2YFVA

The heterotrimeric complex of kluyveromyces lactis scm3, cse4 and h4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
73
structure length
68
Chain Sequence
ISRMPFARLVKEVTDQFTLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIMRKDMQLARRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords HISTONE H3-LIKE CENTROMERIC PROTEIN CSE4
publication title Recognition of the Centromere-Specific Histone Cse4 by the Chaperone Scm3.
pubmed doi rcsb
source organism Kluyveromyces lactis nrrl y-1140
total genus 24
structure length 68
sequence length 73
ec nomenclature
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2yfvA00
5BNXA 4H9NA 3MGQA 4J8VA 1AOIA 3W98C 5B24A 5GT3C 3LELA 5B31D 3C1CA 3KUYB 4J8WD 1BFMA 1EQZC 3REHC 3KSYA 3B0DC 3W99D 1P3KC 4X23D 5AV5B 3UT9C 3REKD 1WWSA 1P3AC 4WU9D 3MVDB 2CV5A 3REJD 1HQ3B 5B40D 1P3MB 2NQBB 1KX3B 3KWQB 5B33A 2F8NG 3LJAA 5CPID 1P3ID 2IO5C 4DRAA 3B6FD 4G91B 5CP6A 3MGPA 5B0YD 4KHAB 1KX5A 3X1SD 3AZFA 1F66C 3AZND 5GSUC 3AYWB 4J8XC 5B1MD 5BS7C 4R8PD 5B2JC 4JJNA 3TU4D 3WTPC 1P3LD 4KGCB 5CPKA 4WNNA 4XUJD 5AVCC 4E45A 5B0ZB 4YM6B 3W98D 5AY8C 1P3GC 1P3OA 4XZQA 4H9NB 3WA9C 3LZ0D 3B0CT 3AZJA 1M19C 5AV8C 3REHD 2PYOB 3WKJB 1P3BC 1BH8B 1P3KD 5FUGA 5B1LB 3AZEC 4H9RB 4KUDB 1S32D 1P3PB 3REIB 5DNMB 4J8UA 1JFIB 5E5AB 4Z66B 3LZ1B 2F8NB 3W97C 3AZKC 3VH6T 3A6NA 3VH6A 3AN2A 2BYMA 5AV6C 3MNNB 3V9RA 1TAFB 5GT3B 1KX4C 3AZGC 1U35A 1EQZB 3B0BA 2HUEC 1BH9A 4H9SC 3UTBA 5GSUD 3B6GC 3AZFB 3B0DB 1ID3C 5GXQC 2F8NK 3W96B 2CWEA 3KUYA 3UT9B 4J8WC 3WTPD 1P3AB 3RELC 5JRGB 4NE6A 3WAAC 5AV5A 5CPJA 3W99C 3KXBC 3UTAD 3WA9D 1TZYD 3O62D 3REKC 4YS3A 1M19D 3MGRC 4G92C 1ZLAB 3MVDA 2IO5B 1HQ3A 1M1AC 1P3MA 3AZED 4WU8B 3REJC 1KX3A 5B32C 3KWQA 5GT0D 5FUGB 1F66B 5B2IC 4J8XB 3AZLC 4J8UB 3W97D 3AV1C 3AZMD 5B2JB 3C1BB 3AFAD 3B6FC 3AZKD 3AYWA 3X1SC 5AVCB 1B67A 1M18B 5AY8B 4ZUXD 1P3GB 1KX4D 5BO0B 3AZGD 5AVBD 4KGCA 5AV9B 3TU4C 5AV8B 5B0ZA 4YM6A 3B6GD 3LELC 4XUJC 1P3BB 3C1CC 2FJ7D 5DNND 1KU5A 3LZ0C 3RELD 5CPIA 2PYOA 3WKJA 1BH8A 3WAAD 5B1LA 5B32G 5B0YA 4H9RA 3KXBD 4KUDA 5CPJB 1P3PA 3REIA 4NFTA 5BT1D 5DNMA 1JFIA 2NZDD 5E5AA 4Z66A 1S32C 3LZ1A 3MGRD 4YS3B 1M1AD 5AV6B 2F8NA 5F99D 5B32D 4QLCC 2HUEB 3LJAC 5B2ID 3AV2D 3MGSB 2AROC 3MNNA 3AZLD 1TAFA 3X1TC 1ID3B 5GT3A 3W98A 4ZBJC 2HIOC 5GXQB 3AV1D 4LD9D 5B31B 1EQZA 1P3FD 3X1UC 4J8WB 3REHA 1R4VA 1P3KA 3W96A 4Z5TD 5KDMA 3AZHD 3UT9A 4JJNC 3KXBB 3W99B 4X23B 1P34D 1P3AA 5JRGA 3REKB 5CPKC 3MGRB 4G92B 3MGQD 4J8VD 1AOID 4WU9B 5B24D 3LELD 4EO5C 3C1CD 3NQUB 3REJB 5B40B 3UTAC 5BNVB 1TZYC 1ZLAA 5B2IB 3O62C 4CSRA 5CPIB 1P3IB 4WU8A 3AZIC 1F1EA 3B6FB 3R45B 5B0YB 1F66A 5GT0C 3X1SB 4J8XA 3AZNB 2CV5D 5BS7A 3WTPE 5B1MB 5B2JA 3X1VC 3C1BA 4R8PB 4QLCD 3A6NC 3AZMC 3AFAC 5B33D 2RVQC 3LJAD 3TU4B 5AVCA 1P3LB 2AROD 3X1TD 1M18A 4XUJB 5CP6D 5AY8A 3MGPD 2HIOD 1P3GA 4UUZB 4CAYB 5BO0A 3W98B 1KX5D 1U35C 4ZUXC 1M19A 5AV9A 5AV8A 3X1UD 3LZ0B 5AVBC 2YFWB 1P3BA 3REHB 4HGAC 4JJND 1P3KB 2FJ7C 2YFVB 5KDMB 5DNNC 5CPKD 1S32B 4NE5A 5AV5C 1P3OD 4XZQD 3AZJD 3AZKA 4QLCB 5BT1C 2NZDC 2AROB 5AV6A 2NQBC 2HIOB 3AZID 4CSRB 2L5AA 5F99C 4H9SA 3MGSA 3B6GA 1ID3A 3AV2C 5GSUB 5GXQA 5B31A 3X1VD 4J8WA 3A6ND 4LD9C 1P3FC 2RVQD 3NQJB 3WTPB 1N1JB 4EO5B 3KXBA 3W99A 4X23A 4Z5TC 3AZHC 1U35D 3REKA 3UTAB 3WA9B 3MGRA 3UTBD 1TZYB 4AWLC 1P34C 3O62B 4WU9A 1M19B 3MGQC 4J8VC 1AOIC 3NQUA 3KUYD 5B24C 3REJA 5B40A 3AZIB 5B32A 3VH5W 5BNVA 3AZEB 1Q9CA 5GT0B 5B2IA 3WKJC 5AV5D 1P3IA 2BYKB 4KUDC 3B6FA 3X1VB 3W97B 3R45A 5E5AC 4Z66C 3AZMB 3LZ1C 4H9PB 3AFAB 3X1SA 3MVDD 3AZKB 3AZNA 1HQ3D 1P3MD 5B1MA 2CV5C 2NQBD 1KX3D 4R8PA 3KWQD 5JA4B 4ZUXB 1KX4B 3TU4A 3AZGB 1P3LA 3MNNC 5AVBB 5B33C 4XUJA 3B6GB 4UUZA 4CAYA 1H3OB 4HGAB 5CP6C 3MGPC 2FJ7B 1KX5C 3LZ0A 5DNNB 4DRBA 3AYWD 3AZFC 2YFWA 3W96C 3RELB 3WAAB 2YFVA 3B0CW 5JRGC 4KGCD 1S32A 5B0ZD 4YM6D 2NZDB 4WV4B 1M1AB 4QLCA 5G49A 4E44A 4XZQC 5F99B 1P3OC 1ZLAC 3AZJC 5B32B 2PYOD 3WKJD 2AROA 3X1TA 5B1LD 4WU8C 3AV2B 2HIOA 4KUDD 3AZLB 1P3PD 5CHLB 5DNMD 3REID 3X1UA 5E5AD 4Z66D 3AV1B 4LD9B 3LZ1D 1P3FB 4J8UC 5C3IC 2F8ND 5GSUA 3C1BC 4Z2MH 4Z5TB 3AZHB 3NQJA 3WTPA 4H9QB 4AWLB 3MNND 1P34B 1N1JA 3AN2C 1M18C 5GT3D 5BNXB 3MGQB 4J8VB 1AOIB 5B24B 3LELB 1EQZD 3C1CB 5AV9C 3UTAA 3WA9A 1TZYA 4H9OA 3AZFD 3O62A 3UTBC 3W96D 3UT9D 3AZIA 3KUYC 3AZEA 1P3AD 5JRGD 5GT0A 2BYKA 5CPJC 2CV5B 3X1VA 3W97A 4M6BA 3AZMA 4H9PA 3AFAA 1ZLAD 2F8NH 5G49B 4YS3C 5B33B 3MVDC 3LJAB 4WU8D 1HQ3C 5JA4A 3X1TB 1P3MC 5CP6B 4ZBJB 4ZUXA 3MGPB 1KX3C 1KX4A 1F66D 3KWQC 3AZGA 3MGSC 1KX5B 5AVBA 4J8XD 4J8UD 4NE3A 3X1UB 3VH6W 1H3OA 5B2JD 3C1BD 5B31C 4G91C 2FJ7A 4WZSB 5DNNA 4JJNB 1WWIA 5AVCD 1HTAA 3AYWC 3RELA 3AN2D 5CPKB 1M18D 4WNNB 5AY8D 3VH5T 1P3GD 4X23C 3WAAA 3VH5A 1P3OB 4XZQB 5AV9D 5AV8D 3AZJB 2NZDA 4WU9C 4KGCC 1P3BD 5B0ZC 4H9OB 4YM6C 2NQBA 5B40C 1M1AA 5F99A 5CPIC 5C3IB 1P3IC 2PYOC 3AV2A 2LY8A 3AZLA 4KHAA 5B1LC 1A7WA 5CPJD 5B0YC 3AV1A 4LD9A 1ULYA 1P3PC 3REIC 5DNMC 1P3FA 3AZNC 4YS3D 1B6WA 5AV6D 3A6NB 5B31G 3AN2B 5B1MC 2BYMB 4R8PC 4Z5TA 3V9RB 3AZHA 4Z2MG 1P3LC 4H9QA 3MGSD 1U35B 1P34A 2JSSA 1BH9B 1ID3D 3UTBB 5GXQD
