2YFVA

The heterotrimeric complex of kluyveromyces lactis scm3, cse4 and h4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
73
structure length
68
Chain Sequence
ISRMPFARLVKEVTDQFTLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIMRKDMQLARRIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE H3-LIKE CENTROMERIC PROTEIN CSE4
publication title Recognition of the Centromere-Specific Histone Cse4 by the Chaperone Scm3.
pubmed doi rcsb
source organism Kluyveromyces lactis nrrl y-1140
molecule tags Cell cycle
total genus 24
structure length 68
sequence length 73
ec nomenclature
pdb deposition date 2011-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2yfvA00
1ID3D 4KGCC 5B2IC 5AY8B 5CPKB 2F8NK 5CPJC 3AZFC 3REJD 2HIOC 3NQJA 5B31D 4YM6C 2YFWA 3B6FC 3UT9C 1H3OB 1JFIB 1U35C 4J8WD 1P3KA 3V9RA 5AV9A 4NFTA 4XUJD 4XZQB 3KXBC 3REKC 2AROD 1P3IB 4H9RB 1KX3C 1ID3A 1P3FD 4WV4B 4JJNC 3AFAD 5DNMD 1M18B 4H9OB 2BYMA 4R8PC 5CP6C 5AV5C 3REJA 5B31A 3RELD 5B0ZB 1P3LC 3WKJB 4J8WA 4KUDB 4XUJA 3W99B 5F99B 3X1TD 3VH6T 2F8ND 2AROA 3A6NB 1P3FA 5AV8D 3REHB 3AFAA 5DNMA 3MGQB 3X1VC 1N1JB 3VH5A 3LJAC 3MNND 4UUZA 5B24D 5BNVA 1KX5B 5AY8C 3AYWD 3X1SB 5B1LD 4KHAB 4CAYB 5B2JD 1BFMA 2NZDC 1M19D 1P3BD 3X1TA 2F8NA 3MGSD 5AV8A 4Z66C 4XZQC 2YFVB 3MNNA 1P3IC 3WTPA 5B24A 4J8XC 3UTAB 4KGCD 5JRGB 1M18C 5B33B 4CSRB 3AYWA 5B2ID 3AN2D 3AV2B 1EQZB 5B1LA 4QLCD 5B2JA 5DNNB 3LZ1B 1HQ3B 1M19A 1P3BA 2BYKB 3AZFD 4YM6D 1P3OB 5B0ZC 4G91C 3MGSA 3B6GB 5GT3B 3MGRB 3WKJC 1U35D 4ZUXB 4KUDC 5KDMB 3W99C 5F99C 3REKD 3KXBD 2RVQC 4E45A 1KX3D 3A6NC 3R45A 3REHC 4JJND 3WAAD 3UT9B 5B2IA 3AN2A 4WNNB 1B67A 1KX4B 4QLCA 4LD9B 1ZLAB 4YM6A 1P3AD 5FUGB 5AVCD 1KX5C 3VH5W 2FJ7B 1P3PB 3X1SC 4WU9D 3X1UC 3KUYD 1F66D 1U35A 1P3LD 3LELB 3REKA 3KXBA 3KSYA 1BH9A 4H9PA 5G49B 3WAAA 4H9QB 3KWQD 3W98C 4X23D 1P34D 5B32D 4YS3D 3UTAC 5GT0B 5JRGC 5AVCA 1P3AA 3AZID 4NE3A 3WA9B 5B33C 3AV2C 5CPKD 3W97B 3MVDB 1EQZC 2PYOD 4WU9A 3KUYA 3C1CD 1F66A 5DNNC 3LZ1C 1HQ3C 1P3MB 3AZJB 3B6GC 5GT3C 5BO0A 3MGRC 5B0YD 1KU5A 4ZUXC 3KWQA 2CV5B 4H9SA 4WZSB 4XZQD 4X23A 3AZNB 1P34A 5B32A 2NZDB 3AZKD 4YS3A 5GSUD 3C1BD 3W96B 3AZIA 1M18D 5CPKA 1KX4C 3NQUB 5GXQD 2PYOA 1TZYD 3C1CA 4Z66B 4LD9C 5AVBD 5BS7A 1ZLAC 3AV1B 2HUEB 1H3OA 2FJ7C 1P3PC 4J8XB 1Q9CA 3NQJB 1P3GD 5B0YA 2YFWB 4AWLB 3LELC 4KUDD 4XZQA 3MGPD 4H9RA 3AZKA 3AZGD 5GSUA 3C1BA 1P3KB 3MGQD 1M18A 4H9OA 4G91B 5GXQA 1TZYA 1ID3B 1HTAA 5AVBA 5GT0C 3AZMD 3WA9C 1KX5D 2BYMB 3W97C 3MVDC 3X1SD 3REJB 1P3GA 5BT1D 4J8UD 1P3MC 4KUDA 3AZED 3MGPA 3AZJC 2NQBC 3AZGA 4J8WB 3RELA 3MGQA 4XUJB 3AZHD 5B31G 3LZ0D 2CV5C 1N1JA 3AZNC 5B40D 5CPID 1P3FB 3X1UB 4DRAA 4J8VD 3AFAB 5DNMB 1M1AD 3W96C 3TU4D 3AZMA 4Z5TD 1KX5A 4WU8B 4ZBJB 5E5AD 4Z2MG 3X1SA 4CAYA 4KHAA 4J8UA 3LZ1D 1HQ3D 1S32D 3AZEA 3W98B 3AV1C 1P3OD 3UTBB 2HUEC 1AOID 3B0BA 3MGRD 3AZHA 3X1TB 5C3IB 3O62B 4E44A 3LZ0A 4AWLC 2F8NB 5B40A 1BH8A 5CPIA 4DRBA 5AV8B 5CPJD 4J8VA 1M1AA 3TU4A 1P3KC 2HIOD 3B6FD 4Z5TA 5AV9C 3UT9D 3MNNB 5E5AA 2F8NG 4H9NA 3WTPB 5B24B 1ID3C 3LZ1A 1HQ3A 3VH5T 1S32A 3AYWB 1P3OA 1AOIA 5B1LB 2FJ7D 4KGCA 1M19B 3REJC 5B31C 5CHLB 3B0CW 5KDMA 5JA4A 4R8PD 5CP6D 5AV5D 5CPJA 4J8WC 3AZFA 2HIOA 3B6FA 4XUJC 5BNXA 3UT9A 5AV6B 1P3FC 3R45B 3AFAC 5DNMC 2IO5B 5GT0D 3B0DB 3AZLB 3AN2B 4QLCB 4WU8C 4ZBJC 1KX3A 2FJ7A 5B1MB 4G92C 4JJNA 3X1VD 1P3MD 3AZJD 3UTBC 4R8PA 3LJAD 5AV5A 5CP6A 3REIB 1WWSA 3X1TC 5C3IC 3O62C 5AY8D 5AV8C 1P3LA 2NZDD 3WAAB 3W96D 5GT0A 2NQBB 3MNNC 3WTPC 5B24C 1TAFB 4Z66D 3X1VA 5AVCB 1P3MA 3AYWC 3AZJA 3AV1D 3LJAA 1P3ID 5B1LC 4WU9B 5B2JC 3KUYB 1F66B 4J8XD 1M19C 5AY8A 3MGSC 3WTPE 5BO0B 2NZDA 4X23B 5B0ZD 1P34B 2L5AA 1A7WA 5AV6C 3VH6A 1JFIA 4YS3B 4Z66A 3WKJD 3AZIB 2IO5C 3B0DC 3AZLC 3W99D 5F99D 3AN2C 3AV1A 2RVQD 4QLCC 1P3IA 2PYOB 3C1CB 5B1MC 4J8XA 3A6ND 5B32G 3V9RB 3REHD 5AV9B 3REIC 2JSSA 5B0YB 5B0ZA 4HGAB 3AZKB 5GSUB 3C1BB 5B31B 3X1UD 3WKJA 3WAAC 3W99A 5F99A 5GXQB 4NE5A 1TZYB 4WU8D 2CWEA 3A6NA 5AVBB 1WWIA 3REHA 1P3AC 5AVCC 2AROB 4EO5B 3W98D 3UTBD 4WU9C 3KUYC 1F66C 1P3GB 3UTAD 5JRGD 3MGPB 5B33D 3O62D 3AV2D 4UUZB 4G92B 3AZGB 1EQZD 3X1UA 3RELB 5BNVB 5DNND 1R4VA 3KWQC 4H9SC 4X23C 4WU8A 1P34C 5B32C 3WTPD 3B6GD 4YS3C 5GT3D 3AZMB 3AZIC 4ZUXD 5CPKC 3W98A 2YFVA 3UTBA 2PYOC 3VH6W 3C1CC 4J8UB 3B0CT 3UTAA 5BS7C 5JRGA 3AZEB 5B33A 3O62A 4CSRA 3AV2A 1KX4D 1EQZA 5DNNA 4LD9D 3AZHB 5B0YC 1ZLAD 2BYKA 3LZ0B 5B40B 1BH8B 4HGAC 5CPIB 5B2JB 5AV6D 1M1AB 4J8VB 1P3PD 3B6GA 3AZKC 5GT3A 4Z2MH 5GSUC 3MGRA 3C1BC 3TU4B 1P3BB 4Z5TB 4ZUXA 3MGSB 3LELD 1F1EA 5GXQC 3AZLD 5E5AB 4H9NB 4NE6A 1TZYC 5AVBC 5B1MD 1S32B 2AROC 4WNNA 4EO5C 1KX4A 1AOIB 4KGCB 4LD9A 1ULYA 1P3GC 3REID 1ZLAA 5B2IB 5FUGA 3WA9D 3MGPC 5AV6A 5JA4B 5CPJB 1P3PA 3MVDD 2F8NH 3AZGC 1AOIC 3W97D 3RELC 3AZFB 2HIOB 4YM6B 3B6FB 3MGQC 5BNXB 3LELA 1B6WA 3AZLA 4M6BA 2NQBD 5B1MA 1U35B 5G49A 3AZMC 3REKB 4H9QA 3KXBB 2CV5D 3AZND 1KX3B 1BH9B 4H9PB 4JJNB 3REIA 5BT1C 4J8UC 3WA9A 3AZEC 3W97A 4R8PB 5CP6B 5AV5B 3MVDA 1P3AB 3AZHC 3LZ0C 5B40C 5CPIC 2NQBA 1M1AC 4J8VC 1P3LB 1TAFA 3TU4C 1P3BC 4Z5TC 2CV5A 3AZNA 5E5AC 3W96A 3X1VB 2LY8A 1S32C 3KWQB 1P3KD 5AV9D 1P3OC 3LJAB 3NQUA 5B32B
