3V9RB

Crystal structure of saccharomyces cerevisiae mhf complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
73
Chain Sequence
MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDILSHQDLERIVGLLLMDMLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YOL086W-A
publication title Saccharomyces Cerevisiae MHF Complex Structurally Resembles the Histones (H3-H4)(2) Heterotetramer and Functions as a Heterotetramer
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 16
structure length 73
sequence length 84
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09415 CENP-X CENP-S associating Centromere protein X
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3v9rB00
1M1AA 5B40D 5B0YD 3VH5W 3AZJD 1B67A 2BYMB 1M18C 1P3AC 2AROC 4J8XC 1M18A 2AROA 5AV9D 4G92B 4J8XA 4X23C 5DNMC 5AVBD 4Z5TB 3W99B 5DNMA 4XZQB 1KX4D 1HTAA 1P3GC 4WU9D 4LD9C 4J8VB 1HQ3D 4LD9A 5B40B 5B0YB 2BYKB 4E44A 3AZJB 1AOID 5B32C 1S32C 5AV9B 3LJAA 5B32A 1P34A 4R8PC 5AVBB 2HIOA 3NQJA 3REKD 4R8PA 4WU9B 3B6FA 3MGRC 1P3AD 1HQ3B 5CPKC 5AV6C 1KU5A 1EQZC 4X23D 5CPKA 3WTPC 1AOIB 5GT3C 3MGQA 1EQZA 1P3GD 3VH6A 1N1JA 1P3FB 5GT3A 5B2IA 3LELA 3AZMB 5B1LC 3REKB 1JFIA 5B2JA 5B1LA 4CAYB 5B1MD 1ID3C 3X1TC 3O62D 1S32D 1ID3A 3X1TA 4X23B 4J8UD 3AV2D 5BNXA 3MNNA 1P3GB 3AZHC 3REJC 3MGRD 5BNVB 3AZHA 3AV1D 5AV6D 3W98C 5B1MB 5AY8D 4DRBA 3O62B 1P3OC 1S32B 1KX5C 3MGSA 3B0BA 1P3OA 1P3IC 1KX5A 3W96C 4J8UB 3AV2B 3C1CA 3W96A 1A7WA 1TZYC 3MGRB 5AVCD 3AV1B 1P3BC 1KX3C 2NQBC 5AY8B 1P3BA 4QLCA 1KX3A 4J8WD 3VH6W 5B31G 1TAFA 3REJD 3AZEC 5F99C 3WTPE 3AZEA 1P3MA 3AZGC 3LZ0A 3REHC 3AZGA 5AVCB 3REIA 2F8ND 3R45B 4YM6C 4Z2MG 3WA9C 3AZLA 4YM6A 3KUYD 3C1BD 4J8WB 1TZYD 1U35C 3REJB 4EO5B 1U35A 3WKJA 4Z66D 1P3KA 1BH8A 4ZUXD 1BH9A 2NQBD 5C3IB 5CPJA 3TU4C 4KGCC 3X1SA 5GT0C 4KUDC 4H9QB 5JA4A 5GT0A 3KUYB 5AV5A 3UT9A 4KUDA 3C1BB 3REHD 1TZYB 3LZ1D 4Z66B 4M6BA 5DNND 3WA9D 3V9RB 4ZUXB 2BYMA 2PYOD 4KHAB 4WU8D 4XUJD 2RVQD 3AZKD 4H9NB 2CV5D 5B0ZD 2YFVA 4XZQA 1ULYA 3REHB 1H3OB 3LZ1B 3AFAD 4J8VA 4ZBJB 5FUGB 5DNNB 3TU4D 5B0YA 3AZND 3WA9B 1F66D 2PYOB 4WU8B 5CHLB 4XUJB 4JJNA 5AV9A 4E45A 3A6NC 3AZKB 4G91B 4WV4B 2CV5B 5B0ZB 5AVBA 3A6NA 3UTBD 2HUEC 4CSRA 5B24D 3AFAB 4WNNA 1HQ3A 3AZIC 3KXBB 5GXQC 3TU4B 3AZIA 3AZNB 5GXQA 1F66B 4AWLC 1AOIA 3WAAD 5AV8D 3LJAC 1P3FA 1P34C 1M1AD 2HIOC 3AZMA 3REKA 3UTBB 3B6FC 1ZLAA 1KX4B 4UUZA 5B24B 1Q9CA 5CPIC 1M18D 5B33C 2AROD 4H9OA 5E5AC 4J8XD 5CPIA 3MVDA 5B33A 5E5AA 3MGQC 5DNMD 2IO5B 3X1VA 3WAAB 5AV8B 5B2IC 3LELC 4H9RA 1M1AB 5BNVA 4NE3A 4LD9D 3NQUA 5B2JC 3B0CT 3AZFA 5B1MA 4H9SA 4YS3C 1M18B 4NFTA 2AROB 3LJAD 5KDMA 1P3AB 4J8XB 4YS3A 5B32D 1P34D 2HIOD 5DNMB 3AV2A 3MNNC 5CP6C 4R8PD 1M19C 3B6FD 3KWQA 5CP6A 1M19A 5B31C 4LD9B 3AV1A 2F8NH 5B31A 5CPKD 1P3LA 1EQZD 3MGQD 2FJ7C 3B6GC 3WTPD 3MGSC 5GT3D 3X1UA 3RELA 2FJ7A 5JRGC 5B2ID 5B32B 4H9PA 3LELD 3B6GA 3C1CC 5JRGA 3NQJB 4R8PB 5B2JD 3B6FB 5B1LD 5BT1C 1ID3D 3KSYA 1F1EA 3X1TD 3R45A 5CPKB 5AV6B 3AN2C 1EQZB 2LY8A 3AN2A 4QLCC 1N1JB 3WTPB 5GT3B 2NZDC 5B2IB 3LELB 3AZHD 2NZDA 1P3MC 5B2JB 3LZ0C 5B1LB 3W98D 3MGPC 3UTAC 3REIC 1P3PC 3MGSD 1ID3B 3X1TB 3MGPA 1P3OD 1KX5D 2YFWA 3UTAA 3AYWA 3AZLC 1P3PA 3C1CD 5G49A 5BNXB 1P3ID 3W97C 5BO0A 3W96D 3W97A 2L5AA 3WKJC 1P3KC 3AZHB 3W98B 1P3BD 3B0DC 4QLCD 5CPJC 1KX3D 3MGSB 5GSUA 3X1SC 1P3OB 1KX5B 2F8NB 3C1CB 5AV5C 3UT9C 3AZED 1P3IB 5F99D 3W96B 1P3MD 4HGAC 3AZGD 5FUGA 3REID 4NE6A 3AZLD 4YM6D 1P3BB 2CWEA 1KX3B 4G92C 2NQBB 3AZKA 4Z5TC 1U35D 1P3KD 4XZQC 3AZEB 4Z5TA 5F99B 3W99A 4J8VC 3AZGB 3KXBA 5CPJD 3REIB 5B0YC 3X1SD 3AZJC 5B40A 3AZLB 1F66A 4YM6B 4KGCD 5GT0D 2BYKA 3AZJA 5BS7A 3UT9D 4KUDD 4JJNC 5AV9C 5AVBC 1U35B 1P3KB 1BH8B 4WU9C 1KX4A 4DRAA 4WU9A 1HQ3C 5CPJB 4NE5A 1AOIC 5JA4B 4KGCB 5GT0B 1B6WA 4KUDB 1P3FC 5AV8A 3AZMC 3REKC 1ZLAC 4CAYA 4JJND 1P3AA 3MVDC 3A6ND 2YFVB 4X23A 3X1VC 1P3GA 1WWSA 2JSSA 3AZID 3AZFC 5GXQD 5B1MC 4H9SC 3O62C 4JJNB 1P3FD 3O62A 1S32A 3A6NB 4J8UC 3AZMD 3AV2C 4J8UA 3KWQC 1ZLAD 1WWIA 4CSRB 4WNNB 2HUEB 3AV1C 3MGRA 5CPID 3AZIB 1P3LC 3MVDD 5GXQB 4Z2MH 5B33D 5AV6A 5E5AD 5AY8C 3X1VD 3X1UC 4AWLB 3WTPA 3RELC 5AY8A 3LJAB 4WZSB 1P34B 1BFMA 2HIOB 3AZFD 1ZLAB 4UUZB 3VH6T 5AVCC 4H9OB 5B32G 5CPIB 4YS3D 5AVCA 3MVDB 5B33B 5E5AB 2F8NK 3X1VB 3MGQB 3KWQD 4J8WC 3MNND 5CP6D 3B0CW 4H9RB 1M19D 4EO5C 4J8WA 3NQUB 3REJA 5B31D 1P3LD 3AZFB 1JFIB 3W98A 5C3IC 3X1UD 3RELD 2FJ7D 5KDMB 4YS3B 3B6GD 3AYWC 2F8NA 5JRGD 3KUYC 1P3IA 4H9QA 3C1BC 3KWQB 3MNNB 5CP6B 3KUYA 3C1BA 1M19B 1TZYA 5BT1D 4Z66C 5B31B 1P3LB 4ZUXC 4Z66A 3V9RA 4ZUXA 3AN2D 3X1UB 3RELB 2FJ7B 4KHAA 5GSUC 2NQBA 4H9PB 3B6GB 4H9NA 5JRGB 2NZDD 5F99A 3LZ1C 4ZBJC 3LZ0D 3REHA 1H3OA 3LZ1A 5DNNC 3MGPD 2F8NG 3UTAD 3AYWD 1P3PD 3VH5A 5DNNA 3WA9A 2PYOC 3AN2B 4WU8C 4XUJC 2PYOA 2RVQC 3AZKC 4G91C 3W97D 4WU8A 2CV5C 5B0ZC 4XUJA 4QLCB 2NZDB 2CV5A 1TAFB 3VH5T 5B0ZA 3WKJD 3W99C 3AFAC 1P3MB 3LZ0B 3KXBC 3AFAA 5GSUD 3MGPB 3AZNC 2YFWB 3UTAB 5B40C 3AYWB 1P3PB 3TU4A 1R4VA 3AZNA 1F66C 5G49B 4KGCA 5BS7C 5BO0B 5AV5D 3W97B 3UTBC 3WKJB 1KX4C 3UTBA 5B24C 1BH9B 5B24A 5GSUB 3B0DB 3X1SB 2IO5C 3WAAC 4Z5TD 3W99D 5AV8C 4XZQD 5AV5B 3UT9B 3WAAA 1M1AC 4HGAB 3KXBD 4J8VD