chains in the Genus database with same CATH superfamily
5BNXA 4H9NA 3MGQA 4J8VA 1AOIA 3W98C 5B24A 5GT3C 3LELA 5B31D 3C1CA 3KUYB 4J8WD 1W2EA 1BFMA 1EQZC 3REHC 3KSYA 3B0DC 3W99D 1P3KC 4X23D 5AV5B 3UT9C 2ZY4A 3REKD 1WWSA 1P3AC 2VQRA 4WU9D 3MVDB 2CV5A 3REJD 1HQ3B 5B40D 2DQNC 2JE5A 1P3MB 2NQBB 1KX3B 3KWQB 2Y2JA 3EPKA 5B33A 2F8NG 3LJAA 5CPID 1P3ID 2IO5C 4DRAA 3B6FD 4G91B 5CP6A 3MGPA 5B0YD 4KHAB 1KX5A 3X1SD 3FDDA 3AZFA 1F66C 3AZND 2BG1A 5GSUC 3AYWB 4J8XC 5B1MD 5BS7C 4R8PD 5B2JC 4JJNA 3TU4D 3WTPC 1P3LD 4KGCB 5CPKA 4WNNA 4XUJD 5AVCC 4E45A 5B0ZB 4YM6B 3W98D 5AY8C 1P3GC 4UPKA 1P3OA 4XZQA 4H9NB 3WA9C 3LZ0D 3B0CT 3AZJA 2JCHA 1M19C 5AV8C 3REHD 2J8PA 2PYOB 3WKJB 1P3BC 1BH8B 2Y2GA 1P3KD 5FUGA 5B1LB 3AZEC 4H9RB 4KUDB 1S32D 1P3PB 3REIB 5DNMB 4J8UA 1JFIB 5E5AB 4Z66B 3LZ1B 2XD5A 2F8NB 3W97C 3AZKC 3VH6T 3A6NA 3VH6A 3AN2A 2BYMA 5AV6C 3MNNB 3V9RA 1TAFB 5GT3B 1KX4C 3AZGC 1U35A 1EQZB 3B0BA 2HUEC 1BH9A 4H9SC 3UTBA 5GSUD 3B6GC 3AZFB 3B0DB 1ID3C 5GXQC 2F8NK 3W96B 2CWEA 3KUYA 3UT9B 4J8WC 3WTPD 1P3AB 3RELC 4WJ3C 5JRGB 4NE6A 3WAAC 5AV5A 5CPJA 3W99C 3KXBC 3UTAD 3WA9D 1TZYD 3O62D 3REKC 4YS3A 1M19D 3MGRC 4G92C 1ZLAB 3MVDA 3EPHA 2IO5B 1HQ3A 1M1AC 1P3MA 3AZED 4WU8B 3REJC 1KX3A 5B32C 3KWQA 5GT0D 5FUGB 1F66B 5B2IC 4J8XB 3AZLC 4J8UB 3W97D 3AV1C 3AZMD 5B2JB 3C1BB 3AFAD 3B6FC 3AZKD 2RIQA 2Y2IA 3AYWA 3X1SC 5AVCB 1B67A 1M18B 5AY8B 4ZUXD 1P3GB 1KX4D 5BO0B 3AZGD 5AVBD 2W8SA 4KGCA 5AV9B 3TU4C 5AV8B 2ZY5A 5B0ZA 4YM6A 3B6GD 3LELC 4XUJC 1P3BB 3C1CC 2FJ7D 5DNND 1KU5A 3LZ0C 3RELD 5CPIA 2PYOA 3WKJA 1BH8A 2Y2HA 3WAAD 5B1LA 5B32G 5B0YA 4H9RA 3KXBD 4KUDA 5CPJB 1P3PA 3REIA 4NFTA 5BT1D 5DNMA 1JFIA 2NZDD 5E5AA 4Z66A 1S32C 3LZ1A 3MGRD 4YS3B 1M1AD 5AV6B 2F8NA 5F99D 5B32D 4QLCC 2Y2QA 2HUEB 3LJAC 5B2ID 3AV2D 3MGSB 2AROC 3MNNA 3AZLD 1TAFA 3X1TC 1ID3B 5GT3A 3W98A 4ZBJC 2HIOC 5GXQB 3AV1D 4LD9D 5B31B 1EQZA 1P3FD 3EG5B 3X1UC 4J8WB 3IP4C 3REHA 2ZM5A 1R4VA 1P3KA 3W96A 4Z5TD 5KDMA 3AZHD 3UT9A 4JJNC 3KXBB 3W99B 4X23B 1P34D 1P3AA 5JRGA 3REKB 5CPKC 3MGRB 4G92B 3MGQD 4J8VD 1AOID 4WU9B 5B24D 3LELD 4EO5C 3C1CD 3NQUB 3REJB 5B40B 3UTAC 5BNVB 1TZYC 1ZLAA 5B2IB 3O62C 4CSRA 5CPIB 1P3IB 4WU8A 3AZIC 1F1EA 3B6FB 3R45B 5B0YB 1F66A 5GT0C 3X1SB 4J8XA 3AZNB 2CV5D 5BS7A 5B1MB 5B2JA 3WTPE 3X1VC 3C1BA 4R8PB 4QLCD 3A6NC 3AZMC 3AFAC 5B33D 2RVQC 3LJAD 3TU4B 5AVCA 1P3LB 2AROD 2Y2KA 3X1TD 1M18A 4XUJB 5CP6D 5AY8A 3MGPD 2HIOD 1P3GA 4UUZB 4CAYB 5BO0A 3W98B 1KX5D 1U35C 4ZUXC 2Y2LA 1M19A 5AV9A 5AV8A 3X1UD 3LZ0B 5AVBC 2YFWB 1P3BA 3REHB 4HGAC 4JJND 1P3KB 2FJ7C 2YFVB 5KDMB 3EPJA 5DNNC 1PZRA 5CPKD 1S32B 4NE5A 5AV5C 1P3OD 4XZQD 3AZJD 3AZKA 2ZY3A 4QLCB 5BT1C 2G5HC 2NZDC 2AROB 5AV6A 2NQBC 2HIOB 3AZID 4CSRB 2L5AA 2Y2MA 5F99C 4H9SA 3MGSA 3B6GA 1ID3A 3AV2C 5GSUB 5GXQA 3H0LC 5B31A 3X1VD 4J8WA 3A6ND 4LD9C 1P3FC 2RVQD 3NQJB 3WTPB 1N1JB 4EO5B 3KXBA 3W99A 4X23A 4Z5TC 3AZHC 1U35D 3REKA 3UTAB 3WA9B 3MGRA 3UTBD 1TZYB 4AWLC 1P34C 3O62B 4WU9A 1M19B 3MGQC 4J8VC 1AOIC 3NQUA 3KUYD 5B24C 3REJA 5B40A 3AZIB 5B32A 3F6TA 3VH5W 5BNVA 3AZEB 1Q9CA 2ZY2A 5GT0B 5B2IA 3WKJC 3H0MC 5AV5D 1P3IA 2BYKB 2DF4C 4KUDC 3B6FA 3X1VB 3W97B 3R45A 5E5AC 4Z66C 3AZMB 2FFFB 4H9PB 3LZ1C 3AFAB 3X1SA 3MVDD 3AZKB 3AZNA 1HQ3D 1P3MD 5B1MA 2CV5C 2NQBD 1KX3D 4R8PA 3KWQD 5JA4B 4ZUXB 1KX4B 3TU4A 3AZGB 1P3LA 3MNNC 5AVBB 5B33C 4XUJA 3B6GB 4UUZA 4CAYA 1H3OB 4HGAB 5CP6C 3MGPC 2FJ7B 1KX5C 3LZ0A 5DNNB 4DRBA 3AYWD 3AZFC 2YFWA 3W96C 3RELB 3WAAB 2YFVA 3B0CW 5JRGC 4KGCD 1S32A 5B0ZD 4YM6D 2NZDB 2UWXA 4WV4B 1M1AB 3P5JB 4QLCA 5G49A 4E44A 4XZQC 5F99B 1P3OC 1ZLAC 3A1IA 3AZJC 5B32B 2PYOD 3WKJD 3AL0C 2AROA 3X1TA 5B1LD 4WU8C 3AV2B 2HIOA 4KUDD 3AZLB 1P3PD 5CHLB 5DNMD 3REID 3X1UA 5E5AD 4Z66D 3AV1B 4LD9B 3LZ1D 1P3FB 4J8UC 5C3IC 2F8ND 5GSUA 3C1BC 4Z2MH 4Z5TB 3AZHB 3NQJA 3WTPA 4H9QB 2G5IC 4AWLB 3MNND 1P34B 1N1JA 3AN2C 1M18C 5GT3D 5BNXB 3MGQB 4J8VB 1AOIB 5B24B 3LELB 1EQZD 3C1CB 