chains in the Genus database with same CATH superfamily
1ID3D 4KGCC 5B2IC 5AY8B 5CPKB 2F8NK 5CPJC 2Y2OA 3AZFC 3REJD 2HIOC 3NQJA 5B31D 4YM6C 2YFWA 3B6FC 3UT9C 1H3OB 1JFIB 1U35C 4J8WD 1P3KA 3V9RA 5AV9A 4NFTA 2JE5A 4XUJD 4XZQB 3KXBC 3REKC 2AROD 1P3IB 4H9RB 1KX3C 1ID3A 1P3FD 4WV4B 4JJNC 3AFAD 5DNMD 1M18B 4H9OB 2BYMA 4R8PC 5CP6C 5AV5C 3REJA 5B31A 3RELD 5B0ZB 2UWXA 3EPLA 4J8WA 1P3LC 3WKJB 4KUDB 4XUJA 3W99B 5F99B 3X1TD 3VH6T 2F8ND 2AROA 3A6NB 1P3FA 5AV8D 3REHB 3AFAA 5DNMA 3MGQB 3X1VC 1N1JB 3VH5A 3LJAC 3MNND 4UUZA 2ZM5A 5B24D 3H0MC 5BNVA 1KX5B 5AY8C 3AYWD 3X1SB 5B1LD 4KHAB 4CAYB 5B2JD 1BFMA 2NZDC 1M19D 1P3BD 3X1TA 2F8NA 3MGSD 5AV8A 4Z66C 4XZQC 2YFVB 3MNNA 1P3IC 2Y2IA 5B24A 3WTPA 4J8XC 3UTAB 4KGCD 5JRGB 1M18C 5B33B 4CSRB 3AYWA 5B2ID 3AN2D 3AV2B 1EQZB 5B1LA 4QLCD 5B2JA 5DNNB 3LZ1B 1HQ3B 1M19A 1P3BA 2BYKB 3AZFD 4YM6D 1P3OB 5B0ZC 4G91C 3MGSA 2Y2HA 3B6GB 3A1KA 5GT3B 3MGRB 3WKJC 1U35D 4ZUXB 4KUDC 5KDMB 3W99C 5F99C 3REKD 3KXBD 2RVQC 4E45A 1KX3D 3A6NC 2DF4C 3R45A 3REHC 4JJND 3WAAD 3EG5B 3UT9B 5B2IA 3AN2A 4WNNB 1B67A 1KX4B 4QLCA 4LD9B 1ZLAB 2XD5A 4YM6A 1P3AD 5FUGB 5AVCD 1KX5C 3VH5W 2FJ7B 1P3PB 3X1SC 3FDDA 4WU9D 3X1UC 3KUYD 1F66D 1U35A 3P5JB 1P3LD 3LELB 3REKA 3KXBA 3KSYA 2Y2KA 1BH9A 4H9PA 5G49B 3WAAA 4H9QB 3KWQD 3W98C 4X23D 2G5IC 1P34D 5B32D 4YS3D 3UTAC 5GT0B 5JRGC 5AVCA 1W2EA 3AZID 4NE3A 1P3AA 3WA9B 5B33C 3AV2C 5CPKD 1T3UA 3W97B 3MVDB 1EQZC 2PYOD 4WU9A 3KUYA 3C1CD 1F66A 5DNNC 3LZ1C 1HQ3C 1P3MB 3KFUG 3AZJB 3B6GC 5GT3C 5BO0A 3MGRC 5B0YD 1KU5A 4ZUXC 3KWQA 2CV5B 4H9SA 4WZSB 4XZQD 4X23A 3AZNB 1P34A 3H0RC 5B32A 2NZDB 3AZKD 4YS3A 5GSUD 3C1BD 3W96B 3AZIA 1M18D 5CPKA 1KX4C 2ZY5A 3NQUB 5GXQD 2PYOA 1TZYD 3C1CA 4Z66B 4LD9C 5AVBD 5BS7A 1ZLAC 3AV1B 2Y2PA 2HUEB 1H3OA 2FJ7C 1P3PC 4J8XB 2J8PA 1Q9CA 3NQJB 1P3GD 5B0YA 2YFWB 4AWLB 3LELC 4KUDD 4XZQA 3MGPD 4H9RA 3AZKA 3AZGD 5GSUA 3C1BA 1P3KB 3MGQD 1M18A 4H9OA 4G91B 5GXQA 1TZYA 1ID3B 1HTAA 5AVBA 2Y2JA 5GT0C 3AZMD 3WA9C 1KX5D 2BYMB 3W97C 3MVDC 3X1SD 3REJB 1P3GA 5BT1D 4J8UD 1P3MC 4KUDA 3AZED 3MGPA 3AZJC 4DQYB 2NQBC 3AZGA 4J8WB 3RELA 3MGQA 4XUJB 3AZHD 5B31G 3LZ0D 2CV5C 1N1JA 3AZNC 5B40D 2FFFB 5CPID 1P3FB 3X1UB 4DRAA 4J8VD 3AFAB 5DNMB 1M1AD 3W96C 3F6TA 3TU4D 3AZMA 4Z5TD 1KX5A 4WU8B 4ZBJB 5E5AD 4Z2MG 3X1SA 4CAYA 4KHAA 2F2AC 3EPKA 4J8UA 3LZ1D 1HQ3D 1S32D 3AZEA 3W98B 3AV1C 1P3OD 3UTBB 2HUEC 1AOID 3B0BA 3MGRD 3AZHA 3X1TB 5C3IB 3O62B 4E44A 3LZ0A 4AWLC 2F8NB 5B40A 1BH8A 5CPIA 4DRBA 5AV8B 5CPJD 4J8VA 1M1AA 3TU4A 1P3KC 2HIOD 3B6FD 4Z5TA 5AV9C 3UT9D 3MNNB 5E5AA 2Y2QA 4H9NA 3WTPB 5B24B 1ID3C 2F8NG 3LZ1A 1HQ3A 3VH5T 1S32A 3AYWB 1P3OA 1AOIA 5B1LB 2FJ7D 3AL0C 4KGCA 1M19B 2Y2MA 3REJC 5B31C 5CHLB 3B0CW 5KDMA 5JA4A 4R8PD 5CP6D 5AV5D 5CPJA 4J8WC 3AZFA 2HIOA 3B6FA 4XUJC 5BNXA 3UT9A 5AV6B 1P3FC 3R45B 3AFAC 5DNMC 2IO5B 5GT0D 3B0DB 3AZLB 3AN2B 4QLCB 4WU8C 4ZBJC 1KX3A 2FJ7A 2ZY2A 5B1MB 4G92C 4JJNA 3X1VD 1P3MD 3AZJD 3UTBC 4R8PA 3LJAD 5AV5A 5CP6A 3REIB 1WWSA 3X1TC 5C3IC 3O62C 5AY8D 5AV8C 1P3LA 2NZDD 3WAAB 3W96D 5GT0A 4WJ3C 2RIQA 2NQBB 3MNNC 3WTPC 5B24C 1TAFB 4Z66D 3X1VA 5AVCB 1P3MA 3AYWC 3AZJA 3AV1D 3LJAA 1P3ID 5B1LC 4WU9B 5B2JC 3KUYB 1F66B 4J8XD 1M19C 5AY8A 3EPHA 3MGSC 3WTPE 5BO0B 2NZDA 4X23B 5B0ZD 2Y2GA 1P34B 2L5AA 1A7WA 5AV6C 3VH6A 1JFIA 4YS3B 4Z66A 3WKJD 3AZIB 2IO5C 3B0DC 3AZLC 3W99D 5F99D 3AN2C 3AV1A 2RVQD 4QLCC 1P3IA 2PYOB 3C1CB 5B1MC 4J8XA 3A6ND 5B32G 3V9RB 3REHD 5AV9B 3REIC 2JSSA 5B0YB 5B0ZA 4HGAB 3AZKB 5GSUB 3C1BB 5B31B 3X1UD 3WKJA 3WAAC 3W99A 5F99A 5GXQB 4NE5A 1TZYB 4WU8D 2CWEA 3A6NA 5AVBB 1WWIA 3REHA 1P3AC 5AVCC 2AROB 4EO5B 2ZY3A 3W98D 3UTBD 4WU9C 3KUYC 1F66C 1P3GB 3UTAD 5JRGD 3MGPB 5B33D 3O62D 3AV2D 4UUZB 4G92B 3AZGB 1EQZD 3X1UA 3RELB 5BNVB 2XD1A 5DNND 1R4VA 3KWQC 4H9SC 4X23C 4WU8A 1P34C 5B32C 3WTPD 3B6GD 4YS3C 5GT3D 3AZMB 3AZIC 4ZUXD 5CPKC 3W98A 2YFVA 3UTBA 2PYOC 3VH6W 