3V9RB

Crystal structure of saccharomyces cerevisiae mhf complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
73
Chain Sequence
b'MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDILSHQDLERIVGLLLMDMLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YOL086W-A
molecule tags Dna binding protein
source organism Saccharomyces cerevisiae
publication title Saccharomyces Cerevisiae MHF Complex Structurally Resembles the Histones (H3-H4)(2) Heterotetramer and Functions as a Heterotetramer
pubmed doi rcsb
total genus 16
structure length 73
sequence length 84
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09415 CENP-X CENP-S associating Centromere protein X
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3v9rB00
5AY8B 5CPJC 3MGPA 3AZIA 3UTBA 1M1AC 4KUDD 4JJNB 1KX4A 2F8NB 4Z5TA 5JA4B 1P3KD 1P3FC 5B33C 3AZID 3B6GD 3AV2B 3O62D 3AZNB 3LZ0D 4UUZB 4XUJC 5B31A 4XZQD 3AZHA 1KX3D 5DNND 5AV9C 5AV6C 3KUYB 5AV5D 3X1UB 1KX5C 3AZHD 3AN2A 3REIA 3AZGC 2CWEA 5AVBB 3AFAD 4NE5A 1KX5A 3LELC 3W96B 4QLCA 3UTBB 3B6FC 2HUEC 3TU4D 3AZLD 4WZSB 3REHC 3AZHC 4XUJA 4WU9A 4H9PB 3W99A 4H9SA 4Z66A 3MGQB 5CPJB 1P34B 4ZUXC 5B0YD 4NE3A 3REIC 3B6GC 4J8XA 5C3IC 5B32D 1F1EA 4JJNC 1P3KC 3KUYD 3KWQB 5B33B 3AV2C 1HQ3C 4X23C 5E5AC 3AZMA 2FJ7D 2F8NH 3KWQC 5B32C 4JJND 4NFTA 1WWSA 5B2JA 3WA9D 1M19C 3W99B 1JFIB 3B0BA 3MGPC 5B40A 4Z66B 5CPJA 3A6ND 3KWQD 4CSRB 5B2JD 3WA9A 5DNMB 3A6NA 3KWQA 3W96A 1ZLAC 3MVDD 3WAAB 1H3OA 4WU8A 5JRGA 3REIB 5GT0C 3MGSA 5B0YC 5AV5C 1KX5D 5B31B 4HGAB 5B2JB 3C1BC 1M18A 4X23B 5B32G 3W99D 5GT3C 3B6FD 4YM6B 3LJAD 3C1CC 3RELA 3O62A 3AZNC 1ULYA 2CV5A 3W98B 4WNNA 3KUYC 5AV6D 3W97A 4Z2MH 3AYWA 1P3IA 3REID 4XZQC 1KX3C 2FJ7A 4ZBJB 5AY8D 2HIOA 5B1LC 5CP6C 1EQZA 3A6NB 1AOID 2FJ7C 2YFWB 3AZKB 1P3GD 4YM6A 4LD9A 5B33A 3WTPE 3AZGA 3UTAC 3V9RA 2PYOB 4Z66D 5B24A 4M6BA 2NQBB 3KSYA 2BYMB 4R8PB 1S32B 1F66D 4Z2MG 3KXBB 4J8WD 4KGCD 4E44A 3UT9D 5AV5A 5B32B 1BH9B 4J8UB 4KUDC 3X1SB 3WAAA 3MGQD 1KX4B 2F8NA 1AOIC 2AROB 5AV9B 3AYWB 4YS3D 3WAAD 5AV9D 4J8UC 4UUZA 3X1UC 3X1SC 4XUJD 3AZFD 4X23A 1B6WA 3W96D 3W97D 2AROC 4J8UD 5GSUD 4QLCD 5AV6B 1M1AD 3AZHB 5AV5B 4J8UA 3W98D 3O62B 3AZND 3AV2D 2L5AA 5GXQD 1AOIA 5BS7C 4J8WC 1P3BB 4WU9B 1U35B 3REJA 1P3IB 3LJAA 4CAYB 4JJNA 3REKC 3B6GA 1TZYA 3UTAA 4QLCB 1HQ3B 4KUDB 4EO5C 5B31D 3REJD 2NZDA 3AZFB 4NE6A 3AN2C 1P3AC 3B0DC 4H9SC 5B1MC 5KDMA 5AV6A 3LELD 3REKB 3LZ1D 3RELC 3REKD 3C1CA 5CP6B 5BO0A 5B1MB 3MNND 3TU4A 3AZLA 1U35A 5BT1D 4KGCB 5B0ZC 1TZYC 3MGPD 1JFIA 5AVCA 3O62C 3KXBD 3UTAB 4YS3A 5AV9A 3WA9B 4H9PA 5JRGC 4G92B 1P3OA 5KDMB 3MGSD 3AV1C 5DNNA 1M18C 5B2ID 5B0ZD 4CSRA 5JRGB 5GSUB 1P3PD 1F66A 4H9QA 4J8WA 3VH6T 5GXQA 1P3GB 4KGCA 3AZKD 1M18B 1BH8A 5B0YB 3RELD 4KHAA 4HGAC 2CV5D 3REJB 5B40B 3AZMC 5CPID 5G49B 3VH5W 4J8VC 3AZEC 3MVDC 1HQ3A 1P3MC 3X1VC 3UT9B 3AZGD 3AZFA 5AY8A 5BNXA 1EQZD 5AVCB 4E45A 4WU8D 3A6NC 3LJAB 2FJ7B 3NQJB 1P3GA 4LD9D 4WU8B 5B2IC 3X1VB 3W98A 4KUDA 3AV2A 5CP6A 3MNNA 3AV1D 3X1TB 5CPKA 2PYOC 1P3FD 2F8NG 4Z5TD 1P3KA 5AVCC 3WTPC 2NQBC 5B24C 1U35C 5CPKD 5B40D 5CPJD 5C3IB 3WKJB 4LD9C 4H9QB 3LZ1B 2BYKA 5B31G 5BO0B 3NQUA 1P3OC 2NZDD 1BH8B 5F99D 3LELA 4WNNB 3V9RB 3AZEB 2BYMA 4Z5TB 5JA4A 1Q9CA 4J8VD 5JRGD 3REHD 1P3OB 1P3LD 4ZUXB 3AZJC 4WU9D 4DRBA 3R45B 1P3BD 1A7WA 5BT1C 3B0CW 3AZGB 1P3AA 3NQJA 1KX4C 5B24B 1P3MD 3C1BA 3UTBC 1M1AA 1ID3D 3MNNB 3AZMD 2AROA 5F99B 4XUJB 5GT0A 3MGSC 5BNVA 5B2JC 5G49A 3AYWD 3WKJA 2HIOD 3UT9A 5CPKB 1TZYD 3UTBD 3NQUB 5E5AA 3WAAC 1P3AB 4CAYA 5B40C 3AZMB 5E5AD 1U35D 4R8PD 1S32D 3LZ1A 1R4VA 5B24D 1P3MB 4ZUXA 3UT9C 4XZQB 1KX3B 3W99C 5GT3D 1M19B 4ZBJC 3B0DB 1WWIA 3MGRD 3B6GB 3AFAA 3C1CB 4YS3C 3AZKC 4DRAA 3MGRA 5E5AB 5AVBC 1P3LB 3VH5A 1TAFB 2CV5B 3TU4C 3AZLC 1AOIB 1N1JA 3LELB 4H9RA 2HUEB 3W97B 4YS3B 5GT0B 5BNVB 1P3LC 5B31C 3TU4B 3WTPD 3AZLB 4XZQA 1KX3A 3C1BB 5GSUC 1P3PA 4G92C 1P3ID 1B67A 4R8PC 1S32C 4H9OA 3W97C 2IO5B 1ID3C 5GSUA 1P3PC 1F66B 3REKA 5GXQB 3REHA 4AWLB 1P3LA 1EQZC 4YM6D 4G91C 3VH6W 5DNNB 2HIOC 1M1AB 5B1MA 3AZJA 5CHLB 1P3IC 3AZIB 5AVCD 4AWLC 5CPIC 5AV8D 2PYOD 5B1MD 4R8PA 5AY8C 1S32A 1P3AD 2HIOB 3AZFC 3AN2B 5B0YA 4ZUXD 1P3MA 3C1BD 4WU8C 4J8XD 3MNNC 1KX4D 5F99C 5B2IA 1P3FA 2NZDC 2NQBA 3MGRC 2IO5C 4J8WB 1P3BC 3WKJD 3MGQA 5CPKC 1ID3B 3AN2D 1P3PB 1F66C 1M19A 1N1JB 5B1LB 4J8VA 4KHAB 1P34C 1KU5A 5DNNC 3W96C 3KXBA 3B6FB 5GT3B 1M19D 3LZ0C 2BYKB 2F8NK 1P3KB 1HTAA 3REHB 1P3OD 1BH9A 2F8ND 1TAFA 5FUGA 1H3OB 3MVDA 3AZEA 4H9RB 3MGQC 1P3BA 4WV4B 5B0ZA 