chains in the Genus database with same CATH superfamily
1M1AA 5B40D 5B0YD 3VH5W 3AZJD 1B67A 2BYMB 1M18C 1P3AC 2AROC 2Y2HA 4J8XC 1M18A 2AROA 5AV9D 4G92B 4J8XA 4X23C 5DNMC 5AVBD 4Z5TB 3W99B 5DNMA 4XZQB 1KX4D 1HTAA 1P3GC 4WU9D 4LD9C 2Y2JA 4J8VB 1HQ3D 4LD9A 5B40B 5B0YB 3EG5B 2BYKB 4E44A 3AZJB 2ZY4A 1AOID 5B32C 1S32C 5AV9B 3LJAA 5B32A 1P34A 4R8PC 5AVBB 2HIOA 3NQJA 3REKD 4R8PA 2G5IC 4WU9B 3B6FA 2XD1A 3A1KA 3MGRC 1P3AD 1HQ3B 5CPKC 5AV6C 1KU5A 1EQZC 4X23D 5CPKA 3FDDA 3WTPC 1AOIB 5GT3C 3MGQA 1EQZA 1P3GD 3VH6A 1N1JA 1P3FB 5GT3A 5B2IA 4WJ3C 3LELA 3AZMB 5B1LC 3REKB 1JFIA 5B2JA 5B1LA 4CAYB 5B1MD 1ID3C 3X1TC 3O62D 1S32D 1ID3A 3X1TA 4X23B 4J8UD 3AV2D 5BNXA 3MNNA 1P3GB 3AZHC 2Y2KA 2J8PA 3MGRD 3REJC 5BNVB 3AZHA 3AV1D 5AV6D 3W98C 2Y2IA 5B1MB 5AY8D 4DRBA 3O62B 1P3OC 1S32B 1KX5C 3MGSA 3B0BA 1P3OA 1P3IC 1KX5A 3W96C 4J8UB 3AV2B 3C1CA 3W96A 1A7WA 1TZYC 3MGRB 5AVCD 3AV1B 1W2EA 1P3BC 1KX3C 2NQBC 2ZY3A 5AY8B 1P3BA 4QLCA 1KX3A 4J8WD 3VH6W 5B31G 1TAFA 3REJD 3AZEC 5F99C 3WTPE 3AZEA 1P3MA 3AZGC 3LZ0A 3REHC 3AZGA 5AVCB 3REIA 2F8ND 3R45B 4YM6C 4Z2MG 3WA9C 3AZLA 4YM6A 3KUYD 3C1BD 4J8WB 1TZYD 1U35C 3REJB 4EO5B 1U35A 3WKJA 4Z66D 1P3KA 1BH8A 2ZM5A 4ZUXD 1BH9A 2NQBD 5C3IB 5CPJA 3TU4C 4KGCC 3X1SA 5GT0C 4KUDC 4H9QB 5JA4A 5GT0A 3KUYB 5AV5A 3UT9A 4KUDA 3C1BB 2Y2MA 3REHD 1TZYB 3LZ1D 4Z66B 4M6BA 5DNND 3WA9D 3V9RB 4ZUXB 2BYMA 2PYOD 4KHAB 4WU8D 4XUJD 2RVQD 3AZKD 4H9NB 2CV5D 5B0ZD 2YFVA 4XZQA 1ULYA 3REHB 1H3OB 3LZ1B 3AFAD 4J8VA 4ZBJB 5FUGB 2Y2OA 5DNNB 3TU4D 5B0YA 3AZND 3WA9B 1F66D 2PYOB 4WU8B 5CHLB 4XUJB 4JJNA 5AV9A 4E45A 3A6NC 3AZKB 4G91B 4WV4B 2CV5B 5B0ZB 5AVBA 3A6NA 3UTBD 2HUEC 4CSRA 5B24D 3AFAB 4WNNA 1HQ3A 3AZIC 3KXBB 5GXQC 3TU4B 3AZIA 3AZNB 5GXQA 1F66B 4AWLC 1AOIA 3WAAD 5AV8D 3LJAC 1P3FA 2DQNC 1P34C 1M1AD 2HIOC 3AZMA 3REKA 1Z2CB 3UTBB 3B6FC 1ZLAA 1KX4B 4UUZA 5B24B 1Q9CA 5CPIC 1M18D 5B33C 2AROD 4H9OA 5E5AC 4J8XD 5CPIA 3MVDA 5B33A 5E5AA 3MGQC 5DNMD 2IO5B 3X1VA 3WAAB 5AV8B 5B2IC 3LELC 4H9RA 1M1AB 5BNVA 4NE3A 4LD9D 3NQUA 5B2JC 3B0CT 3AZFA 5B1MA 4H9SA 4YS3C 1M18B 4NFTA 2AROB 3LJAD 5KDMA 1P3AB 4J8XB 4YS3A 5B32D 1P34D 2HIOD 5DNMB 3AV2A 3MNNC 5CP6C 4R8PD 1M19C 3B6FD 3KWQA 5CP6A 2W8SA 1M19A 5B31C 4LD9B 3AV1A 2F8NH 5B31A 5CPKD 1P3LA 3A1IA 1EQZD 3MGQD 2FJ7C 3B6GC 3WTPD 3MGSC 5GT3D 3X1UA 3RELA 2FJ7A 5JRGC 5B2ID 5B32B 4H9PA 3LELD 3B6GA 2UWXA 3C1CC 5JRGA 3NQJB 3F6TA 4R8PB 5B2JD 3B6FB 5B1LD 5BT1C 3KFUG 1ID3D 3KSYA 1F1EA 3X1TD 3R45A 5CPKB 2ZY2A 5AV6B 3AN2C 1EQZB 2LY8A 3AN2A 4QLCC 1N1JB 3WTPB 5GT3B 2NZDC 5B2IB 3LELB 3AZHD 2NZDA 1P3MC 5B2JB 3LZ0C 5B1LB 3W98D 3MGPC 3UTAC 3REIC 1P3PC 3MGSD 1ID3B 3X1TB 3MGPA 1P3OD 1KX5D 2YFWA 3UTAA 3AYWA 3AZLC 1P3PA 3C1CD 5G49A 5BNXB 1P3ID 3W97C 5BO0A 3W96D 2JCHA 3W97A 2L5AA 3WKJC 1P3KC 3AZHB 3W98B 2Y2PA 1P3BD 3B0DC 4QLCD 5CPJC 1KX3D 3MGSB 2ZY5A 5GSUA 3X1SC 1P3OB 2VQRA 1KX5B 2F8NB 3C1CB 5AV5C 3UT9C 3H0MC 3AZED 5F99D 1P3IB 1P3MD 3W96B 4HGAC 2FFFB 3AZGD 5FUGA 3REID 4NE6A 3AZLD 4YM6D 1P3BB 2CWEA 1KX3B 4G92C 2NQBB 3AZKA 4Z5TC 1U35D 1P3KD 4XZQC 3AZEB 4Z5TA 5F99B 3W99A 4J8VC 3AZGB 3KXBA 5CPJD 3REIB 5B0YC 3X1SD 3AZJC 5B40A 3AZLB 1F66A 4YM6B 4KGCD 5GT0D 2BYKA 3AZJA 5BS7A 3UT9D 4KUDD 4JJNC 5AV9C 3AL0C 5AVBC 1U35B 1P3KB 1BH8B 4WU9C 1KX4A 4DRAA 2XD5A 4WU9A 1HQ3C 5CPJB 4NE5A 2RIQA 1AOIC 5JA4B 4KGCB 5GT0B 1B6WA 4KUDB 4DQYB 1P3FC 5AV8A 3AZMC 3REKC 1ZLAC 4CAYA 4JJND 1P3AA 3MVDC 3A6ND 2YFVB 4X23A 3EPKA 3X1VC 1P3GA 1WWSA 2JSSA 3AZID 3AZFC 5GXQD 5B1MC 4H9SC 3O62C 4JJNB 1P3FD 3O62A 1S32A 3A6NB 4J8UC 2JE5A 3AZMD 3AV2C 4J8UA 3KWQC 1ZLAD 1WWIA 4CSRB 4WNNB 2HUEB 3AV1C 3MGRA 5CPID 3AZIB 1P3LC 3P5JB 3MVDD 5GXQB 4Z2MH 1PZRA 5B33D 5AV6A 5E5AD 5AY8C 3X1VD 3X1UC 4AWLB 3WTPA 3RELC 5AY8A 3LJAB 4WZSB 1P34B 1BFMA 2HIOB 3AZFD 1ZLAB 4UUZB 3VH6T 3EPJA 5AVCC 4H9OB 5B32G 5CPIB 4YS3D 5AVCA 3MVDB 5B33B 5E5AB 2F8NK 3X1VB 3MGQB 