4DQYB 5AV9C 3UTAA 3WA9A 1TZYA 4H9OA 3AZFD 3O62A 3UTBC 2XD1A 3W96D 3UT9D 3AZIA 3KUYC 3AZEA 1P3AD 5JRGD 5GT0A 2BYKA 5CPJC 2CV5B 3X1VA 3W97A 3H0RC 4M6BA 3AZMA 4H9PA 3AFAA 1ZLAD 2F8NH 5G49B 4YS3C 5B33B 2Y2OA 3MVDC 3LJAB 1T3UA 4WU8D 1HQ3C 5JA4A 3X1TB 1P3MC 5CP6B 4ZBJB 4ZUXA 3MGPB 1KX3C 1KX4A 1F66D 3KWQC 3AZGA 3MGSC 1KX5B 5AVBA 4J8XD 4J8UD 4NE3A 3X1UB 3VH6W 1H3OA 5B2JD 3C1BD 5B31C 4G91C 2FJ7A 4WZSB 3KFUG 5DNNA 4JJNB 1WWIA 5AVCD 1HTAA 1Z2CB 3AYWC 3RELA 3AN2D 5CPKB 1M18D 4WNNB 5AY8D 3VH5T 1P3GD 4X23C 3WAAA 3VH5A 1P3OB 4XZQB 5AV9D 5AV8D 3AZJB 2NZDA 2Y2NA 4WU9C 4KGCC 1P3BD 3A1KA 5B0ZC 4H9OB 4YM6C 2NQBA 5B40C 1M1AA 5F99A 2F2AC 5CPIC 5C3IB 1P3IC 2PYOC 3AV2A 2LY8A 3AZLA 4KHAA 5B1LC 1A7WA 5CPJD 5B0YC 3AV1A 4LD9A 1ULYA 1P3PC 3REIC 5DNMC 1P3FA 3AZNC 4YS3D 1B6WA 5AV6D 3A6NB 5B31G 3EPLA 5B1MC 3AN2B 2BYMB 4R8PC 4Z5TA 3V9RB 3AZHA 2Y2PA 4Z2MG 1P3LC 4H9QA 3MGSD 1U35B 1P34A 2JSSA 1BH9B 1ID3D 3UTBB 5GXQD
chains in the Genus database with same CATH topology
5BNXA 4H9NA 3MGQA 4J8VA 1AOIA 3W98C 5B24A 5GT3C 3LELA 5B31D 3C1CA 3KUYB 4J8WD 1W2EA 1BFMA 1EQZC 3REHC 3KSYA 3B0DC 3W99D 1P3KC 4X23D 5AV5B 3UT9C 2ZY4A 3REKD 1WWSA 1P3AC 2VQRA 4WU9D 3MVDB 2CV5A 3REJD 1HQ3B 5B40D 2DQNC 2JE5A 1P3MB 2NQBB 1KX3B 3KWQB 2Y2JA 3EPKA 5B33A 2F8NG 3LJAA 5CPID 1P3ID 2IO5C 4DRAA 3B6FD 4G91B 5CP6A 3MGPA 5B0YD 4KHAB 1KX5A 3X1SD 3FDDA 3AZFA 1F66C 3AZND 2BG1A 5GSUC 3AYWB 4J8XC 5B1MD 5BS7C 4R8PD 5B2JC 4JJNA 3TU4D 3WTPC 1P3LD 4KGCB 5CPKA 4WNNA 4XUJD 5AVCC 4E45A 5B0ZB 4YM6B 3W98D 5AY8C 1P3GC 4UPKA 1P3OA 4XZQA 4H9NB 3WA9C 3LZ0D 3B0CT 3AZJA 2JCHA 1M19C 5AV8C 3REHD 2J8PA 2PYOB 3WKJB 1P3BC 1BH8B 2Y2GA 1P3KD 5FUGA 5B1LB 3AZEC 4H9RB 4KUDB 1S32D 1P3PB 3REIB 5DNMB 4J8UA 1JFIB 5E5AB 4Z66B 3LZ1B 2XD5A 2F8NB 3W97C 3AZKC 3VH6T 3A6NA 3VH6A 3AN2A 2BYMA 5AV6C 3MNNB 3V9RA 1TAFB 5GT3B 1KX4C 3AZGC 1U35A 1EQZB 3B0BA 2HUEC 1BH9A 4H9SC 3UTBA 5GSUD 3B6GC 3AZFB 3B0DB 1ID3C 5GXQC 2F8NK 3W96B 2CWEA 3KUYA 3UT9B 4J8WC 3WTPD 1P3AB 3RELC 4WJ3C 5JRGB 4NE6A 3WAAC 5AV5A 5CPJA 3W99C 3KXBC 3UTAD 3WA9D 1TZYD 3O62D 3REKC 4YS3A 1M19D 3MGRC 4G92C 1ZLAB 3MVDA 3EPHA 2IO5B 1HQ3A 1M1AC 1P3MA 3AZED 4WU8B 3REJC 1KX3A 5B32C 3KWQA 5GT0D 5FUGB 1F66B 5B2IC 4J8XB 3AZLC 4J8UB 3W97D 3AV1C 3AZMD 5B2JB 3C1BB 3AFAD 3B6FC 3AZKD 2RIQA 2Y2IA 3AYWA 3X1SC 5AVCB 1B67A 1M18B 5AY8B 4ZUXD 1P3GB 1KX4D 5BO0B 3AZGD 5AVBD 2W8SA 4KGCA 5AV9B 3TU4C 5AV8B 2ZY5A 5B0ZA 4YM6A 3B6GD 3LELC 4XUJC 1P3BB 3C1CC 2FJ7D 5DNND 1KU5A 3LZ0C 3RELD 5CPIA 2PYOA 3WKJA 1BH8A 2Y2HA 3WAAD 5B1LA 5B32G 5B0YA 4H9RA 3KXBD 4KUDA 5CPJB 1P3PA 3REIA 4NFTA 5BT1D 5DNMA 1JFIA 2NZDD 5E5AA 4Z66A 1S32C 3LZ1A 3MGRD 4YS3B 1M1AD 5AV6B 2F8NA 5F99D 5B32D 4QLCC 2Y2QA 2HUEB 3LJAC 5B2ID 3AV2D 3MGSB 2AROC 3MNNA 3AZLD 1TAFA 3X1TC 1ID3B 5GT3A 3W98A 4ZBJC 2HIOC 5GXQB 3AV1D 4LD9D 5B31B 1EQZA 1P3FD 3EG5B 3X1UC 4J8WB 3IP4C 3REHA 2ZM5A 1R4VA 1P3KA 3W96A 4Z5TD 5KDMA 3AZHD 3UT9A 4JJNC 3KXBB 3W99B 4X23B 1P34D 1P3AA 5JRGA 3REKB 5CPKC 3MGRB 4G92B 3MGQD 4J8VD 1AOID 4WU9B 5B24D 3LELD 4EO5C 3C1CD 3NQUB 3REJB 5B40B 3UTAC 5BNVB 1TZYC 1ZLAA 5B2IB 3O62C 4CSRA 5CPIB 1P3IB 4WU8A 3AZIC 1F1EA 3B6FB 3R45B 5B0YB 1F66A 5GT0C 3X1SB 4J8XA 3AZNB 2CV5D 5BS7A 5B1MB 5B2JA 3WTPE 3X1VC 3C1BA 4R8PB 4QLCD 3A6NC 3AZMC 3AFAC 5B33D 2RVQC 3LJAD 3TU4B 5AVCA 1P3LB 2AROD 2Y2KA 3X1TD 1M18A 4XUJB 5CP6D 5AY8A 3MGPD 2HIOD 1P3GA 4UUZB 4CAYB 5BO0A 3W98B 1KX5D 1U35C 4ZUXC 2Y2LA 1M19A 5AV9A 5AV8A 3X1UD 3LZ0B 5AVBC 2YFWB 1P3BA 3REHB 4HGAC 4JJND 1P3KB 2FJ7C 2YFVB 5KDMB 3EPJA 5DNNC 1PZRA 5CPKD 1S32B 4NE5A 5AV5C 1P3OD 4XZQD 3AZJD 3AZKA 2ZY3A 4QLCB 5BT1C 2G5HC 2NZDC 2AROB 5AV6A 2NQBC 2HIOB 3AZID 4CSRB 2L5AA 2Y2MA 5F99C 4H9SA 3MGSA 3B6GA 1ID3A 3AV2C 5GSUB 5GXQA 3H0LC 5B31A 3X1VD 4J8WA 3A6ND 4LD9C 1P3FC 2RVQD 3NQJB 3WTPB 1N1JB 4EO5B 3KXBA 3W99A 4X23A 4Z5TC 3AZHC 1U35D 3REKA 3UTAB 3WA9B 3MGRA 3UTBD 1TZYB 4AWLC 1P34C 3O62B 4WU9A 1M19B 3MGQC 4J8VC 1AOIC 3NQUA 3KUYD 5B24C 3REJA 5B40A 3AZIB 5B32A 3F6TA 3VH5W 5BNVA 3AZEB 1Q9CA 2ZY2A 5GT0B 5B2IA 3WKJC 3H0MC 5AV5D 1P3IA 2BYKB 2DF4C 4KUDC 3B6FA 3X1VB 3W97B 3R45A 5E5AC 4Z66C 3AZMB 2FFFB 4H9PB 3LZ1C 3AFAB 3X1SA 3MVDD 3AZKB 3AZNA 1HQ3D 1P3MD 5B1MA 2CV5C 2NQBD 1KX3D 4R8PA 3KWQD 5JA4B 4ZUXB 1KX4B 3TU4A 3AZGB 1P3LA 3MNNC 5AVBB 5B33C 4XUJA 3B6GB 4UUZA 4CAYA 1H3OB 4HGAB 5CP6C 3MGPC 2FJ7B 1KX5C 3LZ0A 5DNNB 4DRBA 3AYWD 3AZFC 2YFWA 3W96C 3RELB 3WAAB 2YFVA 3B0CW 5JRGC 4KGCD 1S32A 5B0ZD 4YM6D 2NZDB 2UWXA 4WV4B 1M1AB 3P5JB 4QLCA 5G49A 4E44A 4XZQC 5F99B 1P3OC 