3V9RB

Crystal structure of saccharomyces cerevisiae mhf complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
73
Chain Sequence
b'MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDILSHQDLERIVGLLLMDMLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YOL086W-A
publication title Saccharomyces Cerevisiae MHF Complex Structurally Resembles the Histones (H3-H4)(2) Heterotetramer and Functions as a Heterotetramer
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 16
structure length 73
sequence length 84
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09415 CENP-X CENP-S associating Centromere protein X
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3v9rB00
4WNNA 4H9QA 5B24D 3KWQC 3REID 5BS7C 5JRGD 3B0BA 5B1LA 5DNMD 3MGRC 5B40C 1P3GD 5DNND 4JJNC 5B0YC 4CAYB 5E5AA 2L5AA 5CPJD 5B2ID 4CAYA 4EO5B 4KGCB 5CPKD 5AY8D 3W98D 3TU4D 4KGCA 3AV1C 3KUYB 2FJ7B 4E44A 4YM6C 3AZHC 3AYWC 2HUEC 3KUYA 1P3PB 2FJ7A 3W97D 2PYOC 3LJAC 3AZEC 4X23D 5B2JB 1P3IB 3AZGB 4XZQB 5B32B 1JFIB 3VH5T 1ZLAB 5GT0D 1P3IA 5B2JA 4XZQA 5B32A 1P34B 4NE3A 1JFIA 1ZLAA 1ID3C 1KX3B 3X1UC 3AZIB 5AV8C 1P34A 1M1AC 4G91B 3MNNB 3AN2B 5B1MA 3MGQB 3C1BC 2YFWB 3AZIA 4H9NB 2LY8A 5B24C 2AROD 3AN2A 4Z66D 3MGQA 2YFWA 3VH5W 4XUJB 4H9RB 1P3KB 1AOIB 5DNMC 4ZUXC 5JA4A 3LELD 3MGRA 1BH9B 1P3GC 3AZJD 1R4VA 4XUJA 4H9RA 5AV9B 3REKB 5CPJC 1P3KA 1AOIA 3AZFB 1BH9A 3UT9B 1P3MD 5B2IC 2NZDB 5AV6C 5AV9A 3REKA 5B33B 3B0CT 4HGAB 3MGSD 5CPKC 3AZFA 1WWIA 1P3PD 3UT9A 4H9PB 5AY8C 2NZDA 1P3ID 5AV5B 3AZGD 3TU4C 5B33A 1M19B 4CSRA 4H9PA 5B31B 3AZKB 2BYKB 5AV5A 3X1VB 1M19A 3AYWA 3B6GC 1TZYC 4H9SA 1KX3D 2JSSA 3W97C 5B31A 3AZID 3AZKA 2BYKA 1F66D 4X23C 3RELB 3X1VA 3MNND 2NQBB 4J8XC 5G49B 3REHC 3B0CW 3RELA 2NQBA 3B0DB 4G92B 1P3OB 3KXBC 5G49A 1AOID 3AZND 1P3OA 4WU8D 2HIOB 4NE6A 4AWLC 3C1CC 5GSUC 3REKD 4J8UD 3WA9D 4WU9B 2HIOA 1A7WA 2AROC 4Z66C 1KX5D 4ZUXA 5B0ZD 3X1TC 1KX4D 3LELC 3A6ND 4Z5TB 3AV2C 3UTBD 1P3LD 5AV6B 3AZJC 3W96C 3MGPB 3B6FC 4Z5TA 1P3MC 4J8WB 1EQZD 5AV6A 3MVDB 3X1VD 3AFAD 3MGPA 3MGSC 5E5AB 3LZ1D 1P3BC 3LZ0D 4J8WA 5KDMB 3MVDA 5CP6B 3WTPB 4DRAA 1TZYB 2CV5B 5KDMA 4YS3B 1BH8B 3O62B 4KUDB 5CP6A 3WTPA 5AVBB 3B6GA 3REJD 2F8NK 1TZYA 2CV5A 1P3FD 5C3IC 4YS3A 1F66C 1BH8A 3O62A 4KUDA 5CPIC 2F8NB 5AVBA 3X1SB 1HQ3B 3UTAB 3KXBB 1U35D 3REHA 4WU9D 2F8NA 4LD9D 3X1SA 4J8VD 1HQ3A 3NQUB 3WAAC 3UTAA 2IO5C 3AZMB 1WWSA 3KXBA 1M18B 3W99B 3AZNC 3WKJD 3AZMA 3NQUA 4WU8C 3W99A 1M18A 3V9RB 3C1CA 4QLCB 1S32B 4J8UC 5GXQB 3WA9C 5F99B 4R8PB 5B1LD 1P3AC 3AV2B 3V9RA 3AZLB 1S32A 4QLCA 5GXQA 5F99A 1B6WA 5B1MB 5E5AD 5B0ZC 5GT3B 5AVCB 4R8PA 3X1TA 1KX4C 3A6NC 3B6FB 3UTBC 3AV2A 1HTAA 2RVQD 3AZLA 1P3LC 3W96A 3WTPD 3KWQB 5GT3A 5AVCA 3B6FA 1P3BB 5JA4B 1EQZC 2F8NH 3MGRB 3AFAC 4KUDD 5B40B 3KWQA 3REIC 4JJNB 5JRGC 5BS7A 5B0YB 3LZ1C 4KGCD 1P3BA 3LZ0C 3VH6A 5B40A 5DNNC 4JJNA 5B0YA 4WZSB 3KUYD 2FJ7D 3REJC 5BNVB 1P3FC 3AV1B 4CSRB 5CHLB 3W98C 5B2JD 3WAAB 4YM6B 5BNVA 5B32D 4XZQD 3AZHB 3AYWB 3AV1A 1U35C 1ZLAD 2HUEB 5BNXB 5FUGB 1N1JB 4J8VC 4LD9C 2PYOB 3WAAA 3LJAB 3AZEB 4YM6A 1P34D 3AZHA 5B1MD 3WKJC 5BNXA 5FUGA 4ZBJC 1N1JA 2PYOA 3LJAA 3AZEA 3AN2D 1ID3B 3MGQD 5GT0C 3X1UB 5B1LC 4DRBA 5AV8B 1M1AB 1ULYA 3MGRD 1ID3A 5B0YD 3X1UA 4XUJD 1P3KD 3C1BB 4H9OB 5AV8A 1M1AA 5B24B 1H3OB 5B31G 5AV9D 3C1BA 1B67A 4H9OA 5DNMB 4ZUXB 3AZFD 3UT9D 5B24A 1P3GB 2NZDD 1H3OA 4EO5C 5CPJB 5B33D 3AV1D 4KGCC 5DNMA 1P3GA 5B2IB 5AV5D 4Z2MH 5CPJA 3AYWD 1M19D 4WV4B 5CPKB 3KUYC 2FJ7C 5B31D 5AY8B 5B2IA 3LJAD 4NE5A 3AZKD 3TU4B 4UUZB 5CPKA 3WTPE 1P3PC 5AY8A 3W98A 3RELD 5B2JC 1P3IC 2NQBD 3AZGC 4XZQC 3TU4A 1ZLAC 4UUZA 3B6GB 3W97B 4X23B 1P34C 1P3OD 4J8XB 1KX3C 3W97A 5GT0B 3REHB 3AZIC 4X23A 4G91C 3MNNC 2HIOD 4J8XA 3AN2C 3NQJB 3MGQC 1KU5A 5GT0A 4ZUXD 3NQJA 4AWLB 1F1EA 4XUJC 3C1CB 1P3KC 5GSUB 1AOIC 4M6BA 4Z5TD 2AROB 5AV6D 4Z66B 5AV9C 5GSUA 3REKC 3MGPD 3AZFC 3X1TB 3UT9C 3LELB 4J8WD 2AROA 2NZDC 3MVDD 4Z66A 3AZJB 3W96B 5B33C 1KX5C 4HGAC 2F8NG 3LELA 1P3MB 5AV5C 3AZJA 5CP6D 1M19C 3B6GD 3MGSB 4H9SC 1TZYD 2CV5D 5BT1D 1P3MA 5B31C 3AZKC 4YS3D 3VH5A 3X1VC 3O62D 5AVBD 4J8XD 3MGSA 1P3PA 3REHD 5B32G 5BO0B 3RELC 2NQBC 3AZGA 2F8ND 3X1SD 1HQ3D 3UTAD 3KXBD 3VH6T 5BO0A 5C3IB 3B0DC 1F66B 4G92C 1P3OC 3AZMD 5CPIB 3W99D 1M18D 1KX3A 3C1CD 5GSUD 1F66A 3MNNA 5CPIA 2HIOC 2IO5B 1S32D 4QLCD 5GXQD 4WU9C 5F99D 4H9NA 3AZNB 4R8PD 3X1TD 4WU8B 1BFMA 3AV2D 3AZLD 3W96D 3VH6W 4J8UB 3AZNA 3WA9B 5GT3D 5AVCD 3B6FD 4Z5TC 4WU8A 3R45B 1P3AB 3KWQD 4J8UA 3WA9A 3MGPC 4E45A 1KX5B 5B0ZB 3R45A 1P3BD 1KX4B 3A6NB 4J8WC 1P3AA 3UTBB 3MVDC 1P3LB 5B40D 4JJND 1KX5A 5E5AC 5B0ZA 1KX4A 3A6NA 3UTBA 2RVQC 1EQZB 1P3LA 5CP6C 3WTPC 3AFAB 3REIB 5JRGB 2CV5C 5BT1C 3LZ1B 3LZ0B 4YS3C 1EQZA 4Z2MG 3O62C 4KUDC 3AFAA 5CPID 5AVBC 5DNNB 3REIA 5JRGA 3LZ1A 2CWEA 2BYMB 3LZ0A 3X1SC 5DNNA 1HQ3C 3WAAD 3UTAC 4YM6D 3REJB 3AZHD 3KSYA 2BYMA 1P3FB 1TAFB 3AZMC 2PYOD 3AZED 3W98B 3W99C 1M18C 3REJA 1P3FA 1U35B 4KHAB 1TAFA 4NFTA 4LD9B 4J8VB 2YFVB 1P3AD 5B32C 1S32C 4QLCC 1U35A 5GXQC 5F99C 4KHAA 4WU9A 1ID3D 3WKJB 3X1UD 4R8PC 4ZBJB 4LD9A 4J8VA 1Q9CA 2YFVA 5AV8D 1M1AD 3AZLC 4WNNB 4H9QB 5B1MC 3WKJA 5GT3C 5AVCC 3C1BD 5B1LB