3KWQD 4J8WC 3MNND 5CP6D 3B0CW 4H9RB 1M19D 2Y2NA 4EO5C 4J8WA 3NQUB 2DF4C 3REJA 5B31D 1P3LD 3AZFB 1JFIB 3W98A 5C3IC 3X1UD 3RELD 2FJ7D 5KDMB 4YS3B 3B6GD 3AYWC 2F8NA 2Y2QA 5JRGD 3KUYC 1P3IA 4H9QA 3C1BC 3KWQB 3MNNB 5CP6B 3KUYA 3C1BA 1M19B 1TZYA 5BT1D 4Z66C 2BG1A 5B31B 1P3LB 4ZUXC 4Z66A 3V9RA 4ZUXA 3AN2D 2G5HC 3X1UB 3RELB 2FJ7B 4KHAA 5GSUC 2NQBA 2F2AC 4H9PB 3B6GB 4H9NA 5JRGB 2NZDD 5F99A 3LZ1C 4ZBJC 3LZ0D 3REHA 1H3OA 3LZ1A 5DNNC 3MGPD 2F8NG 3UTAD 3AYWD 1P3PD 3VH5A 5DNNA 3WA9A 2PYOC 3EPLA 3AN2B 4WU8C 4XUJC 2PYOA 2RVQC 3AZKC 4G91C 3W97D 4WU8A 2CV5C 5B0ZC 4XUJA 4QLCB 4UPKA 2NZDB 2CV5A 1TAFB 3VH5T 5B0ZA 3WKJD 3W99C 3H0LC 3AFAC 1P3MB 3LZ0B 3KXBC 2Y2LA 3AFAA 5GSUD 3MGPB 3AZNC 2YFWB 3UTAB 5B40C 3AYWB 1P3PB 3TU4A 1R4VA 3AZNA 1F66C 5G49B 4KGCA 5BS7C 3EPHA 5BO0B 5AV5D 3W97B 3UTBC 3WKJB 1KX4C 3UTBA 5B24C 1BH9B 5B24A 5GSUB 3B0DB 1T3UA 3X1SB 2IO5C 3IP4C 3WAAC 4Z5TD 3W99D 5AV8C 4XZQD 3H0RC 5AV5B 3UT9B 3WAAA 2Y2GA 1M1AC 4HGAB 3KXBD 4J8VD
chains in the Genus database with same CATH topology
1M1AA 5B40D 5B0YD 3VH5W 3AZJD 1B67A 2BYMB 1M18C 1P3AC 2AROC 2Y2HA 4J8XC 1M18A 2AROA 5AV9D 4G92B 4J8XA 4X23C 5DNMC 5AVBD 4Z5TB 3W99B 5DNMA 4XZQB 1KX4D 1HTAA 1P3GC 4WU9D 4LD9C 2Y2JA 4J8VB 1HQ3D 4LD9A 5B40B 5B0YB 3EG5B 2BYKB 4E44A 3AZJB 2ZY4A 1AOID 5B32C 1S32C 5AV9B 3LJAA 5B32A 1P34A 4R8PC 5AVBB 2HIOA 3NQJA 3REKD 4R8PA 2G5IC 4WU9B 3B6FA 2XD1A 3A1KA 3MGRC 1P3AD 1HQ3B 5CPKC 5AV6C 1KU5A 1EQZC 4X23D 5CPKA 3FDDA 3WTPC 1AOIB 5GT3C 3MGQA 1EQZA 1P3GD 3VH6A 1N1JA 1P3FB 5GT3A 5B2IA 4WJ3C 3LELA 3AZMB 5B1LC 3REKB 1JFIA 5B2JA 5B1LA 4CAYB 5B1MD 1ID3C 3X1TC 3O62D 1S32D 1ID3A 3X1TA 4X23B 4J8UD 3AV2D 5BNXA 3MNNA 1P3GB 3AZHC 2Y2KA 2J8PA 3MGRD 3REJC 5BNVB 3AZHA 3AV1D 5AV6D 3W98C 2Y2IA 5B1MB 5AY8D 4DRBA 3O62B 1P3OC 1S32B 1KX5C 3MGSA 3B0BA 1P3OA 1P3IC 1KX5A 3W96C 4J8UB 3AV2B 3C1CA 3W96A 1A7WA 1TZYC 3MGRB 5AVCD 3AV1B 1W2EA 1P3BC 1KX3C 2NQBC 2ZY3A 5AY8B 1P3BA 4QLCA 1KX3A 4J8WD 3VH6W 5B31G 1TAFA 3REJD 3AZEC 5F99C 3WTPE 3AZEA 1P3MA 3AZGC 3LZ0A 3REHC 3AZGA 5AVCB 3REIA 2F8ND 3R45B 4YM6C 4Z2MG 3WA9C 3AZLA 4YM6A 3KUYD 3C1BD 4J8WB 1TZYD 1U35C 3REJB 4EO5B 1U35A 3WKJA 4Z66D 1P3KA 1BH8A 2ZM5A 4ZUXD 1BH9A 2NQBD 5C3IB 5CPJA 3TU4C 4KGCC 3X1SA 5GT0C 4KUDC 4H9QB 5JA4A 5GT0A 3KUYB 5AV5A 3UT9A 4KUDA 3C1BB 2Y2MA 3REHD 1TZYB 3LZ1D 4Z66B 4M6BA 5DNND 3WA9D 3V9RB 4ZUXB 2BYMA 2PYOD 4KHAB 4WU8D 4XUJD 2RVQD 3AZKD 4H9NB 2CV5D 5B0ZD 2YFVA 4XZQA 1ULYA 3REHB 1H3OB 3LZ1B 3AFAD 4J8VA 4ZBJB 5FUGB 2Y2OA 5DNNB 3TU4D 5B0YA 3AZND 3WA9B 1F66D 2PYOB 4WU8B 5CHLB 4XUJB 4JJNA 5AV9A 4E45A 3A6NC 3AZKB 4G91B 4WV4B 2CV5B 5B0ZB 5AVBA 3A6NA 3UTBD 2HUEC 4CSRA 5B24D 3AFAB 4WNNA 1HQ3A 3AZIC 3KXBB 5GXQC 3TU4B 3AZIA 3AZNB 5GXQA 1F66B 4AWLC 1AOIA 3WAAD 5AV8D 3LJAC 1P3FA 2DQNC 1P34C 1M1AD 2HIOC 3AZMA 3REKA 1Z2CB 3UTBB 3B6FC 1ZLAA 1KX4B 4UUZA 5B24B 1Q9CA 5CPIC 1M18D 5B33C 2AROD 4H9OA 5E5AC 4J8XD 5CPIA 3MVDA 5B33A 5E5AA 3MGQC 5DNMD 2IO5B 3X1VA 3WAAB 5AV8B 5B2IC 3LELC 4H9RA 1M1AB 5BNVA 4NE3A 4LD9D 3NQUA 5B2JC 3B0CT 3AZFA 5B1MA 4H9SA 4YS3C 1M18B 4NFTA 2AROB 3LJAD 5KDMA 1P3AB 4J8XB 4YS3A 5B32D 1P34D 2HIOD 5DNMB 3AV2A 3MNNC 5CP6C 4R8PD 1M19C 3B6FD 3KWQA 5CP6A 2W8SA 1M19A 5B31C 4LD9B 3AV1A 2F8NH 5B31A 5CPKD 1P3LA 3A1IA 1EQZD 3MGQD 2FJ7C 3B6GC 3WTPD 3MGSC 5GT3D 3X1UA 3RELA 2FJ7A 5JRGC 5B2ID 5B32B 4H9PA 3LELD 3B6GA 2UWXA 3C1CC 5JRGA 3NQJB 3F6TA 4R8PB 5B2JD 3B6FB 5B1LD 5BT1C 3KFUG 1ID3D 3KSYA 1F1EA 3X1TD 3R45A 5CPKB 2ZY2A 5AV6B 3AN2C 1EQZB 2LY8A 3AN2A 4QLCC 1N1JB 3WTPB 5GT3B 2NZDC 5B2IB 3LELB 3AZHD 2NZDA 1P3MC 5B2JB 3LZ0C 5B1LB 3W98D 3MGPC 3UTAC 3REIC 1P3PC 3MGSD 1ID3B 3X1TB 3MGPA 1P3OD 1KX5D 2YFWA 3UTAA 3AYWA 3AZLC 1P3PA 3C1CD 5G49A 5BNXB 1P3ID 3W97C 5BO0A 3W96D 2JCHA 3W97A 2L5AA 3WKJC 1P3KC 3AZHB 3W98B 2Y2PA 1P3BD 3B0DC 4QLCD 5CPJC 1KX3D 3MGSB 2ZY5A 5GSUA 3X1SC 1P3OB 2VQRA 1KX5B 2F8NB 3C1CB 5AV5C 3UT9C 3H0MC 3AZED 5F99D 1P3IB 1P3MD 3W96B 4HGAC 2FFFB 3AZGD 5FUGA 3REID 4NE6A 3AZLD 4YM6D 1P3BB 2CWEA 1KX3B 4G92C 2NQBB 3AZKA 4Z5TC 1U35D 1P3KD 4XZQC 3AZEB 4Z5TA 5F99B 3W99A 4J8VC 3AZGB 3KXBA 5CPJD 3REIB 5B0YC 3X1SD 3AZJC 5B40A 3AZLB 1F66A 4YM6B 4KGCD 5GT0D 2BYKA 3AZJA 5BS7A 3UT9D 4KUDD 4JJNC 5AV9C 3AL0C 5AVBC 1U35B 1P3KB 1BH8B 4WU9C 1KX4A 4DRAA 2XD5A 4WU9A 1HQ3C 5CPJB 4NE5A 2RIQA 1AOIC 5JA4B 4KGCB 5GT0B 1B6WA 4KUDB 4DQYB 1P3FC 5AV8A 3AZMC 3REKC 1ZLAC 4CAYA 4JJND 1P3AA 3MVDC 3A6ND 2YFVB 4X23A 3EPKA 3X1VC 1P3GA 1WWSA 2JSSA 3AZID 3AZFC 5GXQD 5B1MC 4H9SC 3O62C 4JJNB 1P3FD 3O62A 1S32A 3A6NB 4J8UC 