1S32B

Molecular recognition of the nucleosomal 'supergroove'
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
81
structure length
81
Chain Sequence
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords palindromic alpha-satellite 146 bp DNA fragment
publication title Molecular Recognition of the Nucleosomal 'Supergroove'
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1s32B00
4NFTA 5BNXA 2JSSA 4JJND 4WU9A 2NZDC 4H9NA 3REIC 1P3GB 5DNMD 3AN2B 4X23D 5DNNC 4X23C 3WKJD 4KGCB 5GSUA 3AZNB 4WU8A 3R45A 4XZQD 3WTPE 5AV9B 4XZQC 3MGPB 3AZFA 2F8NB 4J8VD 3MGSA 4J8XA 4J8VC 3UTBD 3AN2C 3UTBC 4G91B 5B31A 5B0ZD 2PYOB 1WWIA 3X1SD 5FUGB 1BH9A 3B0CT 3LZ0A 5GT3A 3AYWB 4G91C 3LJAD 4H9RA 1F66C 1KX5A 5AV6D 3AZLA 4Z66B 1P3AA 1P3LA 3C1BB 3X1UC 3MVDD 5B24B 1AOIA 5GT0B 3MVDC 3LZ1B 2CV5A 2FJ7B 3O62D 5BT1D 1P3PD 5F99D 3V9RA 4QLCA 1P3PC 5F99C 5JA4B 3AZIB 4YS3B 5B1LB 3UT9C 1B6WA 4J8WC 5B1MD 4H9OB 5GT0C 4JJNA 3REIA 5B1MC 3LZ1C 5DNNA 4X23A 3AZIC 3WTPB 3AZJD 4YS3C 5CPKD 5B1LC 3AZJC 4XZQA 5CPKC 1P34D 1P34C 4J8VA 5CPJC 3UTBA 1M18D 5BS7C 3WTPC 2HUEB 1KX3D 5G49A 3W97B 1KX3C 3AZMB 2YFWA 5AVCD 5BNXB 3X1VD 3AV2D 5AVCC 5AVBD 3X1VC 4WU9B 1F66A 4H9NB 3AV2C 1H3OA 2HUEC 5AV6A 5JRGB 3W97C 3X1UA 1KX4B 3B0DB 4WU8B 3R45B 3MVDA 4E44A 5AV5C 3REKD 3AZFB 3O62A 1P3PA 5F99A 3MGSB 4J8XB 3UT9A 5JRGC 5B31B 1P3MD 4J8WA 1KX4C 5B1MA 5CP6D 3LZ1A 4Z5TD 1M1AB 5BO0A 1BH9B 3MGSC 3LZ0B 5GT3B 4YS3A 3AZJA 5CPKA 4H9RB 5E5AD 1KX5B 4NE3A 3AZLB 1P3AB 1P34A 1M1AC 5CPJA 4H9PA 1AOIB 1M18A 5BS7A 2CV5B 4J8UD 5GT3C 3KWQD 3AZEC 5B2ID 5AY8D 3KWQC 3V9RB 4QLCB 1KX3A 5B2JD 2F8NH 1KX5C 3A6ND 5B2JC 4H9SC 3A6NC 3AZGD 3AZHD 1ZLAD 5AVCA 3AZGC 3X1VA 1ZLAC 4JJNB 3AV2A 1AOIC 5AVBA 3B0CW 3WA9D 3W97A 5DNNB 1KU5A 4X23B 3WA9C 1P3FD 1P3FC 1P3OD 5AV5A 4XZQB 4JJNC 4J8VB 3W99D 5JRGA 3UTBB 5DNMC 3W99C 1S32D 1KX4A 1S32C 5B0ZB 1P3MA 3WKJC 2YFVA 5CP6A 5G49B 4Z5TA 3REHD 3X1SB 4XUJD 5B32G 2YFWB 2AROD 3AFAD 1F66B 5E5AA 5B0ZC 3B6FD 4YM6D 3VH5A 2HIOD 1H3OB 5GXQD 5AV6B 1M1AA 3B6FC 5GXQC 3X1UB 3X1SC 4CSRA 3C1CD 2BYMB 3VH5T 3MVDB 3AZEA 3O62B 3KXBD 3WAAD 3KWQA 1P3PB 3KXBC 5F99B 1R4VA 5AY8A 3LJAC 3UTAD 1F1EA 5B2JA 5AV6C 3UTAC 3UT9B 4H9SA 3A6NA 4J8WB 3AZGA 2BYKA 1ZLAA 5B1MB 3W96D 1P3BD 1P3BC 5BO0B 3O62C 5BT1C 3WA9A 2CWEA 2LY8A 1P3FA 3AZJB 3MGRD 5CPKB 1B67A 1HQ3D 3MGRC 4DRAA 1HQ3C 4LD9D 1P34B 3W98D 5CPJB 4H9PB 4UUZA 3W98C 5DNMA 3W99A 4CAYA 1S32A 1M18B 3WKJA 5B40D 2F8NG 5B40C 1U35D 1KX3B 1U35C 3REHA 3AYWD 2NQBD 4XUJA 2NQBC 2AROA 5AVCB 3AFAA 4Z66D 3X1VB 3AV2B 1M18C 5AVBB 5B0ZA 3C1BD 5B0YD 3B6FA 4YM6A 5B24D 2HIOA 5GXQA 3X1SA 2FJ7D 5AV5B 3KXBA 3LJAA 4KHAA 5AVBC 3UTAA 3AZKD 2BYMA 1P3MB 2YFVB 1ID3D 5CP6B 5AV8D 3W96A 4Z5TB 4R8PD 1P3BA 3KUYD 3REKC 4R8PC 3KUYC 4M6BA 4WNNA 3B6GD 3MGRA 1HQ3A 5E5AB 1P3MC 3B6GC 5CP6C 4LD9A 3W98A 4Z5TC 5B33D 4CSRB 1ULYA 3AZEB 5B40A 3KWQB 3LELD 3NQUA 1U35A 5B2IB 5AY8B 3LELC 3TU4D 5E5AC 5B2JB 3TU4C 4KUDD 3A6NB 4WU9D 2NQBA 3AZGB 2BYKB 1ZLAB 1TZYD 5KDMA 1TZYC 1P3KD 5GSUD 5B0YA 4J8UC 3WA9B 1P3KC 1TAFA 5B2IC 5AY8C 1P3FB 3MGQD 3AZHC 3RELD 1A7WA 4HGAC 3RELC 4UUZB 3VH5W 5DNMB 3W99B 4CAYB 3AZKA 1S32B 3WKJB 3AV1D 1EQZD 1ID3A 1P3OC 1EQZC 5AV8A 3REKA 4R8PA 3REHB 5BNVA 3KUYA 4WZSB 5B32D 4XUJB 5B31G 3MNND 5B32C 2AROB 3AFAB 3AZLD 2L5AA 3X1TD 1P3AD 1P3LD 3B6GA 1P3ID 4E45A 3B6FB 4YM6B 2HIOB 5GXQB 5CPID 3REHC 1M19D 5B33A 4ZUXD 3C1CB 2IO5C 1M19C 4XUJC 4ZUXC 4QLCD 3REJD 4AWLC 2AROC 3REJC 1Q9CA 3KXBB 3AFAC 2F8NK 3LELA 4KHAB 3LJAB 3UTAB 3TU4A 4YM6C 2NZDD 2HIOC 4KUDA 3REID 3C1CC 1TZYA 5DNND 3W96B 1P3BB 4J8UA 1P3KA 4Z2MG 3WAAC 5B2IA 4NE6A 4WNNB 1P3GD 4DRBA 3MGRB 3AZHA 3MGQA 3AN2D 1HQ3B 1P3GC 4EO5B 3RELA 4LD9B 4KGCD 3W98B 3W96C 3AZND 4KGCC 3AZNC 5AV9D 3MGPD 2F8ND 5AV9C 5B40B 1P3OA 3MGPC 3AV1A 1JFIA 1EQZA 3NQUB 1U35B 4EO5C 1BH8B 2PYOD 1WWSA 1F66D 5B32A 4LD9C 2NQBB 2PYOC 3MNNA 1BFMA 5KDMB 3X1TA 3X1UD 5B0YB 1P3IA 4H9QA 1TAFB 5CPIA 1M19A 4ZUXA 3AYWC 3REJA 3UT9D 4Z66C 4WV4B 3NQJA 3C1BC 4J8WD 5B0YC 5GT0D 3AZKB 5B24C 3LZ1D 2NZDA 3C1CA 4G92B 1ID3B 2FJ7C 3AZID 5AV8B 3REKB 4R8PB 5BNVB 4YS3D 1N1JA 5B1LD 3KUYB 3WAAA 2RVQD 4ZBJB 2RVQC 3AZKC 5CPJD 1P3GA 3B6GB 3AN2A 4G92C 1ID3C 4KGCA 5AV8C 3WTPD 3AZNA 5B33B 3VH6W 5AV9A 4Z2MH 4ZBJC 3MGPA 2F8NA 3LELB 3KSYA 3TU4B 4KUDB 2PYOA 5B33C 1TZYB 3W97D 5FUGA 4J8UB 1P3KB 3AZMD 5GSUB 5C3IB 5AV5D 3AZMC 4NE5A 1BH8A 3AYWA 4KUDC 3B0BA 3AZHB 4WU9C 3MGQB 5CHLB 5JRGD 4HGAB 4Z66A 3RELB 3C1BA 1KX4D 4WU8D 5GSUC 5B24A 5GT0A 3B0DC 3VH6A 5C3IC 4WU8C 3AZFD 2FJ7A 1JFIB 1P3OB 3AV1B 3AZFC 1EQZB 3MGSD 3VH6T 4J8XD 5JA4A 3MGQC 3AZIA 4J8XC 5B1LA 5B31D 5B32B 5B31C 3MNNB 1M1AD 4H9OA 1P3LB 3X1TB 1P3IB 3AV1C 4H9QB 3LZ0D 5CPIB 5GT3D 3WTPA 3LZ0C 2IO5B 3AZED 1M19B 4ZUXB 4AWLB 1HTAA 1KX5D 3REJB 3MNNC 3AZLC 1P3AC 3X1TC 1P3LC 3NQJB 1AOID 1P3IC 2NZDB 2CV5D 3REIB 5CPIC 2CV5C 4QLCC 3WAAB 1N1JB 3AZMA