3C1CC 4J8UB 3B0CT 3UTAA 5BS7C 5JRGA 3AZEB 5B33A 3O62A 4CSRA 3AV2A 1KX4D 1EQZA 5DNNA 4LD9D 3AZHB 5B0YC 1ZLAD 2BYKA 3LZ0B 5B40B 1BH8B 4HGAC 5CPIB 5B2JB 5AV6D 1M1AB 4J8VB 1P3PD 3B6GA 3AZKC 5GT3A 2G5HC 4Z2MH 5GSUC 3MGRA 3C1BC 3TU4B 1P3BB 4Z5TB 4ZUXA 1Z2CB 3MGSB 3LELD 1F1EA 5GXQC 3AZLD 5E5AB 4H9NB 4NE6A 1TZYC 5AVBC 5B1MD 1S32B 1PZRA 2VQRA 2AROC 4WNNA 4EO5C 1KX4A 1AOIB 3A1IA 4KGCB 4LD9A 1ULYA 1P3GC 3REID 1ZLAA 5B2IB 5FUGA 3WA9D 2Y2LA 3MGPC 5AV6A 5JA4B 5CPJB 1P3PA 3MVDD 2Y2NA 3AZGC 1AOIC 2F8NH 3W97D 3RELC 3AZFB 2HIOB 4YM6B 3B6FB 3MGQC 5BNXB 3LELA 1B6WA 3AZLA 4M6BA 2NQBD 5B1MA 1U35B 5G49A 3AZMC 3REKB 4H9QA 3IP4C 3KXBB 2CV5D 3AZND 1KX3B 1BH9B 4H9PB 4JJNB 3REIA 5BT1C 3H0LC 4J8UC 3WA9A 3AZEC 3W97A 2DQNC 5CP6B 5AV5B 4R8PB 3MVDA 1P3AB 2W8SA 3AZHC 3LZ0C 5B40C 5CPIC 2JCHA 2NQBA 2BG1A 1M1AC 4J8VC 1P3LB 1TAFA 3TU4C 1P3BC 4Z5TC 2CV5A 3AZNA 5E5AC 3EPJA 4UPKA 3W96A 3X1VB 2LY8A 2ZY4A 3KWQB 1S32C 1P3KD 5AV9D 1P3OC 3LJAB 3NQUA 5B32B
chains in the Genus database with same CATH topology
1ID3D 4KGCC 5B2IC 5AY8B 5CPKB 2F8NK 5CPJC 2Y2OA 3AZFC 3REJD 2HIOC 3NQJA 5B31D 4YM6C 2YFWA 3B6FC 3UT9C 1H3OB 1JFIB 1U35C 4J8WD 1P3KA 3V9RA 5AV9A 4NFTA 2JE5A 4XUJD 4XZQB 3KXBC 3REKC 2AROD 1P3IB 4H9RB 1KX3C 1ID3A 1P3FD 4WV4B 4JJNC 3AFAD 5DNMD 1M18B 4H9OB 2BYMA 4R8PC 5CP6C 5AV5C 3REJA 5B31A 3RELD 5B0ZB 2UWXA 3EPLA 4J8WA 1P3LC 3WKJB 4KUDB 4XUJA 3W99B 5F99B 3X1TD 3VH6T 2F8ND 2AROA 3A6NB 1P3FA 5AV8D 3REHB 3AFAA 5DNMA 3MGQB 3X1VC 1N1JB 3VH5A 3LJAC 3MNND 4UUZA 2ZM5A 5B24D 3H0MC 5BNVA 1KX5B 5AY8C 3AYWD 3X1SB 5B1LD 4KHAB 4CAYB 5B2JD 1BFMA 2NZDC 1M19D 1P3BD 3X1TA 2F8NA 3MGSD 5AV8A 4Z66C 4XZQC 2YFVB 3MNNA 1P3IC 2Y2IA 5B24A 3WTPA 4J8XC 3UTAB 4KGCD 5JRGB 1M18C 5B33B 4CSRB 3AYWA 5B2ID 3AN2D 3AV2B 1EQZB 5B1LA 4QLCD 5B2JA 5DNNB 3LZ1B 1HQ3B 1M19A 1P3BA 2BYKB 3AZFD 4YM6D 1P3OB 5B0ZC 4G91C 3MGSA 2Y2HA 3B6GB 3A1KA 5GT3B 3MGRB 3WKJC 1U35D 4ZUXB 4KUDC 5KDMB 3W99C 5F99C 3REKD 3KXBD 2RVQC 4E45A 1KX3D 3A6NC 2DF4C 3R45A 3REHC 4JJND 3WAAD 3EG5B 3UT9B 5B2IA 3AN2A 4WNNB 1B67A 1KX4B 4QLCA 4LD9B 1ZLAB 2XD5A 4YM6A 1P3AD 5FUGB 5AVCD 1KX5C 3VH5W 2FJ7B 1P3PB 3X1SC 3FDDA 4WU9D 3X1UC 3KUYD 1F66D 1U35A 3P5JB 1P3LD 3LELB 3REKA 3KXBA 3KSYA 2Y2KA 1BH9A 4H9PA 5G49B 3WAAA 4H9QB 3KWQD 3W98C 4X23D 2G5IC 1P34D 5B32D 4YS3D 3UTAC 5GT0B 5JRGC 5AVCA 1W2EA 3AZID 4NE3A 1P3AA 3WA9B 5B33C 3AV2C 5CPKD 1T3UA 3W97B 3MVDB 1EQZC 2PYOD 4WU9A 3KUYA 3C1CD 1F66A 5DNNC 3LZ1C 1HQ3C 1P3MB 3KFUG 3AZJB 3B6GC 5GT3C 5BO0A 3MGRC 5B0YD 1KU5A 4ZUXC 3KWQA 2CV5B 4H9SA 4WZSB 4XZQD 4X23A 3AZNB 1P34A 3H0RC 5B32A 2NZDB 3AZKD 4YS3A 5GSUD 3C1BD 3W96B 3AZIA 1M18D 5CPKA 1KX4C 2ZY5A 3NQUB 5GXQD 2PYOA 1TZYD 3C1CA 4Z66B 4LD9C 5AVBD 5BS7A 1ZLAC 3AV1B 2Y2PA 2HUEB 1H3OA 2FJ7C 1P3PC 4J8XB 2J8PA 1Q9CA 3NQJB 1P3GD 5B0YA 2YFWB 4AWLB 3LELC 4KUDD 4XZQA 3MGPD 4H9RA 3AZKA 3AZGD 5GSUA 3C1BA 1P3KB 3MGQD 1M18A 4H9OA 4G91B 5GXQA 1TZYA 1ID3B 1HTAA 5AVBA 2Y2JA 5GT0C 3AZMD 3WA9C 1KX5D 2BYMB 3W97C 3MVDC 3X1SD 3REJB 1P3GA 5BT1D 4J8UD 1P3MC 4KUDA 3AZED 3MGPA 3AZJC 4DQYB 2NQBC 3AZGA 4J8WB 3RELA 3MGQA 4XUJB 3AZHD 5B31G 3LZ0D 2CV5C 1N1JA 3AZNC 5B40D 2FFFB 5CPID 1P3FB 3X1UB 4DRAA 4J8VD 3AFAB 5DNMB 1M1AD 3W96C 3F6TA 3TU4D 3AZMA 4Z5TD 1KX5A 4WU8B 4ZBJB 5E5AD 4Z2MG 3X1SA 4CAYA 4KHAA 2F2AC 3EPKA 4J8UA 3LZ1D 1HQ3D 1S32D 3AZEA 3W98B 3AV1C 1P3OD 3UTBB 2HUEC 1AOID 3B0BA 3MGRD 3AZHA 3X1TB 5C3IB 3O62B 4E44A 3LZ0A 4AWLC 2F8NB 5B40A 1BH8A 5CPIA 4DRBA 5AV8B 5CPJD 4J8VA 1M1AA 3TU4A 1P3KC 2HIOD 3B6FD 4Z5TA 5AV9C 3UT9D 3MNNB 5E5AA 2Y2QA 4H9NA 3WTPB 5B24B 1ID3C 2F8NG 3LZ1A 1HQ3A 3VH5T 1S32A 3AYWB 1P3OA 1AOIA 5B1LB 2FJ7D 3AL0C 4KGCA 1M19B 2Y2MA 3REJC 5B31C 5CHLB 3B0CW 5KDMA 5JA4A 4R8PD 5CP6D 5AV5D 5CPJA 4J8WC 3AZFA 2HIOA 3B6FA 4XUJC 5BNXA 3UT9A 5AV6B 1P3FC 3R45B 3AFAC 5DNMC 2IO5B 5GT0D 3B0DB 3AZLB 3AN2B 4QLCB 4WU8C 4ZBJC 1KX3A 2FJ7A 2ZY2A 5B1MB 4G92C 4JJNA 3X1VD 1P3MD 3AZJD 3UTBC 4R8PA 3LJAD 5AV5A 5CP6A 3REIB 1WWSA 3X1TC 5C3IC 3O62C 5AY8D 5AV8C 1P3LA 2NZDD 3WAAB 3W96D 5GT0A 4WJ3C 2RIQA 2NQBB 3MNNC 3WTPC 5B24C 1TAFB 4Z66D 3X1VA 5AVCB 1P3MA 3AYWC 3AZJA 3AV1D 3LJAA 1P3ID 5B1LC 4WU9B 5B2JC 3KUYB 1F66B 4J8XD 1M19C 5AY8A 3EPHA 3MGSC 3WTPE 5BO0B 2NZDA 4X23B 5B0ZD 2Y2GA 1P34B 2L5AA 1A7WA 5AV6C 3VH6A 1JFIA 4YS3B 4Z66A 3WKJD 3AZIB 2IO5C 3B0DC 3AZLC 3W99D 5F99D 3AN2C 3AV1A 2RVQD 4QLCC 1P3IA 2PYOB 3C1CB 5B1MC 4J8XA 3A6ND 5B32G 3V9RB 3REHD 5AV9B 3REIC 2JSSA 5B0YB 5B0ZA 4HGAB 3AZKB 5GSUB 3C1BB 5B31B 3X1UD 3WKJA 3WAAC 3W99A 5F99A 5GXQB 4NE5A 1TZYB 