2JE5A 3AZMD 3AV2C 4J8UA 3KWQC 1ZLAD 1WWIA 4CSRB 4WNNB 2HUEB 3AV1C 3MGRA 5CPID 3AZIB 1P3LC 3P5JB 3MVDD 5GXQB 4Z2MH 1PZRA 5B33D 5AV6A 5E5AD 5AY8C 3X1VD 3X1UC 4AWLB 3WTPA 3RELC 5AY8A 3LJAB 4WZSB 1P34B 1BFMA 2HIOB 3AZFD 1ZLAB 4UUZB 3VH6T 3EPJA 5AVCC 4H9OB 5B32G 5CPIB 4YS3D 5AVCA 3MVDB 5B33B 5E5AB 2F8NK 3X1VB 3MGQB 3KWQD 4J8WC 3MNND 5CP6D 3B0CW 4H9RB 1M19D 2Y2NA 4EO5C 4J8WA 3NQUB 2DF4C 3REJA 5B31D 1P3LD 3AZFB 1JFIB 3W98A 5C3IC 3X1UD 3RELD 2FJ7D 5KDMB 4YS3B 3B6GD 3AYWC 2F8NA 2Y2QA 5JRGD 3KUYC 1P3IA 4H9QA 3C1BC 3KWQB 3MNNB 5CP6B 3KUYA 3C1BA 1M19B 1TZYA 5BT1D 4Z66C 2BG1A 5B31B 1P3LB 4ZUXC 4Z66A 3V9RA 4ZUXA 3AN2D 2G5HC 3X1UB 3RELB 2FJ7B 4KHAA 5GSUC 2NQBA 2F2AC 4H9PB 3B6GB 4H9NA 5JRGB 2NZDD 5F99A 3LZ1C 4ZBJC 3LZ0D 3REHA 1H3OA 3LZ1A 5DNNC 3MGPD 2F8NG 3UTAD 3AYWD 1P3PD 3VH5A 5DNNA 3WA9A 2PYOC 3EPLA 3AN2B 4WU8C 4XUJC 2PYOA 2RVQC 3AZKC 4G91C 3W97D 4WU8A 2CV5C 5B0ZC 4XUJA 4QLCB 4UPKA 2NZDB 2CV5A 1TAFB 3VH5T 5B0ZA 3WKJD 3W99C 3H0LC 3AFAC 1P3MB 3LZ0B 3KXBC 2Y2LA 3AFAA 5GSUD 3MGPB 3AZNC 2YFWB 3UTAB 5B40C 3AYWB 1P3PB 3TU4A 1R4VA 3AZNA 1F66C 5G49B 4KGCA 5BS7C 3EPHA 5BO0B 5AV5D 3W97B 3UTBC 3WKJB 1KX4C 3UTBA 5B24C 1BH9B 5B24A 5GSUB 3B0DB 1T3UA 3X1SB 2IO5C 3IP4C 3WAAC 4Z5TD 3W99D 5AV8C 4XZQD 3H0RC 5AV5B 3UT9B 3WAAA 2Y2GA 1M1AC 4HGAB 3KXBD 4J8VD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1A A;  5B40 D;  5B0Y D;  3VH5 W;  3AZJ D;  1B67 A;  2BYM B;  1M18 C;  1P3A C;  2ARO C;  4J8X C;  1M18 A;  2ARO A;  5AV9 D;  4G92 B;  4J8X A;  4X23 C;  5DNM C;  5AVB D;  4Z5T B;  3W99 B;  5DNM A;  4XZQ B;  1KX4 D;  1HTA A;  1P3G C;  4WU9 D;  4LD9 C;  4J8V B;  1HQ3 D;  4LD9 A;  5B40 B;  5B0Y B;  2BYK B;  4E44 A;  3AZJ B;  1AOI D;  5B32 C;  1S32 C;  5AV9 B;  3LJA A;  5B32 A;  1P34 A;  4R8P C;  5AVB B;  2HIO A;  3NQJ A;  3REK D;  4R8P A;  4WU9 B;  3B6F A;  3MGR C;  1P3A D;  1HQ3 B;  5CPK C;  5AV6 C;  1KU5 A;  1EQZ C;  4X23 D;  5CPK A;  3WTP C;  1AOI B;  5GT3 C;  3MGQ A;  1EQZ A;  1P3G D;  3VH6 A;  1N1J A;  1P3F B;  5GT3 A;  5B2I A;  3LEL A;  3AZM B;  5B1L C;  3REK B;  1JFI A;  5B2J A;  5B1L A;  4CAY B;  5B1M D;  1ID3 C;  3X1T C;  3O62 D;  1S32 D;  1ID3 A;  3X1T A;  4X23 B;  4J8U D;  3AV2 D;  5BNX A;  3MNN A;  1P3G B;  3AZH C;  3REJ C;  3MGR D;  5BNV B;  3AZH A;  3AV1 D;  5AV6 D;  3W98 C;  5B1M B;  5AY8 D;  4DRB A;  3O62 B;  1P3O C;  1S32 B;  1KX5 C;  3MGS A;  3B0B A;  1P3O A;  1P3I C;  1KX5 A;  3W96 C;  4J8U B;  3AV2 B;  3C1C A;  3W96 A;  1A7W A;  1TZY C;  3MGR B;  5AVC D;  3AV1 B;  1P3B C;  1KX3 C;  2NQB C;  5AY8 B;  1P3B A;  4QLC A;  1KX3 A;  4J8W D;  3VH6 W;  5B31 G;  1TAF A;  3REJ D;  3AZE C;  5F99 C;  3WTP E;  3AZE A;  1P3M A;  3AZG C;  3LZ0 A;  3REH C;  3AZG A;  5AVC B;  3REI A;  2F8N D;  3R45 B;  4YM6 C;  4Z2M G;  3WA9 C;  3AZL A;  4YM6 A;  3KUY D;  3C1B D;  4J8W B;  1TZY D;  1U35 C;  3REJ B;  4EO5 B;  1U35 A;  3WKJ A;  4Z66 D;  1P3K A;  1BH8 A;  4ZUX D;  1BH9 A;  2NQB D;  5C3I B;  5CPJ A;  3TU4 C;  4KGC C;  3X1S A;  5GT0 C;  4KUD C;  4H9Q B;  5JA4 A;  5GT0 A;  3KUY B;  5AV5 A;  3UT9 A;  4KUD A;  3C1B B;  3REH D;  1TZY B;  3LZ1 D;  4Z66 B;  4M6B A;  5DNN D;  3WA9 D;  3V9R B;  4ZUX B;  2BYM A;  2PYO D;  4KHA B;  4WU8 D;  4XUJ D;  2RVQ D;  3AZK D;  4H9N B;  2CV5 D;  5B0Z D;  2YFV A;  4XZQ A;  1ULY A;  3REH B;  1H3O B;  3LZ1 B;  3AFA D;  4J8V A;  4ZBJ B;  5FUG B;  5DNN B;  3TU4 D;  5B0Y A;  3AZN D;  3WA9 B;  1F66 D;  2PYO B;  4WU8 B;  5CHL B;  4XUJ B;  4JJN A;  5AV9 A;  4E45 A;  3A6N C;  3AZK B;  4G91 B;  4WV4 B;  2CV5 B;  5B0Z B;  5AVB A;  3A6N A;  3UTB D;  2HUE C;  4CSR A;  5B24 D;  3AFA B;  4WNN A;  1HQ3 A;  3AZI C;  3KXB B;  5GXQ C;  3TU4 B;  3AZI A;  3AZN B;  5GXQ A;  1F66 B;  4AWL C;  1AOI A;  3WAA D;  5AV8 D;  3LJA C;  1P3F A;  1P34 C;  1M1A D;  2HIO C;  3AZM A;  3REK A;  3UTB B;  3B6F C;  1ZLA A;  1KX4 B;  4UUZ A;  5B24 B;  1Q9C A;  5CPI C;  1M18 D;  5B33 C;  2ARO D;  4H9O A;  5E5A C;  4J8X D;  5CPI A;  3MVD A;  5B33 A;  5E5A A;  3MGQ C;  5DNM D;  2IO5 B;  3X1V A;  3WAA B;  5AV8 B;  5B2I C;  3LEL C;  4H9R A;  1M1A B;  5BNV A;  4NE3 A;  4LD9 D;  3NQU A;  5B2J C;  3B0C T;  3AZF A;  5B1M A;  4H9S A;  4YS3 C;  1M18 B;  4NFT A;  2ARO B;  3LJA D;  5KDM A;  1P3A B;  4J8X B;  4YS3 A;  5B32 D;  1P34 D;  2HIO D;  5DNM B;  3AV2 A;  3MNN C;  5CP6 C;  4R8P D;  1M19 C;  3B6F D;  3KWQ A;  5CP6 A;  1M19 A;  5B31 C;  4LD9 B;  3AV1 A;  2F8N H;  5B31 A;  5CPK D;  1P3L A;  1EQZ D;  3MGQ D;  2FJ7 C;  3B6G C;  