chains in the Genus database with same CATH superfamily
2Y2MA 4NFTA 5BNXA 2JSSA 4JJND 4WU9A 2NZDC 4H9NA 3REIC 1P3GB 2RIQA 5DNMD 3AN2B 3F6TA 4X23D 5DNNC 4X23C 3WKJD 4KGCB 5GSUA 3AZNB 4WU8A 3R45A 4XZQD 3WTPE 3EG5B 5AV9B 4XZQC 3MGPB 3AZFA 2F8NB 2Y2GA 4J8VD 3MGSA 4J8XA 4J8VC 3UTBD 3AN2C 3UTBC 4G91B 5B31A 5B0ZD 2PYOB 1Z2CB 1WWIA 3X1SD 5FUGB 1BH9A 3B0CT 3LZ0A 5GT3A 3AYWB 4G91C 3LJAD 4H9RA 1F66C 1KX5A 5AV6D 3AZLA 4Z66B 1P3AA 1P3LA 2JE5A 3C1BB 3X1UC 3MVDD 5B24B 1AOIA 5GT0B 3MVDC 3LZ1B 2CV5A 2FJ7B 3O62D 5BT1D 1P3PD 5F99D 3V9RA 4QLCA 1P3PC 5F99C 5JA4B 3AZIB 4YS3B 5B1LB 3UT9C 3KFUG 1B6WA 4J8WC 5B1MD 4H9OB 5GT0C 4JJNA 3REIA 2BG1A 5B1MC 3LZ1C 5DNNA 4X23A 3AZIC 3WTPB 3AZJD 4YS3C 5CPKD 5B1LC 3AZJC 4XZQA 5CPKC 3A1IA 1P34D 2ZM5A 1P34C 4J8VA 5CPJC 2VQRA 3UTBA 1M18D 1T3UA 5BS7C 3WTPC 2HUEB 3H0MC 2DF4C 1KX3D 5G49A 3W97B 1KX3C 3AZMB 2YFWA 5AVCD 5BNXB 3X1VD 3AV2D 5AVCC 5AVBD 3X1VC 4WU9B 1F66A 4H9NB 3AV2C 1H3OA 2HUEC 5AV6A 5JRGB 3W97C 3X1UA 1KX4B 3B0DB 4WU8B 3R45B 3MVDA 4E44A 5AV5C 3REKD 3AZFB 3O62A 2Y2QA 1P3PA 5F99A 3MGSB 4J8XB 3UT9A 5JRGC 5B31B 1P3MD 4J8WA 1KX4C 5B1MA 5CP6D 3LZ1A 4Z5TD 1M1AB 5BO0A 1BH9B 3MGSC 3LZ0B 5GT3B 3AL0C 4YS3A 3AZJA 5CPKA 4H9RB 5E5AD 1KX5B 4NE3A 3AZLB 1P3AB 1P34A 1M1AC 5CPJA 4H9PA 1AOIB 1M18A 5BS7A 2CV5B 4J8UD 5GT3C 3KWQD 3AZEC 5B2ID 5AY8D 3KWQC 3V9RB 4QLCB 1KX3A 5B2JD 2F8NH 1KX5C 3A6ND 5B2JC 4H9SC 3A6NC 3AZGD 3AZHD 3EPHA 1ZLAD 2JCHA 5AVCA 3AZGC 3X1VA 1ZLAC 4JJNB 3AV2A 1AOIC 5AVBA 3B0CW 3WA9D 3W97A 5DNNB 1KU5A 4X23B 3WA9C 1P3FD 1P3FC 1P3OD 5AV5A 4XZQB 4JJNC 4J8VB 3W99D 5JRGA 3UTBB 5DNMC 3W99C 1S32D 1KX4A 1S32C 5B0ZB 1P3MA 3WKJC 2YFVA 5CP6A 5G49B 4Z5TA 3REHD 3X1SB 4XUJD 2Y2LA 5B32G 2YFWB 2AROD 3AFAD 1F66B 5E5AA 5B0ZC 3B6FD 4YM6D 3VH5A 2HIOD 1H3OB 5GXQD 5AV6B 1M1AA 3B6FC 5GXQC 3X1UB 3X1SC 4CSRA 3C1CD 2BYMB 3VH5T 3MVDB 3AZEA 3O62B 3KXBD 3WAAD 3KWQA 1P3PB 3KXBC 5F99B 1R4VA 5AY8A 3LJAC 3UTAD 1F1EA 5B2JA 5AV6C 3UTAC 3UT9B 4H9SA 3A6NA 2Y2JA 3A1KA 4J8WB 4DQYB 3AZGA 2BYKA 1ZLAA 5B1MB 3W96D 1P3BD 1P3BC 5BO0B 3O62C 5BT1C 3WA9A 2CWEA 2LY8A 1P3FA 3EPLA 3AZJB 3MGRD 5CPKB 1B67A 1HQ3D 3MGRC 4DRAA 1HQ3C 4LD9D 1P34B 3W98D 5CPJB 4H9PB 4UUZA 3W98C 5DNMA 3W99A 4CAYA 1W2EA 1S32A 1M18B 3WKJA 5B40D 2F8NG 5B40C 1U35D 1KX3B 1U35C 3REHA 3AYWD 2NQBD 4XUJA 2NQBC 2AROA 5AVCB 3AFAA 4Z66D 3X1VB 3AV2B 1M18C 5AVBB 5B0ZA 3C1BD 5B0YD 3B6FA 4YM6A 5B24D 2HIOA 5GXQA 3X1SA 2FJ7D 2Y2KA 5AV5B 2Y2PA 2ZY4A 3KXBA 3LJAA 4KHAA 5AVBC 3UTAA 3AZKD 2BYMA 1P3MB 2YFVB 1ID3D 5CP6B 5AV8D 3W96A 4Z5TB 4R8PD 2G5IC 1P3BA 3KUYD 3REKC 4R8PC 3KUYC 4M6BA 4WNNA 3B6GD 3MGRA 1HQ3A 5E5AB 1P3MC 3B6GC 5CP6C 4LD9A 3W98A 4Z5TC 5B33D 2Y2OA 4CSRB 2FFFB 1ULYA 3AZEB 5B40A 3KWQB 3LELD 3NQUA 1U35A 5B2IB 5AY8B 3LELC 3TU4D 5E5AC 5B2JB 3TU4C 4KUDD 3A6NB 4WU9D 2NQBA 3AZGB 2BYKB 1ZLAB 1TZYD 5KDMA 1TZYC 1P3KD 5GSUD 5B0YA 4J8UC 3WA9B 1P3KC 1TAFA 5B2IC 5AY8C 1P3FB 3MGQD 3EPJA 2DQNC 3AZHC 3RELD 1A7WA 4HGAC 3RELC 4UUZB 3VH5W 5DNMB 3W99B 4CAYB 3AZKA 1S32B 3WKJB 3AV1D 1EQZD 1ID3A 1PZRA 1P3OC 1EQZC 5AV8A 3REKA 4R8PA 3REHB 5BNVA 3P5JB 3KUYA 4WZSB 5B32D 4XUJB 5B31G 3MNND 5B32C 2AROB 3AFAB 3AZLD 2L5AA 3X1TD 1P3AD 1P3LD 3B6GA 1P3ID 3IP4C 4E45A 4YM6B 3B6FB 2HIOB 5GXQB 5CPID 3REHC 1M19D 5B33A 4ZUXD 3C1CB 2IO5C 1M19C 4XUJC 4ZUXC 4QLCD 3REJD 4AWLC 2AROC 2ZY5A 3REJC 1Q9CA 3KXBB 3AFAC 2F8NK 3LELA 4KHAB 3LJAB 3UTAB 2F2AC 3TU4A 4YM6C 2NZDD 2HIOC 4KUDA 3REID 2XD5A 3C1CC 1TZYA 5DNND 3W96B 1P3BB 4J8UA 1P3KA 4Z2MG 3WAAC 5B2IA 4NE6A 4WNNB 1P3GD 4DRBA 3MGRB 3AZHA 3MGQA 3AN2D 1HQ3B 1P3GC 4EO5B 2J8PA 3RELA 4LD9B 4KGCD 3W98B 3W96C 3AZND 4KGCC 3AZNC 4WJ3C 5AV9D 3MGPD 2F8ND 2UWXA 5AV9C 5B40B 1P3OA 3MGPC 3AV1A 1JFIA 1EQZA 3NQUB 1U35B 4EO5C 1BH8B 3FDDA 2PYOD 1WWSA 1F66D 5B32A 4LD9C 2NQBB 2PYOC 3MNNA 1BFMA 5KDMB 3X1TA 3X1UD 5B0YB 1P3IA 4H9QA 1TAFB 5CPIA 1M19A 4ZUXA 3AYWC 3REJA 3UT9D 4Z66C 4WV4B 3NQJA 3C1BC 4J8WD 5B0YC 5GT0D 3AZKB 5B24C 3LZ1D 2NZDA 3C1CA 4G92B 1ID3B 2FJ7C 3AZID 5AV8B 3REKB 4R8PB 5BNVB 4YS3D 1N1JA 5B1LD 3KUYB 3WAAA 2RVQD 4ZBJB 2RVQC 3AZKC 5CPJD 1P3GA 3B6GB 3AN2A 4G92C 1ID3C 