2YFVA

The heterotrimeric complex of kluyveromyces lactis scm3, cse4 and h4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
73
structure length
68
Chain Sequence
ISRMPFARLVKEVTDQFTLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIMRKDMQLARRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of the Centromere-Specific Histone Cse4 by the Chaperone Scm3.
pubmed doi rcsb
source organism Kluyveromyces lactis nrrl y-1140
molecule tags Cell cycle
molecule keywords HISTONE H3-LIKE CENTROMERIC PROTEIN CSE4
total genus 24
structure length 68
sequence length 73
ec nomenclature
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2yfvA00
4KUDC 3X1UC 3AZIB 3MGRD 1P3BC 2AROC 5AY8C 1AOIC 1M18A 3AZMC 3RELD 4ZBJB 4NE5A 3AZKA 5CPKC 4Z2MG 3AFAA 4E45A 4J8WA 1P3BB 3W97A 4Z5TC 1P3KD 3RELB 5DNNB 1M19A 4AWLB 3AYWB 1TZYC 3W97C 5G49A 4G91C 1HTAA 5AY8D 3MGQC 4CAYA 5AV6B 1U35C 3UTBD 1KX5D 3W98D 3REHB 1M1AC 4ZUXD 3AV1D 3UTAD 1B6WA 1R4VA 4J8WB 2AROA 4JJNC 3UTBB 5DNNC 1AOIA 1EQZA 4Z2MH 4QLCA 4WZSB 1HQ3C 2HUEC 3KUYA 3AZFD 3AN2D 4YM6D 5GT0D 3V9RA 5BNVB 4NFTA 1M18D 3MNNA 3WKJB 5AV6A 3LZ1B 4H9OA 2HIOC 1P3PA 5B40C 3MGPD 1P34C 5FUGA 5B2ID 3W96C 4HGAB 1EQZB 2PYOC 3X1SA 2YFWA 3AZJC 3MGRA 3C1CD 5B40B 5BO0B 4YS3B 5G49B 4X23A 4H9QB 3LZ1C 3B0DC 3R45B 2BYMA 4LD9C 5B2JD 3AV1A 1N1JB 3AZHC 5E5AD 2CV5A 5KDMB 3A6NC 3AFAB 3AZNB 4WU8D 1P3MC 3MGSD 1P3FB 4UUZB 3X1VC 5AV6D 1P3BA 5AY8A 4Z66A 1KX4C 1KX3C 3WAAC 5B32C 3W98A 3O62D 3KXBB 5BS7C 5CP6B 5BT1D 4ZUXC 3MNNB 3WKJA 2AROD 1P3PD 1AOID 1TZYB 2FJ7A 5JRGD 4YS3C 5B33B 3AFAD 1HQ3D 4UUZA 3AZFA 3AN2A 1BH8A 2PYOA 4Z66B 3MGRB 3W97B 2NZDB 5B31A 3B6GC 5B2JB 1M19D 2HUEB 4H9SA 4WV4B 1HQ3B 3MGPC 4H9QA 4XUJC 4KUDB 3AV1B 3WKJC 4J8WC 3MGQD 1P3PB 3B6GB 3O62A 4ZBJC 3WA9D 4QLCC 5B0ZB 4Z66C 1EQZD 1KX3A 3AV2C 5DNMA 4XUJB 3X1VA 1JFIA 3WTPB 5B31B 5DNND 3A6NA 1P3KB 4JJND 5BO0A 3WKJD 5C3IB 1M1AA 4CSRB 5B1MC 3AZND 4EO5B 4WU9D 3RELC 4KGCC 5B0YC 5GSUD 4G91B 5F99C 4H9SC 5B31C 3X1SB 4Z5TB 2CWEA 1WWSA 3AFAC 1BH9B 3C1BC 3TU4A 3REJB 4CSRA 5JRGA 3LJAC 1P3PC 5CP6A 5AV8A 5DNMC 5B0YD 5B24B 4H9RA 4KUDA 2HIOA 5GSUB 3R45A 1ID3C 1N1JA 5AVCA 2CV5B 1P3ID 3VH6T 3VH6W 2NQBB 4WU8A 1ID3A 3WAAA 3MGSC 2PYOB 3REIC 3A6ND 4JJNA 1EQZC 4J8XD 3REJD 3MVDA 4J8WD 5B32G 5GT0A 4H9RB 4CAYB 3AZIA 3WA9A 3W98C 4G92B 4WU9C 1TZYA 5AVCB 1KX5B 5F99A 3TU4D 3B6FA 3KWQC 3AZKD 5B24C 2PYOD 4ZUXA 2LY8A 3LELD 3AZGA 1WWIA 3A6NB 3AZED 1P3KA 3W96A 5JRGB 3REHC 1M1AB 1U35B 3AZHB 1P3AA 5AV9B 1P3IA 4YM6A 5FUGB 1ZLAB 4J8UD 1P3FD 4WU8B 3AZLB 1F66A 2YFWB 5B1MB 3MGPA 2L5AA 3AZGB 5DNNA 4QLCD 3W96B 3MVDB 1M19B 5JRGC 3LJAA 1ZLAC 5AV5B 3C1BA 3AZIC 2HIOB 5GSUA 4KGCD 5CPJD 5BNXB 5B33D 3C1CC 1F66B 5GT3C 3AZLD 2FJ7C 4J8XC 2AROB 4J8UB 1AOIB 4Z5TA 5CPIB 1BH9A 2F8NB 3KUYC 5B31D 3RELA 5B2IB 5E5AC 5AV8D 1KX4A 4LD9D 2JSSA 3LZ0D 4NE6A 1P3AC 1KU5A 4KUDD 4X23D 3KSYA 3MGQB 3LELB 5C3IC 3REHA 4YM6B 5CPJB 3X1TA 5KDMA 3AZEA 5B32D 3WTPC 3B6FB 2FJ7D 3KXBC 5GT3B 3KWQA 5AVBB 5CPKD 4Z66D 5B2IC 1P34D 5B31G 3KUYB 4WU9A 4X23B 4J8XB 5GSUC 3X1SC 5AV9D 1TZYD 5BNXA 3O62B 4M6BA 3KXBD 2NQBD 4J8VB 3B0DB 3AV2A 3NQUB 3AZLC 5AV6C 5CPIA 1S32A 2F8NG 2F8NK 5CPJC 2HIOD 1B67A 5AV8C 2YFVB 2RVQC 4EO5C 5B0ZC 3UTAB 3X1TB 4E44A 3C1CB 3B0BA 1P3KC 3AZJD 5GXQA 3LZ0B 3X1VB 1P3MB 4LD9A 5AY8B 4J8UC 3UT9D 2NZDA 3REJA 5B2IA 2F8NH 4WU9B 5AV5A 3KXBA 1M1AD 2NZDC 4H9OB 3UTBC 1Q9CA 2YFVA 3MGRC 1P3BD 1M18B 5GXQC 4J8VD 3X1TC 3AZKB 1H3OB 1P3OB 5B0ZA 4R8PC 5JA4A 1BH8B 5AVCD 3REIA 1JFIB 3X1UA 5E5AA 2CV5C 3REKC 4WU8C 1P3MD 1P34B 3W96D 5B33C 1ID3D 5BNVA 1F1EA 1HQ3A 5AV9C 5B24A 4X23C 5GXQD 3LZ0C 4J8VC 4J8XA 3REHD 3UT9A 2NZDD 3REJC 3W97D 3B6GA 5AVBC 5B1LA 1KX3B 4XZQA 4LD9B 4JJNB 5AVBA 1P3FC 3WTPD 1S32B 4YS3A 3UTAC 3MNND 3V9RB 5B0ZD 3WA9B 2BYMB 5DNMD 3AZID 3UT9B 5AV9A 3X1UD 5BS7A 1S32C 5F99B 4YM6C 3AZEC 3LELC 5CPIC 3AZNA 3AZLA 2NQBA 3KUYD 3REID 1ID3B 4KGCB 3AV2D 4Z5TD 3AZMA 1P3MA 3NQUA 3VH5W 5E5AB 5CPKB 5GT3D 2NQBC 3LJAB 4WNNA 3C1BB 1U35A 1P3OD 3AV1C 4XZQD 3LZ1A 1P3GD 1P3AD 3B6FC 1M19C 1P3LA 1ZLAD 3VH5A 3UTAA 1TAFA 3C1CA 3W99A 5CP6D 4KGCA 4J8UA 1P3FA 3AZJA 5JA4B 3WTPA 5B0YB 5B1MA 5B24D 3MGPB 3AZKC 5CPKA 4DRBA 5B2JA 3MVDC 3REKB 1P34A 5B40A 4WNNB 4H9PB 5GT0B 1P3GB 4KHAA 4R8PB 3AZMD 5B1LD 3MGSA 1P3OC 3B0CT 1P3LB 5CPJA 1F66C 2FJ7B 3MVDD 1KX4D 3W99B 5B33A 3NQJA 1P3OA 5B1LB 4R8PD 3AZMB 5GT3A 3KWQB 5CP6C 4ZUXB 3X1UB 3W98B 2IO5C 4H9PA 5F99D 5AV8B 5B2JC 1P3GA 3AZGC 3AYWD 5B1LC 5CHLB 3AZHA 4XUJD 3W99C 2F8ND 5AV5C 1P3IB 2CV5D 1P3LC 4H9NA 3B6GD 1TAFB 3AZEB 1KX3D 3AZFB 3AN2B 4XZQB 5AVBD 3WA9C 3KWQD 3TU4B 1P3IC 3VH6A 1P3LD 3B6FD 5AV5D 5B32B 3W99D 1KX4B 1M18C 4KHAB 4R8PA 3VH5T 5BT1C 3LELA 3MNNC 3AZGD 5B1MD 3AZNC 3O62C 3REKD 3NQJB 5AVCC 2BYKB 3WAAB 3UTBA 4DRAA 4XUJA 5DNMB 1A7WA 4G92C 2F8NA 5CPID 3WTPE 1S32D 2RVQD 3AYWA 3TU4C 3AZHD 1U35D 1KX5C 1F66D 1P3AB 1BFMA 1P3GC 3LZ1D 4XZQC 5GT0C 3MGSB 1ULYA 3AZFC 3AN2C 3AYWC 3MGQA 1KX5A 1ZLAA 4H9NB 3LJAD 1H3OA 3UT9C 3WAAD 2BYKA 4NE3A 3C1BD 4J8VA 5GXQB 3LZ0A 3AZJB 3AV2B 3REIB 3X1VD 4QLCB 5B0YA 3B0CW 4AWLC 4YS3D 4HGAC 5B40D 3REKA 3X1TD 2IO5B 3X1SD 5B32A