3WTP D;  3MGS C;  5GT3 D;  3X1U A;  3REL A;  2FJ7 A;  5JRG C;  5B2I D;  5B32 B;  4H9P A;  3LEL D;  3B6G A;  3C1C C;  5JRG A;  3NQJ B;  4R8P B;  5B2J D;  3B6F B;  5B1L D;  5BT1 C;  1ID3 D;  3KSY A;  1F1E A;  3X1T D;  3R45 A;  5CPK B;  5AV6 B;  3AN2 C;  1EQZ B;  2LY8 A;  3AN2 A;  4QLC C;  1N1J B;  3WTP B;  5GT3 B;  2NZD C;  5B2I B;  3LEL B;  3AZH D;  2NZD A;  1P3M C;  5B2J B;  3LZ0 C;  5B1L B;  3W98 D;  3MGP C;  3UTA C;  3REI C;  1P3P C;  3MGS D;  1ID3 B;  3X1T B;  3MGP A;  1P3O D;  1KX5 D;  2YFW A;  3UTA A;  3AYW A;  3AZL C;  1P3P A;  3C1C D;  5G49 A;  5BNX B;  1P3I D;  3W97 C;  5BO0 A;  3W96 D;  3W97 A;  2L5A A;  3WKJ C;  1P3K C;  3AZH B;  3W98 B;  1P3B D;  3B0D C;  4QLC D;  5CPJ C;  1KX3 D;  3MGS B;  5GSU A;  3X1S C;  1P3O B;  1KX5 B;  2F8N B;  3C1C B;  5AV5 C;  3UT9 C;  3AZE D;  1P3I B;  5F99 D;  3W96 B;  1P3M D;  4HGA C;  3AZG D;  5FUG A;  3REI D;  4NE6 A;  3AZL D;  4YM6 D;  1P3B B;  2CWE A;  1KX3 B;  4G92 C;  2NQB B;  3AZK A;  4Z5T C;  1U35 D;  1P3K D;  4XZQ C;  3AZE B;  4Z5T A;  5F99 B;  3W99 A;  4J8V C;  3AZG B;  3KXB A;  5CPJ D;  3REI B;  5B0Y C;  3X1S D;  3AZJ C;  5B40 A;  3AZL B;  1F66 A;  4YM6 B;  4KGC D;  5GT0 D;  2BYK A;  3AZJ A;  5BS7 A;  3UT9 D;  4KUD D;  4JJN C;  5AV9 C;  5AVB C;  1U35 B;  1P3K B;  1BH8 B;  4WU9 C;  1KX4 A;  4DRA A;  4WU9 A;  1HQ3 C;  5CPJ B;  4NE5 A;  1AOI C;  5JA4 B;  4KGC B;  5GT0 B;  1B6W A;  4KUD B;  1P3F C;  5AV8 A;  3AZM C;  3REK C;  1ZLA C;  4CAY A;  4JJN D;  1P3A A;  3MVD C;  3A6N D;  2YFV B;  4X23 A;  3X1V C;  1P3G A;  1WWS A;  2JSS A;  3AZI D;  3AZF C;  5GXQ D;  5B1M C;  4H9S C;  3O62 C;  4JJN B;  1P3F D;  3O62 A;  1S32 A;  3A6N B;  4J8U C;  3AZM D;  3AV2 C;  4J8U A;  3KWQ C;  1ZLA D;  1WWI A;  4CSR B;  4WNN B;  2HUE B;  3AV1 C;  3MGR A;  5CPI D;  3AZI B;  1P3L C;  3MVD D;  5GXQ B;  4Z2M H;  5B33 D;  5AV6 A;  5E5A D;  5AY8 C;  3X1V D;  3X1U C;  4AWL B;  3WTP A;  3REL C;  5AY8 A;  3LJA B;  4WZS B;  1P34 B;  1BFM A;  2HIO B;  3AZF D;  1ZLA B;  4UUZ B;  3VH6 T;  5AVC C;  4H9O B;  5B32 G;  5CPI B;  4YS3 D;  5AVC A;  3MVD B;  5B33 B;  5E5A B;  2F8N K;  3X1V B;  3MGQ B;  3KWQ D;  4J8W C;  3MNN D;  5CP6 D;  3B0C W;  4H9R B;  1M19 D;  4EO5 C;  4J8W A;  3NQU B;  3REJ A;  5B31 D;  1P3L D;  3AZF B;  1JFI B;  3W98 A;  5C3I C;  3X1U D;  3REL D;  2FJ7 D;  5KDM B;  4YS3 B;  3B6G D;  3AYW C;  2F8N A;  5JRG D;  3KUY C;  1P3I A;  4H9Q A;  3C1B C;  3KWQ B;  3MNN B;  5CP6 B;  3KUY A;  3C1B A;  1M19 B;  1TZY A;  5BT1 D;  4Z66 C;  5B31 B;  1P3L B;  4ZUX C;  4Z66 A;  3V9R A;  4ZUX A;  3AN2 D;  3X1U B;  3REL B;  2FJ7 B;  4KHA A;  5GSU C;  2NQB A;  4H9P B;  3B6G B;  4H9N A;  5JRG B;  2NZD D;  5F99 A;  3LZ1 C;  4ZBJ C;  3LZ0 D;  3REH A;  1H3O A;  3LZ1 A;  5DNN C;  3MGP D;  2F8N G;  3UTA D;  3AYW D;  1P3P D;  3VH5 A;  5DNN A;  3WA9 A;  2PYO C;  3AN2 B;  4WU8 C;  4XUJ C;  2PYO A;  2RVQ C;  3AZK C;  4G91 C;  3W97 D;  4WU8 A;  2CV5 C;  5B0Z C;  4XUJ A;  4QLC B;  2NZD B;  2CV5 A;  1TAF B;  3VH5 T;  5B0Z A;  3WKJ D;  3W99 C;  3AFA C;  1P3M B;  3LZ0 B;  3KXB C;  3AFA A;  5GSU D;  3MGP B;  3AZN C;  2YFW B;  3UTA B;  5B40 C;  3AYW B;  1P3P B;  3TU4 A;  1R4V A;  3AZN A;  1F66 C;  5G49 B;  4KGC A;  5BS7 C;  5BO0 B;  5AV5 D;  3W97 B;  3UTB C;  3WKJ B;  1KX4 C;  3UTB A;  5B24 C;  1BH9 B;  5B24 A;  5GSU B;  3B0D B;  3X1S B;  2IO5 C;  3WAA C;  4Z5T D;  3W99 D;  5AV8 C;  4XZQ D;  5AV5 B;  3UT9 B;  3WAA A;  1M1A C;  4HGA B;  3KXB D;  4J8V D; 
#chains in the Genus database with same CATH topology
 1M1A A;  5B40 D;  5B0Y D;  3VH5 W;  3AZJ D;  1B67 A;  2BYM B;  1M18 C;  1P3A C;  2ARO C;  2Y2H A;  4J8X C;  1M18 A;  2ARO A;  5AV9 D;  4G92 B;  4J8X A;  4X23 C;  5DNM C;  5AVB D;  4Z5T B;  3W99 B;  5DNM A;  4XZQ B;  1KX4 D;  1HTA A;  1P3G C;  4WU9 D;  4LD9 C;  2Y2J A;  4J8V B;  1HQ3 D;  4LD9 A;  5B40 B;  5B0Y B;  3EG5 B;  2BYK B;  4E44 A;  3AZJ B;  2ZY4 A;  1AOI D;  5B32 C;  1S32 C;  5AV9 B;  3LJA A;  5B32 A;  1P34 A;  4R8P C;  5AVB B;  2HIO A;  3NQJ A;  3REK D;  4R8P A;  2G5I C;  4WU9 B;  3B6F A;  2XD1 A;  3A1K A;  3MGR C;  1P3A D;  1HQ3 B;  5CPK C;  5AV6 C;  1KU5 A;  1EQZ C;  4X23 D;  5CPK A;  3FDD A;  3WTP C;  1AOI B;  5GT3 C;  3MGQ A;  1EQZ A;  1P3G D;  3VH6 A;  1N1J A;  1P3F B;  5GT3 A;  5B2I A;  4WJ3 C;  3LEL A;  3AZM B;  5B1L C;  3REK B;  1JFI A;  5B2J A;  5B1L A;  4CAY B;  5B1M D;  1ID3 C;  3X1T C;  3O62 D;  1S32 D;  1ID3 A;  3X1T A;  4X23 B;  4J8U D;  3AV2 D;  