1S32B

Molecular recognition of the nucleosomal 'supergroove'
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
81
structure length
81
Chain Sequence
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords palindromic alpha-satellite 146 bp DNA fragment
publication title Molecular Recognition of the Nucleosomal 'Supergroove'
pubmed doi rcsb
source organism Xenopus laevis
total genus 29
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1s32B00
4J8UD 5AV8C 4Z2MG 3C1BB 3WTPB 1P34B 3V9RB 5B31D 5B32B 4G91C 5B40D 3AZID 4YS3A 3B6FA 5B2IB 5KDMB 3AZGB 1WWSA 3MGSC 4KGCB 5AV6B 3REHA 1ZLAC 5DNNA 5B24A 3B6GA 5AV5D 3X1UB 3W96D 1ID3A 3LJAA 1P3PB 4J8VD 5GT3B 3MGQB 3AZLC 3W98A 4KHAB 3AZED 2CV5B 4R8PB 1AOIC 3MVDD 3AYWB 3KWQD 1P3OD 3LELC 5BT1C 3KUYD 1P3FC 5E5AA 3REKB 5B2JC 1P34D 4H9PA 5BNXB 1P3AB 5B31G 4J8WD 3AN2C 3X1VB 2F8NA 4YM6A 5B2ID 4UUZA 3AZHB 5AY8B 1P3LC 3AZND 3B0DB 2PYOD 3UTBD 3WAAA 2HUEC 3MGPD 5FUGA 2F8NG 3REHC 5DNNC 3UTAD 4Z5TA 5B24C 3B6GC 2F8NH 3C1BA 3W97D 3LJAC 3WTPA 1U35D 4ZUXC 3AZJD 4KUDD 3V9RA 4WU9C 4J8UC 3AFAD 1P3BD 2YFVA 3VH6T 5G49A 5B31C 3W98C 3AZGA 2AROC 3RELB 3AZIC 5B1MD 4KGCA 5AV6A 3AZMD 3O62B 3UT9A 2FJ7B 5B32G 1P3PA 1KX3B 4YM6C 5CPKD 5GT3A 3MGQA 4X23B 4KHAA 2CV5A 4J8VC 4XUJD 5F99D 3AYWA 3C1CD 1P3GD 1KX4D 1HQ3B 3MVDC 1P3OC 3REKA 5BNXA 3KUYC 1ULYA 1P3AA 3C1BC 1S32D 3X1VA 1P34C 3W99D 5CP6D 5B32C 3A6NB 3AZHA 5AY8A 4J8WC 5B2IC 3AZGC 2HIOB 3AZNC 3B0CW 1M18B 2PYOC 1B67A 1A7WA 3MGSD 4YS3B 3X1UC 4DRBA 1P3PC 1ZLAD 3UTAC 2IO5C 4X23D 3WKJA 4NE5A 4WZSB 1U35C 3AZJC 4KUDC 1F66B 3LZ0B 3AFAC 4R8PC 1P3BC 5JRGD 3AYWC 5CPIB 2NQBB 3AZLD 3O62A 1AOID 3REKC 5B0YD 1P3AC 1EQZD 3AZMC 1P3FD 4WNNA 3AZKB 1KX3A 5B2JD 3X1TA 3WA9A 5AY8C 4NE3A 1M1AA 4JJNA 3B0CT 1P3LD 5BS7A 4XUJC 1KX4C 3B6FD 3C1CC 2JSSA 1JFIA 3AZFB 3REHD 5DNND 3WAAB 5B24D 3B6GD 1S32C 1ID3D 3LJAD 3LZ1B 3RELC 1KU5A 4AWLC 3AV2B 2HIOA 3W98D 1M18A 3REJA 2AROD 2YFVB 2FJ7C 5G49B 5E5AD 4XZQB 3REIB 3UT9B 4ZBJB 5B0ZA 4X23C 3LZ0A 1F66A 4EO5B 2F8ND 4YM6D 5CPIA 2YFWB 4HGAB 1P3KA 2NQBA 4LD9B 1HQ3C 5BS7C 4NFTA 5JRGC 1M19B 5CPJA 2NZDA 4QLCA 5AVBB 4M6BA 3KSYA 5B0YC 3AZKA 5C3IC 3B0BA 4Z5TD 1EQZC 4Z66A 3A6NC 3C1BD 3WTPD 3KXBB 5DNMB 5B32D 5JA4B 3X1SA 1TZYB 3AZGD 1M18C 3AV1B 3AZFA 4YS3C 3B6FC 4KGCD 5AV6D 1P3IB 2F8NK 3X1UD 1F66C 4CAYB 1P3PD 3LZ1A 5B40A 4H9QB 1ID3C 5GT3D 5CPIC 3MGQD 3AV2A 3WKJB 5GXQB 2CV5D 4R8PD 1N1JB 3AYWD 5B1LA 5AVCB 3AZKC 3REKD 4XZQA 3REIA 1P3AD 5E5AC 3X1VD 1KX5B 4WNNB 2YFWA 3AZEA 3AZHD 4LD9A 5AY8D 1P3MB 1M19A 3KWQA 3X1TB 4H9SA 5AVBA 3WA9B 4CSRA 1WWIA 3R45A 4J8XB 1M1AB 4JJNB 1BH8A 3WAAC 3MGRB 5B33B 3KXBA 1JFIB 4Z5TC 5BNVB 5AV8B 5DNMA 5JA4A 3WTPC 1TZYA 3UTBA 3AV1A 3MGPA 3RELD 3O62D 2FJ7D 3W97A 1P3IA 4H9NA 4KGCC 5AV6C 3REJB 1R4VA 4ZBJC 4CAYA 3UT9C 3TU4B 1KX3D 4H9QA 4LD9C 4HGAC 5GXQA 1N1JA 5AVBC 5GT3C 3MGQC 5AVCA 5B0ZB 2CV5C 1HQ3D 3LELB 1P3KB 1TAFA 3WTPE 5CPJB 2NZDB 4QLCB 3MNNB 5CPKA 4E44A 4WU8B 1KX5A 5BO0B 3A6ND 3X1VC 3AN2B 1P3MA 5F99A 1TZYC 4Z66B 2CWEA 3AZHC 4H9RB 4J8XA 2HIOD 5GT0B 1M18D 3B0DC 2BYKA 3MGRA 5AV9B 5B33A 3X1SB 4YS3D 3W99A 5CP6A 5BNVA 5AV8A 5GSUB 1BH9A 4ZUXB 3WKJC 4J8UB 1F66D 3NQJA 5GXQC 3LZ0D 5B31B 5CPID 2NQBD 5B40B 3MGSA 3AZIB 4QLCD 4DRAA 3W99C 3O62C 3TU4A 3AZKD 5B1LB 1KX3C 5AV5B 3X1TC 3W96B 3WA9C 3AZLA 4J8VB 1AOIA 1M1AC 4JJNC 4E45A 4WV4B 3LELA 3AZEB 5B33C 3VH5A 3AZFD 3MVDB 3KWQB 1P3OB 3MNNA 4CSRB 3KUYB 4WU8A 3WAAD 3R45B 5BO0A 3AN2A 1BH8B 4Z2MH 3LZ1D 4J8WB 1P3LA 4H9RA 3AV2D 4H9OB 5GT0A 5AV9A 3AZNB 2HIOC 1Q9CA 5B1LD 1BFMA 2PYOB 3REJC 3UTBB 3TU4C 3MGPB 4XZQD 3REID 5GSUA 4ZUXA 3UTAB 2IO5B 4WU9A 3UT9D 2L5AA 4J8UA 3W97B 4H9NB 3VH6W 1U35B 3AZJB 4KUDB 5B31A 4LD9D 5B0ZC 2AROA 3LZ0C 3AFAB 1P3BB 1M19D 3VH5W 3AZIA 5AVBD 2RVQD 2BYMA 1P3KC 2NQBC 5CPJC 2NZDC 4QLCC 3MNNC 5B1MB 4WU8C 3AZMB 5AV5A 3KXBD 4G92B 3W96A 4Z66C 5DNMD 1TAFB 4J8VA 5CPKB 5GT0C 1TZYD 3NQUB 1H3OB 3AV1D 5CHLB 5AV9C 3X1SC 4XUJB 5F99B 3MVDA 3C1CB 1P3GB 1P3OA 1KX4B 3KUYA 3AZFC 5GSUC 1P3ID 1P34A 2BYKB 5B32A 1S32B 4J8WA 3W99B 4H9OA 5B2IA 5KDMA 5CP6B 3WKJD 3VH5T 5GXQD 3LZ1C 5B40C 4AWLB 1BH9B 3AV2C 3AZNA 5AVCD 3NQJB 2PYOA 4G91B 5B1LC 3X1UA 3UTAA 3MGSB 4XZQC 5AV5C 3REIC 3W96C 1U35A 1KX5D 3AZJA 1ZLAB 4KUDA 3AFAA 4R8PA 4EO5C 1P3BA 1P3MD 3X1TD 3WA9D 3AZEC 5JRGB 4J8XD 1M19C 3KWQC 1M1AD 4H9SC 4JJND 5B1MA 2RVQC 3AZLB 3MGRD 3AZMA 5B33D 1AOIB 5B0YB 5C3IB 1B6WA 1EQZB 1P3FB 1HTAA 5AV8D 5B2JB 3KXBC 3NQUA 5DNMC 1H3OA 4XUJA 1KX4A 3C1CA 1P3GA 3UTBC 3AV1C 3MGPC 1P3LB 3B6FB 3REJD 3TU4D 2HUEB 3W97C 1P3IC 1S32A 3REHB 5DNNB 5B24B 3B6GB 3RELA 1ID3B 3LJAB 4WU9B 5B0ZD 2FJ7A 3LELD 5B1MC 5BT1D 3W98B 5AVCC 1P3KD 2AROB 5CPJD 2NZDD 3MNND 4G92C 2BYMB 4WU8D 4NE6A 1ZLAA 4X23A 5E5AB 3AN2D 4H9PB 5CPKC 1KX5C 4Z66D 2F8NB 1HQ3A 5JRGA 4YM6B 5F99C 1P3MC 1P3GC 2LY8A 4UUZB 5GT0D 1F1EA 4J8XC 5AV9D 3VH6A 5B0YA 3X1SD 3MGRC 1P3FA 5FUGB 1EQZA 5GSUD 3A6NA 5B2JA 4ZUXD 5CP6C 4Z5TB 4WU9D