4WU8D 2CWEA 3A6NA 5AVBB 1WWIA 3REHA 1P3AC 5AVCC 2AROB 4EO5B 2ZY3A 3W98D 3UTBD 4WU9C 3KUYC 1F66C 1P3GB 3UTAD 5JRGD 3MGPB 5B33D 3O62D 3AV2D 4UUZB 4G92B 3AZGB 1EQZD 3X1UA 3RELB 5BNVB 2XD1A 5DNND 1R4VA 3KWQC 4H9SC 4X23C 4WU8A 1P34C 5B32C 3WTPD 3B6GD 4YS3C 5GT3D 3AZMB 3AZIC 4ZUXD 5CPKC 3W98A 2YFVA 3UTBA 2PYOC 3VH6W 3C1CC 4J8UB 3B0CT 3UTAA 5BS7C 5JRGA 3AZEB 5B33A 3O62A 4CSRA 3AV2A 1KX4D 1EQZA 5DNNA 4LD9D 3AZHB 5B0YC 1ZLAD 2BYKA 3LZ0B 5B40B 1BH8B 4HGAC 5CPIB 5B2JB 5AV6D 1M1AB 4J8VB 1P3PD 3B6GA 3AZKC 5GT3A 2G5HC 4Z2MH 5GSUC 3MGRA 3C1BC 3TU4B 1P3BB 4Z5TB 4ZUXA 1Z2CB 3MGSB 3LELD 1F1EA 5GXQC 3AZLD 5E5AB 4H9NB 4NE6A 1TZYC 5AVBC 5B1MD 1S32B 1PZRA 2VQRA 2AROC 4WNNA 4EO5C 1KX4A 1AOIB 3A1IA 4KGCB 4LD9A 1ULYA 1P3GC 3REID 1ZLAA 5B2IB 5FUGA 3WA9D 2Y2LA 3MGPC 5AV6A 5JA4B 5CPJB 1P3PA 3MVDD 2Y2NA 3AZGC 1AOIC 2F8NH 3W97D 3RELC 3AZFB 2HIOB 4YM6B 3B6FB 3MGQC 5BNXB 3LELA 1B6WA 3AZLA 4M6BA 2NQBD 5B1MA 1U35B 5G49A 3AZMC 3REKB 4H9QA 3IP4C 3KXBB 2CV5D 3AZND 1KX3B 1BH9B 4H9PB 4JJNB 3REIA 5BT1C 3H0LC 4J8UC 3WA9A 3AZEC 3W97A 2DQNC 5CP6B 5AV5B 4R8PB 3MVDA 1P3AB 2W8SA 3AZHC 3LZ0C 5B40C 5CPIC 2JCHA 2NQBA 2BG1A 1M1AC 4J8VC 1P3LB 1TAFA 3TU4C 1P3BC 4Z5TC 2CV5A 3AZNA 5E5AC 3EPJA 4UPKA 3W96A 3X1VB 2LY8A 2ZY4A 3KWQB 1S32C 1P3KD 5AV9D 1P3OC 3LJAB 3NQUA 5B32B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ID3 D;  4KGC C;  5B2I C;  5AY8 B;  5CPK B;  2F8N K;  5CPJ C;  3AZF C;  3REJ D;  2HIO C;  3NQJ A;  5B31 D;  4YM6 C;  2YFW A;  3B6F C;  3UT9 C;  1H3O B;  1JFI B;  1U35 C;  4J8W D;  1P3K A;  3V9R A;  5AV9 A;  4NFT A;  4XUJ D;  4XZQ B;  3KXB C;  3REK C;  2ARO D;  1P3I B;  4H9R B;  1KX3 C;  1ID3 A;  1P3F D;  4WV4 B;  4JJN C;  3AFA D;  5DNM D;  1M18 B;  4H9O B;  2BYM A;  4R8P C;  5CP6 C;  5AV5 C;  3REJ A;  5B31 A;  3REL D;  5B0Z B;  1P3L C;  3WKJ B;  4J8W A;  4KUD B;  4XUJ A;  3W99 B;  5F99 B;  3X1T D;  3VH6 T;  2F8N D;  2ARO A;  3A6N B;  1P3F A;  5AV8 D;  3REH B;  3AFA A;  5DNM A;  3MGQ B;  3X1V C;  1N1J B;  3VH5 A;  3LJA C;  3MNN D;  4UUZ A;  5B24 D;  5BNV A;  1KX5 B;  5AY8 C;  3AYW D;  3X1S B;  5B1L D;  4KHA B;  4CAY B;  5B2J D;  1BFM A;  2NZD C;  1M19 D;  1P3B D;  3X1T A;  2F8N A;  3MGS D;  5AV8 A;  4Z66 C;  4XZQ C;  2YFV B;  3MNN A;  1P3I C;  3WTP A;  5B24 A;  4J8X C;  3UTA B;  4KGC D;  5JRG B;  1M18 C;  5B33 B;  4CSR B;  3AYW A;  5B2I D;  3AN2 D;  3AV2 B;  1EQZ B;  5B1L A;  4QLC D;  5B2J A;  5DNN B;  3LZ1 B;  1HQ3 B;  1M19 A;  1P3B A;  2BYK B;  3AZF D;  4YM6 D;  1P3O B;  5B0Z C;  4G91 C;  3MGS A;  3B6G B;  5GT3 B;  3MGR B;  3WKJ C;  1U35 D;  4ZUX B;  4KUD C;  5KDM B;  3W99 C;  5F99 C;  3REK D;  3KXB D;  2RVQ C;  4E45 A;  1KX3 D;  3A6N C;  3R45 A;  3REH C;  4JJN D;  3WAA D;  3UT9 B;  5B2I A;  3AN2 A;  4WNN B;  1B67 A;  1KX4 B;  4QLC A;  4LD9 B;  1ZLA B;  4YM6 A;  1P3A D;  5FUG B;  5AVC D;  1KX5 C;  3VH5 W;  2FJ7 B;  1P3P B;  3X1S C;  4WU9 D;  3X1U C;  3KUY D;  1F66 D;  1U35 A;  1P3L D;  3LEL B;  3REK A;  3KXB A;  3KSY A;  1BH9 A;  4H9P A;  5G49 B;  3WAA A;  4H9Q B;  3KWQ D;  3W98 C;  4X23 D;  1P34 D;  5B32 D;  4YS3 D;  3UTA C;  5GT0 B;  5JRG C;  5AVC A;  1P3A A;  3AZI D;  4NE3 A;  3WA9 B;  5B33 C;  3AV2 C;  5CPK D;  3W97 B;  3MVD B;  1EQZ C;  2PYO D;  4WU9 A;  3KUY A;  3C1C D;  1F66 A;  5DNN C;  3LZ1 C;  1HQ3 C;  1P3M B;  3AZJ B;  3B6G C;  5GT3 C;  5BO0 A;  3MGR C;  5B0Y D;  1KU5 A;  4ZUX C;  3KWQ A;  2CV5 B;  4H9S A;  4WZS B;  4XZQ D;  4X23 A;  3AZN B;  1P34 A;  5B32 A;  2NZD B;  3AZK D;  4YS3 A;  5GSU D;  3C1B D;  3W96 B;  3AZI A;  1M18 D;  5CPK A;  1KX4 C;  3NQU B;  5GXQ D;  2PYO A;  1TZY D;  3C1C A;  4Z66 B;  4LD9 C;  5AVB D;  5BS7 A;  1ZLA C;  3AV1 B;  2HUE B;  1H3O A;  2FJ7 C;  1P3P C;  4J8X B;  1Q9C A;  3NQJ B;  1P3G D;  5B0Y A;  2YFW B;  4AWL B;  3LEL C;  4KUD D;  4XZQ A;  3MGP D;  4H9R A;  3AZK A;  3AZG D;  5GSU A;  3C1B A;  1P3K B;  3MGQ D;  1M18 A;  4H9O A;  4G91 B;  5GXQ A;  1TZY A;  1ID3 B;  1HTA A;  5AVB A;  5GT0 C;  3AZM D;  3WA9 C;  1KX5 D;  2BYM B;  3W97 C;  3MVD C;  3X1S D;  3REJ B;  1P3G A;  5BT1 D;  4J8U D;  1P3M C;  4KUD A;  3AZE D;  3MGP A;  3AZJ C;  2NQB C;  3AZG A;  4J8W B;  3REL A;  3MGQ A;  4XUJ B;  3AZH D;  5B31 G;  3LZ0 D;  2CV5 C;  1N1J A;  3AZN C;  5B40 D;  5CPI D;  1P3F B;  3X1U B;  4DRA A;  4J8V D;  3AFA B;  5DNM B;  1M1A D;  3W96 C;  3TU4 D;  3AZM A;  4Z5T D;  1KX5 A;  4WU8 B;  4ZBJ B;  5E5A D;  4Z2M G;  3X1S A;  4CAY A;  4KHA A;  4J8U A;  3LZ1 D;  1HQ3 D;  1S32 D;  