5BNX A;  3MNN A;  1P3G B;  3AZH C;  2Y2K A;  2J8P A;  3MGR D;  3REJ C;  5BNV B;  3AZH A;  3AV1 D;  5AV6 D;  3W98 C;  2Y2I A;  5B1M B;  5AY8 D;  4DRB A;  3O62 B;  1P3O C;  1S32 B;  1KX5 C;  3MGS A;  3B0B A;  1P3O A;  1P3I C;  1KX5 A;  3W96 C;  4J8U B;  3AV2 B;  3C1C A;  3W96 A;  1A7W A;  1TZY C;  3MGR B;  5AVC D;  3AV1 B;  1W2E A;  1P3B C;  1KX3 C;  2NQB C;  2ZY3 A;  5AY8 B;  1P3B A;  4QLC A;  1KX3 A;  4J8W D;  3VH6 W;  5B31 G;  1TAF A;  3REJ D;  3AZE C;  5F99 C;  3WTP E;  3AZE A;  1P3M A;  3AZG C;  3LZ0 A;  3REH C;  3AZG A;  5AVC B;  3REI A;  2F8N D;  3R45 B;  4YM6 C;  4Z2M G;  3WA9 C;  3AZL A;  4YM6 A;  3KUY D;  3C1B D;  4J8W B;  1TZY D;  1U35 C;  3REJ B;  4EO5 B;  1U35 A;  3WKJ A;  4Z66 D;  1P3K A;  1BH8 A;  2ZM5 A;  4ZUX D;  1BH9 A;  2NQB D;  5C3I B;  5CPJ A;  3TU4 C;  4KGC C;  3X1S A;  5GT0 C;  4KUD C;  4H9Q B;  5JA4 A;  5GT0 A;  3KUY B;  5AV5 A;  3UT9 A;  4KUD A;  3C1B B;  2Y2M A;  3REH D;  1TZY B;  3LZ1 D;  4Z66 B;  4M6B A;  5DNN D;  3WA9 D;  3V9R B;  4ZUX B;  2BYM A;  2PYO D;  4KHA B;  4WU8 D;  4XUJ D;  2RVQ D;  3AZK D;  4H9N B;  2CV5 D;  5B0Z D;  2YFV A;  4XZQ A;  1ULY A;  3REH B;  1H3O B;  3LZ1 B;  3AFA D;  4J8V A;  4ZBJ B;  5FUG B;  2Y2O A;  5DNN B;  3TU4 D;  5B0Y A;  3AZN D;  3WA9 B;  1F66 D;  2PYO B;  4WU8 B;  5CHL B;  4XUJ B;  4JJN A;  5AV9 A;  4E45 A;  3A6N C;  3AZK B;  4G91 B;  4WV4 B;  2CV5 B;  5B0Z B;  5AVB A;  3A6N A;  3UTB D;  2HUE C;  4CSR A;  5B24 D;  3AFA B;  4WNN A;  1HQ3 A;  3AZI C;  3KXB B;  5GXQ C;  3TU4 B;  3AZI A;  3AZN B;  5GXQ A;  1F66 B;  4AWL C;  1AOI A;  3WAA D;  5AV8 D;  3LJA C;  1P3F A;  2DQN C;  1P34 C;  1M1A D;  2HIO C;  3AZM A;  3REK A;  1Z2C B;  3UTB B;  3B6F C;  1ZLA A;  1KX4 B;  4UUZ A;  5B24 B;  1Q9C A;  5CPI C;  1M18 D;  5B33 C;  2ARO D;  4H9O A;  5E5A C;  4J8X D;  5CPI A;  3MVD A;  5B33 A;  5E5A A;  3MGQ C;  5DNM D;  2IO5 B;  3X1V A;  3WAA B;  5AV8 B;  5B2I C;  3LEL C;  4H9R A;  1M1A B;  5BNV A;  4NE3 A;  4LD9 D;  3NQU A;  5B2J C;  3B0C T;  3AZF A;  5B1M A;  4H9S A;  4YS3 C;  1M18 B;  4NFT A;  2ARO B;  3LJA D;  5KDM A;  1P3A B;  4J8X B;  4YS3 A;  5B32 D;  1P34 D;  2HIO D;  5DNM B;  3AV2 A;  3MNN C;  5CP6 C;  4R8P D;  1M19 C;  3B6F D;  3KWQ A;  5CP6 A;  2W8S A;  1M19 A;  5B31 C;  4LD9 B;  3AV1 A;  2F8N H;  5B31 A;  5CPK D;  1P3L A;  3A1I A;  1EQZ D;  3MGQ D;  2FJ7 C;  3B6G C;  3WTP D;  3MGS C;  5GT3 D;  3X1U A;  3REL A;  2FJ7 A;  5JRG C;  5B2I D;  5B32 B;  4H9P A;  3LEL D;  3B6G A;  2UWX A;  3C1C C;  5JRG A;  3NQJ B;  3F6T A;  4R8P B;  5B2J D;  3B6F B;  5B1L D;  5BT1 C;  3KFU G;  1ID3 D;  3KSY A;  1F1E A;  3X1T D;  3R45 A;  5CPK B;  2ZY2 A;  5AV6 B;  3AN2 C;  1EQZ B;  2LY8 A;  3AN2 A;  4QLC C;  1N1J B;  3WTP B;  5GT3 B;  2NZD C;  5B2I B;  3LEL B;  3AZH D;  2NZD A;  1P3M C;  5B2J B;  3LZ0 C;  5B1L B;  3W98 D;  3MGP C;  3UTA C;  3REI C;  1P3P C;  3MGS D;  1ID3 B;  3X1T B;  3MGP A;  1P3O D;  1KX5 D;  2YFW A;  3UTA A;  3AYW A;  3AZL C;  1P3P A;  3C1C D;  5G49 A;  5BNX B;  1P3I D;  3W97 C;  5BO0 A;  3W96 D;  2JCH A;  3W97 A;  2L5A A;  3WKJ C;  1P3K C;  3AZH B;  3W98 B;  2Y2P A;  1P3B D;  3B0D C;  4QLC D;  5CPJ C;  1KX3 D;  3MGS B;  2ZY5 A;  5GSU A;  3X1S C;  1P3O B;  2VQR A;  1KX5 B;  2F8N B;  3C1C B;  5AV5 C;  3UT9 C;  3H0M C;  3AZE D;  5F99 D;  1P3I B;  1P3M D;  3W96 B;  4HGA C;  2FFF B;  3AZG D;  5FUG A;  3REI D;  4NE6 A;  3AZL D;  4YM6 D;  1P3B B;  2CWE A;  1KX3 B;  4G92 C;  2NQB B;  3AZK A;  4Z5T C;  1U35 D;  1P3K D;  4XZQ C;  3AZE B;  4Z5T A;  5F99 B;  3W99 A;  4J8V C;  3AZG B;  3KXB A;  5CPJ D;  3REI B;  5B0Y C;  3X1S D;  3AZJ C;  5B40 A;  3AZL B;  1F66 A;  4YM6 B;  4KGC D;  5GT0 D;  2BYK A;  3AZJ A;  5BS7 A;  3UT9 D;  4KUD D;  4JJN C;  5AV9 C;  3AL0 C;  5AVB C;  1U35 B;  1P3K B;  1BH8 B;  4WU9 C;  1KX4 A;  4DRA A;  2XD5 A;  4WU9 A;  1HQ3 C;  5CPJ B;  4NE5 A;  2RIQ A;  1AOI C;  5JA4 B;  4KGC B;  5GT0 B;  1B6W A;  4KUD B;  4DQY B;  1P3F C;  5AV8 A;  3AZM C;  3REK C;  1ZLA C;  4CAY A;  4JJN D;  1P3A A;  3MVD C;  3A6N D;  2YFV B;  4X23 A;  3EPK A;  3X1V C;  1P3G A;  1WWS A;  2JSS A;  3AZI D;  3AZF C;  5GXQ D;  5B1M C;  4H9S C;  3O62 C;  4JJN B;  1P3F D;  3O62 A;  1S32 A;  3A6N B;  4J8U C;  2JE5 A;  3AZM D;  3AV2 C;  4J8U A;  3KWQ C;  1ZLA D;  1WWI A;  4CSR B;  4WNN B;  2HUE B;  3AV1 C;  3MGR A;  5CPI D;  3AZI B;  1P3L C;  3P5J B;  3MVD D;  5GXQ B;  4Z2M H;  1PZR A;  5B33 D;  5AV6 A;  5E5A D;  5AY8 C;  3X1V D;  3X1U C;  4AWL