chains in the Genus database with same CATH superfamily
4J8UD 5AV8C 4Z2MG 3C1BB 3WTPB 1P34B 3V9RB 5B31D 5B32B 4G91C 5B40D 3AZID 4YS3A 2Y2GA 3B6FA 5B2IB 5KDMB 3AZGB 1WWSA 3MGSC 4UPKA 4KGCB 3H0MC 5AV6B 3REHA 1ZLAC 5DNNA 5B24A 3B6GA 5AV5D 3X1UB 3W96D 1ID3A 3LJAA 1P3PB 4J8VD 5GT3B 3MGQB 3AZLC 3W98A 4KHAB 3AZED 2CV5B 4R8PB 1AOIC 3MVDD 3AYWB 3KWQD 1P3OD 3LELC 5BT1C 3KUYD 1P3FC 5E5AA 3REKB 5B2JC 1P34D 4H9PA 5BNXB 1P3AB 5B31G 4J8WD 3AN2C 3X1VB 2F8NA 4YM6A 5B2ID 4UUZA 3AZHB 5AY8B 1P3LC 3AZND 3B0DB 2PYOD 3UTBD 3WAAA 2HUEC 3MGPD 5FUGA 2F8NG 3REHC 5DNNC 3EPJA 3UTAD 4Z5TA 5B24C 3B6GC 2F8NH 3C1BA 3W97D 3LJAC 3WTPA 1U35D 4ZUXC 3AZJD 4KUDD 3V9RA 4WU9C 4J8UC 3AFAD 1P3BD 2YFVA 3VH6T 2Y2OA 5G49A 5B31C 3W98C 3AZGA 2VQRA 2AROC 3RELB 3AZIC 5B1MD 4KGCA 5AV6A 3EPKA 3AZMD 3O62B 3UT9A 2FJ7B 5B32G 1P3PA 3IP4C 1KX3B 4YM6C 5CPKD 5GT3A 2ZY3A 3MGQA 4X23B 4KHAA 2CV5A 4J8VC 4XUJD 5F99D 3AYWA 3C1CD 1P3GD 1KX4D 1HQ3B 3MVDC 1P3OC 3REKA 5BNXA 3A1IA 1ULYA 3KUYC 1P3AA 3C1BC 1S32D 3X1VA 1P34C 3W99D 2Y2QA 5CP6D 5B32C 3A6NB 3AZHA 5AY8A 4J8WC 5B2IC 3AZGC 2HIOB 3AZNC 3B0CW 1M18B 2PYOC 2ZY2A 1B67A 1A7WA 3MGSD 4YS3B 3X1UC 4DRBA 1P3PC 1ZLAD 3UTAC 2IO5C 4X23D 3WKJA 4NE5A 3EG5B 4WZSB 3AZJC 1U35C 4KUDC 1F66B 3LZ0B 3AFAC 4R8PC 1P3BC 5JRGD 3AYWC 5CPIB 2NQBB 3AZLD 3O62A 1AOID 3REKC 5B0YD 3H0LC 1P3AC 2G5IC 3AZMC 1P3FD 4WNNA 1EQZD 3AZKB 1KX3A 5B2JD 3X1TA 3WA9A 5AY8C 4NE3A 1M1AA 3F6TA 4JJNA 3B0CT 1P3LD 5BS7A 4XUJC 1KX4C 3B6FD 3C1CC 2RIQA 2FFFB 2JSSA 1JFIA 2DQNC 3AZFB 1PZRA 3REHD 5DNND 3WAAB 5B24D 3B6GD 1S32C 1ID3D 3LJAD 2ZY4A 2JE5A 3LZ1B 3RELC 1KU5A 4AWLC 3AV2B 2HIOA 3A1KA 3W98D 1M18A 3REJA 2AROD 2YFVB 2FJ7C 5G49B 5E5AD 4XZQB 3REIB 3UT9B 4ZBJB 5B0ZA 4X23C 3LZ0A 1F66A 4EO5B 2F8ND 4YM6D 5CPIA 2YFWB 4HGAB 1P3KA 2NQBA 4LD9B 1HQ3C 5BS7C 4NFTA 5JRGC 1M19B 5CPJA 2NZDA 4QLCA 5AVBB 4M6BA 3KSYA 5B0YC 3AZKA 5C3IC 3B0BA 4Z5TD 1EQZC 4Z66A 3A6NC 3C1BD 3WTPD 3KXBB 5DNMB 5B32D 5JA4B 3X1SA 1TZYB 3AZGD 1M18C 3AV1B 3AZFA 4YS3C 3B6FC 4KGCD 5AV6D 1P3IB 2F8NK 3X1UD 1F66C 4CAYB 1P3PD 3LZ1A 5B40A 4H9QB 1ID3C 5GT3D 5CPIC 3MGQD 3AV2A 2Y2KA 3WKJB 5GXQB 2CV5D 4R8PD 1N1JB 3AYWD 5B1LA 5AVCB 3AZKC 3REKD 4XZQA 3REIA 3EPLA 1P3AD 5E5AC 3X1VD 2Y2PA 1KX5B 4WNNB 2YFWA 3AZEA 3AZHD 4LD9A 5AY8D 1P3MB 1M19A 3KWQA 3X1TB 4H9SA 5AVBA 3WA9B 4CSRA 1WWIA 3R45A 4J8XB 1M1AB 4JJNB 1BH8A 3WAAC 3MGRB 5B33B 3KXBA 1JFIB 4Z5TC 5BNVB 5AV8B 5DNMA 5JA4A 3WTPC 1TZYA 3UTBA 2BG1A 3AV1A 3MGPA 3RELD 3O62D 2FJ7D 3W97A 1P3IA 4H9NA 4KGCC 5AV6C 3REJB 1R4VA 4ZBJC 4CAYA 3UT9C 3TU4B 1KX3D 4H9QA 2ZM5A 4HGAC 4LD9C 5GXQA 1N1JA 5AVBC 5GT3C 3MGQC 2XD5A 5AVCA 5B0ZB 2CV5C 1HQ3D 3LELB 1P3KB 1TAFA 3WTPE 5CPJB 2NZDB 4QLCB 3MNNB 5CPKA 4E44A 4WU8B 1KX5A 5BO0B 3A6ND 3X1VC 3AN2B 1P3MA 5F99A 1TZYC 2Y2IA 4Z66B 2CWEA 3AZHC 4H9RB 4J8XA 2HIOD 5GT0B 1M18D 3B0DC 2BYKA 3MGRA 5AV9B 5B33A 3X1SB 4YS3D 2F2AC 3W99A 5CP6A 5BNVA 5AV8A 5GSUB 1BH9A 4ZUXB 1T3UA 3WKJC 2UWXA 4J8UB 1F66D 3NQJA 5GXQC 3LZ0D 5B31B 3EPHA 5CPID 2NQBD 5B40B 3MGSA 3AZIB 4QLCD 4DRAA 3W99C 3O62C 3TU4A 3AZKD 5B1LB 2Y2HA 1Z2CB 1KX3C 5AV5B 3X1TC 3W96B 2Y2MA 3WA9C 3AZLA 4J8VB 1AOIA 1M1AC 4JJNC 4E45A 4WV4B 3LELA 3P5JB 3FDDA 3AZEB 5B33C 3VH5A 3AZFD 3MVDB 2ZY5A 3KWQB 1P3OB 3MNNA 4CSRB 3KUYB 4WU8A 3WAAD 2Y2NA 3R45B 5BO0A 3AN2A 1BH8B 2Y2LA 4Z2MH 3LZ1D 4J8WB 1P3LA 4H9RA 3AV2D 4H9OB 5GT0A 5AV9A 3AZNB 2HIOC 1Q9CA 5B1LD 3AL0C 1BFMA 2PYOB 3REJC 3UTBB 3TU4C 3MGPB 4XZQD 3REID 5GSUA 4ZUXA 3UTAB 2IO5B 4WU9A 3UT9D 2L5AA 4J8UA 3W97B 4H9NB 3VH6W 1U35B 3AZJB 4KUDB 5B31A 4LD9D 4DQYB 5B0ZC 2AROA 3LZ0C 3AFAB 1P3BB 1M19D 3VH5W 3AZIA 5AVBD 2RVQD 2BYMA 1P3KC 2NQBC 5CPJC 2NZDC 4QLCC 3MNNC 2G5HC 5B1MB 2JCHA 4WU8C 3AZMB 5AV5A 3KXBD 4G92B 3W96A 4Z66C 5DNMD 1TAFB 4J8VA 5CPKB 5GT0C 1TZYD 3NQUB 1H3OB 3AV1D 5CHLB 5AV9C 3X1SC 4XUJB 5F99B 3MVDA 3C1CB 1P3GB 1P3OA 1KX4B 3KUYA 3AZFC 5GSUC 2W8SA 1P3ID 1P34A 2BYKB 5B32A 1S32B 4J8WA 3W99B 4H9OA 5B2IA 5KDMA 5CP6B 3WKJD 3VH5T 5GXQD 3LZ1C 5B40C 4AWLB 1BH9B 3AV2C 3AZNA 5AVCD 3NQJB 2PYOA 4G91B 5B1LC 3X1UA 3UTAA 