5 B;  1U35 B;  4WV4 B;  3KUY D;  5B31 A;  3MGS A;  5CHL B;  3B0C W;  4H9R A;  2DF4 C;  3W97 D;  3AZH B;  5KDM B;  1P3P C;  5AV5 D;  3REI B;  4WJ3 C;  3WKJ B;  4WU9 B;  1TZY B;  5DNM D;  3LEL A;  3A1K A;  3AZI A;  2Y2O A;  2XD1 A;  5B1M D;  2RIQ A;  5JRG B;  4WU8 C;  2Y2Q A;  4YS3 B;  1M19 C;  3W98 D;  3NQU B;  2ARO C;  4ZUX C;  1TAF B;  3REK C;  3MGP D;  2Y2L A;  1KU5 A;  3AZJ A;  1P34 C;  3WAA D;  5BNV A;  3H0R C;  2Y2G A;  3WTP A;  1S32 A;  1ZLA A;  5B31 B;  2DQN C;  3MGS B;  4XZQ D;  4X23 A;  3AZN C;  4H9R B;  5AV8 A;  1KX4 D;  4KUD C;  4J8X D;  1KX3 D;  3AZK A;  3C1C C;  2VQR A;  3LEL B;  3AZI B;  3KWQ A;  5B24 D;  3MGR A;  1P3L A;  3A6N D;  5B0Y C;  1HQ3 D;  5GXQ C;  3REL A;  3AZJ B;  3X1U D;  5B2J D;  1P3G A;  5BNV B;  3TU4 D;  1S32 B;  2PYO A;  3B6F D;  1ZLA B;  3P5J B;  4X23 B;  3AV2 C;  3R45 A;  5AV8 B;  5GSU C;  3X1T D;  4WNN A;  3MGQ D;  3AZK B;  3V9R A;  2HIO D;  5CP6 A;  3KWQ B;  1P3K D;  1P3O C;  3MGR B;  4H9P A;  3AYW A;  4R8P A;  4J8V C;  4J8U A;  3B0B A;  3W99 A;  3WA9 A;  3REL B;  1M18 A;  1P3G B;  2PYO B;  5DNN A;  5AV9 D;  3VH6 W;  5AV5 C;  3AZE D;  3R45 B;  3LZ0 A;  5DNM C;  2CWE A;  1WWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...