4KGCA 5AV8C 3WTPD 3AZNA 5B33B 3VH6W 5AV9A 4Z2MH 4ZBJC 3MGPA 2F8NA 3LELB 3KSYA 3TU4B 2Y2HA 4KUDB 2PYOA 3H0LC 5B33C 3EPKA 1TZYB 3W97D 5FUGA 4J8UB 2XD1A 1P3KB 3AZMD 5GSUB 5C3IB 5AV5D 3AZMC 4NE5A 1BH8A 3AYWA 2Y2NA 4KUDC 3B0BA 4UPKA 3AZHB 4WU9C 3MGQB 5CHLB 5JRGD 4HGAB 4Z66A 3H0RC 3RELB 3C1BA 1KX4D 4WU8D 5GSUC 5B24A 5GT0A 3B0DC 3VH6A 5C3IC 4WU8C 3AZFD 2FJ7A 1JFIB 1P3OB 3AV1B 3AZFC 1EQZB 3MGSD 3VH6T 4J8XD 5JA4A 3MGQC 3AZIA 4J8XC 5B1LA 5B31D 2G5HC 5B32B 5B31C 2Y2IA 3MNNB 1M1AD 4H9OA 2ZY2A 1P3LB 3X1TB 2W8SA 2ZY3A 3AV1C 4H9QB 1P3IB 3LZ0D 5CPIB 5GT3D 3WTPA 3LZ0C 2IO5B 3AZED 1M19B 4ZUXB 4AWLB 1HTAA 1KX5D 3REJB 3MNNC 3AZLC 1P3AC 3X1TC 1P3LC 3NQJB 1AOID 1P3IC 2NZDB 2CV5D 3REIB 5CPIC 2CV5C 4QLCC 3WAAB 1N1JB 3AZMA
chains in the Genus database with same CATH topology
2Y2MA 4NFTA 5BNXA 2JSSA 4JJND 4WU9A 2NZDC 4H9NA 3REIC 1P3GB 2RIQA 5DNMD 3AN2B 3F6TA 4X23D 5DNNC 4X23C 3WKJD 4KGCB 5GSUA 3AZNB 4WU8A 3R45A 4XZQD 3WTPE 3EG5B 5AV9B 4XZQC 3MGPB 3AZFA 2F8NB 2Y2GA 4J8VD 3MGSA 4J8XA 4J8VC 3UTBD 3AN2C 3UTBC 4G91B 5B31A 5B0ZD 2PYOB 1Z2CB 1WWIA 3X1SD 5FUGB 1BH9A 3B0CT 3LZ0A 5GT3A 3AYWB 4G91C 3LJAD 4H9RA 1F66C 1KX5A 5AV6D 3AZLA 4Z66B 1P3AA 1P3LA 2JE5A 3C1BB 3X1UC 3MVDD 5B24B 1AOIA 5GT0B 3MVDC 3LZ1B 2CV5A 2FJ7B 3O62D 5BT1D 1P3PD 5F99D 3V9RA 4QLCA 1P3PC 5F99C 5JA4B 3AZIB 4YS3B 5B1LB 3UT9C 3KFUG 1B6WA 4J8WC 5B1MD 4H9OB 5GT0C 4JJNA 3REIA 2BG1A 5B1MC 3LZ1C 5DNNA 4X23A 3AZIC 3WTPB 3AZJD 4YS3C 5CPKD 5B1LC 3AZJC 4XZQA 5CPKC 3A1IA 1P34D 2ZM5A 1P34C 4J8VA 5CPJC 2VQRA 3UTBA 1M18D 1T3UA 5BS7C 3WTPC 2HUEB 3H0MC 2DF4C 1KX3D 5G49A 3W97B 1KX3C 3AZMB 2YFWA 5AVCD 5BNXB 3X1VD 3AV2D 5AVCC 5AVBD 3X1VC 4WU9B 1F66A 4H9NB 3AV2C 1H3OA 2HUEC 5AV6A 5JRGB 3W97C 3X1UA 1KX4B 3B0DB 4WU8B 3R45B 3MVDA 4E44A 5AV5C 3REKD 3AZFB 3O62A 2Y2QA 1P3PA 5F99A 3MGSB 4J8XB 3UT9A 5JRGC 5B31B 1P3MD 4J8WA 1KX4C 5B1MA 5CP6D 3LZ1A 4Z5TD 1M1AB 5BO0A 1BH9B 3MGSC 3LZ0B 5GT3B 3AL0C 4YS3A 3AZJA 5CPKA 4H9RB 5E5AD 1KX5B 4NE3A 3AZLB 1P3AB 1P34A 1M1AC 5CPJA 4H9PA 1AOIB 1M18A 5BS7A 2CV5B 4J8UD 5GT3C 3KWQD 3AZEC 5B2ID 5AY8D 3KWQC 3V9RB 4QLCB 1KX3A 5B2JD 2F8NH 1KX5C 3A6ND 5B2JC 4H9SC 3A6NC 3AZGD 3AZHD 3EPHA 1ZLAD 2JCHA 5AVCA 3AZGC 3X1VA 1ZLAC 4JJNB 3AV2A 1AOIC 5AVBA 3B0CW 3WA9D 3W97A 5DNNB 1KU5A 4X23B 3WA9C 1P3FD 1P3FC 1P3OD 5AV5A 4XZQB 4JJNC 4J8VB 3W99D 5JRGA 3UTBB 5DNMC 3W99C 1S32D 1KX4A 1S32C 5B0ZB 1P3MA 3WKJC 2YFVA 5CP6A 5G49B 4Z5TA 3REHD 3X1SB 4XUJD 2Y2LA 5B32G 2YFWB 2AROD 3AFAD 1F66B 5E5AA 5B0ZC 3B6FD 4YM6D 3VH5A 2HIOD 1H3OB 5GXQD 5AV6B 1M1AA 3B6FC 5GXQC 3X1UB 3X1SC 4CSRA 3C1CD 2BYMB 3VH5T 3MVDB 3AZEA 3O62B 3KXBD 3WAAD 3KWQA 1P3PB 3KXBC 5F99B 1R4VA 5AY8A 3LJAC 3UTAD 1F1EA 5B2JA 5AV6C 3UTAC 3UT9B 4H9SA 3A6NA 2Y2JA 3A1KA 4J8WB 4DQYB 3AZGA 2BYKA 1ZLAA 5B1MB 3W96D 1P3BD 1P3BC 5BO0B 3O62C 5BT1C 3WA9A 2CWEA 2LY8A 1P3FA 3EPLA 3AZJB 3MGRD 5CPKB 1B67A 1HQ3D 3MGRC 4DRAA 1HQ3C 4LD9D 1P34B 3W98D 5CPJB 4H9PB 4UUZA 3W98C 5DNMA 3W99A 4CAYA 1W2EA 1S32A 1M18B 3WKJA 5B40D 2F8NG 5B40C 1U35D 1KX3B 1U35C 3REHA 3AYWD 2NQBD 4XUJA 2NQBC 2AROA 5AVCB 3AFAA 4Z66D 3X1VB 3AV2B 1M18C 5AVBB 5B0ZA 3C1BD 5B0YD 3B6FA 4YM6A 5B24D 2HIOA 5GXQA 3X1SA 2FJ7D 2Y2KA 5AV5B 2Y2PA 2ZY4A 3KXBA 3LJAA 4KHAA 5AVBC 3UTAA 3AZKD 2BYMA 1P3MB 2YFVB 1ID3D 5CP6B 5AV8D 3W96A 4Z5TB 4R8PD 2G5IC 1P3BA 3KUYD 3REKC 4R8PC 3KUYC 4M6BA 4WNNA 3B6GD 3MGRA 1HQ3A 5E5AB 1P3MC 3B6GC 5CP6C 4LD9A 3W98A 4Z5TC 5B33D 2Y2OA 4CSRB 2FFFB 1ULYA 3AZEB 5B40A 3KWQB 3LELD 3NQUA 1U35A 5B2IB 5AY8B 3LELC 3TU4D 5E5AC 5B2JB 3TU4C 4KUDD 3A6NB 4WU9D 2NQBA 3AZGB 2BYKB 1ZLAB 1TZYD 5KDMA 1TZYC 1P3KD 5GSUD 5B0YA 4J8UC 3WA9B 1P3KC 1TAFA 5B2IC 5AY8C 1P3FB 3MGQD 3EPJA 2DQNC 3AZHC 3RELD 1A7WA 4HGAC 3RELC 4UUZB 3VH5W 5DNMB 3W99B 4CAYB 3AZKA 1S32B 3WKJB 3AV1D 1EQZD 1ID3A 1PZRA 1P3OC 1EQZC 5AV8A 3REKA 4R8PA 3REHB 5BNVA 3P5JB 3KUYA 4WZSB 5B32D 4XUJB 5B31G 3MNND 5B32C 2AROB 3AFAB 3AZLD 2L5AA 3X1TD 1P3AD 1P3LD 3B6GA 1P3ID 3IP4C 4E45A 4YM6B 3B6FB 2HIOB 5GXQB 5CPID 3REHC 1M19D 5B33A 4ZUXD 3C1CB 2IO5C 1M19C 4XUJC 4ZUXC 4QLCD 3REJD 4AWLC 2AROC 2ZY5A 3REJC 1Q9CA 3KXBB 3AFAC 2F8NK 3LELA 4KHAB 3LJAB 3UTAB 2F2AC 3TU4A 4YM6C 2NZDD 2HIOC 4KUDA 3REID 2XD5A 3C1CC 1TZYA 5DNND 3W96B 1P3BB 4J8UA 1P3KA 4Z2MG 3WAAC 5B2IA 4NE6A 4WNNB 1P3GD 4DRBA 3MGRB 3AZHA 3MGQA 3AN2D 1HQ3B 1P3GC 4EO5B 2J8PA 3RELA 4LD9B 4KGCD 3W98B 3W96C 3AZND 4KGCC 3AZNC 4WJ3C 5AV9D 3MGPD 2F8ND 2UWXA 5AV9C 5B40B 1P3OA 3MGPC 3AV1A 1JFIA 1EQZA 3NQUB 1U35B 4EO5C 