3MGSB 2XD1A 4XZQC 5AV5C 3REIC 3W96C 1U35A 1KX5D 3AZJA 1ZLAB 4KUDA 3AFAA 4R8PA 4EO5C 1P3BA 1P3MD 3X1TD 1W2EA 3WA9D 3AZEC 5JRGB 4J8XD 1M19C 3KWQC 1M1AD 4H9SC 4JJND 3KFUG 5B1MA 2RVQC 3AZLB 3MGRD 3AZMA 3H0RC 5B33D 1AOIB 5B0YB 5C3IB 1B6WA 1EQZB 1P3FB 1HTAA 5AV8D 5B2JB 3KXBC 3NQUA 5DNMC 1H3OA 4WJ3C 4XUJA 1KX4A 3C1CA 1P3GA 3UTBC 3AV1C 3MGPC 1P3LB 3B6FB 3REJD 3TU4D 2HUEB 3W97C 1P3IC 2DF4C 3REHB 1S32A 5DNNB 5B24B 3B6GB 3RELA 1ID3B 3LJAB 4WU9B 5B0ZD 2FJ7A 3LELD 5B1MC 5BT1D 3W98B 5AVCC 1P3KD 2AROB 2J8PA 2Y2JA 5CPJD 2NZDD 3MNND 4G92C 2BYMB 4WU8D 4NE6A 1ZLAA 4X23A 5E5AB 3AN2D 4H9PB 5CPKC 1KX5C 4Z66D 2F8NB 1HQ3A 5JRGA 4YM6B 5F99C 1P3MC 1P3GC 2LY8A 4UUZB 5GT0D 1F1EA 4J8XC 5AV9D 3VH6A 5B0YA 3X1SD 3MGRC 1P3FA 5FUGB 1EQZA 5GSUD 3A6NA 5B2JA 4ZUXD 5CP6C 4Z5TB 4WU9D
chains in the Genus database with same CATH topology
4J8UD 5AV8C 4Z2MG 3C1BB 3WTPB 1P34B 3V9RB 5B31D 5B32B 4G91C 5B40D 3AZID 4YS3A 2Y2GA 3B6FA 5B2IB 5KDMB 3AZGB 1WWSA 3MGSC 4UPKA 4KGCB 3H0MC 5AV6B 3REHA 1ZLAC 5DNNA 5B24A 3B6GA 5AV5D 3X1UB 3W96D 1ID3A 3LJAA 1P3PB 4J8VD 5GT3B 3MGQB 3AZLC 3W98A 4KHAB 3AZED 2CV5B 4R8PB 1AOIC 3MVDD 3AYWB 3KWQD 1P3OD 3LELC 5BT1C 3KUYD 1P3FC 5E5AA 3REKB 5B2JC 1P34D 4H9PA 5BNXB 1P3AB 5B31G 4J8WD 3AN2C 3X1VB 2F8NA 4YM6A 5B2ID 4UUZA 3AZHB 5AY8B 1P3LC 3AZND 3B0DB 2PYOD 3UTBD 3WAAA 2HUEC 3MGPD 5FUGA 2F8NG 3REHC 5DNNC 3EPJA 3UTAD 4Z5TA 5B24C 3B6GC 2F8NH 3C1BA 3W97D 3LJAC 3WTPA 1U35D 4ZUXC 3AZJD 4KUDD 3V9RA 4WU9C 4J8UC 3AFAD 1P3BD 2YFVA 3VH6T 2Y2OA 5G49A 5B31C 3W98C 3AZGA 2VQRA 2AROC 3RELB 3AZIC 5B1MD 4KGCA 5AV6A 3EPKA 3AZMD 3O62B 3UT9A 2FJ7B 5B32G 1P3PA 3IP4C 1KX3B 4YM6C 5CPKD 5GT3A 2ZY3A 3MGQA 4X23B 4KHAA 2CV5A 4J8VC 4XUJD 5F99D 3AYWA 3C1CD 1P3GD 1KX4D 1HQ3B 3MVDC 1P3OC 3REKA 5BNXA 3A1IA 1ULYA 3KUYC 1P3AA 3C1BC 1S32D 3X1VA 1P34C 3W99D 2Y2QA 5CP6D 5B32C 3A6NB 3AZHA 5AY8A 4J8WC 5B2IC 3AZGC 2HIOB 3AZNC 3B0CW 1M18B 2PYOC 2ZY2A 1B67A 1A7WA 3MGSD 4YS3B 3X1UC 4DRBA 1P3PC 1ZLAD 3UTAC 2IO5C 4X23D 3WKJA 4NE5A 3EG5B 4WZSB 3AZJC 1U35C 4KUDC 1F66B 3LZ0B 3AFAC 4R8PC 1P3BC 5JRGD 3AYWC 5CPIB 2NQBB 3AZLD 3O62A 1AOID 3REKC 5B0YD 3H0LC 1P3AC 2G5IC 3AZMC 1P3FD 4WNNA 1EQZD 3AZKB 1KX3A 5B2JD 3X1TA 3WA9A 5AY8C 4NE3A 1M1AA 3F6TA 4JJNA 3B0CT 1P3LD 5BS7A 4XUJC 1KX4C 3B6FD 3C1CC 2RIQA 2FFFB 2JSSA 1JFIA 2DQNC 3AZFB 1PZRA 3REHD 5DNND 3WAAB 5B24D 3B6GD 1S32C 1ID3D 3LJAD 2ZY4A 2JE5A 3LZ1B 3RELC 1KU5A 4AWLC 3AV2B 2HIOA 3A1KA 3W98D 1M18A 3REJA 2AROD 2YFVB 2FJ7C 5G49B 5E5AD 4XZQB 3REIB 3UT9B 4ZBJB 5B0ZA 4X23C 3LZ0A 1F66A 4EO5B 2F8ND 4YM6D 5CPIA 2YFWB 4HGAB 1P3KA 2NQBA 4LD9B 1HQ3C 5BS7C 4NFTA 5JRGC 1M19B 5CPJA 2NZDA 4QLCA 5AVBB 4M6BA 3KSYA 5B0YC 3AZKA 5C3IC 3B0BA 4Z5TD 1EQZC 4Z66A 3A6NC 3C1BD 3WTPD 3KXBB 5DNMB 5B32D 5JA4B 3X1SA 1TZYB 3AZGD 1M18C 3AV1B 3AZFA 4YS3C 3B6FC 4KGCD 5AV6D 1P3IB 2F8NK 3X1UD 1F66C 4CAYB 1P3PD 3LZ1A 5B40A 4H9QB 1ID3C 5GT3D 5CPIC 3MGQD 3AV2A 2Y2KA 3WKJB 5GXQB 2CV5D 4R8PD 1N1JB 3AYWD 5B1LA 5AVCB 3AZKC 3REKD 4XZQA 3REIA 3EPLA 1P3AD 5E5AC 3X1VD 2Y2PA 1KX5B 4WNNB 2YFWA 3AZEA 3AZHD 4LD9A 5AY8D 1P3MB 1M19A 3KWQA 3X1TB 4H9SA 5AVBA 3WA9B 4CSRA 1WWIA 3R45A 4J8XB 1M1AB 4JJNB 1BH8A 3WAAC 3MGRB 5B33B 3KXBA 1JFIB 4Z5TC 5BNVB 5AV8B 5DNMA 5JA4A 3WTPC 1TZYA 3UTBA 2BG1A 3AV1A 3MGPA 3RELD 3O62D 2FJ7D 3W97A 1P3IA 4H9NA 4KGCC 5AV6C 3REJB 1R4VA 4ZBJC 4CAYA 3UT9C 3TU4B 1KX3D 4H9QA 2ZM5A 4HGAC 4LD9C 5GXQA 1N1JA 5AVBC 5GT3C 3MGQC 2XD5A 5AVCA 5B0ZB 2CV5C 1HQ3D 3LELB 1P3KB 1TAFA 3WTPE 5CPJB 2NZDB 4QLCB 3MNNB 5CPKA 4E44A 4WU8B 1KX5A 5BO0B 3A6ND 3X1VC 3AN2B 1P3MA 5F99A 1TZYC 2Y2IA 4Z66B 2CWEA 3AZHC 4H9RB 4J8XA 2HIOD 5GT0B 1M18D 3B0DC 2BYKA 3MGRA 5AV9B 5B33A 3X1SB 4YS3D 2F2AC 3W99A 5CP6A 5BNVA 5AV8A 5GSUB 1BH9A 4ZUXB 1T3UA 3WKJC 2UWXA 4J8UB 1F66D 3NQJA 5GXQC 3LZ0D 5B31B 3EPHA 5CPID 2NQBD 5B40B 3MGSA 3AZIB 4QLCD 4DRAA 3W99C 3O62C 3TU4A 3AZKD 5B1LB 2Y2HA 1Z2CB 1KX3C 5AV5B 3X1TC 3W96B 2Y2MA 3WA9C 3AZLA 4J8VB 1AOIA 1M1AC 4JJNC 4E45A 4WV4B 3LELA 3P5JB 3FDDA 3AZEB 5B33C 3VH5A 3AZFD 3MVDB 2ZY5A 3KWQB 1P3OB 3MNNA 4CSRB 3KUYB 4WU8A 3WAAD 2Y2NA 3R45B 5BO0A 3AN2A 1BH8B 2Y2LA 4Z2MH 3LZ1D 4J8WB 1P3LA 4H9RA 3AV2D 4H9OB 5GT0A 5AV9A 3AZNB 2HIOC 1Q9CA 5B1LD 3AL0C 1BFMA 2PYOB 3REJC 3UTBB 3TU4C 3MGPB 4XZQD 3REID 5GSUA 4ZUXA 3UTAB 2IO5B 4WU9A 3UT9D 2L5AA 4J8UA 3W97B 4H9NB 3VH6W 1U35B 3AZJB 4KUDB 5B31A 4LD9D 4DQYB 5B0ZC 2AROA 3LZ0C 3AFAB 1P3BB 1M19D 3VH5W 3AZIA 5AVBD 2RVQD 2BYMA 1P3KC 2NQBC 5CPJC 2NZDC 4QLCC 3MNNC 2G5HC 5B1MB 2JCHA 