3AZE A;  3W98 B;  3AV1 C;  1P3O D;  3UTB B;  2HUE C;  1AOI D;  3B0B A;  3MGR D;  3AZH A;  3X1T B;  5C3I B;  3O62 B;  4E44 A;  3LZ0 A;  4AWL C;  2F8N B;  5B40 A;  1BH8 A;  5CPI A;  4DRB A;  5AV8 B;  5CPJ D;  4J8V A;  1M1A A;  3TU4 A;  1P3K C;  2HIO D;  3B6F D;  4Z5T A;  5AV9 C;  3UT9 D;  3MNN B;  5E5A A;  2F8N G;  4H9N A;  3WTP B;  5B24 B;  1ID3 C;  3LZ1 A;  1HQ3 A;  3VH5 T;  1S32 A;  3AYW B;  1P3O A;  1AOI A;  5B1L B;  2FJ7 D;  4KGC A;  1M19 B;  3REJ C;  5B31 C;  5CHL B;  3B0C W;  5KDM A;  5JA4 A;  4R8P D;  5CP6 D;  5AV5 D;  5CPJ A;  4J8W C;  3AZF A;  2HIO A;  3B6F A;  4XUJ C;  5BNX A;  3UT9 A;  5AV6 B;  1P3F C;  3R45 B;  3AFA C;  5DNM C;  2IO5 B;  5GT0 D;  3B0D B;  3AZL B;  3AN2 B;  4QLC B;  4WU8 C;  4ZBJ C;  1KX3 A;  2FJ7 A;  5B1M B;  4G92 C;  4JJN A;  3X1V D;  1P3M D;  3AZJ D;  3UTB C;  4R8P A;  3LJA D;  5AV5 A;  5CP6 A;  3REI B;  1WWS A;  3X1T C;  5C3I C;  3O62 C;  5AY8 D;  5AV8 C;  1P3L A;  2NZD D;  3WAA B;  3W96 D;  5GT0 A;  2NQB B;  3MNN C;  3WTP C;  5B24 C;  1TAF B;  4Z66 D;  3X1V A;  5AVC B;  1P3M A;  3AYW C;  3AZJ A;  3AV1 D;  3LJA A;  1P3I D;  5B1L C;  4WU9 B;  5B2J C;  3KUY B;  1F66 B;  4J8X D;  1M19 C;  5AY8 A;  3MGS C;  3WTP E;  5BO0 B;  2NZD A;  4X23 B;  5B0Z D;  1P34 B;  2L5A A;  1A7W A;  5AV6 C;  3VH6 A;  1JFI A;  4YS3 B;  4Z66 A;  3WKJ D;  3AZI B;  2IO5 C;  3B0D C;  3AZL C;  3W99 D;  5F99 D;  3AN2 C;  3AV1 A;  2RVQ D;  4QLC C;  1P3I A;  2PYO B;  3C1C B;  5B1M C;  4J8X A;  3A6N D;  5B32 G;  3V9R B;  3REH D;  5AV9 B;  3REI C;  2JSS A;  5B0Y B;  5B0Z A;  4HGA B;  3AZK B;  5GSU B;  3C1B B;  5B31 B;  3X1U D;  3WKJ A;  3WAA C;  3W99 A;  5F99 A;  5GXQ B;  4NE5 A;  1TZY B;  4WU8 D;  2CWE A;  3A6N A;  5AVB B;  1WWI A;  3REH A;  1P3A C;  5AVC C;  2ARO B;  4EO5 B;  3W98 D;  3UTB D;  4WU9 C;  3KUY C;  1F66 C;  1P3G B;  3UTA D;  5JRG D;  3MGP B;  5B33 D;  3O62 D;  3AV2 D;  4UUZ B;  4G92 B;  3AZG B;  1EQZ D;  3X1U A;  3REL B;  5BNV B;  5DNN D;  1R4V A;  3KWQ C;  4H9S C;  4X23 C;  4WU8 A;  1P34 C;  5B32 C;  3WTP D;  3B6G D;  4YS3 C;  5GT3 D;  3AZM B;  3AZI C;  4ZUX D;  5CPK C;  3W98 A;  2YFV A;  3UTB A;  2PYO C;  3VH6 W;  3C1C C;  4J8U B;  3B0C T;  3UTA A;  5BS7 C;  5JRG A;  3AZE B;  5B33 A;  3O62 A;  4CSR A;  3AV2 A;  1KX4 D;  1EQZ A;  5DNN A;  4LD9 D;  3AZH B;  5B0Y C;  1ZLA D;  2BYK A;  3LZ0 B;  5B40 B;  1BH8 B;  4HGA C;  5CPI B;  5B2J B;  5AV6 D;  1M1A B;  4J8V B;  1P3P D;  3B6G A;  3AZK C;  5GT3 A;  4Z2M H;  5GSU C;  3MGR A;  3C1B C;  3TU4 B;  1P3B B;  4Z5T B;  4ZUX A;  3MGS B;  3LEL D;  1F1E A;  5GXQ C;  3AZL D;  5E5A B;  4H9N B;  4NE6 A;  1TZY C;  5AVB C;  5B1M D;  1S32 B;  2ARO C;  4WNN A;  4EO5 C;  1KX4 A;  1AOI B;  4KGC B;  4LD9 A;  1ULY A;  1P3G C;  3REI D;  1ZLA A;  5B2I B;  5FUG A;  3WA9 D;  3MGP C;  5AV6 A;  5JA4 B;  5CPJ B;  1P3P A;  3MVD D;  2F8N H;  3AZG C;  1AOI C;  3W97 D;  3REL C;  3AZF B;  2HIO B;  4YM6 B;  3B6F B;  3MGQ C;  5BNX B;  3LEL A;  1B6W A;  3AZL A;  4M6B A;  2NQB D;  5B1M A;  1U35 B;  5G49 A;  3AZM C;  3REK B;  4H9Q A;  3KXB B;  2CV5 D;  3AZN D;  1KX3 B;  1BH9 B;  4H9P B;  4JJN B;  3REI A;  5BT1 C;  4J8U C;  3WA9 A;  3AZE C;  3W97 A;  4R8P B;  5CP6 B;  5AV5 B;  3MVD A;  1P3A B;  3AZH C;  3LZ0 C;  5B40 C;  5CPI C;  2NQB A;  1M1A C;  4J8V C;  1P3L B;  1TAF A;  3TU4 C;  1P3B C;  4Z5T C;  2CV5 A;  3AZN A;  5E5A C;  3W96 A;  3X1V B;  2LY8 A;  1S32 C;  3KWQ B;  1P3K D;  5AV9 D;  1P3O C;  3LJA B;  3NQU A;  5B32 B; 
#chains in the Genus database with same CATH topology
 1ID3 D;  4KGC C;  5B2I C;  5AY8 B;  5CPK B;  2F8N K;  5CPJ C;  2Y2O A;  3AZF C;  3REJ D;  2HIO C;  3NQJ A;  5B31 D;  4YM6 C;  2YFW A;  3B6F C;  3UT9 C;  1H3O B;  1JFI B;  1U35 C;  4J8W D;  1P3K A;  3V9R A;  5AV9 A;  4NFT A;  2JE5 A;  4XUJ D;  4XZQ B;  3KXB C;  3REK C;  2ARO D;  1P3I B;  4H9R B;  1KX3 C;  1ID3 A;  1P3F D;  4WV4 B;  4JJN C;  3AFA D;  5DNM D;  1M18 B;  4H9O B;  2BYM A;  4R8P C;  5CP6 C;  5AV5 C;  3REJ A;  5B31 A;  3REL D;  5B0Z B;  2UWX A;  3EPL A;  4J8W A;  1P3L C;  3WKJ B;  4KUD B;  4XUJ A;  3W99 B;  5F99 B;  3X1T D;  3VH6 T;  2F8N D;  2ARO A;  3A6N B;  1P3F A;  5AV8 D;  3REH B;  3AFA A;  5DNM A;  3MGQ B;  3X1V C;  1N1J B;  3VH5 A;  3LJA C;  3MNN D;  4UUZ A;  2ZM5 A;  5B24 D;  3H0M C;  5BNV A;  1KX5 B;  5AY8 C;  3AYW D;  3X1S B;  5B1L D;  4KHA B;  4CAY B;  5B2J D;  1BFM A;  2NZD C;  1M19 D;  1P3B D;  3X1T A;  2F8N A;  3MGS D;  5AV8 A;  4Z66 C;  4XZQ C;  2YFV