1S32B

Molecular recognition of the nucleosomal 'supergroove'
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
81
structure length
81
Chain Sequence
b'LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords palindromic alpha-satellite 146 bp DNA fragment
publication title Molecular Recognition of the Nucleosomal 'Supergroove'
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1s32B00
3O62B 3AZGB 3REIB 3LZ0D 3AFAD 3VH6W 1P3FA 2HIOB 3LZ1C 4JJNC 3RELC 3B0DB 4LD9B 1S32A 4X23B 5AV8C 1KX4C 1TZYB 2JSSA 3WAAC 1P3KB 3V9RA 3WKJD 3REKC 5B31C 2FJ7C 1BFMA 3MGSB 3AZJA 2CV5D 5CP6D 1ZLAB 1KX3B 1HQ3D 4R8PD 3UT9D 5E5AA 1P34A 3AZIC 5F99A 4XZQD 3MNND 1F66B 2NZDC 5BNXA 3TU4C 3AZLB 1P3ID 4ZUXA 3AZKD 5DNND 4Z5TD 3A6NB 3MGQD 5CPKB 4UUZA 3REJD 1M18A 5CPJD 4J8WD 3B6FA 4H9QB 1M19D 3MGPA 4Z66C 1P3OB 5B0YA 3AYWB 2CV5C 3REID 4XUJA 5B1MC 1H3OA 4NE5A 3LZ0A 3VH5T 3AFAA 4AWLB 4NE3A 4KGCB 1P3AB 1M1AA 3AN2D 3AZFA 3AZHC 5B2JD 3WKJA 3KUYB 4J8XA 1ZLAD 4EO5B 3AV1B 4E45A 4J8UB 3W96B 3X1VB 1HQ3A 3B6GB 4M6BA 5B24C 5BO0B 3AZLD 5FUGA 3MNNA 5GT0C 4YS3C 3AV2A 5B2ID 5BS7A 2NQBA 5B40A 3A6ND 5CPKD 5AY8D 5DNNA 5F99B 3AZEB 3B0CT 4Z5TA 5JRGD 3W99C 3LZ1B 3MGQA 2AROA 3REJA 5GXQC 3RELB 3NQJB 5CPJA 4ZUXB 4J8WA 3LJAC 3X1UA 1M19A 5BT1D 1EQZC 3AYWD 3VH5W 4HGAB 5CPIC 3AZGA 2PYOD 5B31B 3REIA 3C1CB 4H9SA 1F1EA 1A7WA 5B1LC 4WU8C 3LELC 3X1SC 5B32C 4LD9A 3KXBD 3MVDD 1TZYA 5B0ZD 3TU4B 1P3KA 1KX5D 3MGSA 4WU9D 5AV5C 3AV1D 1AOID 3VH6T 1ZLAA 1KX3A 3B6GD 3B0BA 3X1TD 1F66A 2PYOC 3AZLA 2CV5B 5CP6B 1ID3C 3UTBC 5B2IA 4R8PB 3AZNC 4YM6C 3A6NA 3LZ1D 4JJND 3UT9B 5AY8A 5CPKA 3RELD 4XZQB 5JRGA 1U35C 3C1BC 3WTPC 4H9QA 5AVBC 5AV8D 1P3IB 1KX4D 4DRAA 3WA9C 3W98C 3WAAD 3AZKB 1P3OA 5DNNB 4J8VC 1WWIA 3REKD 5B31D 3AYWA 4WU9C 2FJ7D 4Z5TB 3REJB 1P3LC 1B67A 1M19B 5GSUC 4KGCA 3AZID 