4WU8C 3AZMB 5AV5A 3KXBD 4G92B 3W96A 4Z66C 5DNMD 1TAFB 4J8VA 5CPKB 5GT0C 1TZYD 3NQUB 1H3OB 3AV1D 5CHLB 5AV9C 3X1SC 4XUJB 5F99B 3MVDA 3C1CB 1P3GB 1P3OA 1KX4B 3KUYA 3AZFC 5GSUC 2W8SA 1P3ID 1P34A 2BYKB 5B32A 1S32B 4J8WA 3W99B 4H9OA 5B2IA 5KDMA 5CP6B 3WKJD 3VH5T 5GXQD 3LZ1C 5B40C 4AWLB 1BH9B 3AV2C 3AZNA 5AVCD 3NQJB 2PYOA 4G91B 5B1LC 3X1UA 3UTAA 3MGSB 2XD1A 4XZQC 5AV5C 3REIC 3W96C 1U35A 1KX5D 3AZJA 1ZLAB 4KUDA 3AFAA 4R8PA 4EO5C 1P3BA 1P3MD 3X1TD 1W2EA 3WA9D 3AZEC 5JRGB 4J8XD 1M19C 3KWQC 1M1AD 4H9SC 4JJND 3KFUG 5B1MA 2RVQC 3AZLB 3MGRD 3AZMA 3H0RC 5B33D 1AOIB 5B0YB 5C3IB 1B6WA 1EQZB 1P3FB 1HTAA 5AV8D 5B2JB 3KXBC 3NQUA 5DNMC 1H3OA 4WJ3C 4XUJA 1KX4A 3C1CA 1P3GA 3UTBC 3AV1C 3MGPC 1P3LB 3B6FB 3REJD 3TU4D 2HUEB 3W97C 1P3IC 2DF4C 3REHB 1S32A 5DNNB 5B24B 3B6GB 3RELA 1ID3B 3LJAB 4WU9B 5B0ZD 2FJ7A 3LELD 5B1MC 5BT1D 3W98B 5AVCC 1P3KD 2AROB 2J8PA 2Y2JA 5CPJD 2NZDD 3MNND 4G92C 2BYMB 4WU8D 4NE6A 1ZLAA 4X23A 5E5AB 3AN2D 4H9PB 5CPKC 1KX5C 4Z66D 2F8NB 1HQ3A 5JRGA 4YM6B 5F99C 1P3MC 1P3GC 2LY8A 4UUZB 5GT0D 1F1EA 4J8XC 5AV9D 3VH6A 5B0YA 3X1SD 3MGRC 1P3FA 5FUGB 1EQZA 5GSUD 3A6NA 5B2JA 4ZUXD 5CP6C 4Z5TB 4WU9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8U D;  5AV8 C;  4Z2M G;  3C1B B;  3WTP B;  1P34 B;  3V9R B;  5B31 D;  5B32 B;  4G91 C;  5B40 D;  3AZI D;  4YS3 A;  3B6F A;  5B2I B;  5KDM B;  3AZG B;  1WWS A;  3MGS C;  4KGC B;  5AV6 B;  3REH A;  1ZLA C;  5DNN A;  5B24 A;  3B6G A;  5AV5 D;  3X1U B;  3W96 D;  1ID3 A;  3LJA A;  1P3P B;  4J8V D;  5GT3 B;  3MGQ B;  3AZL C;  3W98 A;  4KHA B;  3AZE D;  2CV5 B;  4R8P B;  1AOI C;  3MVD D;  3AYW B;  3KWQ D;  1P3O D;  3LEL C;  5BT1 C;  3KUY D;  1P3F C;  5E5A A;  3REK B;  5B2J C;  1P34 D;  4H9P A;  5BNX B;  1P3A B;  5B31 G;  4J8W D;  3AN2 C;  3X1V B;  2F8N A;  4YM6 A;  5B2I D;  4UUZ A;  3AZH B;  5AY8 B;  1P3L C;  3AZN D;  3B0D B;  2PYO D;  3UTB D;  3WAA A;  2HUE C;  3MGP D;  5FUG A;  2F8N G;  3REH C;  5DNN C;  3UTA D;  4Z5T A;  5B24 C;  3B6G C;  2F8N H;  3C1B A;  3W97 D;  3LJA C;  3WTP A;  1U35 D;  4ZUX C;  3AZJ D;  4KUD D;  3V9R A;  4WU9 C;  4J8U C;  3AFA D;  1P3B D;  2YFV A;  3VH6 T;  5G49 A;  5B31 C;  3W98 C;  3AZG A;  2ARO C;  3REL B;  3AZI C;  5B1M D;  4KGC A;  5AV6 A;  3AZM D;  3O62 B;  3UT9 A;  2FJ7 B;  5B32 G;  1P3P A;  1KX3 B;  4YM6 C;  5CPK D;  5GT3 A;  3MGQ A;  4X23 B;  4KHA A;  2CV5 A;  4J8V C;  4XUJ D;  5F99 D;  3AYW A;  3C1C D;  1P3G D;  1KX4 D;  1HQ3 B;  3MVD C;  1P3O C;  3REK A;  5BNX A;  3KUY C;  1ULY A;  1P3A A;  3C1B C;  1S32 D;  3X1V A;  1P34 C;  3W99 D;  5CP6 D;  5B32 C;  3A6N B;  3AZH A;  5AY8 A;  4J8W C;  5B2I C;  3AZG C;  2HIO B;  3AZN C;  3B0C W;  1M18 B;  2PYO C;  1B67 A;  1A7W A;  3MGS D;  4YS3 B;  3X1U C;  4DRB A;  1P3P C;  1ZLA D;  3UTA C;  2IO5 C;  4X23 D;  3WKJ A;  4NE5 A;  4WZS B;  1U35 C;  3AZJ C;  4KUD C;  1F66 B;  3LZ0 B;  3AFA C;  4R8P C;  1P3B C;  5JRG D;  3AYW C;  5CPI B;  2NQB B;  3AZL D;  3O62 A;  1AOI D;  3REK C;  5B0Y D;  1P3A C;  1EQZ D;  3AZM C;  1P3F D;  4WNN A;  3AZK B;  1KX3 A;  5B2J D;  3X1T A;  3WA9 A;  5AY8 C;  4NE3 A;  1M1A A;  4JJN A;  3B0C T;  1P3L D;  5BS7 A;  4XUJ C;  1KX4 C;  3B6F D;  3C1C C;  2JSS A;  1JFI A;  3AZF B;  3REH D;  5DNN D;  3WAA B;  5B24 D;  3B6G D;  1S32 C;  1ID3 D;  3LJA D;  3LZ1 B;  3REL C;  1KU5 A;  4AWL C;  3AV2 B;  2HIO A;  3W98 D;  1M18 A;  3REJ A;  2ARO D;  2YFV B;  2FJ7 C;  5G49 B;  5E5A D;  4XZQ B;  3REI B;  3UT9 B;  4ZBJ B;  5B0Z A;  4X23 C;  3LZ0 A;  1F66 A;  4EO5 B;  2F8N D;  4YM6 D;  5CPI A;  2YFW B;  4HGA B;  1P3K A;  2NQB A;  4LD9 B;  1HQ3 C;  5BS7 C;  4NFT A;  5JRG C;  1M19 B;  5CPJ A;  2NZD A;  4QLC A;  5AVB B;  4M6B A;  3KSY A;  5B0Y C;  3AZK A;  5C3I C;  3B0B A;  4Z5T D;  1EQZ C;  4Z66 A;  3A6N C;  3C1B D;  3WTP D;  3KXB B;  5DNM B;  5B32 D;  5JA4 B;  3X1S A;  1TZY B;  3AZG D;  1M18 C;  3AV1 B;  3AZF A;  4YS3 C;  3B6F C;  4KGC D;  5AV6 D;  1P3I B;  2F8N K;  3X1U D;  1F66 C;  4CAY B;  1P3P D;  3LZ1 A;  5B40 A;  4H9Q B;  1ID3 C;  5GT3 D;  5CPI C;  3MGQ D;  3AV2 A;  3WKJ B;  5GXQ B;  2CV5 D;  4R8P D;  1N1J B;  3AYW D;  5B1L A;  5AVC B;  3AZK C;  3REK D;  4XZQ A;  3REI A;  1P3A D;  5E5A C;  3X1V D;  1KX5 B;  4WNN B;  2YFW A;  3AZE A;  3AZH D;  4LD9 A;  5AY8 D;  1P3M B;  1M19 A;  3KWQ A;  3X1T B;  4H9S A;  5AVB A;  3WA9 B;  4CSR A;  1WWI A;  3R45 A;  4J8X B;  1M1A B;  4JJN B;  1BH8 A;  3WAA C;  3MGR B;  5B33 B;  3KXB A;  1JFI B;  4Z5T