B;  3WTP A;  3REL C;  5AY8 A;  3LJA B;  4WZS B;  1P34 B;  1BFM A;  2HIO B;  3AZF D;  1ZLA B;  4UUZ B;  3VH6 T;  3EPJ A;  5AVC C;  4H9O B;  5B32 G;  5CPI B;  4YS3 D;  5AVC A;  3MVD B;  5B33 B;  5E5A B;  2F8N K;  3X1V B;  3MGQ B;  3KWQ D;  4J8W C;  3MNN D;  5CP6 D;  3B0C W;  4H9R B;  1M19 D;  2Y2N A;  4EO5 C;  4J8W A;  3NQU B;  2DF4 C;  3REJ A;  5B31 D;  1P3L D;  3AZF B;  1JFI B;  3W98 A;  5C3I C;  3X1U D;  3REL D;  2FJ7 D;  5KDM B;  4YS3 B;  3B6G D;  3AYW C;  2F8N A;  2Y2Q A;  5JRG D;  3KUY C;  1P3I A;  4H9Q A;  3C1B C;  3KWQ B;  3MNN B;  5CP6 B;  3KUY A;  3C1B A;  1M19 B;  1TZY A;  5BT1 D;  4Z66 C;  2BG1 A;  5B31 B;  1P3L B;  4ZUX C;  4Z66 A;  3V9R A;  4ZUX A;  3AN2 D;  2G5H C;  3X1U B;  3REL B;  2FJ7 B;  4KHA A;  5GSU C;  2NQB A;  2F2A C;  4H9P B;  3B6G B;  4H9N A;  5JRG B;  2NZD D;  5F99 A;  3LZ1 C;  4ZBJ C;  3LZ0 D;  3REH A;  1H3O A;  3LZ1 A;  5DNN C;  3MGP D;  2F8N G;  3UTA D;  3AYW D;  1P3P D;  3VH5 A;  5DNN A;  3WA9 A;  2PYO C;  3EPL A;  3AN2 B;  4WU8 C;  4XUJ C;  2PYO A;  2RVQ C;  3AZK C;  4G91 C;  3W97 D;  4WU8 A;  2CV5 C;  5B0Z C;  4XUJ A;  4QLC B;  4UPK A;  2NZD B;  2CV5 A;  1TAF B;  3VH5 T;  5B0Z A;  3WKJ D;  3W99 C;  3H0L C;  3AFA C;  1P3M B;  3LZ0 B;  3KXB C;  2Y2L A;  3AFA A;  5GSU D;  3MGP B;  3AZN C;  2YFW B;  3UTA B;  5B40 C;  3AYW B;  1P3P B;  3TU4 A;  1R4V A;  3AZN A;  1F66 C;  5G49 B;  4KGC A;  5BS7 C;  3EPH A;  5BO0 B;  5AV5 D;  3W97 B;  3UTB C;  3WKJ B;  1KX4 C;  3UTB A;  5B24 C;  1BH9 B;  5B24 A;  5GSU B;  3B0D B;  1T3U A;  3X1S B;  2IO5 C;  3IP4 C;  3WAA C;  4Z5T D;  3W99 D;  5AV8 C;  4XZQ D;  3H0R C;  5AV5 B;  3UT9 B;  3WAA A;  2Y2G A;  1M1A C;  4HGA B;  3KXB D;  4J8V D; 
#chains in the Genus database with same CATH homology
 1M1A A;  5B40 D;  5B0Y D;  3VH5 W;  3AZJ D;  1B67 A;  2BYM B;  1M18 C;  1P3A C;  2ARO C;  2Y2H A;  4J8X C;  1M18 A;  2ARO A;  5AV9 D;  4G92 B;  4J8X A;  4X23 C;  5DNM C;  5AVB D;  4Z5T B;  3W99 B;  5DNM A;  4XZQ B;  1KX4 D;  1HTA A;  1P3G C;  4WU9 D;  4LD9 C;  2Y2J A;  4J8V B;  1HQ3 D;  4LD9 A;  5B40 B;  5B0Y B;  3EG5 B;  2BYK B;  4E44 A;  3AZJ B;  2ZY4 A;  1AOI D;  5B32 C;  1S32 C;  5AV9 B;  3LJA A;  5B32 A;  1P34 A;  4R8P C;  5AVB B;  2HIO A;  3NQJ A;  3REK D;  4R8P A;  2G5I C;  4WU9 B;  3B6F A;  2XD1 A;  3A1K A;  3MGR C;  1P3A D;  1HQ3 B;  5CPK C;  5AV6 C;  1KU5 A;  1EQZ C;  4X23 D;  5CPK A;  3FDD A;  3WTP C;  1AOI B;  5GT3 C;  3MGQ A;  1EQZ A;  1P3G D;  3VH6 A;  1N1J A;  1P3F B;  5GT3 A;  5B2I A;  4WJ3 C;  3LEL A;  3AZM B;  5B1L C;  3REK B;  1JFI A;  5B2J A;  5B1L A;  4CAY B;  5B1M D;  1ID3 C;  3X1T C;  3O62 D;  1S32 D;  1ID3 A;  3X1T A;  4X23 B;  4J8U D;  3AV2 D;  5BNX A;  3MNN A;  1P3G B;  3AZH C;  2Y2K A;  2J8P A;  3MGR D;  3REJ C;  5BNV B;  3AZH A;  3AV1 D;  5AV6 D;  3W98 C;  2Y2I A;  5B1M B;  5AY8 D;  4DRB A;  3O62 B;  1P3O C;  1S32 B;  1KX5 C;  3MGS A;  3B0B A;  1P3O A;  1P3I C;  1KX5 A;  3W96 C;  4J8U B;  3AV2 B;  3C1C A;  3W96 A;  1A7W A;  1TZY C;  3MGR B;  5AVC D;  3AV1 B;  1W2E A;  1P3B C;  1KX3 C;  2NQB C;  2ZY3 A;  5AY8 B;  1P3B A;  4QLC A;  1KX3 A;  4J8W D;  3VH6 W;  5B31 G;  1TAF A;  3REJ D;  3AZE C;  5F99 C;  3WTP E;  3AZE A;  1P3M A;  3AZG C;  3LZ0 A;  3REH C;  3AZG A;  5AVC B;  3REI A;  2F8N D;  3R45 B;  4YM6 C;  4Z2M G;  3WA9 C;  3AZL A;  4YM6 A;  3KUY D;  3C1B D;  4J8W B;  1TZY D;  1U35 C;  3REJ B;  4EO5 B;  1U35 A;  3WKJ A;  4Z66 D;  1P3K A;  1BH8 A;  2ZM5 A;  4ZUX D;  1BH9 A;  2NQB D;  5C3I B;  5CPJ A;  3TU4 C;  4KGC C;  3X1S A;  5GT0 C;  4KUD C;  4H9Q B;  5JA4 A;  5GT0 A;  3KUY B;  5AV5 A;  3UT9 A;  4KUD A;  3C1B B;  2Y2M A;  3REH D;  1TZY B;  3LZ1 D;  4Z66 B;  4M6B A;  5DNN D;  3WA9 D;  3V9R B;  4ZUX B;  2BYM A;  2PYO D;  4KHA B;  4WU8 D;  4XUJ D;  2RVQ D;  3AZK D;  4H9N B;  2CV5 D;  5B0Z D;  2YFV A;  4XZQ A;  1ULY A;  3REH B;  1H3O B;  3LZ1 B;  3AFA D;  4J8V A;  4ZBJ B;  5FUG B;  2Y2O A;  5DNN B;  3TU4 D;  5B0Y A;  3AZN D;  3WA9 B;  1F66 D;  2PYO B;  4WU8 B;  5CHL B;  4XUJ B;  4JJN A;  5AV9 A;  4E45 A;  3A6N C;  3AZK B;  4G91 B;  4WV4 B;  2CV5 B;  5B0Z B;  5AVB A;  3A6N A;  3UTB D;  2HUE C;  4CSR A;  5B24 D;  3AFA B;  4WNN A;  1HQ3 A;  3AZI C;  3KXB B;  5GXQ C;  3TU4 B;  3AZI A;  3AZN B;  5GXQ A;  1F66 B;  4AWL C;  1AOI A;  3WAA D;  5AV8 D;  3LJA C;  1P3F A;  2DQN C;  1P34 C;  1M1A D;  2HIO C;  3AZM A;  3REK A;  1Z2C B;  3UTB B;  3B6F C;  1ZLA A;  1KX4 B;  4UUZ A;  5B24 B;  1Q9C A;  5CPI