4X23D 1P34D 3AZED 1TZYB 5CP6D 3AV1A 3AZJD 2NZDB 3X1TA 4H9OB 3AZJB 5DNMA 2JSSA 3B6FA 4H9NB 1BFMA 3RELB 1P3FB 5AVBD 3B0CT 5DNMD 5AV8B 5CPIA 1ZLAB 3X1VD 1HQ3D 4Z66C 5F99A 3LJAC 3C1CD 5B0ZB 4WU9C 5B2IB 5B1LA 5AV8C 5DNMC 2NQBD 2RVQD 3X1TC 3MGSB 4QLCC 1EQZB 5GT3A 4G91B 5B1LD 4YM6C 4J8VB 5B33D 3AZIC 3VH5T 3MVDB 2YFVA 2PYOA 5AV8A 5CPIB 2LY8A 1M18D 3AFAC 3W98C 3R45A 1P3GC 3AYWC 3LZ0A 1ID3A 5FUGB 4Z5TC 3KUYA 2AROD 3AFAB 2YFWA 3AZKA 2CV5C 3WTPA 3REJC 3WA9C 3X1SD 3AZNA 3X1UD 5BS7A 3MGRB 3VH6A 2RVQC 3X1TD 3AV1B 3X1SA 1ZLAA 2YFVB 3X1UA 5BNXB 3WKJC 4LD9B 3MGPB 3LZ1C 4H9NA 5AVBA 1ZLAD 4KGCC 3UTAD 1KX5B 3LZ0B 3X1VA 4J8XC 4EO5B 5B32A 3WTPB 3KXBC 5GT0D 1P34A 4J8XB 5GXQC
chains in the Genus database with same CATH superfamily
5AY8B 5CPJC 3MGPA 3AZIA 3UTBA 1M1AC 4KUDD 3H0LC 4JJNB 1KX4A 2F8NB 4Z5TA 5JA4B 1P3KD 1P3FC 5B33C 3AZID 3B6GD 3AV2B 3O62D 3AZNB 4UUZB 4XUJC 3LZ0D 5B31A 4XZQD 3AZHA 1KX3D 5DNND 5AV9C 5AV6C 3KUYB 5AV5D 3X1UB 1KX5C 3AZHD 3AN2A 3REIA 3AZGC 2CWEA 5AVBB 3AFAD 2Y2MA 4NE5A 1KX5A 3F6TA 3LELC 3W96B 4QLCA 3UTBB 3B6FC 2HUEC 3TU4D 3AZLD 4WZSB 3REHC 3AZHC 4XUJA 4WU9A 4H9PB 3W99A 4H9SA 4Z66A 3MGQB 5CPJB 1P34B 4ZUXC 5B0YD 4NE3A 2RIQA 3REIC 2XD5A 3B6GC 4J8XA 5C3IC 5B32D 1F1EA 4JJNC 1P3KC 3KUYD 3KWQB 5B33B 2DQNC 3AV2C 1HQ3C 4X23C 5E5AC 3AZMA 2FJ7D 2F8NH 3KWQC 5B32C 4JJND 4NFTA 3H0MC 1WWSA 5B2JA 3WA9D 1M19C 3W99B 1JFIB 3B0BA 3MGPC 5B40A 4Z66B 5CPJA 3A6ND 3KWQD 1PZRA 2DF4C 4CSRB 5B2JD 3WA9A 5DNMB 3A6NA 3KWQA 3W96A 1ZLAC 3MVDD 3WAAB 1H3OA 2Y2LA 4WU8A 5JRGA 3REIB 5GT0C 3MGSA 5B0YC 5AV5C 1KX5D 5B31B 4HGAB 5B2JB 3C1BC 1M18A 4X23B 5B32G 4UPKA 4WJ3C 3W99D 5GT3C 3B6FD 4YM6B 3LJAD 3C1CC 3EPJA 3RELA 3O62A 3AZNC 3A1KA 1ULYA 2CV5A 3W98B 4WNNA 3KUYC 5AV6D 3W97A 4Z2MH 3AYWA 1P3IA 3REID 4XZQC 1KX3C 2FJ7A 4ZBJB 5AY8D 2HIOA 5B1LC 5CP6C 1EQZA 3A6NB 1AOID 2FJ7C 2YFWB 3AZKB 1P3GD 4YM6A 4LD9A 5B33A 3WTPE 3AZGA 3UTAC 3V9RA 2PYOB 4Z66D 5B24A 4M6BA 2ZM5A 2NQBB 3KSYA 2BYMB 4R8PB 1S32B 1F66D 4Z2MG 3KXBB 4J8WD 4KGCD 4E44A 3UT9D 5AV5A 5B32B 1BH9B 4J8UB 4KUDC 3X1SB 3WAAA 3MGQD 1KX4B 2F8NA 2G5HC 3EPLA 2AROB 1AOIC 5AV9B 3AYWB 4YS3D 3WAAD 5AV9D 4J8UC 4UUZA 3X1UC 3X1SC 4XUJD 3AZFD 4X23A 1B6WA 3W96D 3W97D 2AROC 4J8UD 1W2EA 5GSUD 4QLCD 5AV6B 1M1AD 3AZHB 5AV5B 4J8UA 3W98D 3O62B 3AZND 3AV2D 2L5AA 5GXQD 1AOIA 5BS7C 4J8WC 1P3BB 4WU9B 1U35B 1Z2CB 3REJA 1P3IB 3LJAA 4CAYB 4JJNA 3REKC 3B6GA 1TZYA 3UTAA 4QLCB 1HQ3B 4KUDB 2ZY5A 4EO5C 5B31D 3REJD 2NZDA 3AZFB 4NE6A 3AN2C 1P3AC 3B0DC 4H9SC 2Y2NA 5B1MC 5KDMA 5AV6A 3LELD 3REKB 3LZ1D 3RELC 3REKD 3C1CA 5CP6B 5BO0A 5B1MB 3MNND 3TU4A 3AZLA 1U35A 5BT1D 4KGCB 5B0ZC 1TZYC 3MGPD 1JFIA 5AVCA 3O62C 3KXBD 3UTAB 4YS3A 5AV9A 3WA9B 4H9PA 5JRGC 2ZY2A 2G5IC 4G92B 1P3OA 5KDMB 3MGSD 3AV1C 3P5JB 5DNNA 1M18C 5B2ID 5B0ZD 4CSRA 5JRGB 2J8PA 5GSUB 1P3PD 1F66A 4H9QA 4J8WA 3VH6T 5GXQA 1P3GB 4KGCA 3AZKD 1M18B 1BH8A 5B0YB 3RELD 4KHAA 1T3UA 4HGAC 3AL0C 2CV5D 3REJB 5B40B 3AZMC 3IP4C 5CPID 5G49B 3VH5W 4J8VC 3AZEC 3MVDC 1HQ3A 1P3MC 3X1VC 3UT9B 3AZGD 3AZFA 5AY8A 5BNXA 1EQZD 5AVCB 4E45A 4WU8D 3A6NC 3LJAB 2FJ7B 3NQJB 2UWXA 1P3GA 4WU8B 5B2IC 4LD9D 3X1VB 3W98A 4KUDA 3AV2A 5CP6A 3MNNA 3AV1D 3X1TB 5CPKA 2PYOC 1P3FD 2F8NG 4Z5TD 1P3KA 5AVCC 3WTPC 2NQBC 5B24C 1U35C 5CPKD 5B40D 5CPJD 5C3IB 3WKJB 4LD9C 4H9QB 3LZ1B 2BYKA 5B31G 5BO0B 3NQUA 1P3OC 2NZDD 1BH8B 5F99D 3LELA 4WNNB 3V9RB 3AZEB 2BYMA 4Z5TB 5JA4A 2VQRA 1Q9CA 4J8VD 5JRGD 3REHD 1P3OB 1P3LD 2FFFB 4ZUXB 3AZJC 4WU9D 4DRBA 3R45B 1P3BD 1A7WA 5BT1C 3B0CW 3EG5B 3AZGB 1P3AA 3NQJA 1KX4C 5B24B 1P3MD 3C1BA 3UTBC 1M1AA 1ID3D 3MNNB 3AZMD 2AROA 5F99B 4XUJB 5GT0A 3MGSC 5BNVA 5B2JC 5G49A 3AYWD 3WKJA 2HIOD 3UT9A 5CPKB 1TZYD 3UTBD 3NQUB 5E5AA 2ZY4A 3WAAC 1P3AB 4CAYA 5B40C 3AZMB 5E5AD 2XD1A 1U35D 4R8PD 1S32D 3LZ1A 1R4VA 5B24D 1P3MB 4ZUXA 2Y2JA 3UT9C 4DQYB 4XZQB 1KX3B 3W99C 5GT3D 1M19B 4ZBJC 3B0DB 1WWIA 3MGRD 3B6GB 3AFAA 3C1CB 4YS3C 3AZKC 4DRAA 3MGRA 5E5AB 5AVBC 1P3LB 3VH5A 1TAFB 2JCHA 2Y2QA 3TU4C 3AZLC 2CV5B 1AOIB 2Y2OA 1N1JA 3LELB 4H9RA 2HUEB 3W97B 4YS3B 5GT0B 5BNVB 1P3LC 5B31C 3TU4B 3WTPD 3AZLB 4XZQA 1KX3A 3C1BB 5GSUC 1P3PA 4G92C 1P3ID 1B67A 4R8PC 1S32C 4H9OA 3W97C 2IO5B 2F2AC 1ID3C 5GSUA 1P3PC 1F66B 3REKA 5GXQB 3REHA 4AWLB 1P3LA 1EQZC 4YM6D 4G91C 3A1IA 3VH6W 2HIOC 5DNNB 1M1AB 5B1MA 3AZJA 5CHLB 1P3IC 3AZIB 5AVCD 4AWLC 5CPIC 5AV8D 3EPKA 5B1MD 2PYOD 4R8PA 5AY8C 1S32A 1P3AD 2HIOB 3AZFC 3AN2B 5B0YA 4ZUXD 1P3MA 2Y2GA 3C1BD 4WU8C 2Y2HA 3MNNC 4J8XD 1KX4D 5F99C 5B2IA 1P3FA 2NZDC 3EPHA 2NQBA 3MGRC 2IO5C 