1BH8B 3FDDA 2PYOD 1WWSA 1F66D 5B32A 4LD9C 2NQBB 2PYOC 3MNNA 1BFMA 5KDMB 3X1TA 3X1UD 5B0YB 1P3IA 4H9QA 1TAFB 5CPIA 1M19A 4ZUXA 3AYWC 3REJA 3UT9D 4Z66C 4WV4B 3NQJA 3C1BC 4J8WD 5B0YC 5GT0D 3AZKB 5B24C 3LZ1D 2NZDA 3C1CA 4G92B 1ID3B 2FJ7C 3AZID 5AV8B 3REKB 4R8PB 5BNVB 4YS3D 1N1JA 5B1LD 3KUYB 3WAAA 2RVQD 4ZBJB 2RVQC 3AZKC 5CPJD 1P3GA 3B6GB 3AN2A 4G92C 1ID3C 4KGCA 5AV8C 3WTPD 3AZNA 5B33B 3VH6W 5AV9A 4Z2MH 4ZBJC 3MGPA 2F8NA 3LELB 3KSYA 3TU4B 2Y2HA 4KUDB 2PYOA 3H0LC 5B33C 3EPKA 1TZYB 3W97D 5FUGA 4J8UB 2XD1A 1P3KB 3AZMD 5GSUB 5C3IB 5AV5D 3AZMC 4NE5A 1BH8A 3AYWA 2Y2NA 4KUDC 3B0BA 4UPKA 3AZHB 4WU9C 3MGQB 5CHLB 5JRGD 4HGAB 4Z66A 3H0RC 3RELB 3C1BA 1KX4D 4WU8D 5GSUC 5B24A 5GT0A 3B0DC 3VH6A 5C3IC 4WU8C 3AZFD 2FJ7A 1JFIB 1P3OB 3AV1B 3AZFC 1EQZB 3MGSD 3VH6T 4J8XD 5JA4A 3MGQC 3AZIA 4J8XC 5B1LA 5B31D 2G5HC 5B32B 5B31C 2Y2IA 3MNNB 1M1AD 4H9OA 2ZY2A 1P3LB 3X1TB 2W8SA 2ZY3A 3AV1C 4H9QB 1P3IB 3LZ0D 5CPIB 5GT3D 3WTPA 3LZ0C 2IO5B 3AZED 1M19B 4ZUXB 4AWLB 1HTAA 1KX5D 3REJB 3MNNC 3AZLC 1P3AC 3X1TC 1P3LC 3NQJB 1AOID 1P3IC 2NZDB 2CV5D 3REIB 5CPIC 2CV5C 4QLCC 3WAAB 1N1JB 3AZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NFT A;  5BNX A;  2JSS A;  4JJN D;  4WU9 A;  2NZD C;  4H9N A;  3REI C;  1P3G B;  5DNM D;  3AN2 B;  4X23 D;  5DNN C;  4X23 C;  3WKJ D;  4KGC B;  5GSU A;  3AZN B;  4WU8 A;  3R45 A;  4XZQ D;  3WTP E;  5AV9 B;  4XZQ C;  3MGP B;  3AZF A;  2F8N B;  4J8V D;  3MGS A;  4J8X A;  4J8V C;  3UTB D;  3AN2 C;  3UTB C;  4G91 B;  5B31 A;  5B0Z D;  2PYO B;  1WWI A;  3X1S D;  5FUG B;  1BH9 A;  3B0C T;  3LZ0 A;  5GT3 A;  3AYW B;  4G91 C;  3LJA D;  4H9R A;  1F66 C;  1KX5 A;  5AV6 D;  3AZL A;  4Z66 B;  1P3A A;  1P3L A;  3C1B B;  3X1U C;  3MVD D;  5B24 B;  1AOI A;  5GT0 B;  3MVD C;  3LZ1 B;  2CV5 A;  2FJ7 B;  3O62 D;  5BT1 D;  1P3P D;  5F99 D;  3V9R A;  4QLC A;  1P3P C;  5F99 C;  5JA4 B;  3AZI B;  4YS3 B;  5B1L B;  3UT9 C;  1B6W A;  4J8W C;  5B1M D;  4H9O B;  5GT0 C;  4JJN A;  3REI A;  5B1M C;  3LZ1 C;  5DNN A;  4X23 A;  3AZI C;  3WTP B;  3AZJ D;  4YS3 C;  5CPK D;  5B1L C;  3AZJ C;  4XZQ A;  5CPK C;  1P34 D;  1P34 C;  4J8V A;  5CPJ C;  3UTB A;  1M18 D;  5BS7 C;  3WTP C;  2HUE B;  1KX3 D;  5G49 A;  3W97 B;  1KX3 C;  3AZM B;  2YFW A;  5AVC D;  5BNX B;  3X1V D;  3AV2 D;  5AVC C;  5AVB D;  3X1V C;  4WU9 B;  1F66 A;  4H9N B;  3AV2 C;  1H3O A;  2HUE C;  5AV6 A;  5JRG B;  3W97 C;  3X1U A;  1KX4 B;  3B0D B;  4WU8 B;  3R45 B;  3MVD A;  4E44 A;  5AV5 C;  3REK D;  3AZF B;  3O62 A;  1P3P A;  5F99 A;  3MGS B;  4J8X B;  3UT9 A;  5JRG C;  5B31 B;  1P3M D;  4J8W A;  1KX4 C;  5B1M A;  5CP6 D;  3LZ1 A;  4Z5T D;  1M1A B;  5BO0 A;  1BH9 B;  3MGS C;  3LZ0 B;  5GT3 B;  4YS3 A;  3AZJ A;  5CPK A;  4H9R B;  5E5A D;  1KX5 B;  4NE3 A;  3AZL B;  1P3A B;  1P34 A;  1M1A C;  5CPJ A;  4H9P A;  1AOI B;  1M18 A;  5BS7 A;  2CV5 B;  4J8U D;  5GT3 C;  3KWQ D;  3AZE C;  5B2I D;  5AY8 D;  3KWQ C;  3V9R B;  4QLC B;  1KX3 A;  5B2J D;  2F8N H;  1KX5 C;  3A6N D;  5B2J C;  4H9S C;  3A6N C;  3AZG D;  3AZH D;  1ZLA D;  5AVC A;  3AZG C;  3X1V A;  1ZLA C;  4JJN B;  3AV2 A;  1AOI C;  5AVB A;  3B0C W;  3WA9 D;  3W97 A;  5DNN B;  1KU5 A;  4X23 B;  3WA9 C;  1P3F D;  1P3F C;  1P3O D;  5AV5 A;  4XZQ B;  4JJN C;  4J8V B;  3W99 D;  5JRG A;  3UTB B;  5DNM C;  3W99 C;  1S32 D;  1KX4 A;  1S32 C;  5B0Z B;  1P3M A;  3WKJ C;  2YFV A;  5CP6 A;  5G49 B;  4Z5T A;  3REH D;  3X1S B;  4XUJ D;  5B32 G;  2YFW B;  2ARO D;  3AFA D;  1F66 B;  5E5A A;  5B0Z C;  3B6F D;  4YM6 D;  3VH5 A;  2HIO D;  1H3O B;  5GXQ D;  5AV6 B;  1M1A A;  3B6F C;  5GXQ C;  3X1U B;  3X1S C;  4CSR A;  3C1C D;  2BYM B;  3VH5 T;  3MVD B;  3AZE A;  3O62 B;  3KXB D;  3WAA D;  3KWQ A;  1P3P B;  3KXB C;  5F99 B;  1R4V A;  5AY8 A;  3LJA C;  3UTA D;  1F1E A;  5B2J A;  5AV6 C;  3UTA C;  3UT9 B;  4H9S A;  3A6N A;  4J8W B;  3AZG A;  2BYK A;  1ZLA A;  5B1M B;  3W96 D;  1P3B D;  1P3B C;  5BO0 B;  3O62 C;  5BT1 C;  3WA9 A;  2CWE A;  2LY8 A;  1P3F A;  3AZJ B;  3MGR D;  5CPK B;  1B67 A;  1HQ3 D;  3MGR C;  4DRA A;  1HQ3 C;  4LD9 D;  1P34 B;  3W98 D;  5CPJ B;  4H9P B;  4UUZ A;  3W98 C;  5DNM A;  3W99 A;  4CAY A;  1S32 A;  1M18 B;  3WKJ A;  5B40 D;  2F8N G;  5B40 C;  1U35 D;  1KX3 B;  1U35 C;  3REH A;  3AYW D;  2NQB D;  4XUJ A;  2NQB C;  2ARO A;  5AVC B;  3AFA A;  4Z66 D;  3X1V B;  3AV2 B;  1M18 C;  5AVB B;  5B0Z A;  3C1B D;  5B0Y D;  3B6F A;  4YM6 A;  5B24 D;  2HIO A;  5GXQ A;  