C;  5BNV B;  5AV8 B;  5DNM A;  5JA4 A;  3WTP C;  1TZY A;  3UTB A;  3AV1 A;  3MGP A;  3REL D;  3O62 D;  2FJ7 D;  3W97 A;  1P3I A;  4H9N A;  4KGC C;  5AV6 C;  3REJ B;  1R4V A;  4ZBJ C;  4CAY A;  3UT9 C;  3TU4 B;  1KX3 D;  4H9Q A;  4LD9 C;  4HGA C;  5GXQ A;  1N1J A;  5AVB C;  5GT3 C;  3MGQ C;  5AVC A;  5B0Z B;  2CV5 C;  1HQ3 D;  3LEL B;  1P3K B;  1TAF A;  3WTP E;  5CPJ B;  2NZD B;  4QLC B;  3MNN B;  5CPK A;  4E44 A;  4WU8 B;  1KX5 A;  5BO0 B;  3A6N D;  3X1V C;  3AN2 B;  1P3M A;  5F99 A;  1TZY C;  4Z66 B;  2CWE A;  3AZH C;  4H9R B;  4J8X A;  2HIO D;  5GT0 B;  1M18 D;  3B0D C;  2BYK A;  3MGR A;  5AV9 B;  5B33 A;  3X1S B;  4YS3 D;  3W99 A;  5CP6 A;  5BNV A;  5AV8 A;  5GSU B;  1BH9 A;  4ZUX B;  3WKJ C;  4J8U B;  1F66 D;  3NQJ A;  5GXQ C;  3LZ0 D;  5B31 B;  5CPI D;  2NQB D;  5B40 B;  3MGS A;  3AZI B;  4QLC D;  4DRA A;  3W99 C;  3O62 C;  3TU4 A;  3AZK D;  5B1L B;  1KX3 C;  5AV5 B;  3X1T C;  3W96 B;  3WA9 C;  3AZL A;  4J8V B;  1AOI A;  1M1A C;  4JJN C;  4E45 A;  4WV4 B;  3LEL A;  3AZE B;  5B33 C;  3VH5 A;  3AZF D;  3MVD B;  3KWQ B;  1P3O B;  3MNN A;  4CSR B;  3KUY B;  4WU8 A;  3WAA D;  3R45 B;  5BO0 A;  3AN2 A;  1BH8 B;  4Z2M H;  3LZ1 D;  4J8W B;  1P3L A;  4H9R A;  3AV2 D;  4H9O B;  5GT0 A;  5AV9 A;  3AZN B;  2HIO C;  1Q9C A;  5B1L D;  1BFM A;  2PYO B;  3REJ C;  3UTB B;  3TU4 C;  3MGP B;  4XZQ D;  3REI D;  5GSU A;  4ZUX A;  3UTA B;  2IO5 B;  4WU9 A;  3UT9 D;  2L5A A;  4J8U A;  3W97 B;  4H9N B;  3VH6 W;  1U35 B;  3AZJ B;  4KUD B;  5B31 A;  4LD9 D;  5B0Z C;  2ARO A;  3LZ0 C;  3AFA B;  1P3B B;  1M19 D;  3VH5 W;  3AZI A;  5AVB D;  2RVQ D;  2BYM A;  1P3K C;  2NQB C;  5CPJ C;  2NZD C;  4QLC C;  3MNN C;  5B1M B;  4WU8 C;  3AZM B;  5AV5 A;  3KXB D;  4G92 B;  3W96 A;  4Z66 C;  5DNM D;  1TAF B;  4J8V A;  5CPK B;  5GT0 C;  1TZY D;  3NQU B;  1H3O B;  3AV1 D;  5CHL B;  5AV9 C;  3X1S C;  4XUJ B;  5F99 B;  3MVD A;  3C1C B;  1P3G B;  1P3O A;  1KX4 B;  3KUY A;  3AZF C;  5GSU C;  1P3I D;  1P34 A;  2BYK B;  5B32 A;  1S32 B;  4J8W A;  3W99 B;  4H9O A;  5B2I A;  5KDM A;  5CP6 B;  3WKJ D;  3VH5 T;  5GXQ D;  3LZ1 C;  5B40 C;  4AWL B;  1BH9 B;  3AV2 C;  3AZN A;  5AVC D;  3NQJ B;  2PYO A;  4G91 B;  5B1L C;  3X1U A;  3UTA A;  3MGS B;  4XZQ C;  5AV5 C;  3REI C;  3W96 C;  1U35 A;  1KX5 D;  3AZJ A;  1ZLA B;  4KUD A;  3AFA A;  4R8P A;  4EO5 C;  1P3B A;  1P3M D;  3X1T D;  3WA9 D;  3AZE C;  5JRG B;  4J8X D;  1M19 C;  3KWQ C;  1M1A D;  4H9S C;  4JJN D;  5B1M A;  2RVQ C;  3AZL B;  3MGR D;  3AZM A;  5B33 D;  1AOI B;  5B0Y B;  5C3I B;  1B6W A;  1EQZ B;  1P3F B;  1HTA A;  5AV8 D;  5B2J B;  3KXB C;  3NQU A;  5DNM C;  1H3O A;  4XUJ A;  1KX4 A;  3C1C A;  1P3G A;  3UTB C;  3AV1 C;  3MGP C;  1P3L B;  3B6F B;  3REJ D;  3TU4 D;  2HUE B;  3W97 C;  1P3I C;  1S32 A;  3REH B;  5DNN B;  5B24 B;  3B6G B;  3REL A;  1ID3 B;  3LJA B;  4WU9 B;  5B0Z D;  2FJ7 A;  3LEL D;  5B1M C;  5BT1 D;  3W98 B;  5AVC C;  1P3K D;  2ARO B;  5CPJ D;  2NZD D;  3MNN D;  4G92 C;  2BYM B;  4WU8 D;  4NE6 A;  1ZLA A;  4X23 A;  5E5A B;  3AN2 D;  4H9P B;  5CPK C;  1KX5 C;  4Z66 D;  2F8N B;  1HQ3 A;  5JRG A;  4YM6 B;  5F99 C;  1P3M C;  1P3G C;  2LY8 A;  4UUZ B;  5GT0 D;  1F1E A;  4J8X C;  5AV9 D;  3VH6 A;  5B0Y A;  3X1S D;  3MGR C;  1P3F A;  5FUG B;  1EQZ A;  5GSU D;  3A6N A;  5B2J A;  4ZUX D;  5CP6 C;  4Z5T B;  4WU9 D; 
#chains in the Genus database with same CATH topology
 4J8U D;  5AV8 C;  4Z2M G;  3C1B B;  3WTP B;  1P34 B;  3V9R B;  5B31 D;  5B32 B;  4G91 C;  5B40 D;  3AZI D;  4YS3 A;  2Y2G A;  3B6F A;  5B2I B;  5KDM B;  3AZG B;  1WWS A;  3MGS C;  4UPK A;  4KGC B;  3H0M C;  5AV6 B;  3REH A;  1ZLA C;  5DNN A;  5B24 A;  3B6G A;  5AV5 D;  3X1U B;  3W96 D;  1ID3 A;  3LJA A;  1P3P B;  4J8V D;  5GT3 B;  3MGQ B;  3AZL C;  3W98 A;  4KHA B;  3AZE D;  2CV5 B;  4R8P B;  1AOI C;  3MVD D;  3AYW B;  3KWQ D;  1P3O D;  3LEL C;  5BT1 C;  3KUY D;  1P3F C;  5E5A A;  3REK B;  5B2J C;  1P34 D;  4H9P A;  5BNX B;  1P3A B;  5B31 G;  4J8W D;  3AN2 C;  3X1V B;  2F8N A;  4YM6 A;  5B2I D;  4UUZ A;  3AZH B;  5AY8 B;  1P3L C;  3AZN D;  3B0D B;  2PYO D;  3UTB D;  3WAA A;  2HUE C;  3MGP D;  5FUG A;  2F8N G;  3REH C;  5DNN C;  3EPJ A;  3UTA D;  4Z5T A;  5B24 C;  3B6G C;  2F8N H;  3C1B A;  3W97 D;  3LJA C;  3WTP A;  1U35 D;  4ZUX C;  3AZJ D;  4KUD D;  3V9R A;  4WU9 C;  4J8U C;  3AFA D;  1P3B D;  2YFV A;  3VH6 T;  2Y2O A;  5G49 A;  5B31 C;  3W98 C;  3AZG