2RVQC 2NZDD 3TU4D 4YS3B 5AV9C 2LY8A 1KX5A 1P3FC 4H9NB 3KUYA 3AN2B 3AV1A 1AOIA 1TAFB 4J8UA 3W96A 3X1VA 3B6GA 5BO0A 4Z66D 5CPIB 5B2JB 5B1MD 3AZEA 3X1SB 3LZ1A 5E5AC 4H9PB 3RELA 3W97C 5B32B 3NQJA 5AV6C 2F8ND 5B2IB 1KX4A 3AZHD 5DNMC 5AY8B 5B31A 5JRGB 1P3MC 3C1CA 5BNVA 5AV5B 4QLCC 5B24D 3B6FC 1ULYA 1BH8A 5GT0D 5B0YC 2PYOB 4YS3D 4G91B 4Z2MH 3TU4A 3UTBB 1P3BC 3W99D 5GXQD 3KXBB 3LJAD 3MVDB 2F8NH 3WTPE 3AZFC 2F8NK 5B0ZB 4CSRB 1EQZD 3WA9B 5CPID 1KX5B 3NQUB 4NFTA 1N1JB 4J8VB 5CP6A 4WU9B 2CV5A 1AOIB 5B1LD 4WU8D 5B1MA 3LELD 2IO5C 4J8XC 1P3LB 4R8PA 5GT3C 3X1SD 3UT9A 5AVCC 3X1TB 5B32D 5GSUB 4XZQA 5C3IC 1P3IA 3AZKA 3MGRC 3AV2C 4G92C 2NQBC 5B33C 1P3PC 4JJNB 5AV9B 5B40C 5AV5D 2AROC 5AV8B 1KX4B 3AZMC 1P3GC 3WAAB 5B24A 3X1UC 3REKB 2FJ7B 3O62C 5BNVB 1ID3D 4YS3A 3UTBD 3AZND 4YM6D 4H9NA 3AZIB 2HIOC 3AN2A 1BH8B 1U35D 2L5AA 1TAFA 3WTPD 3C1BD 3W97B 5AVBD 4LD9C 4X23C 2NZDB 3WA9D 3W98D 5AV6B 3UTAC 1TZYC 4J8VD 1P3KC 5CPIA 5B2JA 3KWQC 4KHAB 4KUDC 3MGSC 1P3LD 1P3MB 4WU8A 5GSUD 3X1SA 1KX3C 2RVQD 4Z66B 4H9PA 5B32A 3REHC 1F66C 5B1MB 5AV9D 1P3BB 1P3FD 5G49B 5AV5A 4CAYB 2F8NB 3AZHB 1P3OC 2PYOA 5B31G 1ID3A 3UTBA 2IO5B 5GT3B 5B24B 5KDMB 5AVCB 5E5AD 4KGCC 1P3AC 1M1AC 3KXBA 3W97D 5GT0B 5C3IB 5AV6D 3WTPA 5JA4A 3MVDA 5B0ZA 4CSRA 4WZSB 3WA9A 3MGRB 5DNMD 3NQUA 4J8VA 1N1JA 4WU9A 5B33B 1P3PB 1P3MD 3W99B 2HUEC 1P3LA 5GXQB 3KUYC 1S32C 3LJAB 4QLCD 3X1TA 4J8UC 3W96C 5GSUA 3X1VC 1EQZB 3B6FD 3AZMB 1P3GB 1Q9CA 2BYMB 5B0YD 3AZJC 2BYKB 5B1LB 4WU8B 4XUJD 3LELB 1P3BD 4Z2MG 4JJNA 5AV9A 1P34C 5F99C 3AZEC 5AV8A 3AZFD 4ZUXC 3WAAA 3UTAB 3REKA 1JFIB 2F8NG 2FJ7A 4HGAC 3KWQB 1M18C 4KUDB 4J8XD 3C1CC 5GT3D 5AVCD 3AZIA 3MGPC 4H9OB 2NZDA 3W97A 5CHLB 4XUJC 5AV6A 1ID3B 4E44A 3REHB 3MGRD 3AV2D 3LZ0C 2NQBD 4NE6A 5B33D 3AFAC 3AZNB 4YM6B 1P3PD 4KHAA 5DNMA 5B40D 1B6WA 1P3MA 1U35B 3C1BB 3WTPB 5JA4B 2AROD 5AVBB 3W98B 3AZMD 4QLCA 1P3GD 4Z66A 3X1UD 3VH6A 3O62D 1KU5A 3WKJC 3KSYA 2YFVB 3AZGD 4WNNB 4H9RB 5CP6C 2YFWB 1P3BA 3R45B 4ZBJC 1HQ3C 4R8PC 5G49A 2HIOD 3UT9C 4CAYA 4XZQC 1M1AB 3MNNC 2F8NA 5B32G 4X23D 4LD9D 3UTAD 1P3IC 5BS7C 1TZYD 1P3KD 3AZHA 3AZKC 1WWSA 3KWQD 5DNNC 4KUDD 1P3FB 4Z5TC 3MGSD 3MGQC 3REJC 2HUEB 5CPJC 4J8WC 1S32B 1KX3D 5GT3A 5KDMA 5AVCA 1M19C 3V9RB 5GT0A 3AZGC 3REHD 1F66D 3REIC 3AZJB 4H9SC 3MGRA 5B33A 1P3PA 3W99A 1BH9A 4WV4B 3B0DC 5E5AB 1P34B 5GXQA 3AN2C 3LJAA 5BNXB 1EQZA 3AZMA 1P3GA 5DNMB 1P3OD 2BYMA 2BYKA 5B2JC 3O62A 5B1LA 3LELA 4UUZB 1M18B 1ZLAC 4QLCB 3B6FB 2HIOA 3MGPB 1HTAA 1P3AD 1M1AD 4KGCD 5B0YB 4DRBA 3AZLC 4X23A 4XUJB 3UTAA 1JFIA 5B2IC 1H3OB 3LZ0B 3A6NC 3AFAB 3KWQA 5AY8C 5CPKC 4KUDA 5JRGC 3KUYD 1S32D 3AZFB 4J8UD 4H9OA 3W96D 3X1VD 5BT1C 3AYWC 3AZJD 3WKJB 3REHA 4G91C 3B0CW 4J8XB 3AZNA 4YM6A 1R4VA 4AWLC 1P34D 4ZBJB 5F99D 3AZED 1HQ3B 3VH5A 2CWEA 1U35A 3C1BA 5AVBA 3KXBC 3W98A 5FUGB 4ZUXD 3MNNB 3MVDC 5B0ZC 3AV2B 4G92B 2NQBB 1KX5C 2YFVA 1BH9B 5B40B 4WNNA 1M18D 4H9RA 4EO5C 2YFWA 3MGQB 3C1CD 3AV1C 1AOIC 2AROB 3R45A 3B6GC 5CPJB 3MGPD 4J8WB 3X1UB 3X1TC 1P3AA
chains in the Genus database with same CATH superfamily
3O62B 3AZGB 3REIB 3LZ0D 3AFAD 3VH6W 1P3FA 2HIOB 3LZ1C 4JJNC 3RELC 3B0DB 4LD9B 1S32A 4X23B 5AV8C 1KX4C 1TZYB 2JSSA 3WAAC 1P3KB 3V9RA 3WKJD 3REKC 5B31C 2FJ7C 1BFMA 3MGSB 3AZJA 2CV5D 5CP6D 1ZLAB 1KX3B 1HQ3D 4R8PD 3UT9D 5E5AA 1P34A 3AZIC 5F99A 4XZQD 3MNND 1F66B 2NZDC 5BNXA 3TU4C 3AZLB 1P3ID 4ZUXA 3AZKD 5DNND 4Z5TD 3A6NB 3MGQD 5CPKB 4UUZA 3REJD 1M18A 5CPJD 4J8WD 3A1KA 3B6FA 4H9QB 1M19D 3MGPA 3A1IA 4Z66C 2G5IC 2Y2OA 5B0YA 1P3OB 3AYWB 2CV5C 3REID 4XUJA 5B1MC 1H3OA 2Y2HA 4NE5A 3LZ0A 3VH5T 3AFAA 4AWLB 4NE3A 4KGCB 1P3AB 1M1AA 3AN2D 3AZFA 3H0LC 3AZHC 5B2JD 3WKJA 