chains in the Genus database with same CATH superfamily
4WNNA 4H9QA 5B24D 3KWQC 3REID 5BS7C 5JRGD 3B0BA 5B1LA 5DNMD 3MGRC 5B40C 1P3GD 5DNND 4JJNC 5B0YC 2FFFB 4CAYB 5E5AA 2L5AA 5CPJD 5B2ID 4CAYA 4EO5B 4KGCB 5CPKD 2W8SA 5AY8D 3W98D 1T3UA 3TU4D 4KGCA 3AV1C 2F2AC 3KUYB 2FJ7B 4E44A 4YM6C 3AZHC 3AYWC 2HUEC 2Y2JA 3KUYA 1P3PB 2FJ7A 3W97D 2PYOC 3LJAC 3AZEC 4X23D 5B2JB 1P3IB 3AZGB 4XZQB 5B32B 1JFIB 3VH5T 1ZLAB 5GT0D 1P3IA 5B2JA 4XZQA 5B32A 1P34B 4NE3A 1JFIA 1ZLAA 1ID3C 1KX3B 3X1UC 3AZIB 5AV8C 1P34A 1M1AC 4G91B 3MNNB 3AN2B 5B1MA 3MGQB 2Y2NA 2YFWB 2Y2GA 3C1BC 3AZIA 4H9NB 2LY8A 5B24C 2AROD 3AN2A 4Z66D 3MGQA 2YFWA 3VH5W 3H0LC 4H9RB 4XUJB 1P3KB 5DNMC 4ZUXC 1AOIB 5JA4A 3LELD 3MGRA 1BH9B 1P3GC 3AZJD 1R4VA 4XUJA 4H9RA 5AV9B 3REKB 5CPJC 1P3KA 1AOIA 2UWXA 2G5HC 3AZFB 1BH9A 3UT9B 1P3MD 5B2IC 2NZDB 5AV6C 5AV9A 3REKA 5B33B 3B0CT 4HGAB 3MGSD 5CPKC 3AZFA 1WWIA 1P3PD 3UT9A 4H9PB 5AY8C 2NZDA 1P3ID 5AV5B 3AZGD 3TU4C 5B33A 1M19B 4CSRA 4H9PA 5B31B 3AZKB 2BYKB 5AV5A 3X1VB 1M19A 3AYWA 3B6GC 1TZYC 4H9SA 1KX3D 2JSSA 3W97C 5B31A 3AZID 3AZKA 2BYKA 1F66D 4X23C 3RELB 3X1VA 3MNND 2NQBB 4J8XC 5G49B 3REHC 3B0CW 3RELA 2NQBA 3B0DB 4G92B 1P3OB 3KXBC 5G49A 1AOID 3AZND 1P3OA 4WU8D 2HIOB 4NE6A 4AWLC 3C1CC 5GSUC 3REKD 4J8UD 3WA9D 4WU9B 2ZY5A 2HIOA 1A7WA 2AROC 2Y2IA 4Z66C 1KX5D 4ZUXA 5B0ZD 3X1TC 1KX4D 3LELC 3A6ND 4Z5TB 3EPJA 3AV2C 3UTBD 1P3LD 5AV6B 3AZJC 3W96C 3MGPB 3B6FC 4Z5TA 1P3MC 4J8WB 1EQZD 5AV6A 3MVDB 3X1VD 2XD5A 3AFAD 3MGPA 3MGSC 5E5AB 3LZ1D 2Y2PA 1P3BC 3LZ0D 4J8WA 5KDMB 3MVDA 5CP6B 3WTPB 4DRAA 1TZYB 2CV5B 5KDMA 4YS3B 1BH8B 3O62B 4KUDB 5CP6A 3WTPA 5AVBB 3B6GA 3REJD 2F8NK 1TZYA 2CV5A 1P3FD 5C3IC 4YS3A 1F66C 1BH8A 2JE5A 3O62A 4KUDA 5CPIC 2F8NB 5AVBA 3X1SB 1HQ3B 3UTAB 3KXBB 1U35D 3REHA 4WU9D 2F8NA 4LD9D 3X1SA 4J8VD 1HQ3A 3NQUB 3WAAC 3UTAA 2IO5C 3IP4C 1WWSA 3KXBA 3AZMB 1M18B 3W99B 3AZNC 3WKJD 3AZMA 3NQUA 4WU8C 3W99A 1M18A 3V9RB 3C1CA 4QLCB 1S32B 4J8UC 5GXQB 3WA9C 5F99B 2Y2KA 4R8PB 5B1LD 1P3AC 3AV2B 3V9RA 3AZLB 1S32A 4QLCA 4DQYB 5GXQA 2Y2QA 5F99A 1B6WA 5B1MB 5E5AD 5B0ZC 5GT3B 5AVCB 4R8PA 3X1TA 1KX4C 3A6NC 3B6FB 3UTBC 3AV2A 1HTAA 2RVQD 3AZLA 1P3LC 3W96A 3WTPD 3KWQB 5GT3A 5AVCA 3B6FA 2VQRA 2ZY2A 1P3BB 5JA4B 1EQZC 2F8NH 3MGRB 3AFAC 4KUDD 5B40B 3KWQA 3REIC 4JJNB 5JRGC 5BS7A 5B0YB 3LZ1C 4KGCD 1P3BA 3LZ0C 3VH6A 5B40A 5DNNC 4JJNA 5B0YA 4WZSB 3EPHA 3KUYD 2FJ7D 3REJC 5BNVB 1P3FC 3AV1B 4CSRB 5CHLB 3W98C 5B2JD 3WAAB 4YM6B 5BNVA 5B32D 4XZQD 3AZHB 3AYWB 3AV1A 1U35C 1ZLAD 2HUEB 5BNXB 5FUGB 1N1JB 4J8VC 4LD9C 2PYOB 3WAAA 3LJAB 3AZEB 2XD1A 4YM6A 1P34D 3KFUG 3AZHA 5B1MD 3WKJC 5BNXA 5FUGA 4ZBJC 1N1JA 2PYOA 3LJAA 3AZEA 3AN2D 1ID3B 3MGQD 5GT0C 3X1UB 5B1LC 4DRBA 2Y2LA 2RIQA 5AV8B 1M1AB 1ULYA 3MGRD 3AL0C 2Y2OA 1ID3A 5B0YD 3X1UA 3F6TA 4XUJD 2J8PA 1P3KD 3C1BB 4H9OB 5AV8A 1M1AA 5B24B 1H3OB 5B31G 5AV9D 3C1BA 1B67A 4H9OA 5DNMB 4ZUXB 3AZFD 3UT9D 5B24A 1P3GB 2NZDD 1H3OA 2ZM5A 4EO5C 3H0MC 5CPJB 5B33D 3AV1D 4KGCC 5DNMA 1P3GA 5B2IB 5AV5D 4Z2MH 5CPJA 3FDDA 3AYWD 1M19D 4WV4B 5CPKB 3KUYC 2FJ7C 5B31D 5AY8B 5B2IA 3LJAD 4NE5A 3AZKD 3TU4B 4UUZB 5CPKA 3WTPE 1P3PC 5AY8A 3W98A 3RELD 5B2JC 1P3IC 2NQBD 3AZGC 4XZQC 3TU4A 1ZLAC 4UUZA 3B6GB 2G5IC 3W97B 4X23B 1P34C 1P3OD 4J8XB 2DF4C 1KX3C 3W97A 5GT0B 3REHB 3AZIC 4X23A 4G91C 3MNNC 2HIOD 4J8XA 3AN2C 2ZY3A 3NQJB 3MGQC 1KU5A 5GT0A 4ZUXD 3NQJA 4AWLB 1F1EA 4XUJC 3C1CB 1P3KC 5GSUB 1AOIC 4M6BA 3H0RC 4Z5TD 2AROB 5AV6D 4Z66B 5AV9C 5GSUA 3REKC 3MGPD 3AZFC 3X1TB 2Y2HA 3UT9C 3LELB 4J8WD 2AROA 2NZDC 3MVDD 4Z66A 2Y2MA 3AZJB 3W96B 3EPLA 5B33C 2JCHA 4HGAC 1KX5C 2F8NG 3LELA 1P3MB 1W2EA 5AV5C 3AZJA 5CP6D 1M19C 3B6GD 2DQNC 3MGSB 4H9SC 1TZYD 2CV5D 5BT1D 1P3MA 5B31C 3AZKC 4YS3D 4WJ3C 3VH5A 3X1VC 3O62D 5AVBD 4J8XD 3MGSA 1P3PA 3REHD 5B32G 5BO0B 3RELC 2NQBC 3AZGA 2F8ND 3X1SD 1HQ3D 3UTAD 3KXBD 3VH6T 5BO0A 5C3IB 3B0DC 1F66B 4UPKA 