3X1S A;  2FJ7 D;  5AV5 B;  3KXB A;  3LJA A;  4KHA A;  5AVB C;  3UTA A;  3AZK D;  2BYM A;  1P3M B;  2YFV B;  1ID3 D;  5CP6 B;  5AV8 D;  3W96 A;  4Z5T B;  4R8P D;  1P3B A;  3KUY D;  3REK C;  4R8P C;  3KUY C;  4M6B A;  4WNN A;  3B6G D;  3MGR A;  1HQ3 A;  5E5A B;  1P3M C;  3B6G C;  5CP6 C;  4LD9 A;  3W98 A;  4Z5T C;  5B33 D;  4CSR B;  1ULY A;  3AZE B;  5B40 A;  3KWQ B;  3LEL D;  3NQU A;  1U35 A;  5B2I B;  5AY8 B;  3LEL C;  3TU4 D;  5E5A C;  5B2J B;  3TU4 C;  4KUD D;  3A6N B;  4WU9 D;  2NQB A;  3AZG B;  2BYK B;  1ZLA B;  1TZY D;  5KDM A;  1TZY C;  1P3K D;  5GSU D;  5B0Y A;  4J8U C;  3WA9 B;  1P3K C;  1TAF A;  5B2I C;  5AY8 C;  1P3F B;  3MGQ D;  3AZH C;  3REL D;  1A7W A;  4HGA C;  3REL C;  4UUZ B;  3VH5 W;  5DNM B;  3W99 B;  4CAY B;  3AZK A;  1S32 B;  3WKJ B;  3AV1 D;  1EQZ D;  1ID3 A;  1P3O C;  1EQZ C;  5AV8 A;  3REK A;  4R8P A;  3REH B;  5BNV A;  3KUY A;  4WZS B;  5B32 D;  4XUJ B;  5B31 G;  3MNN D;  5B32 C;  2ARO B;  3AFA B;  3AZL D;  2L5A A;  3X1T D;  1P3A D;  1P3L D;  3B6G A;  1P3I D;  4E45 A;  3B6F B;  4YM6 B;  2HIO B;  5GXQ B;  5CPI D;  3REH C;  1M19 D;  5B33 A;  4ZUX D;  3C1C B;  2IO5 C;  1M19 C;  4XUJ C;  4ZUX C;  4QLC D;  3REJ D;  4AWL C;  2ARO C;  3REJ C;  1Q9C A;  3KXB B;  3AFA C;  2F8N K;  3LEL A;  4KHA B;  3LJA B;  3UTA B;  3TU4 A;  4YM6 C;  2NZD D;  2HIO C;  4KUD A;  3REI D;  3C1C C;  1TZY A;  5DNN D;  3W96 B;  1P3B B;  4J8U A;  1P3K A;  4Z2M G;  3WAA C;  5B2I A;  4NE6 A;  4WNN B;  1P3G D;  4DRB A;  3MGR B;  3AZH A;  3MGQ A;  3AN2 D;  1HQ3 B;  1P3G C;  4EO5 B;  3REL A;  4LD9 B;  4KGC D;  3W98 B;  3W96 C;  3AZN D;  4KGC C;  3AZN C;  5AV9 D;  3MGP D;  2F8N D;  5AV9 C;  5B40 B;  1P3O A;  3MGP C;  3AV1 A;  1JFI A;  1EQZ A;  3NQU B;  1U35 B;  4EO5 C;  1BH8 B;  2PYO D;  1WWS A;  1F66 D;  5B32 A;  4LD9 C;  2NQB B;  2PYO C;  3MNN A;  1BFM A;  5KDM B;  3X1T A;  3X1U D;  5B0Y B;  1P3I A;  4H9Q A;  1TAF B;  5CPI A;  1M19 A;  4ZUX A;  3AYW C;  3REJ A;  3UT9 D;  4Z66 C;  4WV4 B;  3NQJ A;  3C1B C;  4J8W D;  5B0Y C;  5GT0 D;  3AZK B;  5B24 C;  3LZ1 D;  2NZD A;  3C1C A;  4G92 B;  1ID3 B;  2FJ7 C;  3AZI D;  5AV8 B;  3REK B;  4R8P B;  5BNV B;  4YS3 D;  1N1J A;  5B1L D;  3KUY B;  3WAA A;  2RVQ D;  4ZBJ B;  2RVQ C;  3AZK C;  5CPJ D;  1P3G A;  3B6G B;  3AN2 A;  4G92 C;  1ID3 C;  4KGC A;  5AV8 C;  3WTP D;  3AZN A;  5B33 B;  3VH6 W;  5AV9 A;  4Z2M H;  4ZBJ C;  3MGP A;  2F8N A;  3LEL B;  3KSY A;  3TU4 B;  4KUD B;  2PYO A;  5B33 C;  1TZY B;  3W97 D;  5FUG A;  4J8U B;  1P3K B;  3AZM D;  5GSU B;  5C3I B;  5AV5 D;  3AZM C;  4NE5 A;  1BH8 A;  3AYW A;  4KUD C;  3B0B A;  3AZH B;  4WU9 C;  3MGQ B;  5CHL B;  5JRG D;  4HGA B;  4Z66 A;  3REL B;  3C1B A;  1KX4 D;  4WU8 D;  5GSU C;  5B24 A;  5GT0 A;  3B0D C;  3VH6 A;  5C3I C;  4WU8 C;  3AZF D;  2FJ7 A;  1JFI B;  1P3O B;  3AV1 B;  3AZF C;  1EQZ B;  3MGS D;  3VH6 T;  4J8X D;  5JA4 A;  3MGQ C;  3AZI A;  4J8X C;  5B1L A;  5B31 D;  5B32 B;  5B31 C;  3MNN B;  1M1A D;  4H9O A;  1P3L B;  3X1T B;  1P3I B;  3AV1 C;  4H9Q B;  3LZ0 D;  5CPI B;  5GT3 D;  3WTP A;  3LZ0 C;  2IO5 B;  3AZE D;  1M19 B;  4ZUX B;  4AWL B;  1HTA A;  1KX5 D;  3REJ B;  3MNN C;  3AZL C;  1P3A C;  3X1T C;  1P3L C;  3NQJ B;  1AOI D;  1P3I C;  2NZD B;  2CV5 D;  3REI B;  5CPI C;  2CV5 C;  4QLC C;  3WAA B;  1N1J B;  3AZM A; 
#chains in the Genus database with same CATH topology
 2Y2M A;  4NFT A;  5BNX A;  2JSS A;  4JJN D;  4WU9 A;  2NZD C;  4H9N A;  3REI C;  1P3G B;  2RIQ A;  5DNM D;  3AN2 B;  3F6T A;  4X23 D;  5DNN C;  4X23 C;  3WKJ D;  4KGC B;  5GSU A;  3AZN B;  4WU8 A;  3R45 A;  4XZQ D;  3WTP E;  3EG5 B;  5AV9 B;  4XZQ C;  3MGP B;  3AZF A;  2F8N B;  2Y2G A;  4J8V D;  3MGS A;  4J8X A;  4J8V C;  3UTB D;  3AN2 C;  3UTB C;  4G91 B;  5B31 A;  5B0Z D;  2PYO B;  1Z2C B;  1WWI A;  3X1S D;  5FUG B;  1BH9 A;  3B0C T;  3LZ0 A;  5GT3 A;  3AYW B;  4G91 C;  3LJA D;  4H9R A;  1F66 C;  1KX5 A;  5AV6 D;  3AZL A;  4Z66 B;  1P3A A;  1P3L A;  2JE5 A;  3C1B B;  3X1U C;  3MVD D;  5B24 B;  1AOI A;  5GT0 B;  3MVD C;  3LZ1 B;  2CV5 A;  2FJ7 B;  3O62 D;  5BT1 D;  1P3P D;  5F99 D;  3V9R A;  4QLC A;  1P3P C;  5F99 C;  5JA4 B;  3AZI B;  4YS3 B;  5B1L B;  3UT9 C;  3KFU G;  1B6W A;  4J8W C;  5B1M D;  4H9O B;  5GT0 C;  4JJN A;  3REI A;  2BG1 A;  5B1M C;  3LZ1 C;  5DNN A;  4X23 A;  3AZI C;  3WTP B;  3AZJ D;  4YS3 C;  5CPK D;  5B1L C;  3AZJ C;  4XZQ A;  5CPK C;  3A1I A;  1P34 D;  