A;  2VQR A;  2ARO C;  3REL B;  3AZI C;  5B1M D;  4KGC A;  5AV6 A;  3EPK A;  3AZM D;  3O62 B;  3UT9 A;  2FJ7 B;  5B32 G;  1P3P A;  3IP4 C;  1KX3 B;  4YM6 C;  5CPK D;  5GT3 A;  2ZY3 A;  3MGQ A;  4X23 B;  4KHA A;  2CV5 A;  4J8V C;  4XUJ D;  5F99 D;  3AYW A;  3C1C D;  1P3G D;  1KX4 D;  1HQ3 B;  3MVD C;  1P3O C;  3REK A;  5BNX A;  3A1I A;  1ULY A;  3KUY C;  1P3A A;  3C1B C;  1S32 D;  3X1V A;  1P34 C;  3W99 D;  2Y2Q A;  5CP6 D;  5B32 C;  3A6N B;  3AZH A;  5AY8 A;  4J8W C;  5B2I C;  3AZG C;  2HIO B;  3AZN C;  3B0C W;  1M18 B;  2PYO C;  2ZY2 A;  1B67 A;  1A7W A;  3MGS D;  4YS3 B;  3X1U C;  4DRB A;  1P3P C;  1ZLA D;  3UTA C;  2IO5 C;  4X23 D;  3WKJ A;  4NE5 A;  3EG5 B;  4WZS B;  3AZJ C;  1U35 C;  4KUD C;  1F66 B;  3LZ0 B;  3AFA C;  4R8P C;  1P3B C;  5JRG D;  3AYW C;  5CPI B;  2NQB B;  3AZL D;  3O62 A;  1AOI D;  3REK C;  5B0Y D;  3H0L C;  1P3A C;  2G5I C;  3AZM C;  1P3F D;  4WNN A;  1EQZ D;  3AZK B;  1KX3 A;  5B2J D;  3X1T A;  3WA9 A;  5AY8 C;  4NE3 A;  1M1A A;  3F6T A;  4JJN A;  3B0C T;  1P3L D;  5BS7 A;  4XUJ C;  1KX4 C;  3B6F D;  3C1C C;  2RIQ A;  2FFF B;  2JSS A;  1JFI A;  2DQN C;  3AZF B;  1PZR A;  3REH D;  5DNN D;  3WAA B;  5B24 D;  3B6G D;  1S32 C;  1ID3 D;  3LJA D;  2ZY4 A;  2JE5 A;  3LZ1 B;  3REL C;  1KU5 A;  4AWL C;  3AV2 B;  2HIO A;  3A1K A;  3W98 D;  1M18 A;  3REJ A;  2ARO D;  2YFV B;  2FJ7 C;  5G49 B;  5E5A D;  4XZQ B;  3REI B;  3UT9 B;  4ZBJ B;  5B0Z A;  4X23 C;  3LZ0 A;  1F66 A;  4EO5 B;  2F8N D;  4YM6 D;  5CPI A;  2YFW B;  4HGA B;  1P3K A;  2NQB A;  4LD9 B;  1HQ3 C;  5BS7 C;  4NFT A;  5JRG C;  1M19 B;  5CPJ A;  2NZD A;  4QLC A;  5AVB B;  4M6B A;  3KSY A;  5B0Y C;  3AZK A;  5C3I C;  3B0B A;  4Z5T D;  1EQZ C;  4Z66 A;  3A6N C;  3C1B D;  3WTP D;  3KXB B;  5DNM B;  5B32 D;  5JA4 B;  3X1S A;  1TZY B;  3AZG D;  1M18 C;  3AV1 B;  3AZF A;  4YS3 C;  3B6F C;  4KGC D;  5AV6 D;  1P3I B;  2F8N K;  3X1U D;  1F66 C;  4CAY B;  1P3P D;  3LZ1 A;  5B40 A;  4H9Q B;  1ID3 C;  5GT3 D;  5CPI C;  3MGQ D;  3AV2 A;  2Y2K A;  3WKJ B;  5GXQ B;  2CV5 D;  4R8P D;  1N1J B;  3AYW D;  5B1L A;  5AVC B;  3AZK C;  3REK D;  4XZQ A;  3REI A;  3EPL A;  1P3A D;  5E5A C;  3X1V D;  2Y2P A;  1KX5 B;  4WNN B;  2YFW A;  3AZE A;  3AZH D;  4LD9 A;  5AY8 D;  1P3M B;  1M19 A;  3KWQ A;  3X1T B;  4H9S A;  5AVB A;  3WA9 B;  4CSR A;  1WWI A;  3R45 A;  4J8X B;  1M1A B;  4JJN B;  1BH8 A;  3WAA C;  3MGR B;  5B33 B;  3KXB A;  1JFI B;  4Z5T C;  5BNV B;  5AV8 B;  5DNM A;  5JA4 A;  3WTP C;  1TZY A;  3UTB A;  2BG1 A;  3AV1 A;  3MGP A;  3REL D;  3O62 D;  2FJ7 D;  3W97 A;  1P3I A;  4H9N A;  4KGC C;  5AV6 C;  3REJ B;  1R4V A;  4ZBJ C;  4CAY A;  3UT9 C;  3TU4 B;  1KX3 D;  4H9Q A;  2ZM5 A;  4HGA C;  4LD9 C;  5GXQ A;  1N1J A;  5AVB C;  5GT3 C;  3MGQ C;  2XD5 A;  5AVC A;  5B0Z B;  2CV5 C;  1HQ3 D;  3LEL B;  1P3K B;  1TAF A;  3WTP E;  5CPJ B;  2NZD B;  4QLC B;  3MNN B;  5CPK A;  4E44 A;  4WU8 B;  1KX5 A;  5BO0 B;  3A6N D;  3X1V C;  3AN2 B;  1P3M A;  5F99 A;  1TZY C;  2Y2I A;  4Z66 B;  2CWE A;  3AZH C;  4H9R B;  4J8X A;  2HIO D;  5GT0 B;  1M18 D;  3B0D C;  2BYK A;  3MGR A;  5AV9 B;  5B33 A;  3X1S B;  4YS3 D;  2F2A C;  3W99 A;  5CP6 A;  5BNV A;  5AV8 A;  5GSU B;  1BH9 A;  4ZUX B;  1T3U A;  3WKJ C;  2UWX A;  4J8U B;  1F66 D;  3NQJ A;  5GXQ C;  3LZ0 D;  5B31 B;  3EPH A;  5CPI D;  2NQB D;  5B40 B;  3MGS A;  3AZI B;  4QLC D;  4DRA A;  3W99 C;  3O62 C;  3TU4 A;  3AZK D;  5B1L B;  2Y2H A;  1Z2C B;  1KX3 C;  5AV5 B;  3X1T C;  3W96 B;  2Y2M A;  3WA9 C;  3AZL A;  4J8V B;  1AOI A;  1M1A C;  4JJN C;  4E45 A;  4WV4 B;  3LEL A;  3P5J B;  3FDD A;  3AZE B;  5B33 C;  3VH5 A;  3AZF D;  3MVD B;  2ZY5 A;  3KWQ B;  1P3O B;  3MNN A;  4CSR B;  3KUY B;  4WU8 A;  3WAA D;  2Y2N A;  3R45 B;  5BO0 A;  3AN2 A;  1BH8 B;  2Y2L A;  4Z2M H;  3LZ1 D;  4J8W B;  1P3L A;  4H9R A;  3AV2 D;  4H9O B;  5GT0 A;  5AV9 A;  3AZN B;  2HIO C;  1Q9C A;  5B1L D;  3AL0 C;  1BFM A;  2PYO B;  3REJ C;  3UTB B;  3TU4 C;  3MGP B;  4XZQ D;  3REI D;  5GSU A;  4ZUX A;  3UTA B;  2IO5 B;  4WU9 A;  3UT9 D;  2L5A A;  4J8U A;  3W97 B;  4H9N B;  3VH6 W;  1U35 B;  3AZJ B;  4KUD B;  5B31 A;  4LD9 D;  4DQY B;  5B0Z C;  2ARO A;  3LZ0 C;  3AFA B;  1P3B B;  1M19 D;  3VH5 W;  3AZI A;  5AVB D;  2RVQ D;  2BYM A;  1P3K C;  2NQB C;  5CPJ C;  2NZD C;  4QLC C;  3MNN C;  2G5H C;  5B1M B;  2JCH A;  4WU8 C;  3AZM B;  5AV5 A;  3KXB D;  4G92 B;  3W96 A;  4Z66 C;  5DNM D;  1TAF