chains in the Genus database with same CATH superfamily
4KUDC 3X1UC 3AZIB 3MGRD 1P3BC 2AROC 5AY8C 1AOIC 1M18A 3AZMC 3RELD 4ZBJB 4NE5A 3AZKA 5CPKC 4Z2MG 3AFAA 4E45A 4J8WA 1P3BB 3W97A 4Z5TC 1P3KD 3RELB 5DNNB 1M19A 4AWLB 3AYWB 1TZYC 1T3UA 3W97C 5G49A 4G91C 1HTAA 5AY8D 3MGQC 4CAYA 5AV6B 1U35C 3UTBD 1KX5D 3W98D 3REHB 1M1AC 4ZUXD 3AV1D 3UTAD 1B6WA 1R4VA 4J8WB 2AROA 4JJNC 3UTBB 5DNNC 1AOIA 1EQZA 4Z2MH 4QLCA 4WZSB 1HQ3C 2HUEC 3KUYA 3AZFD 3AN2D 4YM6D 5GT0D 3V9RA 5BNVB 4NFTA 1M18D 3MNNA 3WKJB 5AV6A 3LZ1B 4H9OA 2HIOC 2W8SA 1P3PA 5B40C 3MGPD 1P34C 5FUGA 5B2ID 3W96C 4HGAB 1EQZB 3EPHA 2PYOC 3X1SA 2YFWA 3AZJC 3MGRA 2RIQA 3C1CD 5B40B 5BO0B 4YS3B 5G49B 4X23A 4H9QB 3LZ1C 3B0DC 3R45B 2BYMA 4LD9C 5B2JD 3AV1A 1N1JB 3AZHC 5E5AD 2CV5A 5KDMB 3A6NC 3AFAB 3AZNB 4WU8D 1P3MC 3MGSD 1P3FB 4UUZB 3X1VC 5AV6D 1P3BA 5AY8A 4Z66A 1KX4C 3EG5B 1KX3C 3WAAC 5B32C 3W98A 3O62D 3KXBB 5BS7C 5CP6B 5BT1D 4ZUXC 3MNNB 3WKJA 2AROD 1P3PD 1AOID 1TZYB 2FJ7A 5JRGD 4YS3C 5B33B 2F2AC 3AFAD 1HQ3D 4UUZA 3AZFA 3AN2A 1BH8A 2PYOA 4Z66B 3MGRB 3W97B 2NZDB 5B31A 3B6GC 2DF4C 5B2JB 1M19D 2HUEB 4H9SA 4WV4B 1HQ3B 3MGPC 4H9QA 4XUJC 4KUDB 3AV1B 3WKJC 4J8WC 3MGQD 1P3PB 3B6GB 2Y2OA 4ZBJC 3O62A 3WA9D 4QLCC 5B0ZB 4Z66C 1EQZD 1KX3A 3AV2C 5DNMA 4XUJB 3X1VA 1JFIA 3WTPB 5B31B 5DNND 3A6NA 1P3KB 4JJND 3KFUG 5BO0A 3WKJD 5C3IB 1M1AA 4CSRB 5B1MC 3AZND 4EO5B 4WU9D 3RELC 3H0MC 4KGCC 5B0YC 5GSUD 4G91B 5F99C 4H9SC 5B31C 3X1SB 4Z5TB 2CWEA 1WWSA 3AFAC 1BH9B 3C1BC 2JE5A 3REJB 4CSRA 3TU4A 5JRGA 3LJAC 1P3PC 5CP6A 5AV8A 5DNMC 5B0YD 5B24B 4H9RA 4KUDA 2HIOA 5GSUB 3R45A 1Z2CB 1ID3C 1N1JA 5AVCA 2CV5B 1P3ID 2Y2MA 3VH6T 3VH6W 2NQBB 4WU8A 1ID3A 3WAAA 3MGSC 2Y2LA 2PYOB 3REIC 3A6ND 4JJNA 1EQZC 4J8XD 3REJD 3MVDA 4J8WD 5B32G 5GT0A 4H9RB 4CAYB 3AZIA 3WA9A 3W98C 4G92B 2ZY2A 4WU9C 1TZYA 5AVCB 1KX5B 5F99A 3TU4D 3B6FA 3KWQC 3AZKD 5B24C 2PYOD 4ZUXA 2G5IC 2LY8A 3LELD 3AZGA 1WWIA 3A6NB 3AZED 1P3KA 3W96A 3A1IA 5JRGB 3REHC 1M1AB 1U35B 2FFFB 3AZHB 1P3AA 2Y2JA 5AV9B 1P3IA 4YM6A 5FUGB 1ZLAB 4J8UD 1P3FD 4WU8B 3AZLB 1F66A 2YFWB 5B1MB 3MGPA 2L5AA 3AZGB 5DNNA 4QLCD 3W96B 3MVDB 1M19B 5JRGC 3LJAA 1ZLAC 5AV5B 3C1BA 3AZIC 2HIOB 5GSUA 4KGCD 5CPJD 3FDDA 5BNXB 5B33D 3C1CC 1F66B 2BG1A 5GT3C 3AZLD 2FJ7C 4J8XC 2DQNC 2AROB 4J8UB 1AOIB 4Z5TA 5CPIB 1BH9A 2F8NB 3KUYC 5B31D 3RELA 1W2EA 5B2IB 2Y2PA 5E5AC 5AV8D 3H0LC 1KX4A 4LD9D 2JSSA 3LZ0D 4NE6A 1P3AC 1KU5A 4KUDD 4X23D 3KSYA 3P5JB 3MGQB 3LELB 5C3IC 3REHA 2ZY4A 4YM6B 5CPJB 3X1TA 5KDMA 3AZEA 5B32D 3WTPC 3B6FB 2FJ7D 3KXBC 5GT3B 3KWQA 5AVBB 2ZY5A 5CPKD 4Z66D 5B2IC 1P34D 5B31G 3KUYB 4WU9A 4X23B 4J8XB 4DQYB 5GSUC 3X1SC 5AV9D 1TZYD 3AL0C 5BNXA 3O62B 2UWXA 4M6BA 3KXBD 2NQBD 4J8VB 3B0DB 3AV2A 3NQUB 3AZLC 5AV6C 5CPIA 1S32A 2F8NG 2J8PA 2F8NK 5CPJC 2HIOD 1B67A 5AV8C 2YFVB 2ZM5A 2RVQC 4EO5C 5B0ZC 3UTAB 3X1TB 4E44A 3C1CB 2XD1A 3B0BA 3EPLA 1P3KC 3AZJD 5GXQA 3LZ0B 3X1VB 3F6TA 1P3MB 4LD9A 5AY8B 4J8UC 3UT9D 2Y2IA 2NZDA 3REJA 5B2IA 2F8NH 4WU9B 5AV5A 3KXBA 1M1AD 2NZDC 4H9OB 3UTBC 1Q9CA 2YFVA 3MGRC 1P3BD 1M18B 5GXQC 4J8VD 2G5HC 3X1TC 3AZKB 1H3OB 4UPKA 1P3OB 5B0ZA 4R8PC 5JA4A 1BH8B 5AVCD 3EPJA 3REIA 3X1UA 1JFIB 5E5AA 2CV5C 3REKC 4WU8C 1P3MD 1P34B 3W96D 5B33C 1ID3D 5BNVA 1F1EA 1HQ3A 5AV9C 5B24A 4X23C 5GXQD 3LZ0C 4J8VC 4J8XA 3A1KA 3REHD 3UT9A 2NZDD 3REJC 3W97D 3B6GA 5AVBC 2Y2HA 5B1LA 1KX3B 2Y2KA 4XZQA 4LD9B 4JJNB 5AVBA 1P3FC 3WTPD 1S32B 4YS3A 3UTAC 3MNND 3V9RB 5B0ZD 3WA9B 2BYMB 5DNMD 3AZID 2VQRA 3UT9B 5AV9A 3X1UD 5BS7A 2ZY3A 1S32C 5F99B 4YM6C 3AZEC 3LELC 5CPIC 3AZNA 3AZLA 2NQBA 3KUYD 3REID 1ID3B 4KGCB 3AV2D 4Z5TD 3AZMA 1P3MA 3NQUA 3VH5W 5E5AB 5CPKB 5GT3D 2NQBC 3LJAB 4WNNA 4WJ3C 3C1BB 1U35A 1P3OD 3AV1C 4XZQD 3LZ1A 1P3GD 1P3AD 2Y2QA 3B6FC 1M19C 1P3LA 1ZLAD 3VH5A 3UTAA 1TAFA 3C1CA 3W99A 5CP6D 4KGCA 4J8UA 1P3FA 3AZJA 5JA4B 3WTPA 5B0YB 5B1MA 5B24D 3MGPB 3AZKC 5CPKA 4DRBA 5B2JA 3MVDC 3REKB 1P34A 5B40A 