4G92C 1P3OC 3AZMD 5CPIB 3W99D 1M18D 1KX3A 3C1CD 5GSUD 1F66A 3MNNA 3EPKA 5CPIA 2HIOC 2IO5B 1S32D 4QLCD 5GXQD 4WU9C 5F99D 4H9NA 3AZNB 4R8PD 3X1TD 4WU8B 1BFMA 3AV2D 3AZLD 3W96D 3VH6W 4J8UB 3AZNA 3WA9B 3A1IA 5GT3D 5AVCD 3B6FD 4Z5TC 4WU8A 3R45B 3A1KA 1P3AB 3KWQD 4J8UA 3WA9A 3MGPC 4E45A 1KX5B 5B0ZB 3R45A 1P3BD 1KX4B 3A6NB 4J8WC 1P3AA 3UTBB 3MVDC 1P3LB 5B40D 4JJND 1KX5A 5E5AC 5B0ZA 1KX4A 3P5JB 3A6NA 1PZRA 3UTBA 2RVQC 1EQZB 1P3LA 2BG1A 5CP6C 3WTPC 3AFAB 3REIB 5JRGB 2CV5C 5BT1C 3LZ1B 3LZ0B 4YS3C 1EQZA 4Z2MG 3O62C 4KUDC 3AFAA 5CPID 5AVBC 5DNNB 3REIA 5JRGA 3LZ1A 2CWEA 2BYMB 3LZ0A 3X1SC 5DNNA 1HQ3C 3WAAD 3UTAC 4YM6D 3REJB 3AZHD 2BYMA 3KSYA 1P3FB 1TAFB 3AZMC 2PYOD 3AZED 3W98B 3W99C 1M18C 3REJA 1P3FA 1U35B 4KHAB 1TAFA 4NFTA 2ZY4A 3EG5B 4LD9B 4J8VB 2YFVB 1P3AD 5B32C 1S32C 4QLCC 1U35A 5GXQC 5F99C 4KHAA 4WU9A 1ID3D 3WKJB 3X1UD 4R8PC 4ZBJB 4LD9A 4J8VA 1Q9CA 2YFVA 5AV8D 1M1AD 3AZLC 4WNNB 4H9QB 5B1MC 3WKJA 5GT3C 5AVCC 1Z2CB 3C1BD 5B1LB
chains in the Genus database with same CATH topology
4WNNA 4H9QA 5B24D 3KWQC 3REID 5BS7C 5JRGD 3B0BA 5B1LA 5DNMD 3MGRC 5B40C 1P3GD 5DNND 4JJNC 5B0YC 2FFFB 4CAYB 5E5AA 2L5AA 5CPJD 5B2ID 4CAYA 4EO5B 4KGCB 5CPKD 2W8SA 5AY8D 3W98D 1T3UA 3TU4D 4KGCA 3AV1C 2F2AC 3KUYB 2FJ7B 4E44A 4YM6C 3AZHC 3AYWC 2HUEC 2Y2JA 3KUYA 1P3PB 2FJ7A 3W97D 2PYOC 3LJAC 3AZEC 4X23D 5B2JB 1P3IB 3AZGB 4XZQB 5B32B 1JFIB 3VH5T 1ZLAB 5GT0D 1P3IA 5B2JA 4XZQA 5B32A 1P34B 4NE3A 1JFIA 1ZLAA 1ID3C 1KX3B 3X1UC 3AZIB 5AV8C 1P34A 1M1AC 4G91B 3MNNB 3AN2B 5B1MA 3MGQB 2Y2NA 2YFWB 2Y2GA 3C1BC 3AZIA 4H9NB 2LY8A 5B24C 2AROD 3AN2A 4Z66D 3MGQA 2YFWA 3VH5W 3H0LC 4H9RB 4XUJB 1P3KB 5DNMC 4ZUXC 1AOIB 5JA4A 3LELD 3MGRA 1BH9B 1P3GC 3AZJD 1R4VA 4XUJA 4H9RA 5AV9B 3REKB 5CPJC 1P3KA 1AOIA 2UWXA 2G5HC 3AZFB 1BH9A 3UT9B 1P3MD 5B2IC 2NZDB 5AV6C 5AV9A 3REKA 5B33B 3B0CT 4HGAB 3MGSD 5CPKC 3AZFA 1WWIA 1P3PD 3UT9A 4H9PB 5AY8C 2NZDA 1P3ID 5AV5B 3AZGD 3TU4C 5B33A 1M19B 4CSRA 4H9PA 5B31B 3AZKB 2BYKB 5AV5A 3X1VB 1M19A 3AYWA 3B6GC 1TZYC 4H9SA 1KX3D 2JSSA 3W97C 5B31A 3AZID 3AZKA 2BYKA 1F66D 4X23C 3RELB 3X1VA 3MNND 2NQBB 4J8XC 5G49B 3REHC 3B0CW 3RELA 2NQBA 3B0DB 4G92B 1P3OB 3KXBC 5G49A 1AOID 3AZND 1P3OA 4WU8D 2HIOB 4NE6A 4AWLC 3C1CC 5GSUC 3REKD 4J8UD 3WA9D 4WU9B 2ZY5A 2HIOA 1A7WA 2AROC 2Y2IA 4Z66C 1KX5D 4ZUXA 5B0ZD 3X1TC 1KX4D 3LELC 3A6ND 4Z5TB 3EPJA 3AV2C 3UTBD 1P3LD 5AV6B 3AZJC 3W96C 3MGPB 3B6FC 4Z5TA 1P3MC 4J8WB 1EQZD 5AV6A 3MVDB 3X1VD 2XD5A 3AFAD 3MGPA 3MGSC 5E5AB 3LZ1D 2Y2PA 1P3BC 3LZ0D 4J8WA 5KDMB 3MVDA 5CP6B 3WTPB 4DRAA 1TZYB 2CV5B 5KDMA 4YS3B 1BH8B 3O62B 4KUDB 5CP6A 3WTPA 5AVBB 3B6GA 3REJD 2F8NK 1TZYA 2CV5A 1P3FD 5C3IC 4YS3A 1F66C 1BH8A 2JE5A 3O62A 4KUDA 5CPIC 2F8NB 5AVBA 3X1SB 1HQ3B 3UTAB 3KXBB 1U35D 3REHA 4WU9D 2F8NA 4LD9D 3X1SA 4J8VD 1HQ3A 3NQUB 3WAAC 3UTAA 2IO5C 3IP4C 1WWSA 3KXBA 3AZMB 1M18B 3W99B 3AZNC 3WKJD 3AZMA 3NQUA 4WU8C 3W99A 1M18A 3V9RB 3C1CA 4QLCB 1S32B 4J8UC 5GXQB 3WA9C 5F99B 2Y2KA 4R8PB 5B1LD 1P3AC 3AV2B 3V9RA 3AZLB 1S32A 4QLCA 4DQYB 5GXQA 2Y2QA 5F99A 1B6WA 5B1MB 5E5AD 5B0ZC 5GT3B 5AVCB 4R8PA 3X1TA 1KX4C 3A6NC 3B6FB 3UTBC 3AV2A 1HTAA 2RVQD 3AZLA 1P3LC 3W96A 3WTPD 3KWQB 5GT3A 5AVCA 3B6FA 2VQRA 2ZY2A 1P3BB 5JA4B 1EQZC 2F8NH 3MGRB 3AFAC 4KUDD 5B40B 3KWQA 3REIC 4JJNB 5JRGC 5BS7A 5B0YB 3LZ1C 4KGCD 1P3BA 3LZ0C 3VH6A 5B40A 5DNNC 4JJNA 5B0YA 4WZSB 3EPHA 3KUYD 2FJ7D 3REJC 5BNVB 1P3FC 3AV1B 4CSRB 5CHLB 3W98C 5B2JD 3WAAB 4YM6B 5BNVA 5B32D 4XZQD 3AZHB 3AYWB 3AV1A 1U35C 1ZLAD 2HUEB 5BNXB 5FUGB 1N1JB 4J8VC 4LD9C 2PYOB 3WAAA 3LJAB 3AZEB 2XD1A 4YM6A 1P34D 3KFUG 3AZHA 5B1MD 3WKJC 5BNXA 5FUGA 4ZBJC 1N1JA 2PYOA 3LJAA 3AZEA 3AN2D 1ID3B 3MGQD 5GT0C 3X1UB 5B1LC 4DRBA 2Y2LA 2RIQA 5AV8B 1M1AB 1ULYA 3MGRD 3AL0C 2Y2OA 1ID3A 5B0YD 3X1UA 3F6TA 4XUJD 2J8PA 1P3KD 3C1BB 4H9OB 5AV8A 1M1AA 5B24B 1H3OB 5B31G 5AV9D 3C1BA 1B67A 4H9OA 5DNMB 4ZUXB 3AZFD 3UT9D 5B24A 1P3GB 2NZDD 1H3OA 2ZM5A 4EO5C 3H0MC 5CPJB 5B33D 3AV1D 4KGCC 5DNMA 1P3GA 5B2IB 5AV5D 4Z2MH 5CPJA 3FDDA 3AYWD 1M19D 4WV4B 5CPKB 3KUYC 2FJ7C 5B31D 5AY8B 5B2IA 3LJAD 4NE5A 3AZKD 3TU4B 4UUZB 5CPKA 3WTPE 1P3PC 5AY8A 3W98A 3RELD 5B2JC 1P3IC 2NQBD 3AZGC 4XZQC 3TU4A 1ZLAC 4UUZA 3B6GB 2G5IC 3W97B 4X23B 1P34C 1P3OD 4J8XB 2DF4C 1KX3C 3W97A 5GT0B 3REHB 3AZIC 4X23A 4G91C 3MNNC 2HIOD 4J8XA 3AN2C 2ZY3A 3NQJB 3MGQC 1KU5A 5GT0A 4ZUXD 3NQJA 4AWLB 1F1EA 4XUJC 3C1CB 1P3KC 5GSUB 1AOIC 4M6BA 3H0RC 4Z5TD 2AROB 5AV6D 4Z66B 5AV9C 5GSUA 3REKC 3MGPD 3AZFC 3X1TB 2Y2HA 3UT9C 3LELB 4J8WD 2AROA 2NZDC 3MVDD 4Z66A 