4J8WB 1P3BC 3WKJD 3MGQA 5CPKC 1ID3B 3AN2D 1P3PB 1F66C 1M19A 1N1JB 5B1LB 4J8VA 4KHAB 1P34C 1KU5A 5DNNC 3W96C 3KXBA 3B6FB 5GT3B 1M19D 3LZ0C 2BYKB 2F8NK 1P3KB 3FDDA 1HTAA 3REHB 1P3OD 1BH9A 2F8ND 1TAFA 5FUGA 1H3OB 3MVDA 3KFUG 3AZEA 4H9RB 3MGQC 1P3BA 4WV4B 5B0ZA 2ZY3A 4X23D 1P34D 3AZED 1TZYB 5CP6D 3AV1A 3AZJD 2NZDB 3X1TA 4H9OB 3AZJB 5DNMA 2JSSA 3B6FA 4H9NB 1BFMA 3RELB 1P3FB 5AVBD 3B0CT 5DNMD 5AV8B 5CPIA 1ZLAB 3X1VD 1HQ3D 4Z66C 5F99A 3LJAC 3C1CD 5B0ZB 4WU9C 5B2IB 5B1LA 5AV8C 5DNMC 2NQBD 2RVQD 3X1TC 3MGSB 4QLCC 1EQZB 5GT3A 4G91B 5B1LD 4YM6C 4J8VB 5B33D 3AZIC 3VH5T 3MVDB 2YFVA 2PYOA 5AV8A 5CPIB 2LY8A 1M18D 3AFAC 3W98C 2Y2IA 3R45A 1P3GC 2Y2KA 3AYWC 3LZ0A 1ID3A 5FUGB 4Z5TC 3KUYA 2AROD 3AFAB 2YFWA 3AZKA 2CV5C 3WTPA 3REJC 3WA9C 2BG1A 3X1SD 3AZNA 3X1UD 5BS7A 3MGRB 3VH6A 2RVQC 3X1TD 3AV1B 3X1SA 1ZLAA 2JE5A 2YFVB 3X1UA 5BNXB 2W8SA 3WKJC 4LD9B 3MGPB 3LZ1C 4H9NA 5AVBA 1ZLAD 4KGCC 3UTAD 1KX5B 3LZ0B 3X1VA 3H0RC 4J8XC 4EO5B 5B32A 3WTPB 3KXBC 5GT0D 1P34A 2Y2PA 4J8XB 5GXQC
chains in the Genus database with same CATH topology
5AY8B 5CPJC 3MGPA 3AZIA 3UTBA 1M1AC 4KUDD 3H0LC 4JJNB 1KX4A 2F8NB 4Z5TA 5JA4B 1P3KD 1P3FC 5B33C 3AZID 3B6GD 3AV2B 3O62D 3AZNB 4UUZB 4XUJC 3LZ0D 5B31A 4XZQD 3AZHA 1KX3D 5DNND 5AV9C 5AV6C 3KUYB 5AV5D 3X1UB 1KX5C 3AZHD 3AN2A 3REIA 3AZGC 2CWEA 5AVBB 3AFAD 2Y2MA 4NE5A 1KX5A 3F6TA 3LELC 3W96B 4QLCA 3UTBB 3B6FC 2HUEC 3TU4D 3AZLD 4WZSB 3REHC 3AZHC 4XUJA 4WU9A 4H9PB 3W99A 4H9SA 4Z66A 3MGQB 5CPJB 1P34B 4ZUXC 5B0YD 4NE3A 2RIQA 3REIC 2XD5A 3B6GC 4J8XA 5C3IC 5B32D 1F1EA 4JJNC 1P3KC 3KUYD 3KWQB 5B33B 2DQNC 3AV2C 1HQ3C 4X23C 5E5AC 3AZMA 2FJ7D 2F8NH 3KWQC 5B32C 4JJND 4NFTA 3H0MC 1WWSA 5B2JA 3WA9D 1M19C 3W99B 1JFIB 3B0BA 3MGPC 5B40A 4Z66B 5CPJA 3A6ND 3KWQD 1PZRA 2DF4C 4CSRB 5B2JD 3WA9A 5DNMB 3A6NA 3KWQA 3W96A 1ZLAC 3MVDD 3WAAB 1H3OA 2Y2LA 4WU8A 5JRGA 3REIB 5GT0C 3MGSA 5B0YC 5AV5C 1KX5D 5B31B 4HGAB 5B2JB 3C1BC 1M18A 4X23B 5B32G 4UPKA 4WJ3C 3W99D 5GT3C 3B6FD 4YM6B 3LJAD 3C1CC 3EPJA 3RELA 3O62A 3AZNC 3A1KA 1ULYA 2CV5A 3W98B 4WNNA 3KUYC 5AV6D 3W97A 4Z2MH 3AYWA 1P3IA 3REID 4XZQC 1KX3C 2FJ7A 4ZBJB 5AY8D 2HIOA 5B1LC 5CP6C 1EQZA 3A6NB 1AOID 2FJ7C 2YFWB 3AZKB 1P3GD 4YM6A 4LD9A 5B33A 3WTPE 3AZGA 3UTAC 3V9RA 2PYOB 4Z66D 5B24A 4M6BA 2ZM5A 2NQBB 3KSYA 2BYMB 4R8PB 1S32B 1F66D 4Z2MG 3KXBB 4J8WD 4KGCD 4E44A 3UT9D 5AV5A 5B32B 1BH9B 4J8UB 4KUDC 3X1SB 3WAAA 3MGQD 1KX4B 2F8NA 2G5HC 3EPLA 2AROB 1AOIC 5AV9B 3AYWB 4YS3D 3WAAD 5AV9D 4J8UC 4UUZA 3X1UC 3X1SC 4XUJD 3AZFD 4X23A 1B6WA 3W96D 3W97D 2AROC 4J8UD 1W2EA 5GSUD 4QLCD 5AV6B 1M1AD 3AZHB 5AV5B 4J8UA 3W98D 3O62B 3AZND 3AV2D 2L5AA 5GXQD 1AOIA 5BS7C 4J8WC 1P3BB 4WU9B 1U35B 1Z2CB 3REJA 1P3IB 3LJAA 4CAYB 4JJNA 3REKC 3B6GA 1TZYA 3UTAA 4QLCB 1HQ3B 4KUDB 2ZY5A 4EO5C 5B31D 3REJD 2NZDA 3AZFB 4NE6A 3AN2C 1P3AC 3B0DC 4H9SC 2Y2NA 5B1MC 5KDMA 5AV6A 3LELD 3REKB 3LZ1D 3RELC 3REKD 3C1CA 5CP6B 5BO0A 5B1MB 3MNND 3TU4A 3AZLA 1U35A 5BT1D 4KGCB 5B0ZC 1TZYC 3MGPD 1JFIA 5AVCA 3O62C 3KXBD 3UTAB 4YS3A 5AV9A 3WA9B 4H9PA 5JRGC 2ZY2A 2G5IC 4G92B 1P3OA 5KDMB 3MGSD 3AV1C 3P5JB 5DNNA 1M18C 5B2ID 5B0ZD 4CSRA 5JRGB 2J8PA 5GSUB 1P3PD 1F66A 4H9QA 4J8WA 3VH6T 5GXQA 1P3GB 4KGCA 3AZKD 1M18B 1BH8A 5B0YB 3RELD 4KHAA 1T3UA 4HGAC 3AL0C 2CV5D 3REJB 5B40B 3AZMC 3IP4C 5CPID 5G49B 3VH5W 4J8VC 3AZEC 3MVDC 1HQ3A 1P3MC 3X1VC 3UT9B 3AZGD 3AZFA 5AY8A 5BNXA 1EQZD 5AVCB 4E45A 4WU8D 3A6NC 3LJAB 2FJ7B 3NQJB 2UWXA 1P3GA 4WU8B 5B2IC 4LD9D 3X1VB 3W98A 4KUDA 3AV2A 5CP6A 3MNNA 3AV1D 3X1TB 5CPKA 2PYOC 1P3FD 2F8NG 4Z5TD 1P3KA 5AVCC 3WTPC 2NQBC 5B24C 1U35C 5CPKD 5B40D 5CPJD 5C3IB 3WKJB 4LD9C 4H9QB 3LZ1B 2BYKA 5B31G 5BO0B 3NQUA 1P3OC 2NZDD 1BH8B 5F99D 3LELA 4WNNB 3V9RB 3AZEB 2BYMA 4Z5TB 5JA4A 2VQRA 1Q9CA 4J8VD 5JRGD 3REHD 1P3OB 1P3LD 2FFFB 4ZUXB 3AZJC 4WU9D 4DRBA 3R45B 1P3BD 1A7WA 5BT1C 3B0CW 3EG5B 3AZGB 1P3AA 3NQJA 1KX4C 5B24B 1P3MD 3C1BA 3UTBC 1M1AA 1ID3D 3MNNB 3AZMD 2AROA 5F99B 4XUJB 5GT0A 3MGSC 5BNVA 5B2JC 5G49A 3AYWD 3WKJA 2HIOD 3UT9A 5CPKB 1TZYD 3UTBD 3NQUB 5E5AA 2ZY4A 3WAAC 1P3AB 4CAYA 5B40C 3AZMB 5E5AD 2XD1A 1U35D 4R8PD 1S32D 3LZ1A 1R4VA 5B24D 1P3MB 4ZUXA 2Y2JA 3UT9C 4DQYB 4XZQB 1KX3B 3W99C 5GT3D 1M19B 4ZBJC 3B0DB 1WWIA 3MGRD 3B6GB 3AFAA 3C1CB 4YS3C 3AZKC 4DRAA 3MGRA 5E5AB 5AVBC 1P3LB 3VH5A 1TAFB 2JCHA 2Y2QA 3TU4C 3AZLC 2CV5B 1AOIB 2Y2OA 1N1JA 3LELB 4H9RA 2HUEB 3W97B 4YS3B 5GT0B 5BNVB 1P3LC 5B31C 3TU4B 3WTPD 3AZLB 4XZQA 1KX3A 3C1BB 5GSUC 1P3PA 4G92C 1P3ID 1B67A 4R8PC 1S32C 4H9OA 3W97C 2IO5B 2F2AC 1ID3C 5GSUA 1P3PC 