2ZM5 A;  1P34 C;  4J8V A;  5CPJ C;  2VQR A;  3UTB A;  1M18 D;  1T3U A;  5BS7 C;  3WTP C;  2HUE B;  3H0M C;  2DF4 C;  1KX3 D;  5G49 A;  3W97 B;  1KX3 C;  3AZM B;  2YFW A;  5AVC D;  5BNX B;  3X1V D;  3AV2 D;  5AVC C;  5AVB D;  3X1V C;  4WU9 B;  1F66 A;  4H9N B;  3AV2 C;  1H3O A;  2HUE C;  5AV6 A;  5JRG B;  3W97 C;  3X1U A;  1KX4 B;  3B0D B;  4WU8 B;  3R45 B;  3MVD A;  4E44 A;  5AV5 C;  3REK D;  3AZF B;  3O62 A;  2Y2Q A;  1P3P A;  5F99 A;  3MGS B;  4J8X B;  3UT9 A;  5JRG C;  5B31 B;  1P3M D;  4J8W A;  1KX4 C;  5B1M A;  5CP6 D;  3LZ1 A;  4Z5T D;  1M1A B;  5BO0 A;  1BH9 B;  3MGS C;  3LZ0 B;  5GT3 B;  3AL0 C;  4YS3 A;  3AZJ A;  5CPK A;  4H9R B;  5E5A D;  1KX5 B;  4NE3 A;  3AZL B;  1P3A B;  1P34 A;  1M1A C;  5CPJ A;  4H9P A;  1AOI B;  1M18 A;  5BS7 A;  2CV5 B;  4J8U D;  5GT3 C;  3KWQ D;  3AZE C;  5B2I D;  5AY8 D;  3KWQ C;  3V9R B;  4QLC B;  1KX3 A;  5B2J D;  2F8N H;  1KX5 C;  3A6N D;  5B2J C;  4H9S C;  3A6N C;  3AZG D;  3AZH D;  3EPH A;  1ZLA D;  2JCH A;  5AVC A;  3AZG C;  3X1V A;  1ZLA C;  4JJN B;  3AV2 A;  1AOI C;  5AVB A;  3B0C W;  3WA9 D;  3W97 A;  5DNN B;  1KU5 A;  4X23 B;  3WA9 C;  1P3F D;  1P3F C;  1P3O D;  5AV5 A;  4XZQ B;  4JJN C;  4J8V B;  3W99 D;  5JRG A;  3UTB B;  5DNM C;  3W99 C;  1S32 D;  1KX4 A;  1S32 C;  5B0Z B;  1P3M A;  3WKJ C;  2YFV A;  5CP6 A;  5G49 B;  4Z5T A;  3REH D;  3X1S B;  4XUJ D;  2Y2L A;  5B32 G;  2YFW B;  2ARO D;  3AFA D;  1F66 B;  5E5A A;  5B0Z C;  3B6F D;  4YM6 D;  3VH5 A;  2HIO D;  1H3O B;  5GXQ D;  5AV6 B;  1M1A A;  3B6F C;  5GXQ C;  3X1U B;  3X1S C;  4CSR A;  3C1C D;  2BYM B;  3VH5 T;  3MVD B;  3AZE A;  3O62 B;  3KXB D;  3WAA D;  3KWQ A;  1P3P B;  3KXB C;  5F99 B;  1R4V A;  5AY8 A;  3LJA C;  3UTA D;  1F1E A;  5B2J A;  5AV6 C;  3UTA C;  3UT9 B;  4H9S A;  3A6N A;  2Y2J A;  3A1K A;  4J8W B;  4DQY B;  3AZG A;  2BYK A;  1ZLA A;  5B1M B;  3W96 D;  1P3B D;  1P3B C;  5BO0 B;  3O62 C;  5BT1 C;  3WA9 A;  2CWE A;  2LY8 A;  1P3F A;  3EPL A;  3AZJ B;  3MGR D;  5CPK B;  1B67 A;  1HQ3 D;  3MGR C;  4DRA A;  1HQ3 C;  4LD9 D;  1P34 B;  3W98 D;  5CPJ B;  4H9P B;  4UUZ A;  3W98 C;  5DNM A;  3W99 A;  4CAY A;  1W2E A;  1S32 A;  1M18 B;  3WKJ A;  5B40 D;  2F8N G;  5B40 C;  1U35 D;  1KX3 B;  1U35 C;  3REH A;  3AYW D;  2NQB D;  4XUJ A;  2NQB C;  2ARO A;  5AVC B;  3AFA A;  4Z66 D;  3X1V B;  3AV2 B;  1M18 C;  5AVB B;  5B0Z A;  3C1B D;  5B0Y D;  3B6F A;  4YM6 A;  5B24 D;  2HIO A;  5GXQ A;  3X1S A;  2FJ7 D;  2Y2K A;  5AV5 B;  2Y2P A;  2ZY4 A;  3KXB A;  3LJA A;  4KHA A;  5AVB C;  3UTA A;  3AZK D;  2BYM A;  1P3M B;  2YFV B;  1ID3 D;  5CP6 B;  5AV8 D;  3W96 A;  4Z5T B;  4R8P D;  2G5I C;  1P3B A;  3KUY D;  3REK C;  4R8P C;  3KUY C;  4M6B A;  4WNN A;  3B6G D;  3MGR A;  1HQ3 A;  5E5A B;  1P3M C;  3B6G C;  5CP6 C;  4LD9 A;  3W98 A;  4Z5T C;  5B33 D;  2Y2O A;  4CSR B;  2FFF B;  1ULY A;  3AZE B;  5B40 A;  3KWQ B;  3LEL D;  3NQU A;  1U35 A;  5B2I B;  5AY8 B;  3LEL C;  3TU4 D;  5E5A C;  5B2J B;  3TU4 C;  4KUD D;  3A6N B;  4WU9 D;  2NQB A;  3AZG B;  2BYK B;  1ZLA B;  1TZY D;  5KDM A;  1TZY C;  1P3K D;  5GSU D;  5B0Y A;  4J8U C;  3WA9 B;  1P3K C;  1TAF A;  5B2I C;  5AY8 C;  1P3F B;  3MGQ D;  3EPJ A;  2DQN C;  3AZH C;  3REL D;  1A7W A;  4HGA C;  3REL C;  4UUZ B;  3VH5 W;  5DNM B;  3W99 B;  4CAY B;  3AZK A;  1S32 B;  3WKJ B;  3AV1 D;  1EQZ D;  1ID3 A;  1PZR A;  1P3O C;  1EQZ C;  5AV8 A;  3REK A;  4R8P A;  3REH B;  5BNV A;  3P5J B;  3KUY A;  4WZS B;  5B32 D;  4XUJ B;  5B31 G;  3MNN D;  5B32 C;  2ARO B;  3AFA B;  3AZL D;  2L5A A;  3X1T D;  1P3A D;  1P3L D;  3B6G A;  1P3I D;  3IP4 C;  4E45 A;  4YM6 B;  3B6F B;  2HIO B;  5GXQ B;  5CPI D;  3REH C;  1M19 D;  5B33 A;  4ZUX D;  3C1C B;  2IO5 C;  1M19 C;  4XUJ C;  4ZUX C;  4QLC D;  3REJ D;  4AWL C;  2ARO C;  2ZY5 A;  3REJ C;  1Q9C A;  3KXB B;  3AFA C;  2F8N K;  3LEL A;  4KHA B;  3LJA B;  3UTA B;  2F2A C;  3TU4 A;  4YM6 C;  2NZD D;  2HIO C;  4KUD A;  3REI D;  2XD5 A;  3C1C C;  1TZY A;  5DNN D;  3W96 B;  1P3B B;  4J8U A;  1P3K A;  4Z2M G;  3WAA C;  5B2I A;  4NE6 A;  4WNN B;  1P3G D;  4DRB A;  3MGR B;  3AZH A;  3MGQ A;  3AN2 D;  1HQ3 B;  1P3G C;  4EO5 B;  2J8P A;  3REL A;  4LD9 B;  4KGC D;  3W98 B;  3W96 C;  3AZN D;  4KGC C;  3AZN C;  4WJ3 C;  5AV9 D;  3MGP D;  2F8N D;  2UWX A;  5AV9 C;  5B40 B;  1P3O A;  3MGP C;  3AV1 A;  1JFI A;  1EQZ A;  3NQU B;  1U35 B;  4EO5 C;  1BH8 B;  3FDD A;  2PYO D;  1WWS A;  1F66 