4WNNB 4H9PB 5GT0B 1P3GB 4KHAA 4R8PB 3AZMD 5B1LD 3MGSA 1P3OC 3B0CT 1P3LB 5CPJA 1F66C 2FJ7B 3MVDD 1KX4D 3W99B 5B33A 1PZRA 3NQJA 1P3OA 2XD5A 5B1LB 4R8PD 3AZMB 2JCHA 5GT3A 3KWQB 5CP6C 4ZUXB 3X1UB 3W98B 2IO5C 4H9PA 5F99D 5AV8B 5B2JC 1P3GA 3AZGC 3AYWD 5B1LC 5CHLB 3AZHA 4XUJD 3W99C 2F8ND 5AV5C 1P3IB 2CV5D 1P3LC 4H9NA 3B6GD 1TAFB 3AZEB 1KX3D 3AZFB 3AN2B 4XZQB 3IP4C 5AVBD 3WA9C 3KWQD 3TU4B 1P3IC 3H0RC 3VH6A 1P3LD 3B6FD 5AV5D 5B32B 3W99D 1KX4B 1M18C 4KHAB 4R8PA 3VH5T 5BT1C 3LELA 3MNNC 3AZGD 5B1MD 3AZNC 3O62C 3REKD 3NQJB 5AVCC 2BYKB 3WAAB 3UTBA 4DRAA 4XUJA 5DNMB 1A7WA 4G92C 2F8NA 5CPID 2Y2GA 3WTPE 1S32D 2RVQD 3AYWA 3TU4C 3AZHD 1U35D 1KX5C 1F66D 1P3AB 1BFMA 1P3GC 3LZ1D 4XZQC 5GT0C 3MGSB 1ULYA 3AZFC 3AN2C 3AYWC 3MGQA 1KX5A 1ZLAA 4H9NB 3LJAD 1H3OA 3UT9C 2Y2NA 3WAAD 2BYKA 4NE3A 3C1BD 4J8VA 5GXQB 3LZ0A 3AZJB 3AV2B 3REIB 3X1VD 4QLCB 5B0YA 3B0CW 4AWLC 4YS3D 4HGAC 5B40D 3REKA 3X1TD 3EPKA 2IO5B 3X1SD 5B32A
chains in the Genus database with same CATH topology
4KUDC 3X1UC 3AZIB 3MGRD 1P3BC 2AROC 5AY8C 1AOIC 1M18A 3AZMC 3RELD 4ZBJB 4NE5A 3AZKA 5CPKC 4Z2MG 3AFAA 4E45A 4J8WA 1P3BB 3W97A 4Z5TC 1P3KD 3RELB 5DNNB 1M19A 4AWLB 3AYWB 1TZYC 1T3UA 3W97C 5G49A 4G91C 1HTAA 5AY8D 3MGQC 4CAYA 5AV6B 1U35C 3UTBD 1KX5D 3W98D 3REHB 1M1AC 4ZUXD 3AV1D 3UTAD 1B6WA 1R4VA 4J8WB 2AROA 4JJNC 3UTBB 5DNNC 1AOIA 1EQZA 4Z2MH 4QLCA 4WZSB 1HQ3C 2HUEC 3KUYA 3AZFD 3AN2D 4YM6D 5GT0D 3V9RA 5BNVB 4NFTA 1M18D 3MNNA 3WKJB 5AV6A 3LZ1B 4H9OA 2HIOC 2W8SA 1P3PA 5B40C 3MGPD 1P34C 5FUGA 5B2ID 3W96C 4HGAB 1EQZB 3EPHA 2PYOC 3X1SA 2YFWA 3AZJC 3MGRA 2RIQA 3C1CD 5B40B 5BO0B 4YS3B 5G49B 4X23A 4H9QB 3LZ1C 3B0DC 3R45B 2BYMA 4LD9C 5B2JD 3AV1A 1N1JB 3AZHC 5E5AD 2CV5A 5KDMB 3A6NC 3AFAB 3AZNB 4WU8D 1P3MC 3MGSD 1P3FB 4UUZB 3X1VC 5AV6D 1P3BA 5AY8A 4Z66A 1KX4C 3EG5B 1KX3C 3WAAC 5B32C 3W98A 3O62D 3KXBB 5BS7C 5CP6B 5BT1D 4ZUXC 3MNNB 3WKJA 2AROD 1P3PD 1AOID 1TZYB 2FJ7A 5JRGD 4YS3C 5B33B 2F2AC 3AFAD 1HQ3D 4UUZA 3AZFA 3AN2A 1BH8A 2PYOA 4Z66B 3MGRB 3W97B 2NZDB 5B31A 3B6GC 2DF4C 5B2JB 1M19D 2HUEB 4H9SA 4WV4B 1HQ3B 3MGPC 4H9QA 4XUJC 4KUDB 3AV1B 3WKJC 4J8WC 3MGQD 1P3PB 3B6GB 2Y2OA 4ZBJC 3O62A 3WA9D 4QLCC 5B0ZB 4Z66C 1EQZD 1KX3A 3AV2C 5DNMA 4XUJB 3X1VA 1JFIA 3WTPB 5B31B 5DNND 3A6NA 1P3KB 4JJND 3KFUG 5BO0A 3WKJD 5C3IB 1M1AA 4CSRB 5B1MC 3AZND 4EO5B 4WU9D 3RELC 3H0MC 4KGCC 5B0YC 5GSUD 4G91B 5F99C 4H9SC 5B31C 3X1SB 4Z5TB 2CWEA 1WWSA 3AFAC 1BH9B 3C1BC 2JE5A 3REJB 4CSRA 3TU4A 5JRGA 3LJAC 1P3PC 5CP6A 5AV8A 5DNMC 5B0YD 5B24B 4H9RA 4KUDA 2HIOA 5GSUB 3R45A 1Z2CB 1ID3C 1N1JA 5AVCA 2CV5B 1P3ID 2Y2MA 3VH6T 3VH6W 2NQBB 4WU8A 1ID3A 3WAAA 3MGSC 2Y2LA 2PYOB 3REIC 3A6ND 4JJNA 1EQZC 4J8XD 3REJD 3MVDA 4J8WD 5B32G 5GT0A 4H9RB 4CAYB 3AZIA 3WA9A 3W98C 4G92B 2ZY2A 4WU9C 1TZYA 5AVCB 1KX5B 5F99A 3TU4D 3B6FA 3KWQC 3AZKD 5B24C 2PYOD 4ZUXA 2G5IC 2LY8A 3LELD 3AZGA 1WWIA 3A6NB 3AZED 1P3KA 3W96A 3A1IA 5JRGB 3REHC 1M1AB 1U35B 2FFFB 3AZHB 1P3AA 2Y2JA 5AV9B 1P3IA 4YM6A 5FUGB 1ZLAB 4J8UD 1P3FD 4WU8B 3AZLB 1F66A 2YFWB 5B1MB 3MGPA 2L5AA 3AZGB 5DNNA 4QLCD 3W96B 3MVDB 1M19B 5JRGC 3LJAA 1ZLAC 5AV5B 3C1BA 3AZIC 2HIOB 5GSUA 4KGCD 5CPJD 3FDDA 5BNXB 5B33D 3C1CC 1F66B 2BG1A 5GT3C 3AZLD 2FJ7C 4J8XC 2DQNC 2AROB 4J8UB 1AOIB 4Z5TA 5CPIB 1BH9A 2F8NB 3KUYC 5B31D 3RELA 1W2EA 5B2IB 2Y2PA 5E5AC 5AV8D 3H0LC 1KX4A 4LD9D 2JSSA 3LZ0D 4NE6A 1P3AC 1KU5A 4KUDD 4X23D 3KSYA 3P5JB 3MGQB 3LELB 5C3IC 3REHA 2ZY4A 4YM6B 5CPJB 3X1TA 5KDMA 3AZEA 5B32D 3WTPC 3B6FB 2FJ7D 3KXBC 5GT3B 3KWQA 5AVBB 2ZY5A 5CPKD 4Z66D 5B2IC 1P34D 5B31G 3KUYB 4WU9A 4X23B 4J8XB 4DQYB 5GSUC 3X1SC 5AV9D 1TZYD 3AL0C 5BNXA 3O62B 2UWXA 4M6BA 3KXBD 2NQBD 4J8VB 3B0DB 3AV2A 3NQUB 3AZLC 5AV6C 5CPIA 1S32A 2F8NG 2J8PA 2F8NK 5CPJC 2HIOD 1B67A 5AV8C 2YFVB 2ZM5A 2RVQC 4EO5C 5B0ZC 3UTAB 3X1TB 4E44A 3C1CB 2XD1A 3B0BA 3EPLA 1P3KC 3AZJD 5GXQA 3LZ0B 3X1VB 3F6TA 1P3MB 4LD9A 5AY8B 4J8UC 3UT9D 2Y2IA 2NZDA 3REJA 5B2IA 2F8NH 4WU9B 5AV5A 3KXBA 1M1AD 2NZDC 4H9OB 3UTBC 1Q9CA 2YFVA 3MGRC 1P3BD 1M18B 5GXQC 4J8VD 2G5HC 3X1TC 3AZKB 1H3OB 4UPKA 1P3OB 5B0ZA 4R8PC 5JA4A 1BH8B 5AVCD 3EPJA 3REIA 3X1UA 1JFIB 5E5AA 2CV5C 3REKC 4WU8C 1P3MD 1P34B 3W96D 5B33C 1ID3D 5BNVA 1F1EA 1HQ3A 5AV9C 5B24A 4X23C 5GXQD 3LZ0C 4J8VC 4J8XA 3A1KA 3REHD 3UT9A 2NZDD 3REJC 3W97D 3B6GA 5AVBC 2Y2HA 5B1LA 1KX3B 2Y2KA 4XZQA 4LD9B 4JJNB 5AVBA 1P3FC 3WTPD 1S32B 4YS3A 3UTAC 3MNND 3V9RB 5B0ZD 3WA9B 2BYMB 5DNMD 3AZID 2VQRA 3UT9B 5AV9A 3X1UD 5BS7A 2ZY3A 1S32C 5F99B 4YM6C 3AZEC 3LELC 5CPIC 3AZNA 3AZLA 2NQBA 3KUYD 