1F66B 3REKA 5GXQB 3REHA 4AWLB 1P3LA 1EQZC 4YM6D 4G91C 3A1IA 3VH6W 2HIOC 5DNNB 1M1AB 5B1MA 3AZJA 5CHLB 1P3IC 3AZIB 5AVCD 4AWLC 5CPIC 5AV8D 3EPKA 5B1MD 2PYOD 4R8PA 5AY8C 1S32A 1P3AD 2HIOB 3AZFC 3AN2B 5B0YA 4ZUXD 1P3MA 2Y2GA 3C1BD 4WU8C 2Y2HA 3MNNC 4J8XD 1KX4D 5F99C 5B2IA 1P3FA 2NZDC 3EPHA 2NQBA 3MGRC 2IO5C 4J8WB 1P3BC 3WKJD 3MGQA 5CPKC 1ID3B 3AN2D 1P3PB 1F66C 1M19A 1N1JB 5B1LB 4J8VA 4KHAB 1P34C 1KU5A 5DNNC 3W96C 3KXBA 3B6FB 5GT3B 1M19D 3LZ0C 2BYKB 2F8NK 1P3KB 3FDDA 1HTAA 3REHB 1P3OD 1BH9A 2F8ND 1TAFA 5FUGA 1H3OB 3MVDA 3KFUG 3AZEA 4H9RB 3MGQC 1P3BA 4WV4B 5B0ZA 2ZY3A 4X23D 1P34D 3AZED 1TZYB 5CP6D 3AV1A 3AZJD 2NZDB 3X1TA 4H9OB 3AZJB 5DNMA 2JSSA 3B6FA 4H9NB 1BFMA 3RELB 1P3FB 5AVBD 3B0CT 5DNMD 5AV8B 5CPIA 1ZLAB 3X1VD 1HQ3D 4Z66C 5F99A 3LJAC 3C1CD 5B0ZB 4WU9C 5B2IB 5B1LA 5AV8C 5DNMC 2NQBD 2RVQD 3X1TC 3MGSB 4QLCC 1EQZB 5GT3A 4G91B 5B1LD 4YM6C 4J8VB 5B33D 3AZIC 3VH5T 3MVDB 2YFVA 2PYOA 5AV8A 5CPIB 2LY8A 1M18D 3AFAC 3W98C 2Y2IA 3R45A 1P3GC 2Y2KA 3AYWC 3LZ0A 1ID3A 5FUGB 4Z5TC 3KUYA 2AROD 3AFAB 2YFWA 3AZKA 2CV5C 3WTPA 3REJC 3WA9C 2BG1A 3X1SD 3AZNA 3X1UD 5BS7A 3MGRB 3VH6A 2RVQC 3X1TD 3AV1B 3X1SA 1ZLAA 2JE5A 2YFVB 3X1UA 5BNXB 2W8SA 3WKJC 4LD9B 3MGPB 3LZ1C 4H9NA 5AVBA 1ZLAD 4KGCC 3UTAD 1KX5B 3LZ0B 3X1VA 3H0RC 4J8XC 4EO5B 5B32A 3WTPB 3KXBC 5GT0D 1P34A 2Y2PA 4J8XB 5GXQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AY8 B;  5CPJ C;  3MGP A;  3AZI A;  3UTB A;  1M1A C;  4KUD D;  4JJN B;  1KX4 A;  2F8N B;  4Z5T A;  5JA4 B;  1P3K D;  1P3F C;  5B33 C;  3AZI D;  3B6G D;  3AV2 B;  3O62 D;  3AZN B;  3LZ0 D;  4UUZ B;  4XUJ C;  5B31 A;  4XZQ D;  3AZH A;  1KX3 D;  5DNN D;  5AV9 C;  5AV6 C;  3KUY B;  5AV5 D;  3X1U B;  1KX5 C;  3AZH D;  3AN2 A;  3REI A;  3AZG C;  2CWE A;  5AVB B;  3AFA D;  4NE5 A;  1KX5 A;  3LEL C;  3W96 B;  4QLC A;  3UTB B;  3B6F C;  2HUE C;  3TU4 D;  3AZL D;  4WZS B;  3REH C;  3AZH C;  4XUJ A;  4WU9 A;  4H9P B;  3W99 A;  4H9S A;  4Z66 A;  3MGQ B;  5CPJ B;  1P34 B;  4ZUX C;  5B0Y D;  4NE3 A;  3REI C;  3B6G C;  4J8X A;  5C3I C;  5B32 D;  1F1E A;  4JJN C;  1P3K C;  3KUY D;  3KWQ B;  5B33 B;  3AV2 C;  1HQ3 C;  4X23 C;  5E5A C;  3AZM A;  2FJ7 D;  2F8N H;  3KWQ C;  5B32 C;  4JJN D;  4NFT A;  1WWS A;  5B2J A;  3WA9 D;  1M19 C;  3W99 B;  1JFI B;  3B0B A;  3MGP C;  5B40 A;  4Z66 B;  5CPJ A;  3A6N D;  3KWQ D;  4CSR B;  5B2J D;  3WA9 A;  5DNM B;  3A6N A;  3KWQ A;  3W96 A;  1ZLA C;  3MVD D;  3WAA B;  1H3O A;  4WU8 A;  5JRG A;  3REI B;  5GT0 C;  3MGS A;  5B0Y C;  5AV5 C;  1KX5 D;  5B31 B;  4HGA B;  5B2J B;  3C1B C;  1M18 A;  4X23 B;  5B32 G;  3W99 D;  5GT3 C;  3B6F D;  4YM6 B;  3LJA D;  3C1C C;  3REL A;  3O62 A;  3AZN C;  1ULY A;  2CV5 A;  3W98 B;  4WNN A;  3KUY C;  5AV6 D;  3W97 A;  4Z2M H;  3AYW A;  1P3I A;  3REI D;  4XZQ C;  1KX3 C;  2FJ7 A;  4ZBJ B;  5AY8 D;  2HIO A;  5B1L C;  5CP6 C;  1EQZ A;  3A6N B;  1AOI D;  2FJ7 C;  2YFW B;  3AZK B;  1P3G D;  4YM6 A;  4LD9 A;  5B33 A;  3WTP E;  3AZG A;  3UTA C;  3V9R A;  2PYO B;  4Z66 D;  5B24 A;  4M6B A;  2NQB B;  3KSY A;  2BYM B;  4R8P B;  1S32 B;  1F66 D;  4Z2M G;  3KXB B;  4J8W D;  4KGC D;  4E44 A;  3UT9 D;  5AV5 A;  5B32 B;  1BH9 B;  4J8U B;  4KUD C;  3X1S B;  3WAA A;  3MGQ D;  1KX4 B;  2F8N A;  1AOI C;  2ARO B;  5AV9 B;  3AYW B;  4YS3 D;  3WAA D;  5AV9 D;  4J8U C;  4UUZ A;  3X1U C;  3X1S C;  4XUJ D;  3AZF D;  4X23 A;  1B6W A;  3W96 D;  3W97 D;  2ARO C;  4J8U D;  5GSU D;  4QLC D;  5AV6 B;  1M1A D;  3AZH B;  5AV5 B;  4J8U A;  3W98 D;  3O62 B;  3AZN D;  3AV2 D;  2L5A A;  5GXQ D;  1AOI A;  5BS7 C;  4J8W C;  1P3B B;  4WU9 B;  1U35 B;  3REJ A;  1P3I B;  3LJA A;  4CAY B;  4JJN A;  3REK C;  3B6G A;  1TZY A;  3UTA A;  4QLC B;  1HQ3 B;  4KUD B;  4EO5 C;  5B31 D;  3REJ D;  2NZD A;  3AZF B;  4NE6 A;  3AN2 C;  1P3A C;  3B0D C;  4H9S C;  5B1M C;  5KDM A;  5AV6 A;  3LEL D;  3REK B;  3LZ1 D;  3REL C;  3REK D;  3C1C A;  5CP6 B;  5BO0 A;  5B1M B;  3MNN D;  3TU4 A;  3AZL A;  1U35 A;  5BT1 D;  4KGC B;  5B0Z C;  1TZY C;  3MGP D;  1JFI A;  5AVC A;  3O62 C;  3KXB D;  3UTA B;  4YS3 A;  5AV9 A;  3WA9 B;  4H9P A;  5JRG C;  4G92 B;  1P3O A;  5KDM B;  3MGS D;  3AV1 C;  5DNN A;  1M18 C;  5B2I D;  5B0Z D;  4CSR A;  5JRG B;  5GSU B;  1P3P D;  1F66 A;  4H9Q A;  4J8W A;  3VH6 T;  5GXQ A;  1P3G B;  4KGC A;  3AZK D;  1M18 B;  1BH8 A;  5B0Y B;  3REL D;  4KHA A;  4HGA C;  2CV5 D;  3REJ B;  5B40 B;  3AZM C;  5CPI D;  5G49 B;  3VH5 W;  4J8V C;  3AZE C;  3MVD C;  1HQ3 A;  1P3M C;  