1ZLAC 3A1IA 3AZJC 5B32B 2PYOD 3WKJD 3AL0C 2AROA 3X1TA 5B1LD 4WU8C 3AV2B 2HIOA 4KUDD 3AZLB 1P3PD 5CHLB 5DNMD 3REID 3X1UA 5E5AD 4Z66D 3AV1B 4LD9B 3LZ1D 1P3FB 4J8UC 5C3IC 2F8ND 5GSUA 3C1BC 4Z2MH 4Z5TB 3AZHB 3NQJA 3WTPA 4H9QB 2G5IC 4AWLB 3MNND 1P34B 1N1JA 3AN2C 1M18C 5GT3D 5BNXB 3MGQB 4J8VB 1AOIB 5B24B 3LELB 1EQZD 3C1CB 4DQYB 5AV9C 3UTAA 3WA9A 1TZYA 4H9OA 3AZFD 3O62A 3UTBC 2XD1A 3W96D 3UT9D 3AZIA 3KUYC 3AZEA 1P3AD 5JRGD 5GT0A 2BYKA 5CPJC 2CV5B 3X1VA 3W97A 3H0RC 4M6BA 3AZMA 4H9PA 3AFAA 1ZLAD 2F8NH 5G49B 4YS3C 5B33B 2Y2OA 3MVDC 3LJAB 1T3UA 4WU8D 1HQ3C 5JA4A 3X1TB 1P3MC 5CP6B 4ZBJB 4ZUXA 3MGPB 1KX3C 1KX4A 1F66D 3KWQC 3AZGA 3MGSC 1KX5B 5AVBA 4J8XD 4J8UD 4NE3A 3X1UB 3VH6W 1H3OA 5B2JD 3C1BD 5B31C 4G91C 2FJ7A 4WZSB 3KFUG 5DNNA 4JJNB 1WWIA 5AVCD 1HTAA 1Z2CB 3AYWC 3RELA 3AN2D 5CPKB 1M18D 4WNNB 5AY8D 3VH5T 1P3GD 4X23C 3WAAA 3VH5A 1P3OB 4XZQB 5AV9D 5AV8D 3AZJB 2NZDA 2Y2NA 4WU9C 4KGCC 1P3BD 3A1KA 5B0ZC 4H9OB 4YM6C 2NQBA 5B40C 1M1AA 5F99A 2F2AC 5CPIC 5C3IB 1P3IC 2PYOC 3AV2A 2LY8A 3AZLA 4KHAA 5B1LC 1A7WA 5CPJD 5B0YC 3AV1A 4LD9A 1ULYA 1P3PC 3REIC 5DNMC 1P3FA 3AZNC 4YS3D 1B6WA 5AV6D 3A6NB 5B31G 3EPLA 5B1MC 3AN2B 2BYMB 4R8PC 4Z5TA 3V9RB 3AZHA 2Y2PA 4Z2MG 1P3LC 4H9QA 3MGSD 1U35B 1P34A 2JSSA 1BH9B 1ID3D 3UTBB 5GXQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNX A;  4H9N A;  3MGQ A;  4J8V A;  1AOI A;  3W98 C;  5B24 A;  5GT3 C;  3LEL A;  5B31 D;  3C1C A;  3KUY B;  4J8W D;  1BFM A;  1EQZ C;  3REH C;  3KSY A;  3B0D C;  3W99 D;  1P3K C;  4X23 D;  5AV5 B;  3UT9 C;  3REK D;  1WWS A;  1P3A C;  4WU9 D;  3MVD B;  2CV5 A;  3REJ D;  1HQ3 B;  5B40 D;  1P3M B;  2NQB B;  1KX3 B;  3KWQ B;  5B33 A;  2F8N G;  3LJA A;  5CPI D;  1P3I D;  2IO5 C;  4DRA A;  3B6F D;  4G91 B;  5CP6 A;  3MGP A;  5B0Y D;  4KHA B;  1KX5 A;  3X1S D;  3AZF A;  1F66 C;  3AZN D;  5GSU C;  3AYW B;  4J8X C;  5B1M D;  5BS7 C;  4R8P D;  5B2J C;  4JJN A;  3TU4 D;  3WTP C;  1P3L D;  4KGC B;  5CPK A;  4WNN A;  4XUJ D;  5AVC C;  4E45 A;  5B0Z B;  4YM6 B;  3W98 D;  5AY8 C;  1P3G C;  1P3O A;  4XZQ A;  4H9N B;  3WA9 C;  3LZ0 D;  3B0C T;  3AZJ A;  1M19 C;  5AV8 C;  3REH D;  2PYO B;  3WKJ B;  1P3B C;  1BH8 B;  1P3K D;  5FUG A;  5B1L B;  3AZE C;  4H9R B;  4KUD B;  1S32 D;  1P3P B;  3REI B;  5DNM B;  4J8U A;  1JFI B;  5E5A B;  4Z66 B;  3LZ1 B;  2F8N B;  3W97 C;  3AZK C;  3VH6 T;  3A6N A;  3VH6 A;  3AN2 A;  2BYM A;  5AV6 C;  3MNN B;  3V9R A;  1TAF B;  5GT3 B;  1KX4 C;  3AZG C;  1U35 A;  1EQZ B;  3B0B A;  2HUE C;  1BH9 A;  4H9S C;  3UTB A;  5GSU D;  3B6G C;  3AZF B;  3B0D B;  1ID3 C;  5GXQ C;  2F8N K;  3W96 B;  2CWE A;  3KUY A;  3UT9 B;  4J8W C;  3WTP D;  1P3A B;  3REL C;  5JRG B;  4NE6 A;  3WAA C;  5AV5 A;  5CPJ A;  3W99 C;  3KXB C;  3UTA D;  3WA9 D;  1TZY D;  3O62 D;  3REK C;  4YS3 A;  1M19 D;  3MGR C;  4G92 C;  1ZLA B;  3MVD A;  2IO5 B;  1HQ3 A;  1M1A C;  1P3M A;  3AZE D;  4WU8 B;  3REJ C;  1KX3 A;  5B32 C;  3KWQ A;  5GT0 D;  5FUG B;  1F66 B;  5B2I C;  4J8X B;  3AZL C;  4J8U B;  3W97 D;  3AV1 C;  3AZM D;  5B2J B;  3C1B B;  3AFA D;  3B6F C;  3AZK D;  3AYW A;  3X1S C;  5AVC B;  1B67 A;  1M18 B;  5AY8 B;  4ZUX D;  1P3G B;  1KX4 D;  5BO0 B;  3AZG D;  5AVB D;  4KGC A;  5AV9 B;  3TU4 C;  5AV8 B;  5B0Z A;  4YM6 A;  3B6G D;  3LEL C;  4XUJ C;  1P3B B;  3C1C C;  2FJ7 D;  5DNN D;  1KU5 A;  3LZ0 C;  3REL D;  5CPI A;  2PYO A;  3WKJ A;  1BH8 A;  3WAA D;  5B1L A;  5B32 G;  5B0Y A;  4H9R A;  3KXB D;  4KUD A;  5CPJ B;  1P3P A;  3REI A;  4NFT A;  5BT1 D;  5DNM A;  1JFI A;  2NZD D;  5E5A A;  4Z66 A;  1S32 C;  3LZ1 A;  3MGR D;  4YS3 B;  1M1A D;  5AV6 B;  2F8N A;  5F99 D;  5B32 D;  4QLC C;  2HUE B;  3LJA C;  5B2I D;  3AV2 D;  3MGS B;  2ARO C;  3MNN A;  3AZL D;  1TAF A;  3X1T C;  1ID3 B;  5GT3 A;  3W98 A;  4ZBJ C;  2HIO C;  5GXQ B;  3AV1 D;  4LD9 D;  5B31 B;  1EQZ A;  1P3F D;  3X1U C;  4J8W B;  3REH A;  1R4V A;  1P3K A;  3W96 A;  4Z5T D;  5KDM A;  3AZH D;  3UT9 A;  4JJN C;  3KXB B;  3W99 B;  4X23 B;  1P34 D;  1P3A A;  5JRG A;  3REK B;  5CPK C;  3MGR B;  4G92 B;  3MGQ D;  4J8V D;  1AOI D;  4WU9 B;  5B24 D;  3LEL D;  4EO5 C;  3C1C D;  3NQU B;  3REJ B;  5B40 B;  3UTA C;  5BNV B;  1TZY C;  1ZLA A;  5B2I B;  3O62 C;  4CSR A;  5CPI B;  1P3I B;  4WU8 A;  3AZI C;  1F1E A;  3B6F B;  3R45 B;  5B0Y B;  1F66 A;  5GT0 C;  3X1S B;  4J8X A;  3AZN B;  2CV5 D;  5BS7 A;  3WTP E;  5B1M B;  5B2J A;  3X1V C;  3C1B A;  4R8P B;  4QLC D;  3A6N C;  3AZM C;  3AFA C;  5B33 D;  2RVQ C;  3LJA D;  3TU4 B;  5AVC A;  1P3L B;  2ARO D;  3X1T D;  1M18 A;  4XUJ B;  5CP6 D;  5AY8 A;  3MGP D;  2HIO D;  1P3G A;  4UUZ B;  4CAY B;  5BO0 A;  3W98 B;  1KX5 D;  1U35 C;  4ZUX C;  1M19 A;  5AV9 A;  5AV8 A;  3X1U D;  3LZ0 B;  5AVB C;  2YFW B;  1P3B A;  3REH B;  4HGA C;  4JJN D;  1P3K B;  2FJ7 C;  2YFV B;  5KDM B;  5DNN C;  5CPK D;  1S32 B;  4NE5 A;  5AV5 C;  1P3O D;  4XZQ D;  3AZJ D;  3AZK A;  4QLC B;  5BT1 C;  2NZD C;  2ARO B;  5AV6 A;  2NQB C;  2HIO B;  3AZI D;  4CSR B;  2L5A A;  5F99 C;  4H9S A;  3MGS A;  3B6G A;  1ID3 A;  3AV2 C;  5GSU B;  5GXQ A;  5B31 A;  3X1V D;  4J8W A;  3A6N D;  4LD9 C;  1P3F C;  2RVQ D;  3NQJ B;  3WTP B;  1N1J B;  4EO5 B;  3KXB A;  3W99 A;  4X23 A;  4Z5T C;  3AZH C;  1U35 D;  3REK A;  3UTA B;  3WA9 B;  3MGR A;  3UTB D;  1TZY B;  4AWL C;  1P34 C;  3O62 B;  4WU9 A;  1M19 B;  3MGQ C;  4J8V C;  1AOI C;  3NQU A;  3KUY D;  5B24 C;  3REJ A;  5B40 A;  3AZI B;  5B32 A;  3VH5 W;  5BNV A;  3AZE B;  1Q9C A;  5GT0 B;  5B2I A;  3WKJ C;  5AV5 D;  1P3I A;  2BYK B;  4KUD C;  3B6F A;  3X1V B;  3W97 B;  3R45 A;  5E5A C;  4Z66 C;  3AZM B;  3LZ1 C;  4H9P B;  3AFA B;  3X1S A;  3MVD D;  3AZK B;  3AZN A;  1HQ3 D;  1P3M D;  5B1M A;  2CV5 C;  2NQB D;  1KX3 D;  4R8P A;  3KWQ D;  5JA4 B;  4ZUX B;  1KX4 B;  3TU4 A;  3AZG B;  1P3L A;  3MNN C;  5AVB B;  5B33 C;  4XUJ A;  3B6G B;  4UUZ A;  4CAY A;  1H3O B;  4HGA B;  5CP6 C;  3MGP C;  2FJ7 B;  1KX5 C;  3LZ0 A;  5DNN B;  4DRB A;  3AYW D;  3AZF C;  2YFW A;  3W96 C;  3REL B;  3WAA B;  2YFV A;  3B0C W;  5JRG C;  4KGC D;  1S32 A;  5B0Z D;  4YM6 D;  2NZD B;  4WV4 B;  1M1A B;  4QLC A;  5G49 A;  4E44 A;  4XZQ C;  5F99 B;  1P3O C;  1ZLA C;  3AZJ C;  5B32 B;  2PYO D;  3WKJ D;  2ARO A;  3X1T A;  5B1L D;  4WU8 C;  3AV2 B;  2HIO A;  4KUD D;  3AZL B;  1P3P D;  5CHL B;  5DNM D;  3REI D;  3X1U A;  5E5A D;  4Z66 D;  3AV1 B;  4LD9 B;  3LZ1 D;  1P3F B;  4J8U C;  5C3I C;  2F8N D;  5GSU A;  3C1B C;  4Z2M H;  4Z5T B;  3AZH B;  3NQJ A;  3WTP A;  4H9Q B;  4AWL B;  3MNN D;  1P34 B;  1N1J A;  3AN2 C;  1M18 C;  5GT3 D;  5BNX B;  3MGQ B;  4J8V B;  1AOI B;  5B24 B;  3LEL B;  1EQZ D;  3C1C B;  5AV9 C;  3UTA A;  3WA9 A;  1TZY A;  4H9O A;  3AZF D;  3O62 A;  3UTB C;  3W96 D;  3UT9 D;  3AZI A;  3KUY C;  3AZE A;  1P3A D;  5JRG D;  5GT0 A;  2BYK A;  5CPJ C;  2CV5 B;  3X1V A;  3W97 A;  4M6B A;  3AZM A;  4H9P A;  3AFA A;  1ZLA D;  2F8N H;  5G49 B;  4YS3 C;  5B33 B;  3MVD C;  3LJA B;  4WU8 D;  1HQ3 C;  5JA4 A;  3X1T B;  1P3M C;  5CP6 B;  4ZBJ B;  4ZUX A;  3MGP B;  1KX3 C;  1KX4 A;  1F66 D;  3KWQ C;  3AZG A;  3MGS C;  1KX5 B;  5AVB A;  4J8X D;  4J8U D;  4NE3 A;  3X1U B;  3VH6 W;  1H3O A;  5B2J D;  3C1B D;  5B31 C;  4G91 C;  2FJ7 A;  4WZS B;  5DNN A;  4JJN B;  1WWI A;  5AVC D;  1HTA A;  3AYW C;  3REL A;  3AN2 D;  5CPK B;  1M18 D;  4WNN B;  5AY8 D;  3VH5 T;  1P3G D;  4X23 C;  3WAA A;  3VH5 A;  1P3O B;  4XZQ B;  5AV9 D;  5AV8 D;  3AZJ B;  2NZD A;  4WU9 C;  4KGC C;  1P3B D;  5B0Z C;  4H9O B;  4YM6 C;  2NQB A;  5B40 C;  1M1A A;  5F99 A;  5CPI C;  5C3I B;  1P3I C;  2PYO C;  3AV2 A;  2LY8 A;  3AZL A;  4KHA A;  5B1L C;  1A7W A;  5CPJ D;  5B0Y C;  3AV1 A;  4LD9 A;  1ULY A;  1P3P C;  3REI C;  5DNM C;  1P3F A;  3AZN C;  4YS3 D;  1B6W A;  5AV6 D;  3A6N B;  5B31 G;  3AN2 B;  5B1M C;  2BYM B;  4R8P C;  4Z5T A;  3V9R B;  3AZH A;  4Z2M G;  1P3L C;  4H9Q A;  3MGS D;  1U35 B;  1P34 A;  2JSS A;  1BH9 B;  1ID3 D;  3UTB B;  5GXQ D; 
#chains in the Genus database with same CATH topology
 5BNX A;  4H9N A;  3MGQ A;  4J8V A;  1AOI A;  3W98 C;  5B24 A;  5GT3 C;  3LEL A;  5B31 D;  3C1C A;  3KUY B;  4J8W D;  1W2E A;  1BFM A;  1EQZ C;  3REH C;  3KSY A;  3B0D C;  3W99 D;  1P3K C;  4X23 D;  5AV5 B;  3UT9 C;  2ZY4 A;  3REK D;  1WWS A;  1P3A C;  2VQR A;  4WU9 D;  3MVD B;  2CV5 A;  3REJ D;  1HQ3 B;  5B40 D;  2DQN C;  2JE5 A;  1P3M B;  2NQB B;  1KX3 B;  3KWQ B;  2Y2J A;  3EPK A;  5B33 A;  2F8N G;  3LJA A;  5CPI D;  1P3I D;  2IO5 C;  4DRA A;  3B6F D;  4G91 B;  5CP6 A;  3MGP A;  5B0Y D;  4KHA B;  1KX5 A;  3X1S D;  3FDD A;  3AZF A;  1F66 C;  3AZN D;  2BG1 A;  5GSU C;  3AYW B;  4J8X C;  5B1M D;  5BS7 C;  4R8P D;  5B2J C;  4JJN A;  3TU4 D;  3WTP C;  1P3L D;  4KGC B;  5CPK A;  4WNN A;  4XUJ D;  5AVC C;  4E45 A;  5B0Z B;  4YM6 B;  3W98 D;  5AY8 C;  1P3G C;  4UPK A;  1P3O A;  4XZQ A;  4H9N B;  3WA9 C;  3LZ0 D;  3B0C T;  3AZJ A;  2JCH A;  1M19 C;  5AV8 C;  3REH D;  2J8P A;  2PYO B;  3WKJ B;  