D;  5B32 A;  4LD9 C;  2NQB B;  2PYO C;  3MNN A;  1BFM A;  5KDM B;  3X1T A;  3X1U D;  5B0Y B;  1P3I A;  4H9Q A;  1TAF B;  5CPI A;  1M19 A;  4ZUX A;  3AYW C;  3REJ A;  3UT9 D;  4Z66 C;  4WV4 B;  3NQJ A;  3C1B C;  4J8W D;  5B0Y C;  5GT0 D;  3AZK B;  5B24 C;  3LZ1 D;  2NZD A;  3C1C A;  4G92 B;  1ID3 B;  2FJ7 C;  3AZI D;  5AV8 B;  3REK B;  4R8P B;  5BNV B;  4YS3 D;  1N1J A;  5B1L D;  3KUY B;  3WAA A;  2RVQ D;  4ZBJ B;  2RVQ C;  3AZK C;  5CPJ D;  1P3G A;  3B6G B;  3AN2 A;  4G92 C;  1ID3 C;  4KGC A;  5AV8 C;  3WTP D;  3AZN A;  5B33 B;  3VH6 W;  5AV9 A;  4Z2M H;  4ZBJ C;  3MGP A;  2F8N A;  3LEL B;  3KSY A;  3TU4 B;  2Y2H A;  4KUD B;  2PYO A;  3H0L C;  5B33 C;  3EPK A;  1TZY B;  3W97 D;  5FUG A;  4J8U B;  2XD1 A;  1P3K B;  3AZM D;  5GSU B;  5C3I B;  5AV5 D;  3AZM C;  4NE5 A;  1BH8 A;  3AYW A;  2Y2N A;  4KUD C;  3B0B A;  4UPK A;  3AZH B;  4WU9 C;  3MGQ B;  5CHL B;  5JRG D;  4HGA B;  4Z66 A;  3H0R C;  3REL B;  3C1B A;  1KX4 D;  4WU8 D;  5GSU C;  5B24 A;  5GT0 A;  3B0D C;  3VH6 A;  5C3I C;  4WU8 C;  3AZF D;  2FJ7 A;  1JFI B;  1P3O B;  3AV1 B;  3AZF C;  1EQZ B;  3MGS D;  3VH6 T;  4J8X D;  5JA4 A;  3MGQ C;  3AZI A;  4J8X C;  5B1L A;  5B31 D;  2G5H C;  5B32 B;  5B31 C;  2Y2I A;  3MNN B;  1M1A D;  4H9O A;  2ZY2 A;  1P3L B;  3X1T B;  2W8S A;  2ZY3 A;  3AV1 C;  4H9Q B;  1P3I B;  3LZ0 D;  5CPI B;  5GT3 D;  3WTP A;  3LZ0 C;  2IO5 B;  3AZE D;  1M19 B;  4ZUX B;  4AWL B;  1HTA A;  1KX5 D;  3REJ B;  3MNN C;  3AZL C;  1P3A C;  3X1T C;  1P3L C;  3NQJ B;  1AOI D;  1P3I C;  2NZD B;  2CV5 D;  3REI B;  5CPI C;  2CV5 C;  4QLC C;  3WAA B;  1N1J B;  3AZM A; 
#chains in the Genus database with same CATH homology
 2Y2M A;  4NFT A;  5BNX A;  2JSS A;  4JJN D;  4WU9 A;  2NZD C;  4H9N A;  3REI C;  1P3G B;  2RIQ A;  5DNM D;  3AN2 B;  3F6T A;  4X23 D;  5DNN C;  4X23 C;  3WKJ D;  4KGC B;  5GSU A;  3AZN B;  4WU8 A;  3R45 A;  4XZQ D;  3WTP E;  3EG5 B;  5AV9 B;  4XZQ C;  3MGP B;  3AZF A;  2F8N B;  2Y2G A;  4J8V D;  3MGS A;  4J8X A;  4J8V C;  3UTB D;  3AN2 C;  3UTB C;  4G91 B;  5B31 A;  5B0Z D;  2PYO B;  1Z2C B;  1WWI A;  3X1S D;  5FUG B;  1BH9 A;  3B0C T;  3LZ0 A;  5GT3 A;  3AYW B;  4G91 C;  3LJA D;  4H9R A;  1F66 C;  1KX5 A;  5AV6 D;  3AZL A;  4Z66 B;  1P3A A;  1P3L A;  2JE5 A;  3C1B B;  3X1U C;  3MVD D;  5B24 B;  1AOI A;  5GT0 B;  3MVD C;  3LZ1 B;  2CV5 A;  2FJ7 B;  3O62 D;  5BT1 D;  1P3P D;  5F99 D;  3V9R A;  4QLC A;  1P3P C;  5F99 C;  5JA4 B;  3AZI B;  4YS3 B;  5B1L B;  3UT9 C;  3KFU G;  1B6W A;  4J8W C;  5B1M D;  4H9O B;  5GT0 C;  4JJN A;  3REI A;  2BG1 A;  5B1M C;  3LZ1 C;  5DNN A;  4X23 A;  3AZI C;  3WTP B;  3AZJ D;  4YS3 C;  5CPK D;  5B1L C;  3AZJ C;  4XZQ A;  5CPK C;  3A1I A;  1P34 D;  2ZM5 A;  1P34 C;  4J8V A;  5CPJ C;  2VQR A;  3UTB A;  1M18 D;  1T3U A;  5BS7 C;  3WTP C;  2HUE B;  3H0M C;  2DF4 C;  1KX3 D;  5G49 A;  3W97 B;  1KX3 C;  3AZM B;  2YFW A;  5AVC D;  5BNX B;  3X1V D;  3AV2 D;  5AVC C;  5AVB D;  3X1V C;  4WU9 B;  1F66 A;  4H9N B;  3AV2 C;  1H3O A;  2HUE C;  5AV6 A;  5JRG B;  3W97 C;  3X1U A;  1KX4 B;  3B0D B;  4WU8 B;  3R45 B;  3MVD A;  4E44 A;  5AV5 C;  3REK D;  3AZF B;  3O62 A;  2Y2Q A;  1P3P A;  5F99 A;  3MGS B;  4J8X B;  3UT9 A;  5JRG C;  5B31 B;  1P3M D;  4J8W A;  1KX4 C;  5B1M A;  5CP6 D;  3LZ1 A;  4Z5T D;  1M1A B;  5BO0 A;  1BH9 B;  3MGS C;  3LZ0 B;  5GT3 B;  3AL0 C;  4YS3 A;  3AZJ A;  5CPK A;  4H9R B;  5E5A D;  1KX5 B;  4NE3 A;  3AZL B;  1P3A B;  1P34 A;  1M1A C;  5CPJ A;  4H9P A;  1AOI B;  1M18 A;  5BS7 A;  2CV5 B;  4J8U D;  5GT3 C;  3KWQ D;  3AZE C;  5B2I D;  5AY8 D;  3KWQ C;  3V9R B;  4QLC B;  1KX3 A;  5B2J D;  2F8N H;  1KX5 C;  3A6N D;  5B2J C;  4H9S C;  3A6N C;  3AZG D;  3AZH D;  3EPH A;  1ZLA D;  2JCH A;  5AVC A;  3AZG C;  3X1V A;  1ZLA C;  4JJN B;  3AV2 A;  1AOI C;  5AVB A;  3B0C W;  3WA9 D;  3W97 A;  5DNN B;  1KU5 A;  4X23 B;  3WA9 C;  1P3F D;  1P3F C;  1P3O D;  5AV5 A;  4XZQ B;  4JJN C;  4J8V B;  3W99 D;  5JRG A;  3UTB B;  5DNM C;  3W99 C;  1S32 D;  1KX4 A;  1S32 C;  5B0Z B;  1P3M A;  3WKJ C;  2YFV A;  5CP6 A;  5G49 B;  4Z5T A;  3REH D;  3X1S B;  4XUJ D;  2Y2L A;  5B32 G;  2YFW B;  2ARO D;  3AFA D;  1F66 B;  5E5A A;  5B0Z C;  3B6F D;  4YM6 D;  3VH5 A;  2HIO D;  1H3O B;  5GXQ D;  5AV6 B;  1M1A A;  3B6F C;  5GXQ C;  3X1U B;  3X1S C;  4CSR A;  3C1C D;  2BYM B;  3VH5 T;  3MVD B;  3AZE A;  3O62 B;  3KXB D;  3WAA D;  3KWQ A;  1P3P B;  3KXB