3REID 1ID3B 4KGCB 3AV2D 4Z5TD 3AZMA 1P3MA 3NQUA 3VH5W 5E5AB 5CPKB 5GT3D 2NQBC 3LJAB 4WNNA 4WJ3C 3C1BB 1U35A 1P3OD 3AV1C 4XZQD 3LZ1A 1P3GD 1P3AD 2Y2QA 3B6FC 1M19C 1P3LA 1ZLAD 3VH5A 3UTAA 1TAFA 3C1CA 3W99A 5CP6D 4KGCA 4J8UA 1P3FA 3AZJA 5JA4B 3WTPA 5B0YB 5B1MA 5B24D 3MGPB 3AZKC 5CPKA 4DRBA 5B2JA 3MVDC 3REKB 1P34A 5B40A 4WNNB 4H9PB 5GT0B 1P3GB 4KHAA 4R8PB 3AZMD 5B1LD 3MGSA 1P3OC 3B0CT 1P3LB 5CPJA 1F66C 2FJ7B 3MVDD 1KX4D 3W99B 5B33A 1PZRA 3NQJA 1P3OA 2XD5A 5B1LB 4R8PD 3AZMB 2JCHA 5GT3A 3KWQB 5CP6C 4ZUXB 3X1UB 3W98B 2IO5C 4H9PA 5F99D 5AV8B 5B2JC 1P3GA 3AZGC 3AYWD 5B1LC 5CHLB 3AZHA 4XUJD 3W99C 2F8ND 5AV5C 1P3IB 2CV5D 1P3LC 4H9NA 3B6GD 1TAFB 3AZEB 1KX3D 3AZFB 3AN2B 4XZQB 3IP4C 5AVBD 3WA9C 3KWQD 3TU4B 1P3IC 3H0RC 3VH6A 1P3LD 3B6FD 5AV5D 5B32B 3W99D 1KX4B 1M18C 4KHAB 4R8PA 3VH5T 5BT1C 3LELA 3MNNC 3AZGD 5B1MD 3AZNC 3O62C 3REKD 3NQJB 5AVCC 2BYKB 3WAAB 3UTBA 4DRAA 4XUJA 5DNMB 1A7WA 4G92C 2F8NA 5CPID 2Y2GA 3WTPE 1S32D 2RVQD 3AYWA 3TU4C 3AZHD 1U35D 1KX5C 1F66D 1P3AB 1BFMA 1P3GC 3LZ1D 4XZQC 5GT0C 3MGSB 1ULYA 3AZFC 3AN2C 3AYWC 3MGQA 1KX5A 1ZLAA 4H9NB 3LJAD 1H3OA 3UT9C 2Y2NA 3WAAD 2BYKA 4NE3A 3C1BD 4J8VA 5GXQB 3LZ0A 3AZJB 3AV2B 3REIB 3X1VD 4QLCB 5B0YA 3B0CW 4AWLC 4YS3D 4HGAC 5B40D 3REKA 3X1TD 3EPKA 2IO5B 3X1SD 5B32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUD C;  3X1U C;  3AZI B;  3MGR D;  1P3B C;  2ARO C;  5AY8 C;  1AOI C;  1M18 A;  3AZM C;  3REL D;  4ZBJ B;  4NE5 A;  3AZK A;  5CPK C;  4Z2M G;  3AFA A;  4E45 A;  4J8W A;  1P3B B;  3W97 A;  4Z5T C;  1P3K D;  3REL B;  5DNN B;  1M19 A;  4AWL B;  3AYW B;  1TZY C;  3W97 C;  5G49 A;  4G91 C;  1HTA A;  5AY8 D;  3MGQ C;  4CAY A;  5AV6 B;  1U35 C;  3UTB D;  1KX5 D;  3W98 D;  3REH B;  1M1A C;  4ZUX D;  3AV1 D;  3UTA D;  1B6W A;  1R4V A;  4J8W B;  2ARO A;  4JJN C;  3UTB B;  5DNN C;  1AOI A;  1EQZ A;  4Z2M H;  4QLC A;  4WZS B;  1HQ3 C;  2HUE C;  3KUY A;  3AZF D;  3AN2 D;  4YM6 D;  5GT0 D;  3V9R A;  5BNV B;  4NFT A;  1M18 D;  3MNN A;  3WKJ B;  5AV6 A;  3LZ1 B;  4H9O A;  2HIO C;  1P3P A;  5B40 C;  3MGP D;  1P34 C;  5FUG A;  5B2I D;  3W96 C;  4HGA B;  1EQZ B;  2PYO C;  3X1S A;  2YFW A;  3AZJ C;  3MGR A;  3C1C D;  5B40 B;  5BO0 B;  4YS3 B;  5G49 B;  4X23 A;  4H9Q B;  3LZ1 C;  3B0D C;  3R45 B;  2BYM A;  4LD9 C;  5B2J D;  3AV1 A;  1N1J B;  3AZH C;  5E5A D;  2CV5 A;  5KDM B;  3A6N C;  3AFA B;  3AZN B;  4WU8 D;  1P3M C;  3MGS D;  1P3F B;  4UUZ B;  3X1V C;  5AV6 D;  1P3B A;  5AY8 A;  4Z66 A;  1KX4 C;  1KX3 C;  3WAA C;  5B32 C;  3W98 A;  3O62 D;  3KXB B;  5BS7 C;  5CP6 B;  5BT1 D;  4ZUX C;  3MNN B;  3WKJ A;  2ARO D;  1P3P D;  1AOI D;  1TZY B;  2FJ7 A;  5JRG D;  4YS3 C;  5B33 B;  3AFA D;  1HQ3 D;  4UUZ A;  3AZF A;  3AN2 A;  1BH8 A;  2PYO A;  4Z66 B;  3MGR B;  3W97 B;  2NZD B;  5B31 A;  3B6G C;  5B2J B;  1M19 D;  2HUE B;  4H9S A;  4WV4 B;  1HQ3 B;  3MGP C;  4H9Q A;  4XUJ C;  4KUD B;  3AV1 B;  3WKJ C;  4J8W C;  3MGQ D;  1P3P B;  3B6G B;  3O62 A;  4ZBJ C;  3WA9 D;  4QLC C;  5B0Z B;  4Z66 C;  1EQZ D;  1KX3 A;  3AV2 C;  5DNM A;  4XUJ B;  3X1V A;  1JFI A;  3WTP B;  5B31 B;  5DNN D;  3A6N A;  1P3K B;  4JJN D;  5BO0 A;  3WKJ D;  5C3I B;  1M1A A;  4CSR B;  5B1M C;  3AZN D;  4EO5 B;  4WU9 D;  3REL C;  4KGC C;  5B0Y C;  5GSU D;  4G91 B;  5F99 C;  4H9S C;  5B31 C;  3X1S B;  4Z5T B;  2CWE A;  1WWS A;  3AFA C;  1BH9 B;  3C1B C;  3TU4 A;  3REJ B;  4CSR A;  5JRG A;  3LJA C;  1P3P C;  5CP6 A;  5AV8 A;  5DNM C;  5B0Y D;  5B24 B;  4H9R A;  4KUD A;  2HIO A;  5GSU B;  3R45 A;  1ID3 C;  1N1J A;  5AVC A;  2CV5 B;  1P3I D;  3VH6 T;  3VH6 W;  2NQB B;  4WU8 A;  1ID3 A;  3WAA A;  3MGS C;  2PYO B;  3REI C;  3A6N D;  4JJN A;  1EQZ C;  4J8X D;  3REJ D;  3MVD A;  4J8W D;  5B32 G;  5GT0 A;  4H9R B;  4CAY B;  3AZI A;  3WA9 A;  3W98 C;  4G92 B;  4WU9 C;  1TZY A;  5AVC B;  1KX5 B;  5F99 A;  3TU4 D;  3B6F A;  3KWQ C;  3AZK D;  5B24 C;  2PYO D;  4ZUX A;  2LY8 A;  3LEL D;  3AZG A;  1WWI A;  3A6N B;  3AZE D;  1P3K A;  3W96 A;  5JRG B;  3REH C;  1M1A B;  1U35 B;  3AZH B;  1P3A A;  5AV9 B;  1P3I A;  4YM6 A;  5FUG B;  1ZLA B;  4J8U D;  1P3F D;  4WU8 B;  3AZL B;  1F66 A;  2YFW B;  5B1M B;  3MGP A;  2L5A A;  3AZG B;  5DNN A;  4QLC D;  3W96 B;  3MVD B;  1M19 B;  5JRG C;  3LJA A;  1ZLA C;  5AV5 B;  3C1B A;  3AZI C;  2HIO B;  5GSU A;  4KGC D;  5CPJ D;  5BNX B;  5B33 D;  3C1C C;  1F66 B;  5GT3 C;  3AZL D;  2FJ7 C;  4J8X C;  2ARO B;  4J8U B;  1AOI B;  4Z5T A;  5CPI B;  1BH9 A;  2F8N B;  