2Y2MA 3AZJB 3W96B 3EPLA 5B33C 2JCHA 4HGAC 1KX5C 2F8NG 3LELA 1P3MB 1W2EA 5AV5C 3AZJA 5CP6D 1M19C 3B6GD 2DQNC 3MGSB 4H9SC 1TZYD 2CV5D 5BT1D 1P3MA 5B31C 3AZKC 4YS3D 4WJ3C 3VH5A 3X1VC 3O62D 5AVBD 4J8XD 3MGSA 1P3PA 3REHD 5B32G 5BO0B 3RELC 2NQBC 3AZGA 2F8ND 3X1SD 1HQ3D 3UTAD 3KXBD 3VH6T 5BO0A 5C3IB 3B0DC 1F66B 4UPKA 4G92C 1P3OC 3AZMD 5CPIB 3W99D 1M18D 1KX3A 3C1CD 5GSUD 1F66A 3MNNA 3EPKA 5CPIA 2HIOC 2IO5B 1S32D 4QLCD 5GXQD 4WU9C 5F99D 4H9NA 3AZNB 4R8PD 3X1TD 4WU8B 1BFMA 3AV2D 3AZLD 3W96D 3VH6W 4J8UB 3AZNA 3WA9B 3A1IA 5GT3D 5AVCD 3B6FD 4Z5TC 4WU8A 3R45B 3A1KA 1P3AB 3KWQD 4J8UA 3WA9A 3MGPC 4E45A 1KX5B 5B0ZB 3R45A 1P3BD 1KX4B 3A6NB 4J8WC 1P3AA 3UTBB 3MVDC 1P3LB 5B40D 4JJND 1KX5A 5E5AC 5B0ZA 1KX4A 3P5JB 3A6NA 1PZRA 3UTBA 2RVQC 1EQZB 1P3LA 2BG1A 5CP6C 3WTPC 3AFAB 3REIB 5JRGB 2CV5C 5BT1C 3LZ1B 3LZ0B 4YS3C 1EQZA 4Z2MG 3O62C 4KUDC 3AFAA 5CPID 5AVBC 5DNNB 3REIA 5JRGA 3LZ1A 2CWEA 2BYMB 3LZ0A 3X1SC 5DNNA 1HQ3C 3WAAD 3UTAC 4YM6D 3REJB 3AZHD 2BYMA 3KSYA 1P3FB 1TAFB 3AZMC 2PYOD 3AZED 3W98B 3W99C 1M18C 3REJA 1P3FA 1U35B 4KHAB 1TAFA 4NFTA 2ZY4A 3EG5B 4LD9B 4J8VB 2YFVB 1P3AD 5B32C 1S32C 4QLCC 1U35A 5GXQC 5F99C 4KHAA 4WU9A 1ID3D 3WKJB 3X1UD 4R8PC 4ZBJB 4LD9A 4J8VA 1Q9CA 2YFVA 5AV8D 1M1AD 3AZLC 4WNNB 4H9QB 5B1MC 3WKJA 5GT3C 5AVCC 1Z2CB 3C1BD 5B1LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNN A;  4H9Q A;  5B24 D;  3KWQ C;  3REI D;  5BS7 C;  5JRG D;  3B0B A;  5B1L A;  5DNM D;  3MGR C;  5B40 C;  1P3G D;  5DNN D;  4JJN C;  5B0Y C;  4CAY B;  5E5A A;  2L5A A;  5CPJ D;  5B2I D;  4CAY A;  4EO5 B;  4KGC B;  5CPK D;  5AY8 D;  3W98 D;  3TU4 D;  4KGC A;  3AV1 C;  3KUY B;  2FJ7 B;  4E44 A;  4YM6 C;  3AZH C;  3AYW C;  2HUE C;  3KUY A;  1P3P B;  2FJ7 A;  3W97 D;  2PYO C;  3LJA C;  3AZE C;  4X23 D;  5B2J B;  1P3I B;  3AZG B;  4XZQ B;  5B32 B;  1JFI B;  3VH5 T;  1ZLA B;  5GT0 D;  1P3I A;  5B2J A;  4XZQ A;  5B32 A;  1P34 B;  4NE3 A;  1JFI A;  1ZLA A;  1ID3 C;  1KX3 B;  3X1U C;  3AZI B;  5AV8 C;  1P34 A;  1M1A C;  4G91 B;  3MNN B;  3AN2 B;  5B1M A;  3MGQ B;  3C1B C;  2YFW B;  3AZI A;  4H9N B;  2LY8 A;  5B24 C;  2ARO D;  3AN2 A;  4Z66 D;  3MGQ A;  2YFW A;  3VH5 W;  4XUJ B;  4H9R B;  1P3K B;  1AOI B;  5DNM C;  4ZUX C;  5JA4 A;  3LEL D;  3MGR A;  1BH9 B;  1P3G C;  3AZJ D;  1R4V A;  4XUJ A;  4H9R A;  5AV9 B;  3REK B;  5CPJ C;  1P3K A;  1AOI A;  3AZF B;  1BH9 A;  3UT9 B;  1P3M D;  5B2I C;  2NZD B;  5AV6 C;  5AV9 A;  3REK A;  5B33 B;  3B0C T;  4HGA B;  3MGS D;  5CPK C;  3AZF A;  1WWI A;  1P3P D;  3UT9 A;  4H9P B;  5AY8 C;  2NZD A;  1P3I D;  5AV5 B;  3AZG D;  3TU4 C;  5B33 A;  1M19 B;  4CSR A;  4H9P A;  5B31 B;  3AZK B;  2BYK B;  5AV5 A;  3X1V B;  1M19 A;  3AYW A;  3B6G C;  1TZY C;  4H9S A;  1KX3 D;  2JSS A;  3W97 C;  5B31 A;  3AZI D;  3AZK A;  2BYK A;  1F66 D;  4X23 C;  3REL B;  3X1V A;  3MNN D;  2NQB B;  4J8X C;  5G49 B;  3REH C;  3B0C W;  3REL A;  2NQB A;  3B0D B;  4G92 B;  1P3O B;  3KXB C;  5G49 A;  1AOI D;  3AZN D;  1P3O A;  4WU8 D;  2HIO B;  4NE6 A;  4AWL C;  3C1C C;  5GSU C;  3REK D;  4J8U D;  3WA9 D;  4WU9 B;  2HIO A;  1A7W A;  2ARO C;  4Z66 C;  1KX5 D;  4ZUX A;  5B0Z D;  3X1T C;  1KX4 D;  3LEL C;  3A6N D;  4Z5T B;  3AV2 C;  3UTB D;  1P3L D;  5AV6 B;  3AZJ C;  3W96 C;  3MGP B;  3B6F C;  4Z5T A;  1P3M C;  4J8W B;  1EQZ D;  5AV6 A;  3MVD B;  3X1V D;  3AFA D;  3MGP A;  3MGS C;  5E5A B;  3LZ1 D;  1P3B C;  3LZ0 D;  4J8W A;  5KDM B;  3MVD A;  5CP6 B;  3WTP B;  4DRA A;  1TZY B;  2CV5 B;  5KDM A;  4YS3 B;  1BH8 B;  3O62 B;  4KUD B;  5CP6 A;  3WTP A;  5AVB B;  3B6G A;  3REJ D;  2F8N K;  1TZY A;  2CV5 A;  1P3F D;  5C3I C;  4YS3 A;  1F66 C;  1BH8 A;  3O62 A;  4KUD A;  5CPI C;  2F8N B;  5AVB A;  3X1S B;  1HQ3 B;  3UTA B;  3KXB B;  1U35 D;  3REH A;  4WU9 D;  2F8N A;  4LD9 D;  3X1S A;  4J8V D;  1HQ3 A;  3NQU B;  3WAA C;  3UTA A;  2IO5 C;  3AZM B;  1WWS A;  3KXB A;  1M18 B;  3W99 B;  3AZN C;  3WKJ D;  3AZM A;  3NQU A;  4WU8 C;  3W99 A;  1M18 A;  3V9R B;  3C1C A;  4QLC B;  1S32 B;  4J8U C;  5GXQ B;  3WA9 C;  5F99 B;  4R8P B;  5B1L D;  1P3A C;  3AV2 B;  3V9R A;  3AZL B;  1S32 A;  4QLC A;  5GXQ A;  5F99 A;  1B6W A;  5B1M B;  5E5A D;  5B0Z C;  5GT3 B;  5AVC B;  4R8P A;  3X1T A;  1KX4 C;  3A6N C;  3B6F B;  3UTB C;  3AV2 A;  1HTA A;  2RVQ D;  3AZL A;  1P3L C;  3W96 A;  3WTP D;  3KWQ B;  5GT3 A;  5AVC A;  3B6F A;  1P3B B;  5JA4 B;  1EQZ C;  2F8N H;  3MGR B;  3AFA C;  4KUD D;  5B40 B;  3KWQ A;  3REI C;  4JJN B;  5JRG C;  