B;  3MNN A;  1P3I C;  2Y2I A;  5B24 A;  3WTP A;  4J8X C;  3UTA B;  4KGC D;  5JRG B;  1M18 C;  5B33 B;  4CSR B;  3AYW A;  5B2I D;  3AN2 D;  3AV2 B;  1EQZ B;  5B1L A;  4QLC D;  5B2J A;  5DNN B;  3LZ1 B;  1HQ3 B;  1M19 A;  1P3B A;  2BYK B;  3AZF D;  4YM6 D;  1P3O B;  5B0Z C;  4G91 C;  3MGS A;  2Y2H A;  3B6G B;  3A1K A;  5GT3 B;  3MGR B;  3WKJ C;  1U35 D;  4ZUX B;  4KUD C;  5KDM B;  3W99 C;  5F99 C;  3REK D;  3KXB D;  2RVQ C;  4E45 A;  1KX3 D;  3A6N C;  2DF4 C;  3R45 A;  3REH C;  4JJN D;  3WAA D;  3EG5 B;  3UT9 B;  5B2I A;  3AN2 A;  4WNN B;  1B67 A;  1KX4 B;  4QLC A;  4LD9 B;  1ZLA B;  2XD5 A;  4YM6 A;  1P3A D;  5FUG B;  5AVC D;  1KX5 C;  3VH5 W;  2FJ7 B;  1P3P B;  3X1S C;  3FDD A;  4WU9 D;  3X1U C;  3KUY D;  1F66 D;  1U35 A;  3P5J B;  1P3L D;  3LEL B;  3REK A;  3KXB A;  3KSY A;  2Y2K A;  1BH9 A;  4H9P A;  5G49 B;  3WAA A;  4H9Q B;  3KWQ D;  3W98 C;  4X23 D;  2G5I C;  1P34 D;  5B32 D;  4YS3 D;  3UTA C;  5GT0 B;  5JRG C;  5AVC A;  1W2E A;  3AZI D;  4NE3 A;  1P3A A;  3WA9 B;  5B33 C;  3AV2 C;  5CPK D;  1T3U A;  3W97 B;  3MVD B;  1EQZ C;  2PYO D;  4WU9 A;  3KUY A;  3C1C D;  1F66 A;  5DNN C;  3LZ1 C;  1HQ3 C;  1P3M B;  3KFU G;  3AZJ B;  3B6G C;  5GT3 C;  5BO0 A;  3MGR C;  5B0Y D;  1KU5 A;  4ZUX C;  3KWQ A;  2CV5 B;  4H9S A;  4WZS B;  4XZQ D;  4X23 A;  3AZN B;  1P34 A;  3H0R C;  5B32 A;  2NZD B;  3AZK D;  4YS3 A;  5GSU D;  3C1B D;  3W96 B;  3AZI A;  1M18 D;  5CPK A;  1KX4 C;  2ZY5 A;  3NQU B;  5GXQ D;  2PYO A;  1TZY D;  3C1C A;  4Z66 B;  4LD9 C;  5AVB D;  5BS7 A;  1ZLA C;  3AV1 B;  2Y2P A;  2HUE B;  1H3O A;  2FJ7 C;  1P3P C;  4J8X B;  2J8P A;  1Q9C A;  3NQJ B;  1P3G D;  5B0Y A;  2YFW B;  4AWL B;  3LEL C;  4KUD D;  4XZQ A;  3MGP D;  4H9R A;  3AZK A;  3AZG D;  5GSU A;  3C1B A;  1P3K B;  3MGQ D;  1M18 A;  4H9O A;  4G91 B;  5GXQ A;  1TZY A;  1ID3 B;  1HTA A;  5AVB A;  2Y2J A;  5GT0 C;  3AZM D;  3WA9 C;  1KX5 D;  2BYM B;  3W97 C;  3MVD C;  3X1S D;  3REJ B;  1P3G A;  5BT1 D;  4J8U D;  1P3M C;  4KUD A;  3AZE D;  3MGP A;  3AZJ C;  4DQY B;  2NQB C;  3AZG A;  4J8W B;  3REL A;  3MGQ A;  4XUJ B;  3AZH D;  5B31 G;  3LZ0 D;  2CV5 C;  1N1J A;  3AZN C;  5B40 D;  2FFF B;  5CPI D;  1P3F B;  3X1U B;  4DRA A;  4J8V D;  3AFA B;  5DNM B;  1M1A D;  3W96 C;  3F6T A;  3TU4 D;  3AZM A;  4Z5T D;  1KX5 A;  4WU8 B;  4ZBJ B;  5E5A D;  4Z2M G;  3X1S A;  4CAY A;  4KHA A;  2F2A C;  3EPK A;  4J8U A;  3LZ1 D;  1HQ3 D;  1S32 D;  3AZE A;  3W98 B;  3AV1 C;  1P3O D;  3UTB B;  2HUE C;  1AOI D;  3B0B A;  3MGR D;  3AZH A;  3X1T B;  5C3I B;  3O62 B;  4E44 A;  3LZ0 A;  4AWL C;  2F8N B;  5B40 A;  1BH8 A;  5CPI A;  4DRB A;  5AV8 B;  5CPJ D;  4J8V A;  1M1A A;  3TU4 A;  1P3K C;  2HIO D;  3B6F D;  4Z5T A;  5AV9 C;  3UT9 D;  3MNN B;  5E5A A;  2Y2Q A;  4H9N A;  3WTP B;  5B24 B;  1ID3 C;  2F8N G;  3LZ1 A;  1HQ3 A;  3VH5 T;  1S32 A;  3AYW B;  1P3O A;  1AOI A;  5B1L B;  2FJ7 D;  3AL0 C;  4KGC A;  1M19 B;  2Y2M A;  3REJ C;  5B31 C;  5CHL B;  3B0C W;  5KDM A;  5JA4 A;  4R8P D;  5CP6 D;  5AV5 D;  5CPJ A;  4J8W C;  3AZF A;  2HIO A;  3B6F A;  4XUJ C;  5BNX A;  3UT9 A;  5AV6 B;  1P3F C;  3R45 B;  3AFA C;  5DNM C;  2IO5 B;  5GT0 D;  3B0D B;  3AZL B;  3AN2 B;  4QLC B;  4WU8 C;  4ZBJ C;  1KX3 A;  2FJ7 A;  2ZY2 A;  5B1M B;  4G92 C;  4JJN A;  3X1V D;  1P3M D;  3AZJ D;  3UTB C;  4R8P A;  3LJA D;  5AV5 A;  5CP6 A;  3REI B;  1WWS A;  3X1T C;  5C3I C;  3O62 C;  5AY8 D;  5AV8 C;  1P3L A;  2NZD D;  3WAA B;  3W96 D;  5GT0 A;  4WJ3 C;  2RIQ A;  2NQB B;  3MNN C;  3WTP C;  5B24 C;  1TAF B;  4Z66 D;  3X1V A;  5AVC B;  1P3M A;  3AYW C;  3AZJ A;  3AV1 D;  3LJA A;  1P3I D;  5B1L C;  4WU9 B;  5B2J C;  3KUY B;  1F66 B;  4J8X D;  1M19 C;  5AY8 A;  3EPH A;  3MGS C;  3WTP E;  5BO0 B;  2NZD A;  4X23 B;  5B0Z D;  2Y2G A;  1P34 B;  2L5A A;  1A7W A;  5AV6 C;  3VH6 A;  1JFI A;  4YS3 B;  4Z66 A;  3WKJ D;  3AZI B;  2IO5 C;  3B0D C;  3AZL C;  3W99 D;  5F99 D;  3AN2 C;  3AV1 A;  2RVQ D;  4QLC C;  1P3I A;  2PYO B;  3C1C B;  5B1M C;  4J8X A;  3A6N D;  5B32 G;  3V9R B;  3REH D;  5AV9 B;  3REI C;  2JSS A;  5B0Y B;  5B0Z A;  4HGA B;  3AZK B;  5GSU B;  3C1B B;  5B31 B;  3X1U D;  3WKJ A;  3WAA C;  3W99 A;  5F99 A;  5GXQ B;  4NE5 A;  1TZY B;  4WU8 D;  2CWE A;  3A6N A;  5AVB B;  1WWI A;  3REH A;  1P3A C;  5AVC C;  2ARO B;  4EO5 B;  2ZY3 A;  3W98 D;  3UTB D;  4WU9 C;  3KUY C;  1F66 C;  1P3G B;  3UTA D;  5JRG D;  3MGP B;  5B33 D;  3O62 D;  3AV2 D;  4UUZ B;  4G92 B;  3AZG