B;  4J8V A;  5CPK B;  5GT0 C;  1TZY D;  3NQU B;  1H3O B;  3AV1 D;  5CHL B;  5AV9 C;  3X1S C;  4XUJ B;  5F99 B;  3MVD A;  3C1C B;  1P3G B;  1P3O A;  1KX4 B;  3KUY A;  3AZF C;  5GSU C;  2W8S A;  1P3I D;  1P34 A;  2BYK B;  5B32 A;  1S32 B;  4J8W A;  3W99 B;  4H9O A;  5B2I A;  5KDM A;  5CP6 B;  3WKJ D;  3VH5 T;  5GXQ D;  3LZ1 C;  5B40 C;  4AWL B;  1BH9 B;  3AV2 C;  3AZN A;  5AVC D;  3NQJ B;  2PYO A;  4G91 B;  5B1L C;  3X1U A;  3UTA A;  3MGS B;  2XD1 A;  4XZQ C;  5AV5 C;  3REI C;  3W96 C;  1U35 A;  1KX5 D;  3AZJ A;  1ZLA B;  4KUD A;  3AFA A;  4R8P A;  4EO5 C;  1P3B A;  1P3M D;  3X1T D;  1W2E A;  3WA9 D;  3AZE C;  5JRG B;  4J8X D;  1M19 C;  3KWQ C;  1M1A D;  4H9S C;  4JJN D;  3KFU G;  5B1M A;  2RVQ C;  3AZL B;  3MGR D;  3AZM A;  3H0R C;  5B33 D;  1AOI B;  5B0Y B;  5C3I B;  1B6W A;  1EQZ B;  1P3F B;  1HTA A;  5AV8 D;  5B2J B;  3KXB C;  3NQU A;  5DNM C;  1H3O A;  4WJ3 C;  4XUJ A;  1KX4 A;  3C1C A;  1P3G A;  3UTB C;  3AV1 C;  3MGP C;  1P3L B;  3B6F B;  3REJ D;  3TU4 D;  2HUE B;  3W97 C;  1P3I C;  2DF4 C;  3REH B;  1S32 A;  5DNN B;  5B24 B;  3B6G B;  3REL A;  1ID3 B;  3LJA B;  4WU9 B;  5B0Z D;  2FJ7 A;  3LEL D;  5B1M C;  5BT1 D;  3W98 B;  5AVC C;  1P3K D;  2ARO B;  2J8P A;  2Y2J A;  5CPJ D;  2NZD D;  3MNN D;  4G92 C;  2BYM B;  4WU8 D;  4NE6 A;  1ZLA A;  4X23 A;  5E5A B;  3AN2 D;  4H9P B;  5CPK C;  1KX5 C;  4Z66 D;  2F8N B;  1HQ3 A;  5JRG A;  4YM6 B;  5F99 C;  1P3M C;  1P3G C;  2LY8 A;  4UUZ B;  5GT0 D;  1F1E A;  4J8X C;  5AV9 D;  3VH6 A;  5B0Y A;  3X1S D;  3MGR C;  1P3F A;  5FUG B;  1EQZ A;  5GSU D;  3A6N A;  5B2J A;  4ZUX D;  5CP6 C;  4Z5T B;  4WU9 D; 
#chains in the Genus database with same CATH homology
 4J8U D;  5AV8 C;  4Z2M G;  3C1B B;  3WTP B;  1P34 B;  3V9R B;  5B31 D;  5B32 B;  4G91 C;  5B40 D;  3AZI D;  4YS3 A;  2Y2G A;  3B6F A;  5B2I B;  5KDM B;  3AZG B;  1WWS A;  3MGS C;  4UPK A;  4KGC B;  3H0M C;  5AV6 B;  3REH A;  1ZLA C;  5DNN A;  5B24 A;  3B6G A;  5AV5 D;  3X1U B;  3W96 D;  1ID3 A;  3LJA A;  1P3P B;  4J8V D;  5GT3 B;  3MGQ B;  3AZL C;  3W98 A;  4KHA B;  3AZE D;  2CV5 B;  4R8P B;  1AOI C;  3MVD D;  3AYW B;  3KWQ D;  1P3O D;  3LEL C;  5BT1 C;  3KUY D;  1P3F C;  5E5A A;  3REK B;  5B2J C;  1P34 D;  4H9P A;  5BNX B;  1P3A B;  5B31 G;  4J8W D;  3AN2 C;  3X1V B;  2F8N A;  4YM6 A;  5B2I D;  4UUZ A;  3AZH B;  5AY8 B;  1P3L C;  3AZN D;  3B0D B;  2PYO D;  3UTB D;  3WAA A;  2HUE C;  3MGP D;  5FUG A;  2F8N G;  3REH C;  5DNN C;  3EPJ A;  3UTA D;  4Z5T A;  5B24 C;  3B6G C;  2F8N H;  3C1B A;  3W97 D;  3LJA C;  3WTP A;  1U35 D;  4ZUX C;  3AZJ D;  4KUD D;  3V9R A;  4WU9 C;  4J8U C;  3AFA D;  1P3B D;  2YFV A;  3VH6 T;  2Y2O A;  5G49 A;  5B31 C;  3W98 C;  3AZG A;  2VQR A;  2ARO C;  3REL B;  3AZI C;  5B1M D;  4KGC A;  5AV6 A;  3EPK A;  3AZM D;  3O62 B;  3UT9 A;  2FJ7 B;  5B32 G;  1P3P A;  3IP4 C;  1KX3 B;  4YM6 C;  5CPK D;  5GT3 A;  2ZY3 A;  3MGQ A;  4X23 B;  4KHA A;  2CV5 A;  4J8V C;  4XUJ D;  5F99 D;  3AYW A;  3C1C D;  1P3G D;  1KX4 D;  1HQ3 B;  3MVD C;  1P3O C;  3REK A;  5BNX A;  3A1I A;  1ULY A;  3KUY C;  1P3A A;  3C1B C;  1S32 D;  3X1V A;  1P34 C;  3W99 D;  2Y2Q A;  5CP6 D;  5B32 C;  3A6N B;  3AZH A;  5AY8 A;  4J8W C;  5B2I C;  3AZG C;  2HIO B;  3AZN C;  3B0C W;  1M18 B;  2PYO C;  2ZY2 A;  1B67 A;  1A7W A;  3MGS D;  4YS3 B;  3X1U C;  4DRB A;  1P3P C;  1ZLA D;  3UTA C;  2IO5 C;  4X23 D;  3WKJ A;  4NE5 A;  3EG5 B;  4WZS B;  3AZJ C;  1U35 C;  4KUD C;  1F66 B;  3LZ0 B;  3AFA C;  4R8P C;  1P3B C;  5JRG D;  3AYW C;  5CPI B;  2NQB B;  3AZL D;  3O62 A;  1AOI D;  3REK C;  5B0Y D;  3H0L C;  1P3A C;  2G5I C;  3AZM C;  1P3F D;  4WNN A;  1EQZ D;  3AZK B;  1KX3 A;  5B2J D;  3X1T A;  3WA9 A;  5AY8 C;  4NE3 A;  1M1A A;  3F6T A;  4JJN A;  3B0C T;  1P3L D;  5BS7 A;  4XUJ C;  1KX4 C;  3B6F D;  3C1C C;  2RIQ A;  2FFF B;  2JSS A;  1JFI A;  2DQN C;  3AZF B;  1PZR A;  3REH D;  5DNN D;  3WAA B;  5B24 D;  3B6G D;  1S32 C;  1ID3 D;  3LJA D;  2ZY4 A;  2JE5 A;  3LZ1 B;  3REL C;  1KU5 A;  4AWL C;  3AV2 B;  2HIO A;  3A1K A;  3W98 D;  1M18 A;  3REJ A;  2ARO D;  2YFV B;  2FJ7 C;  5G49 B;  5E5A D;  4XZQ B;  3REI B;  3UT9 B;  4ZBJ B;  5B0Z A;  4X23 C;  3LZ0 A;  1F66 A;  4EO5 B;  2F8N D;  4YM6 D;  5CPI A;  2YFW B;  4HGA B;  1P3K A;  2NQB A;  4LD9 B;  1HQ3 C;  5BS7 C;  4NFT A;  5JRG C;  1M19 B;  5CPJ A;  2NZD A;  4QLC A;  5AVB B;  4M6B A;  3KSY A;  5B0Y C;  3AZK A;  5C3I C;  3B0B