3KUY C;  5B31 D;  3REL A;  5B2I B;  5E5A C;  5AV8 D;  1KX4 A;  4LD9 D;  2JSS A;  3LZ0 D;  4NE6 A;  1P3A C;  1KU5 A;  4KUD D;  4X23 D;  3KSY A;  3MGQ B;  3LEL B;  5C3I C;  3REH A;  4YM6 B;  5CPJ B;  3X1T A;  5KDM A;  3AZE A;  5B32 D;  3WTP C;  3B6F B;  2FJ7 D;  3KXB C;  5GT3 B;  3KWQ A;  5AVB B;  5CPK D;  4Z66 D;  5B2I C;  1P34 D;  5B31 G;  3KUY B;  4WU9 A;  4X23 B;  4J8X B;  5GSU C;  3X1S C;  5AV9 D;  1TZY D;  5BNX A;  3O62 B;  4M6B A;  3KXB D;  2NQB D;  4J8V B;  3B0D B;  3AV2 A;  3NQU B;  3AZL C;  5AV6 C;  5CPI A;  1S32 A;  2F8N G;  2F8N K;  5CPJ C;  2HIO D;  1B67 A;  5AV8 C;  2YFV B;  2RVQ C;  4EO5 C;  5B0Z C;  3UTA B;  3X1T B;  4E44 A;  3C1C B;  3B0B A;  1P3K C;  3AZJ D;  5GXQ A;  3LZ0 B;  3X1V B;  1P3M B;  4LD9 A;  5AY8 B;  4J8U C;  3UT9 D;  2NZD A;  3REJ A;  5B2I A;  2F8N H;  4WU9 B;  5AV5 A;  3KXB A;  1M1A D;  2NZD C;  4H9O B;  3UTB C;  1Q9C A;  2YFV A;  3MGR C;  1P3B D;  1M18 B;  5GXQ C;  4J8V D;  3X1T C;  3AZK B;  1H3O B;  1P3O B;  5B0Z A;  4R8P C;  5JA4 A;  1BH8 B;  5AVC D;  3REI A;  1JFI B;  3X1U A;  5E5A A;  2CV5 C;  3REK C;  4WU8 C;  1P3M D;  1P34 B;  3W96 D;  5B33 C;  1ID3 D;  5BNV A;  1F1E A;  1HQ3 A;  5AV9 C;  5B24 A;  4X23 C;  5GXQ D;  3LZ0 C;  4J8V C;  4J8X A;  3REH D;  3UT9 A;  2NZD D;  3REJ C;  3W97 D;  3B6G A;  5AVB C;  5B1L A;  1KX3 B;  4XZQ A;  4LD9 B;  4JJN B;  5AVB A;  1P3F C;  3WTP D;  1S32 B;  4YS3 A;  3UTA C;  3MNN D;  3V9R B;  5B0Z D;  3WA9 B;  2BYM B;  5DNM D;  3AZI D;  3UT9 B;  5AV9 A;  3X1U D;  5BS7 A;  1S32 C;  5F99 B;  4YM6 C;  3AZE C;  3LEL C;  5CPI C;  3AZN A;  3AZL A;  2NQB A;  3KUY D;  3REI D;  1ID3 B;  4KGC B;  3AV2 D;  4Z5T D;  3AZM A;  1P3M A;  3NQU A;  3VH5 W;  5E5A B;  5CPK B;  5GT3 D;  2NQB C;  3LJA B;  4WNN A;  3C1B B;  1U35 A;  1P3O D;  3AV1 C;  4XZQ D;  3LZ1 A;  1P3G D;  1P3A D;  3B6F C;  1M19 C;  1P3L A;  1ZLA D;  3VH5 A;  3UTA A;  1TAF A;  3C1C A;  3W99 A;  5CP6 D;  4KGC A;  4J8U A;  1P3F A;  3AZJ A;  5JA4 B;  3WTP A;  5B0Y B;  5B1M A;  5B24 D;  3MGP B;  3AZK C;  5CPK A;  4DRB A;  5B2J A;  3MVD C;  3REK B;  1P34 A;  5B40 A;  4WNN B;  4H9P B;  5GT0 B;  1P3G B;  4KHA A;  4R8P B;  3AZM D;  5B1L D;  3MGS A;  1P3O C;  3B0C T;  1P3L B;  5CPJ A;  1F66 C;  2FJ7 B;  3MVD D;  1KX4 D;  3W99 B;  5B33 A;  3NQJ A;  1P3O A;  5B1L B;  4R8P D;  3AZM B;  5GT3 A;  3KWQ B;  5CP6 C;  4ZUX B;  3X1U B;  3W98 B;  2IO5 C;  4H9P A;  5F99 D;  5AV8 B;  5B2J C;  1P3G A;  3AZG C;  3AYW D;  5B1L C;  5CHL B;  3AZH A;  4XUJ D;  3W99 C;  2F8N D;  5AV5 C;  1P3I B;  2CV5 D;  1P3L C;  4H9N A;  3B6G D;  1TAF B;  3AZE B;  1KX3 D;  3AZF B;  3AN2 B;  4XZQ B;  5AVB D;  3WA9 C;  3KWQ D;  3TU4 B;  1P3I C;  3VH6 A;  1P3L D;  3B6F D;  5AV5 D;  5B32 B;  3W99 D;  1KX4 B;  1M18 C;  4KHA B;  4R8P A;  3VH5 T;  5BT1 C;  3LEL A;  3MNN C;  3AZG D;  5B1M D;  3AZN C;  3O62 C;  3REK D;  3NQJ B;  5AVC C;  2BYK B;  3WAA B;  3UTB A;  4DRA A;  4XUJ A;  5DNM B;  1A7W A;  4G92 C;  2F8N A;  5CPI D;  3WTP E;  1S32 D;  2RVQ D;  3AYW A;  3TU4 C;  3AZH D;  1U35 D;  1KX5 C;  1F66 D;  1P3A B;  1BFM A;  1P3G C;  3LZ1 D;  4XZQ C;  5GT0 C;  3MGS B;  1ULY A;  3AZF C;  3AN2 C;  3AYW C;  3MGQ A;  1KX5 A;  1ZLA A;  4H9N B;  3LJA D;  1H3O A;  3UT9 C;  3WAA D;  2BYK A;  4NE3 A;  3C1B D;  4J8V A;  5GXQ B;  3LZ0 A;  3AZJ B;  3AV2 B;  3REI B;  3X1V D;  4QLC B;  5B0Y A;  3B0C W;  4AWL C;  4YS3 D;  4HGA C;  5B40 D;  3REK A;  3X1T D;  2IO5 B;  3X1S D;  5B32 A; 
#chains in the Genus database with same CATH topology
 4KUD C;  3X1U C;  3AZI B;  3MGR D;  1P3B C;  2ARO C;  5AY8 C;  1AOI C;  1M18 A;  3AZM C;  3REL D;  4ZBJ B;  4NE5 A;  3AZK A;  5CPK C;  4Z2M G;  3AFA A;  4E45 A;  4J8W A;  1P3B B;  3W97 A;  4Z5T C;  1P3K D;  3REL B;  5DNN B;  1M19 A;  4AWL B;  3AYW B;  1TZY C;  1T3U A;  3W97 C;  5G49 A;  4G91 C;  1HTA A;  5AY8 D;  3MGQ C;  4CAY A;  5AV6 B;  1U35 C;  3UTB D;  1KX5 D;  3W98 D;  3REH B;  1M1A C;  4ZUX D;  3AV1 D;  3UTA D;  1B6W A;  1R4V A;  4J8W B;  2ARO A;  4JJN C;  3UTB B;  5DNN C;  1AOI A;  1EQZ A;  4Z2M H;  4QLC A;  4WZS B;  1HQ3 C;  2HUE C;  3KUY A;  3AZF D;  3AN2 D;  4YM6 D;  5GT0 D;  3V9R A;  5BNV B;  4NFT A;  1M18 D;  3MNN A;  3WKJ B;  5AV6 A;  3LZ1 B;  4H9O A;  2HIO C;  2W8S A;  1P3P A;  5B40 C;  3MGP D;  1P34 C;  5FUG A;  5B2I D;  3W96 C;  4HGA B;  1EQZ B;  3EPH A;  2PYO C;  3X1S A;  2YFW A;  3AZJ C;  3MGR A;  2RIQ A;  3C1C D;  5B40 B;  5BO0 B;  4YS3 B;  5G49 B;  4X23 A;  4H9Q