C;  5F99 B;  1R4V A;  5AY8 A;  3LJA C;  3UTA D;  1F1E A;  5B2J A;  5AV6 C;  3UTA C;  3UT9 B;  4H9S A;  3A6N A;  2Y2J A;  3A1K A;  4J8W B;  4DQY B;  3AZG A;  2BYK A;  1ZLA A;  5B1M B;  3W96 D;  1P3B D;  1P3B C;  5BO0 B;  3O62 C;  5BT1 C;  3WA9 A;  2CWE A;  2LY8 A;  1P3F A;  3EPL A;  3AZJ B;  3MGR D;  5CPK B;  1B67 A;  1HQ3 D;  3MGR C;  4DRA A;  1HQ3 C;  4LD9 D;  1P34 B;  3W98 D;  5CPJ B;  4H9P B;  4UUZ A;  3W98 C;  5DNM A;  3W99 A;  4CAY A;  1W2E A;  1S32 A;  1M18 B;  3WKJ A;  5B40 D;  2F8N G;  5B40 C;  1U35 D;  1KX3 B;  1U35 C;  3REH A;  3AYW D;  2NQB D;  4XUJ A;  2NQB C;  2ARO A;  5AVC B;  3AFA A;  4Z66 D;  3X1V B;  3AV2 B;  1M18 C;  5AVB B;  5B0Z A;  3C1B D;  5B0Y D;  3B6F A;  4YM6 A;  5B24 D;  2HIO A;  5GXQ A;  3X1S A;  2FJ7 D;  2Y2K A;  5AV5 B;  2Y2P A;  2ZY4 A;  3KXB A;  3LJA A;  4KHA A;  5AVB C;  3UTA A;  3AZK D;  2BYM A;  1P3M B;  2YFV B;  1ID3 D;  5CP6 B;  5AV8 D;  3W96 A;  4Z5T B;  4R8P D;  2G5I C;  1P3B A;  3KUY D;  3REK C;  4R8P C;  3KUY C;  4M6B A;  4WNN A;  3B6G D;  3MGR A;  1HQ3 A;  5E5A B;  1P3M C;  3B6G C;  5CP6 C;  4LD9 A;  3W98 A;  4Z5T C;  5B33 D;  2Y2O A;  4CSR B;  2FFF B;  1ULY A;  3AZE B;  5B40 A;  3KWQ B;  3LEL D;  3NQU A;  1U35 A;  5B2I B;  5AY8 B;  3LEL C;  3TU4 D;  5E5A C;  5B2J B;  3TU4 C;  4KUD D;  3A6N B;  4WU9 D;  2NQB A;  3AZG B;  2BYK B;  1ZLA B;  1TZY D;  5KDM A;  1TZY C;  1P3K D;  5GSU D;  5B0Y A;  4J8U C;  3WA9 B;  1P3K C;  1TAF A;  5B2I C;  5AY8 C;  1P3F B;  3MGQ D;  3EPJ A;  2DQN C;  3AZH C;  3REL D;  1A7W A;  4HGA C;  3REL C;  4UUZ B;  3VH5 W;  5DNM B;  3W99 B;  4CAY B;  3AZK A;  1S32 B;  3WKJ B;  3AV1 D;  1EQZ D;  1ID3 A;  1PZR A;  1P3O C;  1EQZ C;  5AV8 A;  3REK A;  4R8P A;  3REH B;  5BNV A;  3P5J B;  3KUY A;  4WZS B;  5B32 D;  4XUJ B;  5B31 G;  3MNN D;  5B32 C;  2ARO B;  3AFA B;  3AZL D;  2L5A A;  3X1T D;  1P3A D;  1P3L D;  3B6G A;  1P3I D;  3IP4 C;  4E45 A;  4YM6 B;  3B6F B;  2HIO B;  5GXQ B;  5CPI D;  3REH C;  1M19 D;  5B33 A;  4ZUX D;  3C1C B;  2IO5 C;  1M19 C;  4XUJ C;  4ZUX C;  4QLC D;  3REJ D;  4AWL C;  2ARO C;  2ZY5 A;  3REJ C;  1Q9C A;  3KXB B;  3AFA C;  2F8N K;  3LEL A;  4KHA B;  3LJA B;  3UTA B;  2F2A C;  3TU4 A;  4YM6 C;  2NZD D;  2HIO C;  4KUD A;  3REI D;  2XD5 A;  3C1C C;  1TZY A;  5DNN D;  3W96 B;  1P3B B;  4J8U A;  1P3K A;  4Z2M G;  3WAA C;  5B2I A;  4NE6 A;  4WNN B;  1P3G D;  4DRB A;  3MGR B;  3AZH A;  3MGQ A;  3AN2 D;  1HQ3 B;  1P3G C;  4EO5 B;  2J8P A;  3REL A;  4LD9 B;  4KGC D;  3W98 B;  3W96 C;  3AZN D;  4KGC C;  3AZN C;  4WJ3 C;  5AV9 D;  3MGP D;  2F8N D;  2UWX A;  5AV9 C;  5B40 B;  1P3O A;  3MGP C;  3AV1 A;  1JFI A;  1EQZ A;  3NQU B;  1U35 B;  4EO5 C;  1BH8 B;  3FDD A;  2PYO D;  1WWS A;  1F66 D;  5B32 A;  4LD9 C;  2NQB B;  2PYO C;  3MNN A;  1BFM A;  5KDM B;  3X1T A;  3X1U D;  5B0Y B;  1P3I A;  4H9Q A;  1TAF B;  5CPI A;  1M19 A;  4ZUX A;  3AYW C;  3REJ A;  3UT9 D;  4Z66 C;  4WV4 B;  3NQJ A;  3C1B C;  4J8W D;  5B0Y C;  5GT0 D;  3AZK B;  5B24 C;  3LZ1 D;  2NZD A;  3C1C A;  4G92 B;  1ID3 B;  2FJ7 C;  3AZI D;  5AV8 B;  3REK B;  4R8P B;  5BNV B;  4YS3 D;  1N1J A;  5B1L D;  3KUY B;  3WAA A;  2RVQ D;  4ZBJ B;  2RVQ C;  3AZK C;  5CPJ D;  1P3G A;  3B6G B;  3AN2 A;  4G92 C;  1ID3 C;  4KGC A;  5AV8 C;  3WTP D;  3AZN A;  5B33 B;  3VH6 W;  5AV9 A;  4Z2M H;  4ZBJ C;  3MGP A;  2F8N A;  3LEL B;  3KSY A;  3TU4 B;  2Y2H A;  4KUD B;  2PYO A;  3H0L C;  5B33 C;  3EPK A;  1TZY B;  3W97 D;  5FUG A;  4J8U B;  2XD1 A;  1P3K B;  3AZM D;  5GSU B;  5C3I B;  5AV5 D;  3AZM C;  4NE5 A;  1BH8 A;  3AYW A;  2Y2N A;  4KUD C;  3B0B A;  4UPK A;  3AZH B;  4WU9 C;  3MGQ B;  5CHL B;  5JRG D;  4HGA B;  4Z66 A;  3H0R C;  3REL B;  3C1B A;  1KX4 D;  4WU8 D;  5GSU C;  5B24 A;  5GT0 A;  3B0D C;  3VH6 A;  5C3I C;  4WU8 C;  3AZF D;  2FJ7 A;  1JFI B;  1P3O B;  3AV1 B;  3AZF C;  1EQZ B;  3MGS D;  3VH6 T;  4J8X D;  5JA4 A;  3MGQ C;  3AZI A;  4J8X C;  5B1L A;  5B31 D;  2G5H C;  5B32 B;  5B31 C;  2Y2I A;  3MNN B;  1M1A D;  4H9O A;  2ZY2 A;  1P3L B;  3X1T B;  2W8S A;  2ZY3 A;  3AV1 C;  4H9Q B;  1P3I B;  3LZ0 D;  5CPI B;  5GT3 D;  3WTP A;  3LZ0 C;  2IO5 B;  3AZE D;  1M19 B;  4ZUX B;  4AWL B;  1HTA A;  1KX5 D;  3REJ B;  3MNN C;  3AZL C;  1P3A C;  3X1T C;  1P3L C;  3NQJ B;  1AOI D;  1P3I C;  2NZD B;  2CV5 D;  3REI B;  5CPI C;  2CV5 C;  4QLC C;  3WAA B;  1N1J B;  3AZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...