5BS7 A;  5B0Y B;  3LZ1 C;  4KGC D;  1P3B A;  3LZ0 C;  3VH6 A;  5B40 A;  5DNN C;  4JJN A;  5B0Y A;  4WZS B;  3KUY D;  2FJ7 D;  3REJ C;  5BNV B;  1P3F C;  3AV1 B;  4CSR B;  5CHL B;  3W98 C;  5B2J D;  3WAA B;  4YM6 B;  5BNV A;  5B32 D;  4XZQ D;  3AZH B;  3AYW B;  3AV1 A;  1U35 C;  1ZLA D;  2HUE B;  5BNX B;  5FUG B;  1N1J B;  4J8V C;  4LD9 C;  2PYO B;  3WAA A;  3LJA B;  3AZE B;  4YM6 A;  1P34 D;  3AZH A;  5B1M D;  3WKJ C;  5BNX A;  5FUG A;  4ZBJ C;  1N1J A;  2PYO A;  3LJA A;  3AZE A;  3AN2 D;  1ID3 B;  3MGQ D;  5GT0 C;  3X1U B;  5B1L C;  4DRB A;  5AV8 B;  1M1A B;  1ULY A;  3MGR D;  1ID3 A;  5B0Y D;  3X1U A;  4XUJ D;  1P3K D;  3C1B B;  4H9O B;  5AV8 A;  1M1A A;  5B24 B;  1H3O B;  5B31 G;  5AV9 D;  3C1B A;  1B67 A;  4H9O A;  5DNM B;  4ZUX B;  3AZF D;  3UT9 D;  5B24 A;  1P3G B;  2NZD D;  1H3O A;  4EO5 C;  5CPJ B;  5B33 D;  3AV1 D;  4KGC C;  5DNM A;  1P3G A;  5B2I B;  5AV5 D;  4Z2M H;  5CPJ A;  3AYW D;  1M19 D;  4WV4 B;  5CPK B;  3KUY C;  2FJ7 C;  5B31 D;  5AY8 B;  5B2I A;  3LJA D;  4NE5 A;  3AZK D;  3TU4 B;  4UUZ B;  5CPK A;  3WTP E;  1P3P C;  5AY8 A;  3W98 A;  3REL D;  5B2J C;  1P3I C;  2NQB D;  3AZG C;  4XZQ C;  3TU4 A;  1ZLA C;  4UUZ A;  3B6G B;  3W97 B;  4X23 B;  1P34 C;  1P3O D;  4J8X B;  1KX3 C;  3W97 A;  5GT0 B;  3REH B;  3AZI C;  4X23 A;  4G91 C;  3MNN C;  2HIO D;  4J8X A;  3AN2 C;  3NQJ B;  3MGQ C;  1KU5 A;  5GT0 A;  4ZUX D;  3NQJ A;  4AWL B;  1F1E A;  4XUJ C;  3C1C B;  1P3K C;  5GSU B;  1AOI C;  4M6B A;  4Z5T D;  2ARO B;  5AV6 D;  4Z66 B;  5AV9 C;  5GSU A;  3REK C;  3MGP D;  3AZF C;  3X1T B;  3UT9 C;  3LEL B;  4J8W D;  2ARO A;  2NZD C;  3MVD D;  4Z66 A;  3AZJ B;  3W96 B;  5B33 C;  1KX5 C;  4HGA C;  2F8N G;  3LEL A;  1P3M B;  5AV5 C;  3AZJ A;  5CP6 D;  1M19 C;  3B6G D;  3MGS B;  4H9S C;  1TZY D;  2CV5 D;  5BT1 D;  1P3M A;  5B31 C;  3AZK C;  4YS3 D;  3VH5 A;  3X1V C;  3O62 D;  5AVB D;  4J8X D;  3MGS A;  1P3P A;  3REH D;  5B32 G;  5BO0 B;  3REL C;  2NQB C;  3AZG A;  2F8N D;  3X1S D;  1HQ3 D;  3UTA D;  3KXB D;  3VH6 T;  5BO0 A;  5C3I B;  3B0D C;  1F66 B;  4G92 C;  1P3O C;  3AZM D;  5CPI B;  3W99 D;  1M18 D;  1KX3 A;  3C1C D;  5GSU D;  1F66 A;  3MNN A;  5CPI A;  2HIO C;  2IO5 B;  1S32 D;  4QLC D;  5GXQ D;  4WU9 C;  5F99 D;  4H9N A;  3AZN B;  4R8P D;  3X1T D;  4WU8 B;  1BFM A;  3AV2 D;  3AZL D;  3W96 D;  3VH6 W;  4J8U B;  3AZN A;  3WA9 B;  5GT3 D;  5AVC D;  3B6F D;  4Z5T C;  4WU8 A;  3R45 B;  1P3A B;  3KWQ D;  4J8U A;  3WA9 A;  3MGP C;  4E45 A;  1KX5 B;  5B0Z B;  3R45 A;  1P3B D;  1KX4 B;  3A6N B;  4J8W C;  1P3A A;  3UTB B;  3MVD C;  1P3L B;  5B40 D;  4JJN D;  1KX5 A;  5E5A C;  5B0Z A;  1KX4 A;  3A6N A;  3UTB A;  2RVQ C;  1EQZ B;  1P3L A;  5CP6 C;  3WTP C;  3AFA B;  3REI B;  5JRG B;  2CV5 C;  5BT1 C;  3LZ1 B;  3LZ0 B;  4YS3 C;  1EQZ A;  4Z2M G;  3O62 C;  4KUD C;  3AFA A;  5CPI D;  5AVB C;  5DNN B;  3REI A;  5JRG A;  3LZ1 A;  2CWE A;  2BYM B;  3LZ0 A;  3X1S C;  5DNN A;  1HQ3 C;  3WAA D;  3UTA C;  4YM6 D;  3REJ B;  3AZH D;  3KSY A;  2BYM A;  1P3F B;  1TAF B;  3AZM C;  2PYO D;  3AZE D;  3W98 B;  3W99 C;  1M18 C;  3REJ A;  1P3F A;  1U35 B;  4KHA B;  1TAF A;  4NFT A;  4LD9 B;  4J8V B;  2YFV B;  1P3A D;  5B32 C;  1S32 C;  4QLC C;  1U35 A;  5GXQ C;  5F99 C;  4KHA A;  4WU9 A;  1ID3 D;  3WKJ B;  3X1U D;  4R8P C;  4ZBJ B;  4LD9 A;  4J8V A;  1Q9C A;  2YFV A;  5AV8 D;  1M1A D;  3AZL C;  4WNN B;  4H9Q B;  5B1M C;  3WKJ A;  5GT3 C;  5AVC C;  3C1B D;  5B1L B; 
#chains in the Genus database with same CATH topology
 4WNN A;  4H9Q A;  5B24 D;  3KWQ C;  3REI D;  5BS7 C;  5JRG D;  3B0B A;  5B1L A;  5DNM D;  3MGR C;  5B40 C;  1P3G D;  5DNN D;  4JJN C;  5B0Y C;  2FFF B;  4CAY B;  5E5A A;  2L5A A;  5CPJ D;  5B2I D;  4CAY A;  4EO5 B;  4KGC B;  5CPK D;  2W8S A;  5AY8 D;  3W98 D;  1T3U A;  3TU4 D;  4KGC A;  3AV1 C;  2F2A C;  3KUY B;  2FJ7 B;  4E44 A;  4YM6 C;  3AZH C;  3AYW C;  2HUE C;  2Y2J A;  3KUY A;  1P3P B;  2FJ7 A;  3W97 D;  2PYO C;  3LJA C;  3AZE C;  4X23 D;  5B2J B;  1P3I B;  3AZG B;  4XZQ B;  5B32 B;  1JFI B;  3VH5 T;  1ZLA B;  5GT0 D;  1P3I A;  5B2J A;  4XZQ A;  5B32 A;  1P34 B;  4NE3 A;  1JFI A;  1ZLA A;  1ID3 C;  1KX3 B;  3X1U C;  3AZI B;  5AV8 C;  1P34 A;  1M1A C;  4G91 B;  3MNN B;  3AN2 B;  5B1M A;  3MGQ B;  2Y2N A;  2YFW B;  2Y2G A;  3C1B C;  3AZI A;  4H9N B;  2LY8 A;  5B24 C;  2ARO D;  3AN2 A;  4Z66 D;  3MGQ A;  2YFW A;  3VH5 W;  3H0L C;  4H9R B;  4XUJ B;  1P3K B;  5DNM C;  