B;  3LZ1 C;  3B0D C;  3R45 B;  2BYM A;  4LD9 C;  5B2J D;  3AV1 A;  1N1J B;  3AZH C;  5E5A D;  2CV5 A;  5KDM B;  3A6N C;  3AFA B;  3AZN B;  4WU8 D;  1P3M C;  3MGS D;  1P3F B;  4UUZ B;  3X1V C;  5AV6 D;  1P3B A;  5AY8 A;  4Z66 A;  1KX4 C;  3EG5 B;  1KX3 C;  3WAA C;  5B32 C;  3W98 A;  3O62 D;  3KXB B;  5BS7 C;  5CP6 B;  5BT1 D;  4ZUX C;  3MNN B;  3WKJ A;  2ARO D;  1P3P D;  1AOI D;  1TZY B;  2FJ7 A;  5JRG D;  4YS3 C;  5B33 B;  2F2A C;  3AFA D;  1HQ3 D;  4UUZ A;  3AZF A;  3AN2 A;  1BH8 A;  2PYO A;  4Z66 B;  3MGR B;  3W97 B;  2NZD B;  5B31 A;  3B6G C;  2DF4 C;  5B2J B;  1M19 D;  2HUE B;  4H9S A;  4WV4 B;  1HQ3 B;  3MGP C;  4H9Q A;  4XUJ C;  4KUD B;  3AV1 B;  3WKJ C;  4J8W C;  3MGQ D;  1P3P B;  3B6G B;  2Y2O A;  4ZBJ C;  3O62 A;  3WA9 D;  4QLC C;  5B0Z B;  4Z66 C;  1EQZ D;  1KX3 A;  3AV2 C;  5DNM A;  4XUJ B;  3X1V A;  1JFI A;  3WTP B;  5B31 B;  5DNN D;  3A6N A;  1P3K B;  4JJN D;  3KFU G;  5BO0 A;  3WKJ D;  5C3I B;  1M1A A;  4CSR B;  5B1M C;  3AZN D;  4EO5 B;  4WU9 D;  3REL C;  3H0M C;  4KGC C;  5B0Y C;  5GSU D;  4G91 B;  5F99 C;  4H9S C;  5B31 C;  3X1S B;  4Z5T B;  2CWE A;  1WWS A;  3AFA C;  1BH9 B;  3C1B C;  2JE5 A;  3REJ B;  4CSR A;  3TU4 A;  5JRG A;  3LJA C;  1P3P C;  5CP6 A;  5AV8 A;  5DNM C;  5B0Y D;  5B24 B;  4H9R A;  4KUD A;  2HIO A;  5GSU B;  3R45 A;  1Z2C B;  1ID3 C;  1N1J A;  5AVC A;  2CV5 B;  1P3I D;  2Y2M A;  3VH6 T;  3VH6 W;  2NQB B;  4WU8 A;  1ID3 A;  3WAA A;  3MGS C;  2Y2L A;  2PYO B;  3REI C;  3A6N D;  4JJN A;  1EQZ C;  4J8X D;  3REJ D;  3MVD A;  4J8W D;  5B32 G;  5GT0 A;  4H9R B;  4CAY B;  3AZI A;  3WA9 A;  3W98 C;  4G92 B;  2ZY2 A;  4WU9 C;  1TZY A;  5AVC B;  1KX5 B;  5F99 A;  3TU4 D;  3B6F A;  3KWQ C;  3AZK D;  5B24 C;  2PYO D;  4ZUX A;  2G5I C;  2LY8 A;  3LEL D;  3AZG A;  1WWI A;  3A6N B;  3AZE D;  1P3K A;  3W96 A;  3A1I A;  5JRG B;  3REH C;  1M1A B;  1U35 B;  2FFF B;  3AZH B;  1P3A A;  2Y2J A;  5AV9 B;  1P3I A;  4YM6 A;  5FUG B;  1ZLA B;  4J8U D;  1P3F D;  4WU8 B;  3AZL B;  1F66 A;  2YFW B;  5B1M B;  3MGP A;  2L5A A;  3AZG B;  5DNN A;  4QLC D;  3W96 B;  3MVD B;  1M19 B;  5JRG C;  3LJA A;  1ZLA C;  5AV5 B;  3C1B A;  3AZI C;  2HIO B;  5GSU A;  4KGC D;  5CPJ D;  3FDD A;  5BNX B;  5B33 D;  3C1C C;  1F66 B;  2BG1 A;  5GT3 C;  3AZL D;  2FJ7 C;  4J8X C;  2DQN C;  2ARO B;  4J8U B;  1AOI B;  4Z5T A;  5CPI B;  1BH9 A;  2F8N B;  3KUY C;  5B31 D;  3REL A;  1W2E A;  5B2I B;  2Y2P A;  5E5A C;  5AV8 D;  3H0L C;  1KX4 A;  4LD9 D;  2JSS A;  3LZ0 D;  4NE6 A;  1P3A C;  1KU5 A;  4KUD D;  4X23 D;  3KSY A;  3P5J B;  3MGQ B;  3LEL B;  5C3I C;  3REH A;  2ZY4 A;  4YM6 B;  5CPJ B;  3X1T A;  5KDM A;  3AZE A;  5B32 D;  3WTP C;  3B6F B;  2FJ7 D;  3KXB C;  5GT3 B;  3KWQ A;  5AVB B;  2ZY5 A;  5CPK D;  4Z66 D;  5B2I C;  1P34 D;  5B31 G;  3KUY B;  4WU9 A;  4X23 B;  4J8X B;  4DQY B;  5GSU C;  3X1S C;  5AV9 D;  1TZY D;  3AL0 C;  5BNX A;  3O62 B;  2UWX A;  4M6B A;  3KXB D;  2NQB D;  4J8V B;  3B0D B;  3AV2 A;  3NQU B;  3AZL C;  5AV6 C;  5CPI A;  1S32 A;  2F8N G;  2J8P A;  2F8N K;  5CPJ C;  2HIO D;  1B67 A;  5AV8 C;  2YFV B;  2ZM5 A;  2RVQ C;  4EO5 C;  5B0Z C;  3UTA B;  3X1T B;  4E44 A;  3C1C B;  2XD1 A;  3B0B A;  3EPL A;  1P3K C;  3AZJ D;  5GXQ A;  3LZ0 B;  3X1V B;  3F6T A;  1P3M B;  4LD9 A;  5AY8 B;  4J8U C;  3UT9 D;  2Y2I A;  2NZD A;  3REJ A;  5B2I A;  2F8N H;  4WU9 B;  5AV5 A;  3KXB A;  1M1A D;  2NZD C;  4H9O B;  3UTB C;  1Q9C A;  2YFV A;  3MGR C;  1P3B D;  1M18 B;  5GXQ C;  4J8V D;  2G5H C;  3X1T C;  3AZK B;  1H3O B;  4UPK A;  1P3O B;  5B0Z A;  4R8P C;  5JA4 A;  1BH8 B;  5AVC D;  3EPJ A;  3REI A;  3X1U A;  1JFI B;  5E5A A;  2CV5 C;  3REK C;  4WU8 C;  1P3M D;  1P34 B;  3W96 D;  5B33 C;  1ID3 D;  5BNV A;  1F1E A;  1HQ3 A;  5AV9 C;  5B24 A;  4X23 C;  5GXQ D;  3LZ0 C;  4J8V C;  4J8X A;  3A1K A;  3REH D;  3UT9 A;  2NZD D;  3REJ C;  3W97 D;  3B6G A;  5AVB C;  2Y2H A;  5B1L A;  1KX3 B;  2Y2K A;  4XZQ A;  4LD9 B;  4JJN B;  5AVB A;  1P3F C;  3WTP D;  1S32 B;  4YS3 A;  3UTA C;  3MNN D;  3V9R B;  5B0Z D;  3WA9 B;  2BYM B;  5DNM D;  3AZI D;  2VQR A;  3UT9 B;  5AV9 A;  3X1U D;  5BS7 A;  2ZY3 A;  1S32 C;  5F99 B;  4YM6 C;  3AZE C;  3LEL C;  5CPI C;  3AZN A;  3AZL A;  2NQB A;  3KUY D;  3REI D;  1ID3 B;  4KGC B;  3AV2 D;  4Z5T D;  3AZM A;  1P3M A;  3NQU A;  3VH5 W;  5E5A B;  5CPK B;  5GT3 D;  2NQB C;  3LJA B;  4WNN A;  4WJ3 C;  3C1B B;  1U35 A;  1P3O D;  3AV1 C;  4XZQ D;  3LZ1 A;  1P3G D;  1P3A