A;  4Z5T D;  1EQZ C;  4Z66 A;  3A6N C;  3C1B D;  3WTP D;  3KXB B;  5DNM B;  5B32 D;  5JA4 B;  3X1S A;  1TZY B;  3AZG D;  1M18 C;  3AV1 B;  3AZF A;  4YS3 C;  3B6F C;  4KGC D;  5AV6 D;  1P3I B;  2F8N K;  3X1U D;  1F66 C;  4CAY B;  1P3P D;  3LZ1 A;  5B40 A;  4H9Q B;  1ID3 C;  5GT3 D;  5CPI C;  3MGQ D;  3AV2 A;  2Y2K A;  3WKJ B;  5GXQ B;  2CV5 D;  4R8P D;  1N1J B;  3AYW D;  5B1L A;  5AVC B;  3AZK C;  3REK D;  4XZQ A;  3REI A;  3EPL A;  1P3A D;  5E5A C;  3X1V D;  2Y2P A;  1KX5 B;  4WNN B;  2YFW A;  3AZE A;  3AZH D;  4LD9 A;  5AY8 D;  1P3M B;  1M19 A;  3KWQ A;  3X1T B;  4H9S A;  5AVB A;  3WA9 B;  4CSR A;  1WWI A;  3R45 A;  4J8X B;  1M1A B;  4JJN B;  1BH8 A;  3WAA C;  3MGR B;  5B33 B;  3KXB A;  1JFI B;  4Z5T C;  5BNV B;  5AV8 B;  5DNM A;  5JA4 A;  3WTP C;  1TZY A;  3UTB A;  2BG1 A;  3AV1 A;  3MGP A;  3REL D;  3O62 D;  2FJ7 D;  3W97 A;  1P3I A;  4H9N A;  4KGC C;  5AV6 C;  3REJ B;  1R4V A;  4ZBJ C;  4CAY A;  3UT9 C;  3TU4 B;  1KX3 D;  4H9Q A;  2ZM5 A;  4HGA C;  4LD9 C;  5GXQ A;  1N1J A;  5AVB C;  5GT3 C;  3MGQ C;  2XD5 A;  5AVC A;  5B0Z B;  2CV5 C;  1HQ3 D;  3LEL B;  1P3K B;  1TAF A;  3WTP E;  5CPJ B;  2NZD B;  4QLC B;  3MNN B;  5CPK A;  4E44 A;  4WU8 B;  1KX5 A;  5BO0 B;  3A6N D;  3X1V C;  3AN2 B;  1P3M A;  5F99 A;  1TZY C;  2Y2I A;  4Z66 B;  2CWE A;  3AZH C;  4H9R B;  4J8X A;  2HIO D;  5GT0 B;  1M18 D;  3B0D C;  2BYK A;  3MGR A;  5AV9 B;  5B33 A;  3X1S B;  4YS3 D;  2F2A C;  3W99 A;  5CP6 A;  5BNV A;  5AV8 A;  5GSU B;  1BH9 A;  4ZUX B;  1T3U A;  3WKJ C;  2UWX A;  4J8U B;  1F66 D;  3NQJ A;  5GXQ C;  3LZ0 D;  5B31 B;  3EPH A;  5CPI D;  2NQB D;  5B40 B;  3MGS A;  3AZI B;  4QLC D;  4DRA A;  3W99 C;  3O62 C;  3TU4 A;  3AZK D;  5B1L B;  2Y2H A;  1Z2C B;  1KX3 C;  5AV5 B;  3X1T C;  3W96 B;  2Y2M A;  3WA9 C;  3AZL A;  4J8V B;  1AOI A;  1M1A C;  4JJN C;  4E45 A;  4WV4 B;  3LEL A;  3P5J B;  3FDD A;  3AZE B;  5B33 C;  3VH5 A;  3AZF D;  3MVD B;  2ZY5 A;  3KWQ B;  1P3O B;  3MNN A;  4CSR B;  3KUY B;  4WU8 A;  3WAA D;  2Y2N A;  3R45 B;  5BO0 A;  3AN2 A;  1BH8 B;  2Y2L A;  4Z2M H;  3LZ1 D;  4J8W B;  1P3L A;  4H9R A;  3AV2 D;  4H9O B;  5GT0 A;  5AV9 A;  3AZN B;  2HIO C;  1Q9C A;  5B1L D;  3AL0 C;  1BFM A;  2PYO B;  3REJ C;  3UTB B;  3TU4 C;  3MGP B;  4XZQ D;  3REI D;  5GSU A;  4ZUX A;  3UTA B;  2IO5 B;  4WU9 A;  3UT9 D;  2L5A A;  4J8U A;  3W97 B;  4H9N B;  3VH6 W;  1U35 B;  3AZJ B;  4KUD B;  5B31 A;  4LD9 D;  4DQY B;  5B0Z C;  2ARO A;  3LZ0 C;  3AFA B;  1P3B B;  1M19 D;  3VH5 W;  3AZI A;  5AVB D;  2RVQ D;  2BYM A;  1P3K C;  2NQB C;  5CPJ C;  2NZD C;  4QLC C;  3MNN C;  2G5H C;  5B1M B;  2JCH A;  4WU8 C;  3AZM B;  5AV5 A;  3KXB D;  4G92 B;  3W96 A;  4Z66 C;  5DNM D;  1TAF B;  4J8V A;  5CPK B;  5GT0 C;  1TZY D;  3NQU B;  1H3O B;  3AV1 D;  5CHL B;  5AV9 C;  3X1S C;  4XUJ B;  5F99 B;  3MVD A;  3C1C B;  1P3G B;  1P3O A;  1KX4 B;  3KUY A;  3AZF C;  5GSU C;  2W8S A;  1P3I D;  1P34 A;  2BYK B;  5B32 A;  1S32 B;  4J8W A;  3W99 B;  4H9O A;  5B2I A;  5KDM A;  5CP6 B;  3WKJ D;  3VH5 T;  5GXQ D;  3LZ1 C;  5B40 C;  4AWL B;  1BH9 B;  3AV2 C;  3AZN A;  5AVC D;  3NQJ B;  2PYO A;  4G91 B;  5B1L C;  3X1U A;  3UTA A;  3MGS B;  2XD1 A;  4XZQ C;  5AV5 C;  3REI C;  3W96 C;  1U35 A;  1KX5 D;  3AZJ A;  1ZLA B;  4KUD A;  3AFA A;  4R8P A;  4EO5 C;  1P3B A;  1P3M D;  3X1T D;  1W2E A;  3WA9 D;  3AZE C;  5JRG B;  4J8X D;  1M19 C;  3KWQ C;  1M1A D;  4H9S C;  4JJN D;  3KFU G;  5B1M A;  2RVQ C;  3AZL B;  3MGR D;  3AZM A;  3H0R C;  5B33 D;  1AOI B;  5B0Y B;  5C3I B;  1B6W A;  1EQZ B;  1P3F B;  1HTA A;  5AV8 D;  5B2J B;  3KXB C;  3NQU A;  5DNM C;  1H3O A;  4WJ3 C;  4XUJ A;  1KX4 A;  3C1C A;  1P3G A;  3UTB C;  3AV1 C;  3MGP C;  1P3L B;  3B6F B;  3REJ D;  3TU4 D;  2HUE B;  3W97 C;  1P3I C;  2DF4 C;  3REH B;  1S32 A;  5DNN B;  5B24 B;  3B6G B;  3REL A;  1ID3 B;  3LJA B;  4WU9 B;  5B0Z D;  2FJ7 A;  3LEL D;  5B1M C;  5BT1 D;  3W98 B;  5AVC C;  1P3K D;  2ARO B;  2J8P A;  2Y2J A;  5CPJ D;  2NZD D;  3MNN D;  4G92 C;  2BYM B;  4WU8 D;  4NE6 A;  1ZLA A;  4X23 A;  5E5A B;  3AN2 D;  4H9P B;  5CPK C;  1KX5 C;  4Z66 D;  2F8N B;  1HQ3 A;  5JRG A;  4YM6 B;  5F99 C;  1P3M C;  1P3G C;  2LY8 A;  4UUZ B;  5GT0 D;  1F1E A;  4J8X C;  5AV9 D;  3VH6 A;  5B0Y A;  3X1S D;  3MGR C;  1P3F A;  5FUG B;  1EQZ A;  5GSU D;  3A6N A;  5B2J A;  4ZUX D;  5CP6 C;  4Z5T B;  4WU9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...