3X1V C;  3UT9 B;  3AZG D;  3AZF A;  5AY8 A;  5BNX A;  1EQZ D;  5AVC B;  4E45 A;  4WU8 D;  3A6N C;  3LJA B;  2FJ7 B;  3NQJ B;  1P3G A;  4LD9 D;  4WU8 B;  5B2I C;  3X1V B;  3W98 A;  4KUD A;  3AV2 A;  5CP6 A;  3MNN A;  3AV1 D;  3X1T B;  5CPK A;  2PYO C;  1P3F D;  2F8N G;  4Z5T D;  1P3K A;  5AVC C;  3WTP C;  2NQB C;  5B24 C;  1U35 C;  5CPK D;  5B40 D;  5CPJ D;  5C3I B;  3WKJ B;  4LD9 C;  4H9Q B;  3LZ1 B;  2BYK A;  5B31 G;  5BO0 B;  3NQU A;  1P3O C;  2NZD D;  1BH8 B;  5F99 D;  3LEL A;  4WNN B;  3V9R B;  3AZE B;  2BYM A;  4Z5T B;  5JA4 A;  1Q9C A;  4J8V D;  5JRG D;  3REH D;  1P3O B;  1P3L D;  4ZUX B;  3AZJ C;  4WU9 D;  4DRB A;  3R45 B;  1P3B D;  1A7W A;  5BT1 C;  3B0C W;  3AZG B;  1P3A A;  3NQJ A;  1KX4 C;  5B24 B;  1P3M D;  3C1B A;  3UTB C;  1M1A A;  1ID3 D;  3MNN B;  3AZM D;  2ARO A;  5F99 B;  4XUJ B;  5GT0 A;  3MGS C;  5BNV A;  5B2J C;  5G49 A;  3AYW D;  3WKJ A;  2HIO D;  3UT9 A;  5CPK B;  1TZY D;  3UTB D;  3NQU B;  5E5A A;  3WAA C;  1P3A B;  4CAY A;  5B40 C;  3AZM B;  5E5A D;  1U35 D;  4R8P D;  1S32 D;  3LZ1 A;  1R4V A;  5B24 D;  1P3M B;  4ZUX A;  3UT9 C;  4XZQ B;  1KX3 B;  3W99 C;  5GT3 D;  1M19 B;  4ZBJ C;  3B0D B;  1WWI A;  3MGR D;  3B6G B;  3AFA A;  3C1C B;  4YS3 C;  3AZK C;  4DRA A;  3MGR A;  5E5A B;  5AVB C;  1P3L B;  3VH5 A;  1TAF B;  2CV5 B;  3TU4 C;  3AZL C;  1AOI B;  1N1J A;  3LEL B;  4H9R A;  2HUE B;  3W97 B;  4YS3 B;  5GT0 B;  5BNV B;  1P3L C;  5B31 C;  3TU4 B;  3WTP D;  3AZL B;  4XZQ A;  1KX3 A;  3C1B B;  5GSU C;  1P3P A;  4G92 C;  1P3I D;  1B67 A;  4R8P C;  1S32 C;  4H9O A;  3W97 C;  2IO5 B;  1ID3 C;  5GSU A;  1P3P C;  1F66 B;  3REK A;  5GXQ B;  3REH A;  4AWL B;  1P3L A;  1EQZ C;  4YM6 D;  4G91 C;  3VH6 W;  5DNN B;  2HIO C;  1M1A B;  5B1M A;  3AZJ A;  5CHL B;  1P3I C;  3AZI B;  5AVC D;  4AWL C;  5CPI C;  5AV8 D;  2PYO D;  5B1M D;  4R8P A;  5AY8 C;  1S32 A;  1P3A D;  2HIO B;  3AZF C;  3AN2 B;  5B0Y A;  4ZUX D;  1P3M A;  3C1B D;  4WU8 C;  4J8X D;  3MNN C;  1KX4 D;  5F99 C;  5B2I A;  1P3F A;  2NZD C;  2NQB A;  3MGR C;  2IO5 C;  4J8W B;  1P3B C;  3WKJ D;  3MGQ A;  5CPK C;  1ID3 B;  3AN2 D;  1P3P B;  1F66 C;  1M19 A;  1N1J B;  5B1L B;  4J8V A;  4KHA B;  1P34 C;  1KU5 A;  5DNN C;  3W96 C;  3KXB A;  3B6F B;  5GT3 B;  1M19 D;  3LZ0 C;  2BYK B;  2F8N K;  1P3K B;  1HTA A;  3REH B;  1P3O D;  1BH9 A;  2F8N D;  1TAF A;  5FUG A;  1H3O B;  3MVD A;  3AZE A;  4H9R B;  3MGQ C;  1P3B A;  4WV4 B;  5B0Z A;  4X23 D;  1P34 D;  3AZE D;  1TZY B;  5CP6 D;  3AV1 A;  3AZJ D;  2NZD B;  3X1T A;  4H9O B;  3AZJ B;  5DNM A;  2JSS A;  3B6F A;  4H9N B;  1BFM A;  3REL B;  1P3F B;  5AVB D;  3B0C T;  5DNM D;  5AV8 B;  5CPI A;  1ZLA B;  3X1V D;  1HQ3 D;  4Z66 C;  5F99 A;  3LJA C;  3C1C D;  5B0Z B;  4WU9 C;  5B2I B;  5B1L A;  5AV8 C;  5DNM C;  2NQB D;  2RVQ D;  3X1T C;  3MGS B;  4QLC C;  1EQZ B;  5GT3 A;  4G91 B;  5B1L D;  4YM6 C;  4J8V B;  5B33 D;  3AZI C;  3VH5 T;  3MVD B;  2YFV A;  2PYO A;  5AV8 A;  5CPI B;  2LY8 A;  1M18 D;  3AFA C;  3W98 C;  3R45 A;  1P3G C;  3AYW C;  3LZ0 A;  1ID3 A;  5FUG B;  4Z5T C;  3KUY A;  2ARO D;  3AFA B;  2YFW A;  3AZK A;  2CV5 C;  3WTP A;  3REJ C;  3WA9 C;  3X1S D;  3AZN A;  3X1U D;  5BS7 A;  3MGR B;  3VH6 A;  2RVQ C;  3X1T D;  3AV1 B;  3X1S A;  1ZLA A;  2YFV B;  3X1U A;  5BNX B;  3WKJ C;  4LD9 B;  3MGP B;  3LZ1 C;  4H9N A;  5AVB A;  1ZLA D;  4KGC C;  3UTA D;  1KX5 B;  3LZ0 B;  3X1V A;  4J8X C;  4EO5 B;  5B32 A;  3WTP B;  3KXB C;  5GT0 D;  1P34 A;  4J8X B;  5GXQ C; 
#chains in the Genus database with same CATH topology
 5AY8 B;  5CPJ C;  3MGP A;  3AZI A;  3UTB A;  1M1A C;  4KUD D;  3H0L C;  4JJN B;  1KX4 A;  2F8N B;  4Z5T A;  5JA4 B;  1P3K D;  1P3F C;  5B33 C;  3AZI D;  3B6G D;  3AV2 B;  3O62 D;  3AZN B;  4UUZ B;  4XUJ C;  3LZ0 D;  5B31 A;  4XZQ D;  3AZH A;  1KX3 D;  5DNN D;  5AV9 C;  5AV6 C;  3KUY B;  5AV5 D;  3X1U B;  1KX5 C;  3AZH D;  3AN2 A;  3REI A;  3AZG C;  2CWE A;  5AVB B;  3AFA D;  2Y2M A;  4NE5 A;  1KX5 A;  3F6T A;  3LEL C;  3W96 B;  4QLC A;  3UTB B;  3B6F C;  2HUE C;  3TU4 D;  3AZL D;  4WZS B;  3REH C;  3AZH C;  4XUJ A;  4WU9 A;  4H9P B;  3W99 A;  4H9S A;  4Z66 A;  3MGQ B;  5CPJ B;  1P34 B;  4ZUX C;  5B0Y D;  4NE3 A;  2RIQ A;  3REI C;  2XD5 A;  3B6G C;  4J8X A;  5C3I C;  5B32 D;  1F1E A;  4JJN C;  1P3K C;  3KUY D;  3KWQ B;  5B33 B;  2DQN C;  3AV2 C;  1HQ3 C;  4X23 C;  5E5A C;  3AZM A;  2FJ7 D;  2F8N H;  3KWQ C;  5B32 C;  4JJN D;  4NFT A;  3H0M C;  1WWS A;  