D;  2Y2Q A;  3B6F C;  1M19 C;  1P3L A;  1ZLA D;  3VH5 A;  3UTA A;  1TAF A;  3C1C A;  3W99 A;  5CP6 D;  4KGC A;  4J8U A;  1P3F A;  3AZJ A;  5JA4 B;  3WTP A;  5B0Y B;  5B1M A;  5B24 D;  3MGP B;  3AZK C;  5CPK A;  4DRB A;  5B2J A;  3MVD C;  3REK B;  1P34 A;  5B40 A;  4WNN B;  4H9P B;  5GT0 B;  1P3G B;  4KHA A;  4R8P B;  3AZM D;  5B1L D;  3MGS A;  1P3O C;  3B0C T;  1P3L B;  5CPJ A;  1F66 C;  2FJ7 B;  3MVD D;  1KX4 D;  3W99 B;  5B33 A;  1PZR A;  3NQJ A;  1P3O A;  2XD5 A;  5B1L B;  4R8P D;  3AZM B;  2JCH A;  5GT3 A;  3KWQ B;  5CP6 C;  4ZUX B;  3X1U B;  3W98 B;  2IO5 C;  4H9P A;  5F99 D;  5AV8 B;  5B2J C;  1P3G A;  3AZG C;  3AYW D;  5B1L C;  5CHL B;  3AZH A;  4XUJ D;  3W99 C;  2F8N D;  5AV5 C;  1P3I B;  2CV5 D;  1P3L C;  4H9N A;  3B6G D;  1TAF B;  3AZE B;  1KX3 D;  3AZF B;  3AN2 B;  4XZQ B;  3IP4 C;  5AVB D;  3WA9 C;  3KWQ D;  3TU4 B;  1P3I C;  3H0R C;  3VH6 A;  1P3L D;  3B6F D;  5AV5 D;  5B32 B;  3W99 D;  1KX4 B;  1M18 C;  4KHA B;  4R8P A;  3VH5 T;  5BT1 C;  3LEL A;  3MNN C;  3AZG D;  5B1M D;  3AZN C;  3O62 C;  3REK D;  3NQJ B;  5AVC C;  2BYK B;  3WAA B;  3UTB A;  4DRA A;  4XUJ A;  5DNM B;  1A7W A;  4G92 C;  2F8N A;  5CPI D;  2Y2G A;  3WTP E;  1S32 D;  2RVQ D;  3AYW A;  3TU4 C;  3AZH D;  1U35 D;  1KX5 C;  1F66 D;  1P3A B;  1BFM A;  1P3G C;  3LZ1 D;  4XZQ C;  5GT0 C;  3MGS B;  1ULY A;  3AZF C;  3AN2 C;  3AYW C;  3MGQ A;  1KX5 A;  1ZLA A;  4H9N B;  3LJA D;  1H3O A;  3UT9 C;  2Y2N A;  3WAA D;  2BYK A;  4NE3 A;  3C1B D;  4J8V A;  5GXQ B;  3LZ0 A;  3AZJ B;  3AV2 B;  3REI B;  3X1V D;  4QLC B;  5B0Y A;  3B0C W;  4AWL C;  4YS3 D;  4HGA C;  5B40 D;  3REK A;  3X1T D;  3EPK A;  2IO5 B;  3X1S D;  5B32 A; 
#chains in the Genus database with same CATH homology
 4KUD C;  3X1U C;  3AZI B;  3MGR D;  1P3B C;  2ARO C;  5AY8 C;  1AOI C;  1M18 A;  3AZM C;  3REL D;  4ZBJ B;  4NE5 A;  3AZK A;  5CPK C;  4Z2M G;  3AFA A;  4E45 A;  4J8W A;  1P3B B;  3W97 A;  4Z5T C;  1P3K D;  3REL B;  5DNN B;  1M19 A;  4AWL B;  3AYW B;  1TZY C;  1T3U A;  3W97 C;  5G49 A;  4G91 C;  1HTA A;  5AY8 D;  3MGQ C;  4CAY A;  5AV6 B;  1U35 C;  3UTB D;  1KX5 D;  3W98 D;  3REH B;  1M1A C;  4ZUX D;  3AV1 D;  3UTA D;  1B6W A;  1R4V A;  4J8W B;  2ARO A;  4JJN C;  3UTB B;  5DNN C;  1AOI A;  1EQZ A;  4Z2M H;  4QLC A;  4WZS B;  1HQ3 C;  2HUE C;  3KUY A;  3AZF D;  3AN2 D;  4YM6 D;  5GT0 D;  3V9R A;  5BNV B;  4NFT A;  1M18 D;  3MNN A;  3WKJ B;  5AV6 A;  3LZ1 B;  4H9O A;  2HIO C;  2W8S A;  1P3P A;  5B40 C;  3MGP D;  1P34 C;  5FUG A;  5B2I D;  3W96 C;  4HGA B;  1EQZ B;  3EPH A;  2PYO C;  3X1S A;  2YFW A;  3AZJ C;  3MGR A;  2RIQ A;  3C1C D;  5B40 B;  5BO0 B;  4YS3 B;  5G49 B;  4X23 A;  4H9Q B;  3LZ1 C;  3B0D C;  3R45 B;  2BYM A;  4LD9 C;  5B2J D;  3AV1 A;  1N1J B;  3AZH C;  5E5A D;  2CV5 A;  5KDM B;  3A6N C;  3AFA B;  3AZN B;  4WU8 D;  1P3M C;  3MGS D;  1P3F B;  4UUZ B;  3X1V C;  5AV6 D;  1P3B A;  5AY8 A;  4Z66 A;  1KX4 C;  3EG5 B;  1KX3 C;  3WAA C;  5B32 C;  3W98 A;  3O62 D;  3KXB B;  5BS7 C;  5CP6 B;  5BT1 D;  4ZUX C;  3MNN B;  3WKJ A;  2ARO D;  1P3P D;  1AOI D;  1TZY B;  2FJ7 A;  5JRG D;  4YS3 C;  5B33 B;  2F2A C;  3AFA D;  1HQ3 D;  4UUZ A;  3AZF A;  3AN2 A;  1BH8 A;  2PYO A;  4Z66 B;  3MGR B;  3W97 B;  2NZD B;  5B31 A;  3B6G C;  2DF4 C;  5B2J B;  1M19 D;  2HUE B;  4H9S A;  4WV4 B;  1HQ3 B;  3MGP C;  4H9Q A;  4XUJ C;  4KUD B;  3AV1 B;  3WKJ C;  4J8W C;  3MGQ D;  1P3P B;  3B6G B;  2Y2O A;  4ZBJ C;  3O62 A;  3WA9 D;  4QLC C;  5B0Z B;  4Z66 C;  1EQZ D;  1KX3 A;  3AV2 C;  5DNM A;  4XUJ B;  3X1V A;  1JFI A;  3WTP B;  5B31 B;  5DNN D;  3A6N A;  1P3K B;  4JJN D;  3KFU G;  5BO0 A;  3WKJ D;  5C3I B;  1M1A A;  4CSR B;  5B1M C;  3AZN D;  4EO5 B;  4WU9 D;  3REL C;  3H0M C;  4KGC C;  5B0Y C;  5GSU D;  4G91 B;  5F99 C;  4H9S C;  5B31 C;  3X1S B;  4Z5T B;  2CWE A;  1WWS A;  3AFA C;  1BH9 B;  3C1B C;  2JE5 A;  3REJ B;  4CSR A;  3TU4 A;  5JRG A;  3LJA C;  1P3P C;  5CP6 A;  5AV8 A;  5DNM C;  5B0Y D;  5B24 B;  4H9R A;  4KUD A;  2HIO A;  5GSU B;  3R45 A;  1Z2C B;  1ID3 C;  1N1J A;  5AVC A;  2CV5 B;  1P3I D;  2Y2M A;  3VH6 T;  3VH6 W;  2NQB B;  4WU8 A;  1ID3 A;  3WAA A;  3MGS C;  2Y2L A;  2PYO B;  3REI C;  3A6N D;  4JJN A;  1EQZ C;  4J8X D;  3REJ D;  3MVD A;  4J8W D;  5B32 G;  5GT0 A;  4H9R B;  4CAY B;  3AZI A;  3WA9 A;  3W98 C;  4G92 B;  2ZY2 A;  4WU9 C;  1TZY A;  5AVC B;  1KX5 B;  5F99 A;  3TU4 D;  3B6F A;  3KWQ C;  3AZK D;  5B24 C;  2PYO D;  