1P3B C;  1BH8 B;  2Y2G A;  1P3K D;  5FUG A;  5B1L B;  3AZE C;  4H9R B;  4KUD B;  1S32 D;  1P3P B;  3REI B;  5DNM B;  4J8U A;  1JFI B;  5E5A B;  4Z66 B;  3LZ1 B;  2XD5 A;  2F8N B;  3W97 C;  3AZK C;  3VH6 T;  3A6N A;  3VH6 A;  3AN2 A;  2BYM A;  5AV6 C;  3MNN B;  3V9R A;  1TAF B;  5GT3 B;  1KX4 C;  3AZG C;  1U35 A;  1EQZ B;  3B0B A;  2HUE C;  1BH9 A;  4H9S C;  3UTB A;  5GSU D;  3B6G C;  3AZF B;  3B0D B;  1ID3 C;  5GXQ C;  2F8N K;  3W96 B;  2CWE A;  3KUY A;  3UT9 B;  4J8W C;  3WTP D;  1P3A B;  3REL C;  4WJ3 C;  5JRG B;  4NE6 A;  3WAA C;  5AV5 A;  5CPJ A;  3W99 C;  3KXB C;  3UTA D;  3WA9 D;  1TZY D;  3O62 D;  3REK C;  4YS3 A;  1M19 D;  3MGR C;  4G92 C;  1ZLA B;  3MVD A;  3EPH A;  2IO5 B;  1HQ3 A;  1M1A C;  1P3M A;  3AZE D;  4WU8 B;  3REJ C;  1KX3 A;  5B32 C;  3KWQ A;  5GT0 D;  5FUG B;  1F66 B;  5B2I C;  4J8X B;  3AZL C;  4J8U B;  3W97 D;  3AV1 C;  3AZM D;  5B2J B;  3C1B B;  3AFA D;  3B6F C;  3AZK D;  2RIQ A;  2Y2I A;  3AYW A;  3X1S C;  5AVC B;  1B67 A;  1M18 B;  5AY8 B;  4ZUX D;  1P3G B;  1KX4 D;  5BO0 B;  3AZG D;  5AVB D;  2W8S A;  4KGC A;  5AV9 B;  3TU4 C;  5AV8 B;  2ZY5 A;  5B0Z A;  4YM6 A;  3B6G D;  3LEL C;  4XUJ C;  1P3B B;  3C1C C;  2FJ7 D;  5DNN D;  1KU5 A;  3LZ0 C;  3REL D;  5CPI A;  2PYO A;  3WKJ A;  1BH8 A;  2Y2H A;  3WAA D;  5B1L A;  5B32 G;  5B0Y A;  4H9R A;  3KXB D;  4KUD A;  5CPJ B;  1P3P A;  3REI A;  4NFT A;  5BT1 D;  5DNM A;  1JFI A;  2NZD D;  5E5A A;  4Z66 A;  1S32 C;  3LZ1 A;  3MGR D;  4YS3 B;  1M1A D;  5AV6 B;  2F8N A;  5F99 D;  5B32 D;  4QLC C;  2Y2Q A;  2HUE B;  3LJA C;  5B2I D;  3AV2 D;  3MGS B;  2ARO C;  3MNN A;  3AZL D;  1TAF A;  3X1T C;  1ID3 B;  5GT3 A;  3W98 A;  4ZBJ C;  2HIO C;  5GXQ B;  3AV1 D;  4LD9 D;  5B31 B;  1EQZ A;  1P3F D;  3EG5 B;  3X1U C;  4J8W B;  3IP4 C;  3REH A;  2ZM5 A;  1R4V A;  1P3K A;  3W96 A;  4Z5T D;  5KDM A;  3AZH D;  3UT9 A;  4JJN C;  3KXB B;  3W99 B;  4X23 B;  1P34 D;  1P3A A;  5JRG A;  3REK B;  5CPK C;  3MGR B;  4G92 B;  3MGQ D;  4J8V D;  1AOI D;  4WU9 B;  5B24 D;  3LEL D;  4EO5 C;  3C1C D;  3NQU B;  3REJ B;  5B40 B;  3UTA C;  5BNV B;  1TZY C;  1ZLA A;  5B2I B;  3O62 C;  4CSR A;  5CPI B;  1P3I B;  4WU8 A;  3AZI C;  1F1E A;  3B6F B;  3R45 B;  5B0Y B;  1F66 A;  5GT0 C;  3X1S B;  4J8X A;  3AZN B;  2CV5 D;  5BS7 A;  5B1M B;  5B2J A;  3WTP E;  3X1V C;  3C1B A;  4R8P B;  4QLC D;  3A6N C;  3AZM C;  3AFA C;  5B33 D;  2RVQ C;  3LJA D;  3TU4 B;  5AVC A;  1P3L B;  2ARO D;  2Y2K A;  3X1T D;  1M18 A;  4XUJ B;  5CP6 D;  5AY8 A;  3MGP D;  2HIO D;  1P3G A;  4UUZ B;  4CAY B;  5BO0 A;  3W98 B;  1KX5 D;  1U35 C;  4ZUX C;  2Y2L A;  1M19 A;  5AV9 A;  5AV8 A;  3X1U D;  3LZ0 B;  5AVB C;  2YFW B;  1P3B A;  3REH B;  4HGA C;  4JJN D;  1P3K B;  2FJ7 C;  2YFV B;  5KDM B;  3EPJ A;  5DNN C;  1PZR A;  5CPK D;  1S32 B;  4NE5 A;  5AV5 C;  1P3O D;  4XZQ D;  3AZJ D;  3AZK A;  2ZY3 A;  4QLC B;  5BT1 C;  2G5H C;  2NZD C;  2ARO B;  5AV6 A;  2NQB C;  2HIO B;  3AZI D;  4CSR B;  2L5A A;  2Y2M A;  5F99 C;  4H9S A;  3MGS A;  3B6G A;  1ID3 A;  3AV2 C;  5GSU B;  5GXQ A;  3H0L C;  5B31 A;  3X1V D;  4J8W A;  3A6N D;  4LD9 C;  1P3F C;  2RVQ D;  3NQJ B;  3WTP B;  1N1J B;  4EO5 B;  3KXB A;  3W99 A;  4X23 A;  4Z5T C;  3AZH C;  1U35 D;  3REK A;  3UTA B;  3WA9 B;  3MGR A;  3UTB D;  1TZY B;  4AWL C;  1P34 C;  3O62 B;  4WU9 A;  1M19 B;  3MGQ C;  4J8V C;  1AOI C;  3NQU A;  3KUY D;  5B24 C;  3REJ A;  5B40 A;  3AZI B;  5B32 A;  3F6T A;  3VH5 W;  5BNV A;  3AZE B;  1Q9C A;  2ZY2 A;  5GT0 B;  5B2I A;  3WKJ C;  3H0M C;  5AV5 D;  1P3I A;  2BYK B;  2DF4 C;  4KUD C;  3B6F A;  3X1V B;  3W97 B;  3R45 A;  5E5A C;  4Z66 C;  3AZM B;  2FFF B;  4H9P B;  3LZ1 C;  3AFA B;  3X1S A;  3MVD D;  3AZK B;  3AZN A;  1HQ3 D;  1P3M D;  5B1M A;  2CV5 C;  2NQB D;  1KX3 D;  4R8P A;  3KWQ D;  5JA4 B;  4ZUX B;  1KX4 B;  3TU4 A;  3AZG B;  1P3L A;  3MNN C;  5AVB B;  5B33 C;  4XUJ A;  3B6G B;  4UUZ A;  4CAY A;  1H3O B;  4HGA B;  5CP6 C;  3MGP C;  2FJ7 B;  1KX5 C;  3LZ0 A;  5DNN B;  4DRB A;  3AYW D;  3AZF C;  2YFW A;  3W96 C;  3REL B;  3WAA B;  2YFV A;  3B0C W;  5JRG C;  4KGC D;  1S32 A;  5B0Z D;  4YM6 D;  2NZD B;  2UWX A;  4WV4 B;  1M1A B;  3P5J B;  4QLC A;  5G49 A;  4E44 A;  4XZQ C;  5F99 B;  1P3O C;  1ZLA C;  3A1I A;  3AZJ C;  5B32 B;  2PYO D;  3WKJ D;  3AL0 C;  2ARO A;  3X1T A;  5B1L D;  4WU8 C;  3AV2 B;  2HIO A;  4KUD D;  3AZL B;  1P3P D;  5CHL B;  5DNM D;  3REI D;  3X1U A;  5E5A D;  4Z66 D;  3AV1 