4ZUX C;  1AOI B;  5JA4 A;  3LEL D;  3MGR A;  1BH9 B;  1P3G C;  3AZJ D;  1R4V A;  4XUJ A;  4H9R A;  5AV9 B;  3REK B;  5CPJ C;  1P3K A;  1AOI A;  2UWX A;  2G5H C;  3AZF B;  1BH9 A;  3UT9 B;  1P3M D;  5B2I C;  2NZD B;  5AV6 C;  5AV9 A;  3REK A;  5B33 B;  3B0C T;  4HGA B;  3MGS D;  5CPK C;  3AZF A;  1WWI A;  1P3P D;  3UT9 A;  4H9P B;  5AY8 C;  2NZD A;  1P3I D;  5AV5 B;  3AZG D;  3TU4 C;  5B33 A;  1M19 B;  4CSR A;  4H9P A;  5B31 B;  3AZK B;  2BYK B;  5AV5 A;  3X1V B;  1M19 A;  3AYW A;  3B6G C;  1TZY C;  4H9S A;  1KX3 D;  2JSS A;  3W97 C;  5B31 A;  3AZI D;  3AZK A;  2BYK A;  1F66 D;  4X23 C;  3REL B;  3X1V A;  3MNN D;  2NQB B;  4J8X C;  5G49 B;  3REH C;  3B0C W;  3REL A;  2NQB A;  3B0D B;  4G92 B;  1P3O B;  3KXB C;  5G49 A;  1AOI D;  3AZN D;  1P3O A;  4WU8 D;  2HIO B;  4NE6 A;  4AWL C;  3C1C C;  5GSU C;  3REK D;  4J8U D;  3WA9 D;  4WU9 B;  2ZY5 A;  2HIO A;  1A7W A;  2ARO C;  2Y2I A;  4Z66 C;  1KX5 D;  4ZUX A;  5B0Z D;  3X1T C;  1KX4 D;  3LEL C;  3A6N D;  4Z5T B;  3EPJ A;  3AV2 C;  3UTB D;  1P3L D;  5AV6 B;  3AZJ C;  3W96 C;  3MGP B;  3B6F C;  4Z5T A;  1P3M C;  4J8W B;  1EQZ D;  5AV6 A;  3MVD B;  3X1V D;  2XD5 A;  3AFA D;  3MGP A;  3MGS C;  5E5A B;  3LZ1 D;  2Y2P A;  1P3B C;  3LZ0 D;  4J8W A;  5KDM B;  3MVD A;  5CP6 B;  3WTP B;  4DRA A;  1TZY B;  2CV5 B;  5KDM A;  4YS3 B;  1BH8 B;  3O62 B;  4KUD B;  5CP6 A;  3WTP A;  5AVB B;  3B6G A;  3REJ D;  2F8N K;  1TZY A;  2CV5 A;  1P3F D;  5C3I C;  4YS3 A;  1F66 C;  1BH8 A;  2JE5 A;  3O62 A;  4KUD A;  5CPI C;  2F8N B;  5AVB A;  3X1S B;  1HQ3 B;  3UTA B;  3KXB B;  1U35 D;  3REH A;  4WU9 D;  2F8N A;  4LD9 D;  3X1S A;  4J8V D;  1HQ3 A;  3NQU B;  3WAA C;  3UTA A;  2IO5 C;  3IP4 C;  1WWS A;  3KXB A;  3AZM B;  1M18 B;  3W99 B;  3AZN C;  3WKJ D;  3AZM A;  3NQU A;  4WU8 C;  3W99 A;  1M18 A;  3V9R B;  3C1C A;  4QLC B;  1S32 B;  4J8U C;  5GXQ B;  3WA9 C;  5F99 B;  2Y2K A;  4R8P B;  5B1L D;  1P3A C;  3AV2 B;  3V9R A;  3AZL B;  1S32 A;  4QLC A;  4DQY B;  5GXQ A;  2Y2Q A;  5F99 A;  1B6W A;  5B1M B;  5E5A D;  5B0Z C;  5GT3 B;  5AVC B;  4R8P A;  3X1T A;  1KX4 C;  3A6N C;  3B6F B;  3UTB C;  3AV2 A;  1HTA A;  2RVQ D;  3AZL A;  1P3L C;  3W96 A;  3WTP D;  3KWQ B;  5GT3 A;  5AVC A;  3B6F A;  2VQR A;  2ZY2 A;  1P3B B;  5JA4 B;  1EQZ C;  2F8N H;  3MGR B;  3AFA C;  4KUD D;  5B40 B;  3KWQ A;  3REI C;  4JJN B;  5JRG C;  5BS7 A;  5B0Y B;  3LZ1 C;  4KGC D;  1P3B A;  3LZ0 C;  3VH6 A;  5B40 A;  5DNN C;  4JJN A;  5B0Y A;  4WZS B;  3EPH A;  3KUY D;  2FJ7 D;  3REJ C;  5BNV B;  1P3F C;  3AV1 B;  4CSR B;  5CHL B;  3W98 C;  5B2J D;  3WAA B;  4YM6 B;  5BNV A;  5B32 D;  4XZQ D;  3AZH B;  3AYW B;  3AV1 A;  1U35 C;  1ZLA D;  2HUE B;  5BNX B;  5FUG B;  1N1J B;  4J8V C;  4LD9 C;  2PYO B;  3WAA A;  3LJA B;  3AZE B;  2XD1 A;  4YM6 A;  1P34 D;  3KFU G;  3AZH A;  5B1M D;  3WKJ C;  5BNX A;  5FUG A;  4ZBJ C;  1N1J A;  2PYO A;  3LJA A;  3AZE A;  3AN2 D;  1ID3 B;  3MGQ D;  5GT0 C;  3X1U B;  5B1L C;  4DRB A;  2Y2L A;  2RIQ A;  5AV8 B;  1M1A B;  1ULY A;  3MGR D;  3AL0 C;  2Y2O A;  1ID3 A;  5B0Y D;  3X1U A;  3F6T A;  4XUJ D;  2J8P A;  1P3K D;  3C1B B;  4H9O B;  5AV8 A;  1M1A A;  5B24 B;  1H3O B;  5B31 G;  5AV9 D;  3C1B A;  1B67 A;  4H9O A;  5DNM B;  4ZUX B;  3AZF D;  3UT9 D;  5B24 A;  1P3G B;  2NZD D;  1H3O A;  2ZM5 A;  4EO5 C;  3H0M C;  5CPJ B;  5B33 D;  3AV1 D;  4KGC C;  5DNM A;  1P3G A;  5B2I B;  5AV5 D;  4Z2M H;  5CPJ A;  3FDD A;  3AYW D;  1M19 D;  4WV4 B;  5CPK B;  3KUY C;  2FJ7 C;  5B31 D;  5AY8 B;  5B2I A;  3LJA D;  4NE5 A;  3AZK D;  3TU4 B;  4UUZ B;  5CPK A;  3WTP E;  1P3P C;  5AY8 A;  3W98 A;  3REL D;  5B2J C;  1P3I C;  2NQB D;  3AZG C;  4XZQ C;  3TU4 A;  1ZLA C;  4UUZ A;  3B6G B;  2G5I C;  3W97 B;  4X23 B;  1P34 C;  1P3O D;  4J8X B;  2DF4 C;  1KX3 C;  3W97 A;  5GT0 B;  3REH B;  3AZI C;  4X23 A;  4G91 C;  3MNN C;  2HIO D;  4J8X A;  3AN2 C;  2ZY3 A;  3NQJ B;  3MGQ C;  1KU5 A;  5GT0 A;  4ZUX D;  3NQJ A;  4AWL B;  1F1E A;  4XUJ C;  3C1C B;  1P3K C;  5GSU B;  1AOI C;  4M6B A;  3H0R C;  4Z5T D;  2ARO B;  5AV6 D;  4Z66 B;  5AV9 C;  5GSU A;  3REK C;  3MGP D;  3AZF C;  3X1T B;  2Y2H A;  3UT9 C;  3LEL B;  4J8W D;  2ARO A;  2NZD C;  3MVD D;  4Z66 A;  2Y2M A;  3AZJ B;  3W96 B;  3EPL A;  5B33 C;  2JCH A;  4HGA C;  1KX5 C;  2F8N G;  3LEL A;  1P3M B;  1W2E A;  5AV5 C;  3AZJ A;  5CP6 D;  1M19 C;  3B6G D;  2DQN C;  3MGS B;  4H9S C;  1TZY D;  2CV5 D;  5BT1 D;  1P3M A;  5B31 C;  3AZK C;  