3KUYB 4J8XA 1ZLAD 4EO5B 3AV1B 4E45A 4J8UB 3W96B 3X1VB 1HQ3A 3B6GB 4M6BA 5B24C 5BO0B 2XD1A 3AZLD 5FUGA 3MNNA 5GT0C 4YS3C 2ZY5A 3AV2A 5B2ID 5BS7A 2NQBA 2ZY2A 5B40A 3A6ND 5CPKD 5AY8D 5DNNA 5F99B 3AZEB 3B0CT 4Z5TA 5JRGD 3EG5B 3W99C 3LZ1B 3MGQA 2AROA 3REJA 5GXQC 3RELB 3NQJB 5CPJA 4ZUXB 4J8WA 3LJAC 3X1UA 1M19A 5BT1D 1EQZC 3AYWD 3VH5W 4HGAB 5CPIC 3AZGA 2PYOD 5B31B 3REIA 3C1CB 4H9SA 1F1EA 1A7WA 5B1LC 2ZM5A 3LELC 4WU8C 3X1SC 5B32C 4LD9A 3KXBD 1Z2CB 2DF4C 3MVDD 1TZYA 5B0ZD 3TU4B 1P3KA 1KX5D 3MGSA 4WU9D 5AV5C 3AV1D 1AOID 3VH6T 1ZLAA 1KX3A 3B6GD 3B0BA 2Y2KA 3X1TD 1F66A 2PYOC 2UWXA 3AZLA 2CV5B 5CP6B 1ID3C 3UTBC 5B2IA 2ZY3A 4R8PB 3AZNC 4YM6C 3A6NA 3LZ1D 4JJND 3UT9B 5AY8A 5CPKA 3RELD 4XZQB 5JRGA 1U35C 3C1BC 3WTPC 4H9QA 5AVBC 5AV8D 1P3IB 1KX4D 4DRAA 3WA9C 3W98C 3WAAD 3AZKB 1P3OA 5DNNB 4J8VC 1WWIA 3REKD 5B31D 3AYWA 4WU9C 2FJ7D 4Z5TB 3REJB 1P3LC 1B67A 3IP4C 1M19B 5GSUC 4KGCA 3AZID 2RVQC 2NZDD 3TU4D 4YS3B 4WJ3C 5AV9C 2LY8A 1KX5A 1P3FC 4H9NB 3KUYA 3AN2B 3AV1A 1AOIA 1TAFB 4J8UA 3W96A 3X1VA 3B6GA 5BO0A 4Z66D 2JE5A 5CPIB 5B2JB 3EPKA 5B1MD 2G5HC 3AZEA 3X1SB 3LZ1A 5E5AC 4H9PB 3RELA 3W97C 5B32B 3NQJA 5AV6C 2F8ND 5B2IB 1KX4A 3AZHD 5DNMC 5AY8B 5B31A 5JRGB 1P3MC 3C1CA 5BNVA 5AV5B 4QLCC 5B24D 3B6FC 1ULYA 2ZY4A 1BH8A 5B0YC 5GT0D 2PYOB 4YS3D 3EPHA 4G91B 4Z2MH 3TU4A 3FDDA 2Y2PA 2XD5A 3UTBB 1P3BC 3W99D 5GXQD 3KXBB 3LJAD 3MVDB 2F8NH 3WTPE 3AZFC 2F8NK 5B0ZB 4CSRB 2W8SA 3F6TA 1EQZD 3WA9B 5CPID 1KX5B 3NQUB 4NFTA 1N1JB 4J8VB 5CP6A 4WU9B 2CV5A 1AOIB 5B1LD 4WU8D 5B1MA 3LELD 2IO5C 4J8XC 1P3LB 4R8PA 5GT3C 3X1SD 3UT9A 5AVCC 3X1TB 5B32D 5GSUB 4XZQA 2Y2MA 2BG1A 5C3IC 1P3IA 3AZKA 3MGRC 3AV2C 4G92C 2NQBC 5B33C 1P3PC 4JJNB 5AV9B 5B40C 5AV5D 2Y2NA 2AROC 5AV8B 1KX4B 3AZMC 1P3GC 3WAAB 5B24A 3X1UC 3REKB 2FJ7B 3O62C 5BNVB 1ID3D 4YS3A 3UTBD 3AZND 4YM6D 