5B2J A;  3WA9 D;  1M19 C;  3W99 B;  1JFI B;  3B0B A;  3MGP C;  5B40 A;  4Z66 B;  5CPJ A;  3A6N D;  3KWQ D;  1PZR A;  2DF4 C;  4CSR B;  5B2J D;  3WA9 A;  5DNM B;  3A6N A;  3KWQ A;  3W96 A;  1ZLA C;  3MVD D;  3WAA B;  1H3O A;  2Y2L A;  4WU8 A;  5JRG A;  3REI B;  5GT0 C;  3MGS A;  5B0Y C;  5AV5 C;  1KX5 D;  5B31 B;  4HGA B;  5B2J B;  3C1B C;  1M18 A;  4X23 B;  5B32 G;  4UPK A;  4WJ3 C;  3W99 D;  5GT3 C;  3B6F D;  4YM6 B;  3LJA D;  3C1C C;  3EPJ A;  3REL A;  3O62 A;  3AZN C;  3A1K A;  1ULY A;  2CV5 A;  3W98 B;  4WNN A;  3KUY C;  5AV6 D;  3W97 A;  4Z2M H;  3AYW A;  1P3I A;  3REI D;  4XZQ C;  1KX3 C;  2FJ7 A;  4ZBJ B;  5AY8 D;  2HIO A;  5B1L C;  5CP6 C;  1EQZ A;  3A6N B;  1AOI D;  2FJ7 C;  2YFW B;  3AZK B;  1P3G D;  4YM6 A;  4LD9 A;  5B33 A;  3WTP E;  3AZG A;  3UTA C;  3V9R A;  2PYO B;  4Z66 D;  5B24 A;  4M6B A;  2ZM5 A;  2NQB B;  3KSY A;  2BYM B;  4R8P B;  1S32 B;  1F66 D;  4Z2M G;  3KXB B;  4J8W D;  4KGC D;  4E44 A;  3UT9 D;  5AV5 A;  5B32 B;  1BH9 B;  4J8U B;  4KUD C;  3X1S B;  3WAA A;  3MGQ D;  1KX4 B;  2F8N A;  2G5H C;  3EPL A;  2ARO B;  1AOI C;  5AV9 B;  3AYW B;  4YS3 D;  3WAA D;  5AV9 D;  4J8U C;  4UUZ A;  3X1U C;  3X1S C;  4XUJ D;  3AZF D;  4X23 A;  1B6W A;  3W96 D;  3W97 D;  2ARO C;  4J8U D;  1W2E A;  5GSU D;  4QLC D;  5AV6 B;  1M1A D;  3AZH B;  5AV5 B;  4J8U A;  3W98 D;  3O62 B;  3AZN D;  3AV2 D;  2L5A A;  5GXQ D;  1AOI A;  5BS7 C;  4J8W C;  1P3B B;  4WU9 B;  1U35 B;  1Z2C B;  3REJ A;  1P3I B;  3LJA A;  4CAY B;  4JJN A;  3REK C;  3B6G A;  1TZY A;  3UTA A;  4QLC B;  1HQ3 B;  4KUD B;  2ZY5 A;  4EO5 C;  5B31 D;  3REJ D;  2NZD A;  3AZF B;  4NE6 A;  3AN2 C;  1P3A C;  3B0D C;  4H9S C;  2Y2N A;  5B1M C;  5KDM A;  5AV6 A;  3LEL D;  3REK B;  3LZ1 D;  3REL C;  3REK D;  3C1C A;  5CP6 B;  5BO0 A;  5B1M B;  3MNN D;  3TU4 A;  3AZL A;  1U35 A;  5BT1 D;  4KGC B;  5B0Z C;  1TZY C;  3MGP D;  1JFI A;  5AVC A;  3O62 C;  3KXB D;  3UTA B;  4YS3 A;  5AV9 A;  3WA9 B;  4H9P A;  5JRG C;  2ZY2 A;  2G5I C;  4G92 B;  1P3O A;  5KDM B;  3MGS D;  3AV1 C;  3P5J B;  5DNN A;  1M18 C;  5B2I D;  5B0Z D;  4CSR A;  5JRG B;  2J8P A;  5GSU B;  1P3P D;  1F66 A;  4H9Q A;  4J8W A;  3VH6 T;  5GXQ A;  1P3G B;  4KGC A;  3AZK D;  1M18 B;  1BH8 A;  5B0Y B;  3REL D;  4KHA A;  1T3U A;  4HGA C;  3AL0 C;  2CV5 D;  3REJ B;  5B40 B;  3AZM C;  3IP4 C;  5CPI D;  5G49 B;  3VH5 W;  4J8V C;  3AZE C;  3MVD C;  1HQ3 A;  1P3M C;  3X1V C;  3UT9 B;  3AZG D;  3AZF A;  5AY8 A;  5BNX A;  1EQZ D;  5AVC B;  4E45 A;  4WU8 D;  3A6N C;  3LJA B;  2FJ7 B;  3NQJ B;  2UWX A;  1P3G A;  4WU8 B;  5B2I C;  4LD9 D;  3X1V B;  3W98 A;  4KUD A;  3AV2 A;  5CP6 A;  3MNN A;  3AV1 D;  3X1T B;  5CPK A;  2PYO C;  1P3F D;  2F8N G;  4Z5T D;  1P3K A;  5AVC C;  3WTP C;  2NQB C;  5B24 C;  1U35 C;  5CPK D;  5B40 D;  5CPJ D;  5C3I B;  3WKJ B;  4LD9 C;  4H9Q B;  3LZ1 B;  2BYK A;  5B31 G;  5BO0 B;  3NQU A;  1P3O C;  2NZD D;  1BH8 B;  5F99 D;  3LEL A;  4WNN B;  3V9R B;  3AZE B;  2BYM A;  4Z5T B;  5JA4 A;  2VQR A;  1Q9C A;  4J8V D;  5JRG D;  3REH D;  1P3O B;  1P3L D;  2FFF B;  4ZUX B;  3AZJ C;  4WU9 D;  4DRB A;  3R45 B;  1P3B D;  1A7W A;  5BT1 C;  3B0C W;  3EG5 B;  3AZG B;  1P3A A;  3NQJ A;  1KX4 C;  5B24 B;  1P3M D;  3C1B A;  3UTB C;  1M1A A;  1ID3 D;  3MNN B;  3AZM D;  2ARO A;  5F99 B;  4XUJ B;  5GT0 A;  3MGS C;  5BNV A;  5B2J C;  5G49 A;  3AYW D;  3WKJ A;  2HIO D;  3UT9 A;  5CPK B;  1TZY D;  3UTB D;  3NQU B;  5E5A A;  2ZY4 A;  3WAA C;  1P3A B;  4CAY A;  5B40 C;  3AZM B;  5E5A D;  2XD1 A;  1U35 D;  4R8P D;  1S32 D;  3LZ1 A;  1R4V A;  5B24 D;  1P3M B;  4ZUX A;  2Y2J A;  3UT9 C;  4DQY B;  4XZQ B;  1KX3 B;  3W99 C;  5GT3 D;  1M19 B;  4ZBJ C;  3B0D B;  1WWI A;  3MGR D;  3B6G B;  3AFA A;  3C1C B;  4YS3 C;  3AZK C;  4DRA A;  3MGR A;  5E5A B;  5AVB C;  1P3L B;  3VH5 A;  1TAF B;  2JCH A;  2Y2Q A;  3TU4 C;  3AZL C;  2CV5 B;  1AOI B;  2Y2O A;  1N1J A;  3LEL B;  4H9R A;  2HUE B;  3W97 B;  4YS3 B;  5GT0 B;  5BNV B;  1P3L C;  5B31 C;  3TU4 B;  3WTP D;  3AZL B;  4XZQ A;  1KX3 A;  3C1B B;  5GSU C;  1P3P A;  4G92 C;  1P3I D;  1B67 A;  4R8P C;  1S32 C;  4H9O A;  3W97 C;  2IO5 B;  2F2A C;  1ID3 C;  5GSU A;  1P3P C;  1F66 B;  3REK A;  5GXQ B;  3REH A;  4AWL B;  1P3L A;  1EQZ C;  4YM6 D;  4G91 C;  3A1I A;  3VH6 W;  2HIO C;  5DNN B;  1M1A B;  5B1M A;  3AZJ A;  5CHL B;  1P3I C;  3AZI B;  5AVC D;  4AWL C;  5CPI C;  5AV8 D;  3EPK A;  5B1M D;  2PYO D;  4R8P A;  5AY8 C;  1S32 A;  1P3A D;  