C;  1M18 D;  5B33 C;  2ARO D;  4H9O A;  5E5A C;  4J8X D;  5CPI A;  3MVD A;  5B33 A;  5E5A A;  3MGQ C;  5DNM D;  2IO5 B;  3X1V A;  3WAA B;  5AV8 B;  5B2I C;  3LEL C;  4H9R A;  1M1A B;  5BNV A;  4NE3 A;  4LD9 D;  3NQU A;  5B2J C;  3B0C T;  3AZF A;  5B1M A;  4H9S A;  4YS3 C;  1M18 B;  4NFT A;  2ARO B;  3LJA D;  5KDM A;  1P3A B;  4J8X B;  4YS3 A;  5B32 D;  1P34 D;  2HIO D;  5DNM B;  3AV2 A;  3MNN C;  5CP6 C;  4R8P D;  1M19 C;  3B6F D;  3KWQ A;  5CP6 A;  2W8S A;  1M19 A;  5B31 C;  4LD9 B;  3AV1 A;  2F8N H;  5B31 A;  5CPK D;  1P3L A;  3A1I A;  1EQZ D;  3MGQ D;  2FJ7 C;  3B6G C;  3WTP D;  3MGS C;  5GT3 D;  3X1U A;  3REL A;  2FJ7 A;  5JRG C;  5B2I D;  5B32 B;  4H9P A;  3LEL D;  3B6G A;  2UWX A;  3C1C C;  5JRG A;  3NQJ B;  3F6T A;  4R8P B;  5B2J D;  3B6F B;  5B1L D;  5BT1 C;  3KFU G;  1ID3 D;  3KSY A;  1F1E A;  3X1T D;  3R45 A;  5CPK B;  2ZY2 A;  5AV6 B;  3AN2 C;  1EQZ B;  2LY8 A;  3AN2 A;  4QLC C;  1N1J B;  3WTP B;  5GT3 B;  2NZD C;  5B2I B;  3LEL B;  3AZH D;  2NZD A;  1P3M C;  5B2J B;  3LZ0 C;  5B1L B;  3W98 D;  3MGP C;  3UTA C;  3REI C;  1P3P C;  3MGS D;  1ID3 B;  3X1T B;  3MGP A;  1P3O D;  1KX5 D;  2YFW A;  3UTA A;  3AYW A;  3AZL C;  1P3P A;  3C1C D;  5G49 A;  5BNX B;  1P3I D;  3W97 C;  5BO0 A;  3W96 D;  2JCH A;  3W97 A;  2L5A A;  3WKJ C;  1P3K C;  3AZH B;  3W98 B;  2Y2P A;  1P3B D;  3B0D C;  4QLC D;  5CPJ C;  1KX3 D;  3MGS B;  2ZY5 A;  5GSU A;  3X1S C;  1P3O B;  2VQR A;  1KX5 B;  2F8N B;  3C1C B;  5AV5 C;  3UT9 C;  3H0M C;  3AZE D;  5F99 D;  1P3I B;  1P3M D;  3W96 B;  4HGA C;  2FFF B;  3AZG D;  5FUG A;  3REI D;  4NE6 A;  3AZL D;  4YM6 D;  1P3B B;  2CWE A;  1KX3 B;  4G92 C;  2NQB B;  3AZK A;  4Z5T C;  1U35 D;  1P3K D;  4XZQ C;  3AZE B;  4Z5T A;  5F99 B;  3W99 A;  4J8V C;  3AZG B;  3KXB A;  5CPJ D;  3REI B;  5B0Y C;  3X1S D;  3AZJ C;  5B40 A;  3AZL B;  1F66 A;  4YM6 B;  4KGC D;  5GT0 D;  2BYK A;  3AZJ A;  5BS7 A;  3UT9 D;  4KUD D;  4JJN C;  5AV9 C;  3AL0 C;  5AVB C;  1U35 B;  1P3K B;  1BH8 B;  4WU9 C;  1KX4 A;  4DRA A;  2XD5 A;  4WU9 A;  1HQ3 C;  5CPJ B;  4NE5 A;  2RIQ A;  1AOI C;  5JA4 B;  4KGC B;  5GT0 B;  1B6W A;  4KUD B;  4DQY B;  1P3F C;  5AV8 A;  3AZM C;  3REK C;  1ZLA C;  4CAY A;  4JJN D;  1P3A A;  3MVD C;  3A6N D;  2YFV B;  4X23 A;  3EPK A;  3X1V C;  1P3G A;  1WWS A;  2JSS A;  3AZI D;  3AZF C;  5GXQ D;  5B1M C;  4H9S C;  3O62 C;  4JJN B;  1P3F D;  3O62 A;  1S32 A;  3A6N B;  4J8U C;  2JE5 A;  3AZM D;  3AV2 C;  4J8U A;  3KWQ C;  1ZLA D;  1WWI A;  4CSR B;  4WNN B;  2HUE B;  3AV1 C;  3MGR A;  5CPI D;  3AZI B;  1P3L C;  3P5J B;  3MVD D;  5GXQ B;  4Z2M H;  1PZR A;  5B33 D;  5AV6 A;  5E5A D;  5AY8 C;  3X1V D;  3X1U C;  4AWL B;  3WTP A;  3REL C;  5AY8 A;  3LJA B;  4WZS B;  1P34 B;  1BFM A;  2HIO B;  3AZF D;  1ZLA B;  4UUZ B;  3VH6 T;  3EPJ A;  5AVC C;  4H9O B;  5B32 G;  5CPI B;  4YS3 D;  5AVC A;  3MVD B;  5B33 B;  5E5A B;  2F8N K;  3X1V B;  3MGQ B;  3KWQ D;  4J8W C;  3MNN D;  5CP6 D;  3B0C W;  4H9R B;  1M19 D;  2Y2N A;  4EO5 C;  4J8W A;  3NQU B;  2DF4 C;  3REJ A;  5B31 D;  1P3L D;  3AZF B;  1JFI B;  3W98 A;  5C3I C;  3X1U D;  3REL D;  2FJ7 D;  5KDM B;  4YS3 B;  3B6G D;  3AYW C;  2F8N A;  2Y2Q A;  5JRG D;  3KUY C;  1P3I A;  4H9Q A;  3C1B C;  3KWQ B;  3MNN B;  5CP6 B;  3KUY A;  3C1B A;  1M19 B;  1TZY A;  5BT1 D;  4Z66 C;  2BG1 A;  5B31 B;  1P3L B;  4ZUX C;  4Z66 A;  3V9R A;  4ZUX A;  3AN2 D;  2G5H C;  3X1U B;  3REL B;  2FJ7 B;  4KHA A;  5GSU C;  2NQB A;  2F2A C;  4H9P B;  3B6G B;  4H9N A;  5JRG B;  2NZD D;  5F99 A;  3LZ1 C;  4ZBJ C;  3LZ0 D;  3REH A;  1H3O A;  3LZ1 A;  5DNN C;  3MGP D;  2F8N G;  3UTA D;  3AYW D;  1P3P D;  3VH5 A;  5DNN A;  3WA9 A;  2PYO C;  3EPL A;  3AN2 B;  4WU8 C;  4XUJ C;  2PYO A;  2RVQ C;  3AZK C;  4G91 C;  3W97 D;  4WU8 A;  2CV5 C;  5B0Z C;  4XUJ A;  4QLC B;  4UPK A;  2NZD B;  2CV5 A;  1TAF B;  3VH5 T;  5B0Z A;  3WKJ D;  3W99 C;  3H0L C;  3AFA C;  1P3M B;  3LZ0 B;  3KXB C;  2Y2L A;  3AFA A;  5GSU D;  3MGP B;  3AZN C;  2YFW B;  3UTA B;  5B40 C;  3AYW B;  1P3P B;  3TU4 A;  1R4V A;  3AZN A;  1F66 C;  5G49 B;  4KGC A;  5BS7 C;  3EPH A;  5BO0 B;  5AV5 D;  3W97 B;  3UTB C;  3WKJ B;  1KX4 C;  3UTB A;  5B24 C;  1BH9 B;  5B24 A;  5GSU B;  3B0D B;  1T3U A;  3X1S B;  2IO5 C;  3IP4 C;  3WAA C;  4Z5T D;  3W99 D;  5AV8 C;  4XZQ D;  3H0R C;  5AV5 B;  3UT9 B;  3WAA A;  2Y2G A;  1M1A C;  4HGA B;  3KXB D;  4J8V D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...