4YS3 D;  4WJ3 C;  3VH5 A;  3X1V C;  3O62 D;  5AVB D;  4J8X D;  3MGS A;  1P3P A;  3REH D;  5B32 G;  5BO0 B;  3REL C;  2NQB C;  3AZG A;  2F8N D;  3X1S D;  1HQ3 D;  3UTA D;  3KXB D;  3VH6 T;  5BO0 A;  5C3I B;  3B0D C;  1F66 B;  4UPK A;  4G92 C;  1P3O C;  3AZM D;  5CPI B;  3W99 D;  1M18 D;  1KX3 A;  3C1C D;  5GSU D;  1F66 A;  3MNN A;  3EPK A;  5CPI A;  2HIO C;  2IO5 B;  1S32 D;  4QLC D;  5GXQ D;  4WU9 C;  5F99 D;  4H9N A;  3AZN B;  4R8P D;  3X1T D;  4WU8 B;  1BFM A;  3AV2 D;  3AZL D;  3W96 D;  3VH6 W;  4J8U B;  3AZN A;  3WA9 B;  3A1I A;  5GT3 D;  5AVC D;  3B6F D;  4Z5T C;  4WU8 A;  3R45 B;  3A1K A;  1P3A B;  3KWQ D;  4J8U A;  3WA9 A;  3MGP C;  4E45 A;  1KX5 B;  5B0Z B;  3R45 A;  1P3B D;  1KX4 B;  3A6N B;  4J8W C;  1P3A A;  3UTB B;  3MVD C;  1P3L B;  5B40 D;  4JJN D;  1KX5 A;  5E5A C;  5B0Z A;  1KX4 A;  3P5J B;  3A6N A;  1PZR A;  3UTB A;  2RVQ C;  1EQZ B;  1P3L A;  2BG1 A;  5CP6 C;  3WTP C;  3AFA B;  3REI B;  5JRG B;  2CV5 C;  5BT1 C;  3LZ1 B;  3LZ0 B;  4YS3 C;  1EQZ A;  4Z2M G;  3O62 C;  4KUD C;  3AFA A;  5CPI D;  5AVB C;  5DNN B;  3REI A;  5JRG A;  3LZ1 A;  2CWE A;  2BYM B;  3LZ0 A;  3X1S C;  5DNN A;  1HQ3 C;  3WAA D;  3UTA C;  4YM6 D;  3REJ B;  3AZH D;  2BYM A;  3KSY A;  1P3F B;  1TAF B;  3AZM C;  2PYO D;  3AZE D;  3W98 B;  3W99 C;  1M18 C;  3REJ A;  1P3F A;  1U35 B;  4KHA B;  1TAF A;  4NFT A;  2ZY4 A;  3EG5 B;  4LD9 B;  4J8V B;  2YFV B;  1P3A D;  5B32 C;  1S32 C;  4QLC C;  1U35 A;  5GXQ C;  5F99 C;  4KHA A;  4WU9 A;  1ID3 D;  3WKJ B;  3X1U D;  4R8P C;  4ZBJ B;  4LD9 A;  4J8V A;  1Q9C A;  2YFV A;  5AV8 D;  1M1A D;  3AZL C;  4WNN B;  4H9Q B;  5B1M C;  3WKJ A;  5GT3 C;  5AVC C;  1Z2C B;  3C1B D;  5B1L B; 
#chains in the Genus database with same CATH homology
 4WNN A;  4H9Q A;  5B24 D;  3KWQ C;  3REI D;  5BS7 C;  5JRG D;  3B0B A;  5B1L A;  5DNM D;  3MGR C;  5B40 C;  1P3G D;  5DNN D;  4JJN C;  5B0Y C;  2FFF B;  4CAY B;  5E5A A;  2L5A A;  5CPJ D;  5B2I D;  4CAY A;  4EO5 B;  4KGC B;  5CPK D;  2W8S A;  5AY8 D;  3W98 D;  1T3U A;  3TU4 D;  4KGC A;  3AV1 C;  2F2A C;  3KUY B;  2FJ7 B;  4E44 A;  4YM6 C;  3AZH C;  3AYW C;  2HUE C;  2Y2J A;  3KUY A;  1P3P B;  2FJ7 A;  3W97 D;  2PYO C;  3LJA C;  3AZE C;  4X23 D;  5B2J B;  1P3I B;  3AZG B;  4XZQ B;  5B32 B;  1JFI B;  3VH5 T;  1ZLA B;  5GT0 D;  1P3I A;  5B2J A;  4XZQ A;  5B32 A;  1P34 B;  4NE3 A;  1JFI A;  1ZLA A;  1ID3 C;  1KX3 B;  3X1U C;  3AZI B;  5AV8 C;  1P34 A;  1M1A C;  4G91 B;  3MNN B;  3AN2 B;  5B1M A;  3MGQ B;  2Y2N A;  2YFW B;  2Y2G A;  3C1B C;  3AZI A;  4H9N B;  2LY8 A;  5B24 C;  2ARO D;  3AN2 A;  4Z66 D;  3MGQ A;  2YFW A;  3VH5 W;  3H0L C;  4H9R B;  4XUJ B;  1P3K B;  5DNM C;  4ZUX C;  1AOI B;  5JA4 A;  3LEL D;  3MGR A;  1BH9 B;  1P3G C;  3AZJ D;  1R4V A;  4XUJ A;  4H9R A;  5AV9 B;  3REK B;  5CPJ C;  1P3K A;  1AOI A;  2UWX A;  2G5H C;  3AZF B;  1BH9 A;  3UT9 B;  1P3M D;  5B2I C;  2NZD B;  5AV6 C;  5AV9 A;  3REK A;  5B33 B;  3B0C T;  4HGA B;  3MGS D;  5CPK C;  3AZF A;  1WWI A;  1P3P D;  3UT9 A;  4H9P B;  5AY8 C;  2NZD A;  1P3I D;  5AV5 B;  3AZG D;  3TU4 C;  5B33 A;  1M19 B;  4CSR A;  4H9P A;  5B31 B;  3AZK B;  2BYK B;  5AV5 A;  3X1V B;  1M19 A;  3AYW A;  3B6G C;  1TZY C;  4H9S A;  1KX3 D;  2JSS A;  3W97 C;  5B31 A;  3AZI D;  3AZK A;  2BYK A;  1F66 D;  4X23 C;  3REL B;  3X1V A;  3MNN D;  2NQB B;  4J8X C;  5G49 B;  3REH C;  3B0C W;  3REL A;  2NQB A;  3B0D B;  4G92 B;  1P3O B;  3KXB C;  5G49 A;  1AOI D;  3AZN D;  1P3O A;  4WU8 D;  2HIO B;  4NE6 A;  4AWL C;  3C1C C;  5GSU C;  3REK D;  4J8U D;  3WA9 D;  4WU9 B;  2ZY5 A;  2HIO A;  1A7W A;  2ARO C;  2Y2I A;  4Z66 C;  1KX5 D;  4ZUX A;  5B0Z D;  3X1T C;  1KX4 D;  3LEL C;  3A6N D;  4Z5T B;  3EPJ A;  3AV2 C;  3UTB D;  1P3L D;  5AV6 B;  3AZJ C;  3W96 C;  3MGP B;  3B6F C;  4Z5T A;  1P3M C;  4J8W B;  1EQZ D;  5AV6 A;  3MVD B;  3X1V D;  2XD5 A;  3AFA D;  3MGP A;  3MGS C;  5E5A B;  3LZ1 D;  2Y2P A;  1P3B C;  3LZ0 D;  4J8W A;  5KDM B;  3MVD A;  5CP6 B;  3WTP B;  4DRA A;  1TZY B;  2CV5 B;  5KDM A;  4YS3 B;  1BH8 B;  3O62 B;  4KUD B;  5CP6 A;  3WTP A;  5AVB B;  3B6G A;  3REJ D;  2F8N K;  1TZY A;  2CV5 A;  1P3F D;  5C3I C;  4YS3 A;  1F66 C;  1BH8 A;  2JE5 A;  3O62 A;  4KUD A;  5CPI C;  2F8N B;  5AVB A;  3X1S B;  1HQ3 B;  3UTA B;  3KXB B;  1U35 D;  3REH A;  4WU9 D;  2F8N A;  4LD9 D;  3X1S A;  4J8V D;  1HQ3 A;  3NQU B;  3WAA C;  3UTA A;  2IO5 C;  3IP4 C;  1WWS A;  3KXB A;  3AZM B;  1M18 B;  3W99 