2HIO B;  3AZF C;  3AN2 B;  5B0Y A;  4ZUX D;  1P3M A;  2Y2G A;  3C1B D;  4WU8 C;  2Y2H A;  3MNN C;  4J8X D;  1KX4 D;  5F99 C;  5B2I A;  1P3F A;  2NZD C;  3EPH A;  2NQB A;  3MGR C;  2IO5 C;  4J8W B;  1P3B C;  3WKJ D;  3MGQ A;  5CPK C;  1ID3 B;  3AN2 D;  1P3P B;  1F66 C;  1M19 A;  1N1J B;  5B1L B;  4J8V A;  4KHA B;  1P34 C;  1KU5 A;  5DNN C;  3W96 C;  3KXB A;  3B6F B;  5GT3 B;  1M19 D;  3LZ0 C;  2BYK B;  2F8N K;  1P3K B;  3FDD A;  1HTA A;  3REH B;  1P3O D;  1BH9 A;  2F8N D;  1TAF A;  5FUG A;  1H3O B;  3MVD A;  3KFU G;  3AZE A;  4H9R B;  3MGQ C;  1P3B A;  4WV4 B;  5B0Z A;  2ZY3 A;  4X23 D;  1P34 D;  3AZE D;  1TZY B;  5CP6 D;  3AV1 A;  3AZJ D;  2NZD B;  3X1T A;  4H9O B;  3AZJ B;  5DNM A;  2JSS A;  3B6F A;  4H9N B;  1BFM A;  3REL B;  1P3F B;  5AVB D;  3B0C T;  5DNM D;  5AV8 B;  5CPI A;  1ZLA B;  3X1V D;  1HQ3 D;  4Z66 C;  5F99 A;  3LJA C;  3C1C D;  5B0Z B;  4WU9 C;  5B2I B;  5B1L A;  5AV8 C;  5DNM C;  2NQB D;  2RVQ D;  3X1T C;  3MGS B;  4QLC C;  1EQZ B;  5GT3 A;  4G91 B;  5B1L D;  4YM6 C;  4J8V B;  5B33 D;  3AZI C;  3VH5 T;  3MVD B;  2YFV A;  2PYO A;  5AV8 A;  5CPI B;  2LY8 A;  1M18 D;  3AFA C;  3W98 C;  2Y2I A;  3R45 A;  1P3G C;  2Y2K A;  3AYW C;  3LZ0 A;  1ID3 A;  5FUG B;  4Z5T C;  3KUY A;  2ARO D;  3AFA B;  2YFW A;  3AZK A;  2CV5 C;  3WTP A;  3REJ C;  3WA9 C;  2BG1 A;  3X1S D;  3AZN A;  3X1U D;  5BS7 A;  3MGR B;  3VH6 A;  2RVQ C;  3X1T D;  3AV1 B;  3X1S A;  1ZLA A;  2JE5 A;  2YFV B;  3X1U A;  5BNX B;  2W8S A;  3WKJ C;  4LD9 B;  3MGP B;  3LZ1 C;  4H9N A;  5AVB A;  1ZLA D;  4KGC C;  3UTA D;  1KX5 B;  3LZ0 B;  3X1V A;  3H0R C;  4J8X C;  4EO5 B;  5B32 A;  3WTP B;  3KXB C;  5GT0 D;  1P34 A;  2Y2P A;  4J8X B;  5GXQ C; 
#chains in the Genus database with same CATH homology
 5AY8 B;  5CPJ C;  3MGP A;  3AZI A;  3UTB A;  1M1A C;  4KUD D;  3H0L C;  4JJN B;  1KX4 A;  2F8N B;  4Z5T A;  5JA4 B;  1P3K D;  1P3F C;  5B33 C;  3AZI D;  3B6G D;  3AV2 B;  3O62 D;  3AZN B;  4UUZ B;  4XUJ C;  3LZ0 D;  5B31 A;  4XZQ D;  3AZH A;  1KX3 D;  5DNN D;  5AV9 C;  5AV6 C;  3KUY B;  5AV5 D;  3X1U B;  1KX5 C;  3AZH D;  3AN2 A;  3REI A;  3AZG C;  2CWE A;  5AVB B;  3AFA D;  2Y2M A;  4NE5 A;  1KX5 A;  3F6T A;  3LEL C;  3W96 B;  4QLC A;  3UTB B;  3B6F C;  2HUE C;  3TU4 D;  3AZL D;  4WZS B;  3REH C;  3AZH C;  4XUJ A;  4WU9 A;  4H9P B;  3W99 A;  4H9S A;  4Z66 A;  3MGQ B;  5CPJ B;  1P34 B;  4ZUX C;  5B0Y D;  4NE3 A;  2RIQ A;  3REI C;  2XD5 A;  3B6G C;  4J8X A;  5C3I C;  5B32 D;  1F1E A;  4JJN C;  1P3K C;  3KUY D;  3KWQ B;  5B33 B;  2DQN C;  3AV2 C;  1HQ3 C;  4X23 C;  5E5A C;  3AZM A;  2FJ7 D;  2F8N H;  3KWQ C;  5B32 C;  4JJN D;  4NFT A;  3H0M C;  1WWS A;  5B2J A;  3WA9 D;  1M19 C;  3W99 B;  1JFI B;  3B0B A;  3MGP C;  5B40 A;  4Z66 B;  5CPJ A;  3A6N D;  3KWQ D;  1PZR A;  2DF4 C;  4CSR B;  5B2J D;  3WA9 A;  5DNM B;  3A6N A;  3KWQ A;  3W96 A;  1ZLA C;  3MVD D;  3WAA B;  1H3O A;  2Y2L A;  4WU8 A;  5JRG A;  3REI B;  5GT0 C;  3MGS A;  5B0Y C;  5AV5 C;  1KX5 D;  5B31 B;  4HGA B;  5B2J B;  3C1B C;  1M18 A;  4X23 B;  5B32 G;  4UPK A;  4WJ3 C;  3W99 D;  5GT3 C;  3B6F D;  4YM6 B;  3LJA D;  3C1C C;  3EPJ A;  3REL A;  3O62 A;  3AZN C;  3A1K A;  1ULY A;  2CV5 A;  3W98 B;  4WNN A;  3KUY C;  5AV6 D;  3W97 A;  4Z2M H;  3AYW A;  1P3I A;  3REI D;  4XZQ C;  1KX3 C;  2FJ7 A;  4ZBJ B;  5AY8 D;  2HIO A;  5B1L C;  5CP6 C;  1EQZ A;  3A6N B;  1AOI D;  2FJ7 C;  2YFW B;  3AZK B;  1P3G D;  4YM6 A;  4LD9 A;  5B33 A;  3WTP E;  3AZG A;  3UTA C;  3V9R A;  2PYO B;  4Z66 D;  5B24 A;  4M6B A;  2ZM5 A;  2NQB B;  3KSY A;  2BYM B;  4R8P B;  1S32 B;  1F66 D;  4Z2M G;  3KXB B;  4J8W D;  4KGC D;  4E44 A;  3UT9 D;  5AV5 A;  5B32 B;  1BH9 B;  4J8U B;  4KUD C;  3X1S B;  3WAA A;  3MGQ D;  1KX4 B;  2F8N A;  2G5H C;  3EPL A;  2ARO B;  1AOI C;  5AV9 B;  3AYW B;  4YS3 D;  3WAA D;  5AV9 D;  4J8U C;  4UUZ A;  3X1U C;  3X1S C;  4XUJ D;  3AZF D;  4X23 A;  1B6W A;  3W96 D;  3W97 D;  2ARO C;  4J8U D;  1W2E A;  5GSU D;  4QLC D;  5AV6 B;  1M1A D;  3AZH B;  5AV5 B;  4J8U A;  3W98 D;  3O62 B;  3AZN D;  3AV2 D;  2L5A A;  5GXQ D;  1AOI A;  5BS7 C;  4J8W C;  1P3B B;  4WU9 B;  1U35 B;  1Z2C B;  3REJ A;  1P3I B;  3LJA A;  4CAY B;  4JJN A;  3REK C;  3B6G A;  1TZY A;  3UTA A;  4QLC B;  1HQ3 B;  4KUD B;  2ZY5 A;  4EO5 C;  5B31 D;  3REJ D;  2NZD A;  3AZF B;  4NE6 A;  3AN2 C;  1P3A C;  3B0D C;  4H9S C;  2Y2N A;  5B1M C;  5KDM A;  5AV6 A;  3LEL D;  3REK B;  3LZ1 D;  3REL C;  3REK