B;  4LD9 B;  3LZ1 D;  1P3F B;  4J8U C;  5C3I C;  2F8N D;  5GSU A;  3C1B C;  4Z2M H;  4Z5T B;  3AZH B;  3NQJ A;  3WTP A;  4H9Q B;  2G5I C;  4AWL B;  3MNN D;  1P34 B;  1N1J A;  3AN2 C;  1M18 C;  5GT3 D;  5BNX B;  3MGQ B;  4J8V B;  1AOI B;  5B24 B;  3LEL B;  1EQZ D;  3C1C B;  4DQY B;  5AV9 C;  3UTA A;  3WA9 A;  1TZY A;  4H9O A;  3AZF D;  3O62 A;  3UTB C;  2XD1 A;  3W96 D;  3UT9 D;  3AZI A;  3KUY C;  3AZE A;  1P3A D;  5JRG D;  5GT0 A;  2BYK A;  5CPJ C;  2CV5 B;  3X1V A;  3W97 A;  3H0R C;  4M6B A;  3AZM A;  4H9P A;  3AFA A;  1ZLA D;  2F8N H;  5G49 B;  4YS3 C;  5B33 B;  2Y2O A;  3MVD C;  3LJA B;  1T3U A;  4WU8 D;  1HQ3 C;  5JA4 A;  3X1T B;  1P3M C;  5CP6 B;  4ZBJ B;  4ZUX A;  3MGP B;  1KX3 C;  1KX4 A;  1F66 D;  3KWQ C;  3AZG A;  3MGS C;  1KX5 B;  5AVB A;  4J8X D;  4J8U D;  4NE3 A;  3X1U B;  3VH6 W;  1H3O A;  5B2J D;  3C1B D;  5B31 C;  4G91 C;  2FJ7 A;  4WZS B;  3KFU G;  5DNN A;  4JJN B;  1WWI A;  5AVC D;  1HTA A;  1Z2C B;  3AYW C;  3REL A;  3AN2 D;  5CPK B;  1M18 D;  4WNN B;  5AY8 D;  3VH5 T;  1P3G D;  4X23 C;  3WAA A;  3VH5 A;  1P3O B;  4XZQ B;  5AV9 D;  5AV8 D;  3AZJ B;  2NZD A;  2Y2N A;  4WU9 C;  4KGC C;  1P3B D;  3A1K A;  5B0Z C;  4H9O B;  4YM6 C;  2NQB A;  5B40 C;  1M1A A;  5F99 A;  2F2A C;  5CPI C;  5C3I B;  1P3I C;  2PYO C;  3AV2 A;  2LY8 A;  3AZL A;  4KHA A;  5B1L C;  1A7W A;  5CPJ D;  5B0Y C;  3AV1 A;  4LD9 A;  1ULY A;  1P3P C;  3REI C;  5DNM C;  1P3F A;  3AZN C;  4YS3 D;  1B6W A;  5AV6 D;  3A6N B;  5B31 G;  3EPL A;  5B1M C;  3AN2 B;  2BYM B;  4R8P C;  4Z5T A;  3V9R B;  3AZH A;  2Y2P A;  4Z2M G;  1P3L C;  4H9Q A;  3MGS D;  1U35 B;  1P34 A;  2JSS A;  1BH9 B;  1ID3 D;  3UTB B;  5GXQ D; 
#chains in the Genus database with same CATH homology
 5BNX A;  4H9N A;  3MGQ A;  4J8V A;  1AOI A;  3W98 C;  5B24 A;  5GT3 C;  3LEL A;  5B31 D;  3C1C A;  3KUY B;  4J8W D;  1W2E A;  1BFM A;  1EQZ C;  3REH C;  3KSY A;  3B0D C;  3W99 D;  1P3K C;  4X23 D;  5AV5 B;  3UT9 C;  2ZY4 A;  3REK D;  1WWS A;  1P3A C;  2VQR A;  4WU9 D;  3MVD B;  2CV5 A;  3REJ D;  1HQ3 B;  5B40 D;  2DQN C;  2JE5 A;  1P3M B;  2NQB B;  1KX3 B;  3KWQ B;  2Y2J A;  3EPK A;  5B33 A;  2F8N G;  3LJA A;  5CPI D;  1P3I D;  2IO5 C;  4DRA A;  3B6F D;  4G91 B;  5CP6 A;  3MGP A;  5B0Y D;  4KHA B;  1KX5 A;  3X1S D;  3FDD A;  3AZF A;  1F66 C;  3AZN D;  2BG1 A;  5GSU C;  3AYW B;  4J8X C;  5B1M D;  5BS7 C;  4R8P D;  5B2J C;  4JJN A;  3TU4 D;  3WTP C;  1P3L D;  4KGC B;  5CPK A;  4WNN A;  4XUJ D;  5AVC C;  4E45 A;  5B0Z B;  4YM6 B;  3W98 D;  5AY8 C;  1P3G C;  4UPK A;  1P3O A;  4XZQ A;  4H9N B;  3WA9 C;  3LZ0 D;  3B0C T;  3AZJ A;  2JCH A;  1M19 C;  5AV8 C;  3REH D;  2J8P A;  2PYO B;  3WKJ B;  1P3B C;  1BH8 B;  2Y2G A;  1P3K D;  5FUG A;  5B1L B;  3AZE C;  4H9R B;  4KUD B;  1S32 D;  1P3P B;  3REI B;  5DNM B;  4J8U A;  1JFI B;  5E5A B;  4Z66 B;  3LZ1 B;  2XD5 A;  2F8N B;  3W97 C;  3AZK C;  3VH6 T;  3A6N A;  3VH6 A;  3AN2 A;  2BYM A;  5AV6 C;  3MNN B;  3V9R A;  1TAF B;  5GT3 B;  1KX4 C;  3AZG C;  1U35 A;  1EQZ B;  3B0B A;  2HUE C;  1BH9 A;  4H9S C;  3UTB A;  5GSU D;  3B6G C;  3AZF B;  3B0D B;  1ID3 C;  5GXQ C;  2F8N K;  3W96 B;  2CWE A;  3KUY A;  3UT9 B;  4J8W C;  3WTP D;  1P3A B;  3REL C;  4WJ3 C;  5JRG B;  4NE6 A;  3WAA C;  5AV5 A;  5CPJ A;  3W99 C;  3KXB C;  3UTA D;  3WA9 D;  1TZY D;  3O62 D;  3REK C;  4YS3 A;  1M19 D;  3MGR C;  4G92 C;  1ZLA B;  3MVD A;  3EPH A;  2IO5 B;  1HQ3 A;  1M1A C;  1P3M A;  3AZE D;  4WU8 B;  3REJ C;  1KX3 A;  5B32 C;  3KWQ A;  5GT0 D;  5FUG B;  1F66 B;  5B2I C;  4J8X B;  3AZL C;  4J8U B;  3W97 D;  3AV1 C;  3AZM D;  5B2J B;  3C1B B;  3AFA D;  3B6F C;  3AZK D;  2RIQ A;  2Y2I A;  3AYW A;  3X1S C;  5AVC B;  1B67 A;  1M18 B;  5AY8 B;  4ZUX D;  1P3G B;  1KX4 D;  5BO0 B;  3AZG D;  5AVB D;  2W8S A;  4KGC A;  5AV9 B;  3TU4 C;  5AV8 B;  2ZY5 A;  5B0Z A;  4YM6 A;  3B6G D;  3LEL C;  4XUJ C;  1P3B B;  3C1C C;  2FJ7 D;  5DNN D;  1KU5 A;  3LZ0 C;  3REL D;  5CPI A;  2PYO A;  3WKJ A;  1BH8 A;  2Y2H A;  3WAA D;  5B1L A;  5B32 G;  5B0Y A;  4H9R A;  3KXB D;  4KUD A;  5CPJ B;  1P3P A;  3REI A;  4NFT A;  5BT1 D;  5DNM A;  1JFI A;  2NZD D;  5E5A A;  4Z66 A;  1S32 C;  3LZ1 A;  3MGR D;  4YS3 B;  1M1A D;  5AV6 B;  2F8N A;  5F99 D;  5B32 D;  4QLC C;  2Y2Q A;  2HUE B;  3LJA C;  5B2I D;  3AV2 D;  3MGS B;  2ARO C;  3MNN A;  3AZL D;  1TAF A;  3X1T C;  1ID3 B;  5GT3 A;  3W98 A;  4ZBJ C;  2HIO C;  5GXQ B;  3AV1 D;  4LD9 D;  5B31 B;  