4ZUX A;  2G5I C;  2LY8 A;  3LEL D;  3AZG A;  1WWI A;  3A6N B;  3AZE D;  1P3K A;  3W96 A;  3A1I A;  5JRG B;  3REH C;  1M1A B;  1U35 B;  2FFF B;  3AZH B;  1P3A A;  2Y2J A;  5AV9 B;  1P3I A;  4YM6 A;  5FUG B;  1ZLA B;  4J8U D;  1P3F D;  4WU8 B;  3AZL B;  1F66 A;  2YFW B;  5B1M B;  3MGP A;  2L5A A;  3AZG B;  5DNN A;  4QLC D;  3W96 B;  3MVD B;  1M19 B;  5JRG C;  3LJA A;  1ZLA C;  5AV5 B;  3C1B A;  3AZI C;  2HIO B;  5GSU A;  4KGC D;  5CPJ D;  3FDD A;  5BNX B;  5B33 D;  3C1C C;  1F66 B;  2BG1 A;  5GT3 C;  3AZL D;  2FJ7 C;  4J8X C;  2DQN C;  2ARO B;  4J8U B;  1AOI B;  4Z5T A;  5CPI B;  1BH9 A;  2F8N B;  3KUY C;  5B31 D;  3REL A;  1W2E A;  5B2I B;  2Y2P A;  5E5A C;  5AV8 D;  3H0L C;  1KX4 A;  4LD9 D;  2JSS A;  3LZ0 D;  4NE6 A;  1P3A C;  1KU5 A;  4KUD D;  4X23 D;  3KSY A;  3P5J B;  3MGQ B;  3LEL B;  5C3I C;  3REH A;  2ZY4 A;  4YM6 B;  5CPJ B;  3X1T A;  5KDM A;  3AZE A;  5B32 D;  3WTP C;  3B6F B;  2FJ7 D;  3KXB C;  5GT3 B;  3KWQ A;  5AVB B;  2ZY5 A;  5CPK D;  4Z66 D;  5B2I C;  1P34 D;  5B31 G;  3KUY B;  4WU9 A;  4X23 B;  4J8X B;  4DQY B;  5GSU C;  3X1S C;  5AV9 D;  1TZY D;  3AL0 C;  5BNX A;  3O62 B;  2UWX A;  4M6B A;  3KXB D;  2NQB D;  4J8V B;  3B0D B;  3AV2 A;  3NQU B;  3AZL C;  5AV6 C;  5CPI A;  1S32 A;  2F8N G;  2J8P A;  2F8N K;  5CPJ C;  2HIO D;  1B67 A;  5AV8 C;  2YFV B;  2ZM5 A;  2RVQ C;  4EO5 C;  5B0Z C;  3UTA B;  3X1T B;  4E44 A;  3C1C B;  2XD1 A;  3B0B A;  3EPL A;  1P3K C;  3AZJ D;  5GXQ A;  3LZ0 B;  3X1V B;  3F6T A;  1P3M B;  4LD9 A;  5AY8 B;  4J8U C;  3UT9 D;  2Y2I A;  2NZD A;  3REJ A;  5B2I A;  2F8N H;  4WU9 B;  5AV5 A;  3KXB A;  1M1A D;  2NZD C;  4H9O B;  3UTB C;  1Q9C A;  2YFV A;  3MGR C;  1P3B D;  1M18 B;  5GXQ C;  4J8V D;  2G5H C;  3X1T C;  3AZK B;  1H3O B;  4UPK A;  1P3O B;  5B0Z A;  4R8P C;  5JA4 A;  1BH8 B;  5AVC D;  3EPJ A;  3REI A;  3X1U A;  1JFI B;  5E5A A;  2CV5 C;  3REK C;  4WU8 C;  1P3M D;  1P34 B;  3W96 D;  5B33 C;  1ID3 D;  5BNV A;  1F1E A;  1HQ3 A;  5AV9 C;  5B24 A;  4X23 C;  5GXQ D;  3LZ0 C;  4J8V C;  4J8X A;  3A1K A;  3REH D;  3UT9 A;  2NZD D;  3REJ C;  3W97 D;  3B6G A;  5AVB C;  2Y2H A;  5B1L A;  1KX3 B;  2Y2K A;  4XZQ A;  4LD9 B;  4JJN B;  5AVB A;  1P3F C;  3WTP D;  1S32 B;  4YS3 A;  3UTA C;  3MNN D;  3V9R B;  5B0Z D;  3WA9 B;  2BYM B;  5DNM D;  3AZI D;  2VQR A;  3UT9 B;  5AV9 A;  3X1U D;  5BS7 A;  2ZY3 A;  1S32 C;  5F99 B;  4YM6 C;  3AZE C;  3LEL C;  5CPI C;  3AZN A;  3AZL A;  2NQB A;  3KUY D;  3REI D;  1ID3 B;  4KGC B;  3AV2 D;  4Z5T D;  3AZM A;  1P3M A;  3NQU A;  3VH5 W;  5E5A B;  5CPK B;  5GT3 D;  2NQB C;  3LJA B;  4WNN A;  4WJ3 C;  3C1B B;  1U35 A;  1P3O D;  3AV1 C;  4XZQ D;  3LZ1 A;  1P3G D;  1P3A D;  2Y2Q A;  3B6F C;  1M19 C;  1P3L A;  1ZLA D;  3VH5 A;  3UTA A;  1TAF A;  3C1C A;  3W99 A;  5CP6 D;  4KGC A;  4J8U A;  1P3F A;  3AZJ A;  5JA4 B;  3WTP A;  5B0Y B;  5B1M A;  5B24 D;  3MGP B;  3AZK C;  5CPK A;  4DRB A;  5B2J A;  3MVD C;  3REK B;  1P34 A;  5B40 A;  4WNN B;  4H9P B;  5GT0 B;  1P3G B;  4KHA A;  4R8P B;  3AZM D;  5B1L D;  3MGS A;  1P3O C;  3B0C T;  1P3L B;  5CPJ A;  1F66 C;  2FJ7 B;  3MVD D;  1KX4 D;  3W99 B;  5B33 A;  1PZR A;  3NQJ A;  1P3O A;  2XD5 A;  5B1L B;  4R8P D;  3AZM B;  2JCH A;  5GT3 A;  3KWQ B;  5CP6 C;  4ZUX B;  3X1U B;  3W98 B;  2IO5 C;  4H9P A;  5F99 D;  5AV8 B;  5B2J C;  1P3G A;  3AZG C;  3AYW D;  5B1L C;  5CHL B;  3AZH A;  4XUJ D;  3W99 C;  2F8N D;  5AV5 C;  1P3I B;  2CV5 D;  1P3L C;  4H9N A;  3B6G D;  1TAF B;  3AZE B;  1KX3 D;  3AZF B;  3AN2 B;  4XZQ B;  3IP4 C;  5AVB D;  3WA9 C;  3KWQ D;  3TU4 B;  1P3I C;  3H0R C;  3VH6 A;  1P3L D;  3B6F D;  5AV5 D;  5B32 B;  3W99 D;  1KX4 B;  1M18 C;  4KHA B;  4R8P A;  3VH5 T;  5BT1 C;  3LEL A;  3MNN C;  3AZG D;  5B1M D;  3AZN C;  3O62 C;  3REK D;  3NQJ B;  5AVC C;  2BYK B;  3WAA B;  3UTB A;  4DRA A;  4XUJ A;  5DNM B;  1A7W A;  4G92 C;  2F8N A;  5CPI D;  2Y2G A;  3WTP E;  1S32 D;  2RVQ D;  3AYW A;  3TU4 C;  3AZH D;  1U35 D;  1KX5 C;  1F66 D;  1P3A B;  1BFM A;  1P3G C;  3LZ1 D;  4XZQ C;  5GT0 C;  3MGS B;  1ULY A;  3AZF C;  3AN2 C;  3AYW C;  3MGQ A;  1KX5 A;  1ZLA A;  4H9N B;  3LJA D;  1H3O A;  3UT9 C;  2Y2N A;  3WAA D;  2BYK A;  4NE3 A;  3C1B D;  4J8V A;  5GXQ B;  3LZ0 A;  3AZJ B;  3AV2 B;  3REI B;  3X1V D;  4QLC B;  5B0Y A;  3B0C W;  4AWL C;  4YS3 D;  4HGA C;  5B40 D;  3REK A;  3X1T D;  3EPK A;  2IO5 B;  3X1S D;  5B32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...