B;  1EQZ D;  3X1U A;  3REL B;  5BNV B;  2XD1 A;  5DNN D;  1R4V A;  3KWQ C;  4H9S C;  4X23 C;  4WU8 A;  1P34 C;  5B32 C;  3WTP D;  3B6G D;  4YS3 C;  5GT3 D;  3AZM B;  3AZI C;  4ZUX D;  5CPK C;  3W98 A;  2YFV A;  3UTB A;  2PYO C;  3VH6 W;  3C1C C;  4J8U B;  3B0C T;  3UTA A;  5BS7 C;  5JRG A;  3AZE B;  5B33 A;  3O62 A;  4CSR A;  3AV2 A;  1KX4 D;  1EQZ A;  5DNN A;  4LD9 D;  3AZH B;  5B0Y C;  1ZLA D;  2BYK A;  3LZ0 B;  5B40 B;  1BH8 B;  4HGA C;  5CPI B;  5B2J B;  5AV6 D;  1M1A B;  4J8V B;  1P3P D;  3B6G A;  3AZK C;  5GT3 A;  2G5H C;  4Z2M H;  5GSU C;  3MGR A;  3C1B C;  3TU4 B;  1P3B B;  4Z5T B;  4ZUX A;  1Z2C B;  3MGS B;  3LEL D;  1F1E A;  5GXQ C;  3AZL D;  5E5A B;  4H9N B;  4NE6 A;  1TZY C;  5AVB C;  5B1M D;  1S32 B;  1PZR A;  2VQR A;  2ARO C;  4WNN A;  4EO5 C;  1KX4 A;  1AOI B;  3A1I A;  4KGC B;  4LD9 A;  1ULY A;  1P3G C;  3REI D;  1ZLA A;  5B2I B;  5FUG A;  3WA9 D;  2Y2L A;  3MGP C;  5AV6 A;  5JA4 B;  5CPJ B;  1P3P A;  3MVD D;  2Y2N A;  3AZG C;  1AOI C;  2F8N H;  3W97 D;  3REL C;  3AZF B;  2HIO B;  4YM6 B;  3B6F B;  3MGQ C;  5BNX B;  3LEL A;  1B6W A;  3AZL A;  4M6B A;  2NQB D;  5B1M A;  1U35 B;  5G49 A;  3AZM C;  3REK B;  4H9Q A;  3IP4 C;  3KXB B;  2CV5 D;  3AZN D;  1KX3 B;  1BH9 B;  4H9P B;  4JJN B;  3REI A;  5BT1 C;  3H0L C;  4J8U C;  3WA9 A;  3AZE C;  3W97 A;  2DQN C;  5CP6 B;  5AV5 B;  4R8P B;  3MVD A;  1P3A B;  2W8S A;  3AZH C;  3LZ0 C;  5B40 C;  5CPI C;  2JCH A;  2NQB A;  2BG1 A;  1M1A C;  4J8V C;  1P3L B;  1TAF A;  3TU4 C;  1P3B C;  4Z5T C;  2CV5 A;  3AZN A;  5E5A C;  3EPJ A;  4UPK A;  3W96 A;  3X1V B;  2LY8 A;  2ZY4 A;  3KWQ B;  1S32 C;  1P3K D;  5AV9 D;  1P3O C;  3LJA B;  3NQU A;  5B32 B; 
#chains in the Genus database with same CATH homology
 1ID3 D;  4KGC C;  5B2I C;  5AY8 B;  5CPK B;  2F8N K;  5CPJ C;  2Y2O A;  3AZF C;  3REJ D;  2HIO C;  3NQJ A;  5B31 D;  4YM6 C;  2YFW A;  3B6F C;  3UT9 C;  1H3O B;  1JFI B;  1U35 C;  4J8W D;  1P3K A;  3V9R A;  5AV9 A;  4NFT A;  2JE5 A;  4XUJ D;  4XZQ B;  3KXB C;  3REK C;  2ARO D;  1P3I B;  4H9R B;  1KX3 C;  1ID3 A;  1P3F D;  4WV4 B;  4JJN C;  3AFA D;  5DNM D;  1M18 B;  4H9O B;  2BYM A;  4R8P C;  5CP6 C;  5AV5 C;  3REJ A;  5B31 A;  3REL D;  5B0Z B;  2UWX A;  3EPL A;  4J8W A;  1P3L C;  3WKJ B;  4KUD B;  4XUJ A;  3W99 B;  5F99 B;  3X1T D;  3VH6 T;  2F8N D;  2ARO A;  3A6N B;  1P3F A;  5AV8 D;  3REH B;  3AFA A;  5DNM A;  3MGQ B;  3X1V C;  1N1J B;  3VH5 A;  3LJA C;  3MNN D;  4UUZ A;  2ZM5 A;  5B24 D;  3H0M C;  5BNV A;  1KX5 B;  5AY8 C;  3AYW D;  3X1S B;  5B1L D;  4KHA B;  4CAY B;  5B2J D;  1BFM A;  2NZD C;  1M19 D;  1P3B D;  3X1T A;  2F8N A;  3MGS D;  5AV8 A;  4Z66 C;  4XZQ C;  2YFV B;  3MNN A;  1P3I C;  2Y2I A;  5B24 A;  3WTP A;  4J8X C;  3UTA B;  4KGC D;  5JRG B;  1M18 C;  5B33 B;  4CSR B;  3AYW A;  5B2I D;  3AN2 D;  3AV2 B;  1EQZ B;  5B1L A;  4QLC D;  5B2J A;  5DNN B;  3LZ1 B;  1HQ3 B;  1M19 A;  1P3B A;  2BYK B;  3AZF D;  4YM6 D;  1P3O B;  5B0Z C;  4G91 C;  3MGS A;  2Y2H A;  3B6G B;  3A1K A;  5GT3 B;  3MGR B;  3WKJ C;  1U35 D;  4ZUX B;  4KUD C;  5KDM B;  3W99 C;  5F99 C;  3REK D;  3KXB D;  2RVQ C;  4E45 A;  1KX3 D;  3A6N C;  2DF4 C;  3R45 A;  3REH C;  4JJN D;  3WAA D;  3EG5 B;  3UT9 B;  5B2I A;  3AN2 A;  4WNN B;  1B67 A;  1KX4 B;  4QLC A;  4LD9 B;  1ZLA B;  2XD5 A;  4YM6 A;  1P3A D;  5FUG B;  5AVC D;  1KX5 C;  3VH5 W;  2FJ7 B;  1P3P B;  3X1S C;  3FDD A;  4WU9 D;  3X1U C;  3KUY D;  1F66 D;  1U35 A;  3P5J B;  1P3L D;  3LEL B;  3REK A;  3KXB A;  3KSY A;  2Y2K A;  1BH9 A;  4H9P A;  5G49 B;  3WAA A;  4H9Q B;  3KWQ D;  3W98 C;  4X23 D;  2G5I C;  1P34 D;  5B32 D;  4YS3 D;  3UTA C;  5GT0 B;  5JRG C;  5AVC A;  1W2E A;  3AZI D;  4NE3 A;  1P3A A;  3WA9 B;  5B33 C;  3AV2 C;  5CPK D;  1T3U A;  3W97 B;  3MVD B;  1EQZ C;  2PYO D;  4WU9 A;  3KUY A;  3C1C D;  1F66 A;  5DNN C;  3LZ1 C;  1HQ3 C;  1P3M B;  3KFU G;  3AZJ B;  3B6G C;  5GT3 C;  5BO0 A;  3MGR C;  5B0Y D;  1KU5 A;  4ZUX C;  3KWQ A;  2CV5 B;  4H9S A;  4WZS B;  4XZQ D;  4X23 A;  3AZN B;  1P34 A;  3H0R C;  5B32 A;  2NZD B;  3AZK D;  4YS3 A;  5GSU D;  3C1B D;  3W96 B;  3AZI A;  1M18 D;  5CPK A;  1KX4 C;  2ZY5 A;  3NQU B;  5GXQ D;  2PYO A;  1TZY D;  3C1C A;  4Z66 B;  4LD9 C;  5AVB D;  5BS7 A;  1ZLA C;  3AV1 B;  2Y2P A;  2HUE B;  1H3O A;  2FJ7 C;  1P3P C;  4J8X B;  2J8P A;  1Q9C A;  3NQJ B;  1P3G D;  5B0Y A;  2YFW B;  4AWL B;  3LEL C;  4KUD D;  4XZQ A;  3MGP D;  4H9R A;  3AZK A;  3AZG