D;  3C1C A;  5CP6 B;  5BO0 A;  5B1M B;  3MNN D;  3TU4 A;  3AZL A;  1U35 A;  5BT1 D;  4KGC B;  5B0Z C;  1TZY C;  3MGP D;  1JFI A;  5AVC A;  3O62 C;  3KXB D;  3UTA B;  4YS3 A;  5AV9 A;  3WA9 B;  4H9P A;  5JRG C;  2ZY2 A;  2G5I C;  4G92 B;  1P3O A;  5KDM B;  3MGS D;  3AV1 C;  3P5J B;  5DNN A;  1M18 C;  5B2I D;  5B0Z D;  4CSR A;  5JRG B;  2J8P A;  5GSU B;  1P3P D;  1F66 A;  4H9Q A;  4J8W A;  3VH6 T;  5GXQ A;  1P3G B;  4KGC A;  3AZK D;  1M18 B;  1BH8 A;  5B0Y B;  3REL D;  4KHA A;  1T3U A;  4HGA C;  3AL0 C;  2CV5 D;  3REJ B;  5B40 B;  3AZM C;  3IP4 C;  5CPI D;  5G49 B;  3VH5 W;  4J8V C;  3AZE C;  3MVD C;  1HQ3 A;  1P3M C;  3X1V C;  3UT9 B;  3AZG D;  3AZF A;  5AY8 A;  5BNX A;  1EQZ D;  5AVC B;  4E45 A;  4WU8 D;  3A6N C;  3LJA B;  2FJ7 B;  3NQJ B;  2UWX A;  1P3G A;  4WU8 B;  5B2I C;  4LD9 D;  3X1V B;  3W98 A;  4KUD A;  3AV2 A;  5CP6 A;  3MNN A;  3AV1 D;  3X1T B;  5CPK A;  2PYO C;  1P3F D;  2F8N G;  4Z5T D;  1P3K A;  5AVC C;  3WTP C;  2NQB C;  5B24 C;  1U35 C;  5CPK D;  5B40 D;  5CPJ D;  5C3I B;  3WKJ B;  4LD9 C;  4H9Q B;  3LZ1 B;  2BYK A;  5B31 G;  5BO0 B;  3NQU A;  1P3O C;  2NZD D;  1BH8 B;  5F99 D;  3LEL A;  4WNN B;  3V9R B;  3AZE B;  2BYM A;  4Z5T B;  5JA4 A;  2VQR A;  1Q9C A;  4J8V D;  5JRG D;  3REH D;  1P3O B;  1P3L D;  2FFF B;  4ZUX B;  3AZJ C;  4WU9 D;  4DRB A;  3R45 B;  1P3B D;  1A7W A;  5BT1 C;  3B0C W;  3EG5 B;  3AZG B;  1P3A A;  3NQJ A;  1KX4 C;  5B24 B;  1P3M D;  3C1B A;  3UTB C;  1M1A A;  1ID3 D;  3MNN B;  3AZM D;  2ARO A;  5F99 B;  4XUJ B;  5GT0 A;  3MGS C;  5BNV A;  5B2J C;  5G49 A;  3AYW D;  3WKJ A;  2HIO D;  3UT9 A;  5CPK B;  1TZY D;  3UTB D;  3NQU B;  5E5A A;  2ZY4 A;  3WAA C;  1P3A B;  4CAY A;  5B40 C;  3AZM B;  5E5A D;  2XD1 A;  1U35 D;  4R8P D;  1S32 D;  3LZ1 A;  1R4V A;  5B24 D;  1P3M B;  4ZUX A;  2Y2J A;  3UT9 C;  4DQY B;  4XZQ B;  1KX3 B;  3W99 C;  5GT3 D;  1M19 B;  4ZBJ C;  3B0D B;  1WWI A;  3MGR D;  3B6G B;  3AFA A;  3C1C B;  4YS3 C;  3AZK C;  4DRA A;  3MGR A;  5E5A B;  5AVB C;  1P3L B;  3VH5 A;  1TAF B;  2JCH A;  2Y2Q A;  3TU4 C;  3AZL C;  2CV5 B;  1AOI B;  2Y2O A;  1N1J A;  3LEL B;  4H9R A;  2HUE B;  3W97 B;  4YS3 B;  5GT0 B;  5BNV B;  1P3L C;  5B31 C;  3TU4 B;  3WTP D;  3AZL B;  4XZQ A;  1KX3 A;  3C1B B;  5GSU C;  1P3P A;  4G92 C;  1P3I D;  1B67 A;  4R8P C;  1S32 C;  4H9O A;  3W97 C;  2IO5 B;  2F2A C;  1ID3 C;  5GSU A;  1P3P C;  1F66 B;  3REK A;  5GXQ B;  3REH A;  4AWL B;  1P3L A;  1EQZ C;  4YM6 D;  4G91 C;  3A1I A;  3VH6 W;  2HIO C;  5DNN B;  1M1A B;  5B1M A;  3AZJ A;  5CHL B;  1P3I C;  3AZI B;  5AVC D;  4AWL C;  5CPI C;  5AV8 D;  3EPK A;  5B1M D;  2PYO D;  4R8P A;  5AY8 C;  1S32 A;  1P3A D;  2HIO B;  3AZF C;  3AN2 B;  5B0Y A;  4ZUX D;  1P3M A;  2Y2G A;  3C1B D;  4WU8 C;  2Y2H A;  3MNN C;  4J8X D;  1KX4 D;  5F99 C;  5B2I A;  1P3F A;  2NZD C;  3EPH A;  2NQB A;  3MGR C;  2IO5 C;  4J8W B;  1P3B C;  3WKJ D;  3MGQ A;  5CPK C;  1ID3 B;  3AN2 D;  1P3P B;  1F66 C;  1M19 A;  1N1J B;  5B1L B;  4J8V A;  4KHA B;  1P34 C;  1KU5 A;  5DNN C;  3W96 C;  3KXB A;  3B6F B;  5GT3 B;  1M19 D;  3LZ0 C;  2BYK B;  2F8N K;  1P3K B;  3FDD A;  1HTA A;  3REH B;  1P3O D;  1BH9 A;  2F8N D;  1TAF A;  5FUG A;  1H3O B;  3MVD A;  3KFU G;  3AZE A;  4H9R B;  3MGQ C;  1P3B A;  4WV4 B;  5B0Z A;  2ZY3 A;  4X23 D;  1P34 D;  3AZE D;  1TZY B;  5CP6 D;  3AV1 A;  3AZJ D;  2NZD B;  3X1T A;  4H9O B;  3AZJ B;  5DNM A;  2JSS A;  3B6F A;  4H9N B;  1BFM A;  3REL B;  1P3F B;  5AVB D;  3B0C T;  5DNM D;  5AV8 B;  5CPI A;  1ZLA B;  3X1V D;  1HQ3 D;  4Z66 C;  5F99 A;  3LJA C;  3C1C D;  5B0Z B;  4WU9 C;  5B2I B;  5B1L A;  5AV8 C;  5DNM C;  2NQB D;  2RVQ D;  3X1T C;  3MGS B;  4QLC C;  1EQZ B;  5GT3 A;  4G91 B;  5B1L D;  4YM6 C;  4J8V B;  5B33 D;  3AZI C;  3VH5 T;  3MVD B;  2YFV A;  2PYO A;  5AV8 A;  5CPI B;  2LY8 A;  1M18 D;  3AFA C;  3W98 C;  2Y2I A;  3R45 A;  1P3G C;  2Y2K A;  3AYW C;  3LZ0 A;  1ID3 A;  5FUG B;  4Z5T C;  3KUY A;  2ARO D;  3AFA B;  2YFW A;  3AZK A;  2CV5 C;  3WTP A;  3REJ C;  3WA9 C;  2BG1 A;  3X1S D;  3AZN A;  3X1U D;  5BS7 A;  3MGR B;  3VH6 A;  2RVQ C;  3X1T D;  3AV1 B;  3X1S A;  1ZLA A;  2JE5 A;  2YFV B;  3X1U A;  5BNX B;  2W8S A;  3WKJ C;  4LD9 B;  3MGP B;  3LZ1 C;  4H9N A;  5AVB A;  1ZLA D;  4KGC C;  3UTA D;  1KX5 B;  3LZ0 B;  3X1V A;  3H0R C;  4J8X C;  4EO5 B;  5B32 A;  3WTP B;  3KXB C;  5GT0 D;  1P34 A;  2Y2P A;  4J8X B;  5GXQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...