1EQZ A;  1P3F D;  3EG5 B;  3X1U C;  4J8W B;  3IP4 C;  3REH A;  2ZM5 A;  1R4V A;  1P3K A;  3W96 A;  4Z5T D;  5KDM A;  3AZH D;  3UT9 A;  4JJN C;  3KXB B;  3W99 B;  4X23 B;  1P34 D;  1P3A A;  5JRG A;  3REK B;  5CPK C;  3MGR B;  4G92 B;  3MGQ D;  4J8V D;  1AOI D;  4WU9 B;  5B24 D;  3LEL D;  4EO5 C;  3C1C D;  3NQU B;  3REJ B;  5B40 B;  3UTA C;  5BNV B;  1TZY C;  1ZLA A;  5B2I B;  3O62 C;  4CSR A;  5CPI B;  1P3I B;  4WU8 A;  3AZI C;  1F1E A;  3B6F B;  3R45 B;  5B0Y B;  1F66 A;  5GT0 C;  3X1S B;  4J8X A;  3AZN B;  2CV5 D;  5BS7 A;  5B1M B;  5B2J A;  3WTP E;  3X1V C;  3C1B A;  4R8P B;  4QLC D;  3A6N C;  3AZM C;  3AFA C;  5B33 D;  2RVQ C;  3LJA D;  3TU4 B;  5AVC A;  1P3L B;  2ARO D;  2Y2K A;  3X1T D;  1M18 A;  4XUJ B;  5CP6 D;  5AY8 A;  3MGP D;  2HIO D;  1P3G A;  4UUZ B;  4CAY B;  5BO0 A;  3W98 B;  1KX5 D;  1U35 C;  4ZUX C;  2Y2L A;  1M19 A;  5AV9 A;  5AV8 A;  3X1U D;  3LZ0 B;  5AVB C;  2YFW B;  1P3B A;  3REH B;  4HGA C;  4JJN D;  1P3K B;  2FJ7 C;  2YFV B;  5KDM B;  3EPJ A;  5DNN C;  1PZR A;  5CPK D;  1S32 B;  4NE5 A;  5AV5 C;  1P3O D;  4XZQ D;  3AZJ D;  3AZK A;  2ZY3 A;  4QLC B;  5BT1 C;  2G5H C;  2NZD C;  2ARO B;  5AV6 A;  2NQB C;  2HIO B;  3AZI D;  4CSR B;  2L5A A;  2Y2M A;  5F99 C;  4H9S A;  3MGS A;  3B6G A;  1ID3 A;  3AV2 C;  5GSU B;  5GXQ A;  3H0L C;  5B31 A;  3X1V D;  4J8W A;  3A6N D;  4LD9 C;  1P3F C;  2RVQ D;  3NQJ B;  3WTP B;  1N1J B;  4EO5 B;  3KXB A;  3W99 A;  4X23 A;  4Z5T C;  3AZH C;  1U35 D;  3REK A;  3UTA B;  3WA9 B;  3MGR A;  3UTB D;  1TZY B;  4AWL C;  1P34 C;  3O62 B;  4WU9 A;  1M19 B;  3MGQ C;  4J8V C;  1AOI C;  3NQU A;  3KUY D;  5B24 C;  3REJ A;  5B40 A;  3AZI B;  5B32 A;  3F6T A;  3VH5 W;  5BNV A;  3AZE B;  1Q9C A;  2ZY2 A;  5GT0 B;  5B2I A;  3WKJ C;  3H0M C;  5AV5 D;  1P3I A;  2BYK B;  2DF4 C;  4KUD C;  3B6F A;  3X1V B;  3W97 B;  3R45 A;  5E5A C;  4Z66 C;  3AZM B;  2FFF B;  4H9P B;  3LZ1 C;  3AFA B;  3X1S A;  3MVD D;  3AZK B;  3AZN A;  1HQ3 D;  1P3M D;  5B1M A;  2CV5 C;  2NQB D;  1KX3 D;  4R8P A;  3KWQ D;  5JA4 B;  4ZUX B;  1KX4 B;  3TU4 A;  3AZG B;  1P3L A;  3MNN C;  5AVB B;  5B33 C;  4XUJ A;  3B6G B;  4UUZ A;  4CAY A;  1H3O B;  4HGA B;  5CP6 C;  3MGP C;  2FJ7 B;  1KX5 C;  3LZ0 A;  5DNN B;  4DRB A;  3AYW D;  3AZF C;  2YFW A;  3W96 C;  3REL B;  3WAA B;  2YFV A;  3B0C W;  5JRG C;  4KGC D;  1S32 A;  5B0Z D;  4YM6 D;  2NZD B;  2UWX A;  4WV4 B;  1M1A B;  3P5J B;  4QLC A;  5G49 A;  4E44 A;  4XZQ C;  5F99 B;  1P3O C;  1ZLA C;  3A1I A;  3AZJ C;  5B32 B;  2PYO D;  3WKJ D;  3AL0 C;  2ARO A;  3X1T A;  5B1L D;  4WU8 C;  3AV2 B;  2HIO A;  4KUD D;  3AZL B;  1P3P D;  5CHL B;  5DNM D;  3REI D;  3X1U A;  5E5A D;  4Z66 D;  3AV1 B;  4LD9 B;  3LZ1 D;  1P3F B;  4J8U C;  5C3I C;  2F8N D;  5GSU A;  3C1B C;  4Z2M H;  4Z5T B;  3AZH B;  3NQJ A;  3WTP A;  4H9Q B;  2G5I C;  4AWL B;  3MNN D;  1P34 B;  1N1J A;  3AN2 C;  1M18 C;  5GT3 D;  5BNX B;  3MGQ B;  4J8V B;  1AOI B;  5B24 B;  3LEL B;  1EQZ D;  3C1C B;  4DQY B;  5AV9 C;  3UTA A;  3WA9 A;  1TZY A;  4H9O A;  3AZF D;  3O62 A;  3UTB C;  2XD1 A;  3W96 D;  3UT9 D;  3AZI A;  3KUY C;  3AZE A;  1P3A D;  5JRG D;  5GT0 A;  2BYK A;  5CPJ C;  2CV5 B;  3X1V A;  3W97 A;  3H0R C;  4M6B A;  3AZM A;  4H9P A;  3AFA A;  1ZLA D;  2F8N H;  5G49 B;  4YS3 C;  5B33 B;  2Y2O A;  3MVD C;  3LJA B;  1T3U A;  4WU8 D;  1HQ3 C;  5JA4 A;  3X1T B;  1P3M C;  5CP6 B;  4ZBJ B;  4ZUX A;  3MGP B;  1KX3 C;  1KX4 A;  1F66 D;  3KWQ C;  3AZG A;  3MGS C;  1KX5 B;  5AVB A;  4J8X D;  4J8U D;  4NE3 A;  3X1U B;  3VH6 W;  1H3O A;  5B2J D;  3C1B D;  5B31 C;  4G91 C;  2FJ7 A;  4WZS B;  3KFU G;  5DNN A;  4JJN B;  1WWI A;  5AVC D;  1HTA A;  1Z2C B;  3AYW C;  3REL A;  3AN2 D;  5CPK B;  1M18 D;  4WNN B;  5AY8 D;  3VH5 T;  1P3G D;  4X23 C;  3WAA A;  3VH5 A;  1P3O B;  4XZQ B;  5AV9 D;  5AV8 D;  3AZJ B;  2NZD A;  2Y2N A;  4WU9 C;  4KGC C;  1P3B D;  3A1K A;  5B0Z C;  4H9O B;  4YM6 C;  2NQB A;  5B40 C;  1M1A A;  5F99 A;  2F2A C;  5CPI C;  5C3I B;  1P3I C;  2PYO C;  3AV2 A;  2LY8 A;  3AZL A;  4KHA A;  5B1L C;  1A7W A;  5CPJ D;  5B0Y C;  3AV1 A;  4LD9 A;  1ULY A;  1P3P C;  3REI C;  5DNM C;  1P3F A;  3AZN C;  4YS3 D;  1B6W A;  5AV6 D;  3A6N B;  5B31 G;  3EPL A;  5B1M C;  3AN2 B;  2BYM B;  4R8P C;  4Z5T A;  3V9R B;  3AZH A;  2Y2P A;  4Z2M G;  1P3L C;  4H9Q A;  3MGS D;  1U35 B;  1P34 A;  2JSS A;  1BH9 B;  1ID3 D;  3UTB B;  5GXQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...