D;  5GSU A;  3C1B A;  1P3K B;  3MGQ D;  1M18 A;  4H9O A;  4G91 B;  5GXQ A;  1TZY A;  1ID3 B;  1HTA A;  5AVB A;  2Y2J A;  5GT0 C;  3AZM D;  3WA9 C;  1KX5 D;  2BYM B;  3W97 C;  3MVD C;  3X1S D;  3REJ B;  1P3G A;  5BT1 D;  4J8U D;  1P3M C;  4KUD A;  3AZE D;  3MGP A;  3AZJ C;  4DQY B;  2NQB C;  3AZG A;  4J8W B;  3REL A;  3MGQ A;  4XUJ B;  3AZH D;  5B31 G;  3LZ0 D;  2CV5 C;  1N1J A;  3AZN C;  5B40 D;  2FFF B;  5CPI D;  1P3F B;  3X1U B;  4DRA A;  4J8V D;  3AFA B;  5DNM B;  1M1A D;  3W96 C;  3F6T A;  3TU4 D;  3AZM A;  4Z5T D;  1KX5 A;  4WU8 B;  4ZBJ B;  5E5A D;  4Z2M G;  3X1S A;  4CAY A;  4KHA A;  2F2A C;  3EPK A;  4J8U A;  3LZ1 D;  1HQ3 D;  1S32 D;  3AZE A;  3W98 B;  3AV1 C;  1P3O D;  3UTB B;  2HUE C;  1AOI D;  3B0B A;  3MGR D;  3AZH A;  3X1T B;  5C3I B;  3O62 B;  4E44 A;  3LZ0 A;  4AWL C;  2F8N B;  5B40 A;  1BH8 A;  5CPI A;  4DRB A;  5AV8 B;  5CPJ D;  4J8V A;  1M1A A;  3TU4 A;  1P3K C;  2HIO D;  3B6F D;  4Z5T A;  5AV9 C;  3UT9 D;  3MNN B;  5E5A A;  2Y2Q A;  4H9N A;  3WTP B;  5B24 B;  1ID3 C;  2F8N G;  3LZ1 A;  1HQ3 A;  3VH5 T;  1S32 A;  3AYW B;  1P3O A;  1AOI A;  5B1L B;  2FJ7 D;  3AL0 C;  4KGC A;  1M19 B;  2Y2M A;  3REJ C;  5B31 C;  5CHL B;  3B0C W;  5KDM A;  5JA4 A;  4R8P D;  5CP6 D;  5AV5 D;  5CPJ A;  4J8W C;  3AZF A;  2HIO A;  3B6F A;  4XUJ C;  5BNX A;  3UT9 A;  5AV6 B;  1P3F C;  3R45 B;  3AFA C;  5DNM C;  2IO5 B;  5GT0 D;  3B0D B;  3AZL B;  3AN2 B;  4QLC B;  4WU8 C;  4ZBJ C;  1KX3 A;  2FJ7 A;  2ZY2 A;  5B1M B;  4G92 C;  4JJN A;  3X1V D;  1P3M D;  3AZJ D;  3UTB C;  4R8P A;  3LJA D;  5AV5 A;  5CP6 A;  3REI B;  1WWS A;  3X1T C;  5C3I C;  3O62 C;  5AY8 D;  5AV8 C;  1P3L A;  2NZD D;  3WAA B;  3W96 D;  5GT0 A;  4WJ3 C;  2RIQ A;  2NQB B;  3MNN C;  3WTP C;  5B24 C;  1TAF B;  4Z66 D;  3X1V A;  5AVC B;  1P3M A;  3AYW C;  3AZJ A;  3AV1 D;  3LJA A;  1P3I D;  5B1L C;  4WU9 B;  5B2J C;  3KUY B;  1F66 B;  4J8X D;  1M19 C;  5AY8 A;  3EPH A;  3MGS C;  3WTP E;  5BO0 B;  2NZD A;  4X23 B;  5B0Z D;  2Y2G A;  1P34 B;  2L5A A;  1A7W A;  5AV6 C;  3VH6 A;  1JFI A;  4YS3 B;  4Z66 A;  3WKJ D;  3AZI B;  2IO5 C;  3B0D C;  3AZL C;  3W99 D;  5F99 D;  3AN2 C;  3AV1 A;  2RVQ D;  4QLC C;  1P3I A;  2PYO B;  3C1C B;  5B1M C;  4J8X A;  3A6N D;  5B32 G;  3V9R B;  3REH D;  5AV9 B;  3REI C;  2JSS A;  5B0Y B;  5B0Z A;  4HGA B;  3AZK B;  5GSU B;  3C1B B;  5B31 B;  3X1U D;  3WKJ A;  3WAA C;  3W99 A;  5F99 A;  5GXQ B;  4NE5 A;  1TZY B;  4WU8 D;  2CWE A;  3A6N A;  5AVB B;  1WWI A;  3REH A;  1P3A C;  5AVC C;  2ARO B;  4EO5 B;  2ZY3 A;  3W98 D;  3UTB D;  4WU9 C;  3KUY C;  1F66 C;  1P3G B;  3UTA D;  5JRG D;  3MGP B;  5B33 D;  3O62 D;  3AV2 D;  4UUZ B;  4G92 B;  3AZG B;  1EQZ D;  3X1U A;  3REL B;  5BNV B;  2XD1 A;  5DNN D;  1R4V A;  3KWQ C;  4H9S C;  4X23 C;  4WU8 A;  1P34 C;  5B32 C;  3WTP D;  3B6G D;  4YS3 C;  5GT3 D;  3AZM B;  3AZI C;  4ZUX D;  5CPK C;  3W98 A;  2YFV A;  3UTB A;  2PYO C;  3VH6 W;  3C1C C;  4J8U B;  3B0C T;  3UTA A;  5BS7 C;  5JRG A;  3AZE B;  5B33 A;  3O62 A;  4CSR A;  3AV2 A;  1KX4 D;  1EQZ A;  5DNN A;  4LD9 D;  3AZH B;  5B0Y C;  1ZLA D;  2BYK A;  3LZ0 B;  5B40 B;  1BH8 B;  4HGA C;  5CPI B;  5B2J B;  5AV6 D;  1M1A B;  4J8V B;  1P3P D;  3B6G A;  3AZK C;  5GT3 A;  2G5H C;  4Z2M H;  5GSU C;  3MGR A;  3C1B C;  3TU4 B;  1P3B B;  4Z5T B;  4ZUX A;  1Z2C B;  3MGS B;  3LEL D;  1F1E A;  5GXQ C;  3AZL D;  5E5A B;  4H9N B;  4NE6 A;  1TZY C;  5AVB C;  5B1M D;  1S32 B;  1PZR A;  2VQR A;  2ARO C;  4WNN A;  4EO5 C;  1KX4 A;  1AOI B;  3A1I A;  4KGC B;  4LD9 A;  1ULY A;  1P3G C;  3REI D;  1ZLA A;  5B2I B;  5FUG A;  3WA9 D;  2Y2L A;  3MGP C;  5AV6 A;  5JA4 B;  5CPJ B;  1P3P A;  3MVD D;  2Y2N A;  3AZG C;  1AOI C;  2F8N H;  3W97 D;  3REL C;  3AZF B;  2HIO B;  4YM6 B;  3B6F B;  3MGQ C;  5BNX B;  3LEL A;  1B6W A;  3AZL A;  4M6B A;  2NQB D;  5B1M A;  1U35 B;  5G49 A;  3AZM C;  3REK B;  4H9Q A;  3IP4 C;  3KXB B;  2CV5 D;  3AZN D;  1KX3 B;  1BH9 B;  4H9P B;  4JJN B;  3REI A;  5BT1 C;  3H0L C;  4J8U C;  3WA9 A;  3AZE C;  3W97 A;  2DQN C;  5CP6 B;  5AV5 B;  4R8P B;  3MVD A;  1P3A B;  2W8S A;  3AZH C;  3LZ0 C;  5B40 C;  5CPI C;  2JCH A;  2NQB A;  2BG1 A;  1M1A C;  4J8V C;  1P3L B;  1TAF A;  3TU4 C;  1P3B C;  4Z5T C;  2CV5 A;  3AZN A;  5E5A C;  3EPJ A;  4UPK A;  3W96 A;  3X1V B;  2LY8 A;  2ZY4 A;  3KWQ B;  1S32 C;  1P3K D;  5AV9 D;  1P3O C;  3LJA B;  3NQU A;  5B32 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...