B;  3AZN C;  3WKJ D;  3AZM A;  3NQU A;  4WU8 C;  3W99 A;  1M18 A;  3V9R B;  3C1C A;  4QLC B;  1S32 B;  4J8U C;  5GXQ B;  3WA9 C;  5F99 B;  2Y2K A;  4R8P B;  5B1L D;  1P3A C;  3AV2 B;  3V9R A;  3AZL B;  1S32 A;  4QLC A;  4DQY B;  5GXQ A;  2Y2Q A;  5F99 A;  1B6W A;  5B1M B;  5E5A D;  5B0Z C;  5GT3 B;  5AVC B;  4R8P A;  3X1T A;  1KX4 C;  3A6N C;  3B6F B;  3UTB C;  3AV2 A;  1HTA A;  2RVQ D;  3AZL A;  1P3L C;  3W96 A;  3WTP D;  3KWQ B;  5GT3 A;  5AVC A;  3B6F A;  2VQR A;  2ZY2 A;  1P3B B;  5JA4 B;  1EQZ C;  2F8N H;  3MGR B;  3AFA C;  4KUD D;  5B40 B;  3KWQ A;  3REI C;  4JJN B;  5JRG C;  5BS7 A;  5B0Y B;  3LZ1 C;  4KGC D;  1P3B A;  3LZ0 C;  3VH6 A;  5B40 A;  5DNN C;  4JJN A;  5B0Y A;  4WZS B;  3EPH A;  3KUY D;  2FJ7 D;  3REJ C;  5BNV B;  1P3F C;  3AV1 B;  4CSR B;  5CHL B;  3W98 C;  5B2J D;  3WAA B;  4YM6 B;  5BNV A;  5B32 D;  4XZQ D;  3AZH B;  3AYW B;  3AV1 A;  1U35 C;  1ZLA D;  2HUE B;  5BNX B;  5FUG B;  1N1J B;  4J8V C;  4LD9 C;  2PYO B;  3WAA A;  3LJA B;  3AZE B;  2XD1 A;  4YM6 A;  1P34 D;  3KFU G;  3AZH A;  5B1M D;  3WKJ C;  5BNX A;  5FUG A;  4ZBJ C;  1N1J A;  2PYO A;  3LJA A;  3AZE A;  3AN2 D;  1ID3 B;  3MGQ D;  5GT0 C;  3X1U B;  5B1L C;  4DRB A;  2Y2L A;  2RIQ A;  5AV8 B;  1M1A B;  1ULY A;  3MGR D;  3AL0 C;  2Y2O A;  1ID3 A;  5B0Y D;  3X1U A;  3F6T A;  4XUJ D;  2J8P A;  1P3K D;  3C1B B;  4H9O B;  5AV8 A;  1M1A A;  5B24 B;  1H3O B;  5B31 G;  5AV9 D;  3C1B A;  1B67 A;  4H9O A;  5DNM B;  4ZUX B;  3AZF D;  3UT9 D;  5B24 A;  1P3G B;  2NZD D;  1H3O A;  2ZM5 A;  4EO5 C;  3H0M C;  5CPJ B;  5B33 D;  3AV1 D;  4KGC C;  5DNM A;  1P3G A;  5B2I B;  5AV5 D;  4Z2M H;  5CPJ A;  3FDD A;  3AYW D;  1M19 D;  4WV4 B;  5CPK B;  3KUY C;  2FJ7 C;  5B31 D;  5AY8 B;  5B2I A;  3LJA D;  4NE5 A;  3AZK D;  3TU4 B;  4UUZ B;  5CPK A;  3WTP E;  1P3P C;  5AY8 A;  3W98 A;  3REL D;  5B2J C;  1P3I C;  2NQB D;  3AZG C;  4XZQ C;  3TU4 A;  1ZLA C;  4UUZ A;  3B6G B;  2G5I C;  3W97 B;  4X23 B;  1P34 C;  1P3O D;  4J8X B;  2DF4 C;  1KX3 C;  3W97 A;  5GT0 B;  3REH B;  3AZI C;  4X23 A;  4G91 C;  3MNN C;  2HIO D;  4J8X A;  3AN2 C;  2ZY3 A;  3NQJ B;  3MGQ C;  1KU5 A;  5GT0 A;  4ZUX D;  3NQJ A;  4AWL B;  1F1E A;  4XUJ C;  3C1C B;  1P3K C;  5GSU B;  1AOI C;  4M6B A;  3H0R C;  4Z5T D;  2ARO B;  5AV6 D;  4Z66 B;  5AV9 C;  5GSU A;  3REK C;  3MGP D;  3AZF C;  3X1T B;  2Y2H A;  3UT9 C;  3LEL B;  4J8W D;  2ARO A;  2NZD C;  3MVD D;  4Z66 A;  2Y2M A;  3AZJ B;  3W96 B;  3EPL A;  5B33 C;  2JCH A;  4HGA C;  1KX5 C;  2F8N G;  3LEL A;  1P3M B;  1W2E A;  5AV5 C;  3AZJ A;  5CP6 D;  1M19 C;  3B6G D;  2DQN C;  3MGS B;  4H9S C;  1TZY D;  2CV5 D;  5BT1 D;  1P3M A;  5B31 C;  3AZK C;  4YS3 D;  4WJ3 C;  3VH5 A;  3X1V C;  3O62 D;  5AVB D;  4J8X D;  3MGS A;  1P3P A;  3REH D;  5B32 G;  5BO0 B;  3REL C;  2NQB C;  3AZG A;  2F8N D;  3X1S D;  1HQ3 D;  3UTA D;  3KXB D;  3VH6 T;  5BO0 A;  5C3I B;  3B0D C;  1F66 B;  4UPK A;  4G92 C;  1P3O C;  3AZM D;  5CPI B;  3W99 D;  1M18 D;  1KX3 A;  3C1C D;  5GSU D;  1F66 A;  3MNN A;  3EPK A;  5CPI A;  2HIO C;  2IO5 B;  1S32 D;  4QLC D;  5GXQ D;  4WU9 C;  5F99 D;  4H9N A;  3AZN B;  4R8P D;  3X1T D;  4WU8 B;  1BFM A;  3AV2 D;  3AZL D;  3W96 D;  3VH6 W;  4J8U B;  3AZN A;  3WA9 B;  3A1I A;  5GT3 D;  5AVC D;  3B6F D;  4Z5T C;  4WU8 A;  3R45 B;  3A1K A;  1P3A B;  3KWQ D;  4J8U A;  3WA9 A;  3MGP C;  4E45 A;  1KX5 B;  5B0Z B;  3R45 A;  1P3B D;  1KX4 B;  3A6N B;  4J8W C;  1P3A A;  3UTB B;  3MVD C;  1P3L B;  5B40 D;  4JJN D;  1KX5 A;  5E5A C;  5B0Z A;  1KX4 A;  3P5J B;  3A6N A;  1PZR A;  3UTB A;  2RVQ C;  1EQZ B;  1P3L A;  2BG1 A;  5CP6 C;  3WTP C;  3AFA B;  3REI B;  5JRG B;  2CV5 C;  5BT1 C;  3LZ1 B;  3LZ0 B;  4YS3 C;  1EQZ A;  4Z2M G;  3O62 C;  4KUD C;  3AFA A;  5CPI D;  5AVB C;  5DNN B;  3REI A;  5JRG A;  3LZ1 A;  2CWE A;  2BYM B;  3LZ0 A;  3X1S C;  5DNN A;  1HQ3 C;  3WAA D;  3UTA C;  4YM6 D;  3REJ B;  3AZH D;  2BYM A;  3KSY A;  1P3F B;  1TAF B;  3AZM C;  2PYO D;  3AZE D;  3W98 B;  3W99 C;  1M18 C;  3REJ A;  1P3F A;  1U35 B;  4KHA B;  1TAF A;  4NFT A;  2ZY4 A;  3EG5 B;  4LD9 B;  4J8V B;  2YFV B;  1P3A D;  5B32 C;  1S32 C;  4QLC C;  1U35 A;  5GXQ C;  5F99 C;  4KHA A;  4WU9 A;  1ID3 D;  3WKJ B;  3X1U D;  4R8P C;  4ZBJ B;  4LD9 A;  4J8V A;  1Q9C A;  2YFV A;  5AV8 D;  1M1A D;  3AZL C;  4WNN B;  4H9Q B;  5B1M C;  3WKJ A;  5GT3 C;  5AVC C;  1Z2C B;  3C1B D;  5B1L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...