4H9NA 3AZIB 2HIOC 2F2AC 3AN2A 1BH8B 1U35D 2L5AA 1TAFA 3WTPD 3C1BD 3W97B 5AVBD 4LD9C 4X23C 2NZDB 3WA9D 3W98D 5AV6B 3UTAC 1TZYC 4J8VD 1P3KC 5CPIA 5B2JA 3KWQC 4KHAB 4KUDC 3MGSC 1P3LD 1P3MB 4WU8A 2Y2LA 4UPKA 5GSUD 3X1SA 1KX3C 3AL0C 2RVQD 4Z66B 4H9PA 5B32A 3REHC 1F66C 5B1MB 2RIQA 5AV9D 1P3BB 1P3FD 5G49B 5AV5A 4CAYB 2F8NB 2JCHA 3AZHB 1P3OC 2PYOA 5B31G 1ID3A 3UTBA 2IO5B 5GT3B 5B24B 5KDMB 5AVCB 5E5AD 4KGCC 1P3AC 1M1AC 3KXBA 3W97D 5GT0B 5C3IB 5AV6D 3WTPA 5JA4A 3MVDA 5B0ZA 4CSRA 4WZSB 3WA9A 3MGRB 5DNMD 3NQUA 4J8VA 1N1JA 4WU9A 5B33B 1P3PB 1P3MD 3W99B 2HUEC 1P3LA 5GXQB 3KUYC 1S32C 3LJAB 4QLCD 3X1TA 4J8UC 3W96C 5GSUA 3X1VC 1EQZB 3B6FD 3AZMB 1P3GB 3KFUG 1Q9CA 2BYMB 5B0YD 3AZJC 2BYKB 5B1LB 4WU8B 4XUJD 3LELB 1P3BD 4Z2MG 4JJNA 5AV9A 1P34C 5F99C 3AZEC 4DQYB 5AV8A 3AZFD 4ZUXC 3WAAA 3UTAB 3REKA 1JFIB 2F8NG 2FJ7A 4HGAC 3KWQB 1M18C 4KUDB 4J8XD 3C1CC 5GT3D 5AVCD 3AZIA 3MGPC 4H9OB 2NZDA 3W97A 5CHLB 4XUJC 5AV6A 1ID3B 4E44A 3REHB 3MGRD 3AV2D 3LZ0C 2NQBD 4NE6A 5B33D 3AFAC 3AZNB 4YM6B 1P3PD 4KHAA 5DNMA 5B40D 1B6WA 2DQNC 1P3MA 1U35B 3C1BB 3WTPB 5JA4B 2AROD 5AVBB 3W98B 3AZMD 4QLCA 1P3GD 4Z66A 2VQRA 3X1UD 3VH6A 3O62D 1KU5A 3WKJC 3KSYA 2YFVB 3AZGD 2Y2QA 4WNNB 4H9RB 5CP6C 2YFWB 1P3BA 3R45B 4ZBJC 1T3UA 1HQ3C 4R8PC 5G49A 2HIOD 3UT9C 4CAYA 4XZQC 1M1AB 3MNNC 2F8NA 5B32G 4X23D 4LD9D 3UTAD 1P3IC 5BS7C 1TZYD 1P3KD 3AZHA 3AZKC 1WWSA 3KWQD 5DNNC 4KUDD 1P3FB 3P5JB 4Z5TC 3MGSD 3MGQC 3REJC 2HUEB 5CPJC 4J8WC 1S32B 1KX3D 5GT3A 5KDMA 5AVCA 1M19C 3EPJA 3V9RB 5GT0A 3AZGC 3REHD 1F66D 3REIC 3H0RC 3AZJB 4H9SC 1PZRA 3MGRA 2J8PA 5B33A 1P3PA 3W99A 1BH9A 4WV4B 3B0DC 5E5AB 1W2EA 5GXQA 1P34B 3AN2C 3H0MC 3LJAA 5BNXB 1EQZA 3AZMA 1P3GA 5DNMB 1P3OD 2BYMA 2Y2JA 2BYKA 5B2JC 3O62A 5B1LA 3LELA 4UUZB 1M18B 1ZLAC 4QLCB 3B6FB 2HIOA 3MGPB 1HTAA 1P3AD 1M1AD 4KGCD 5B0YB 4DRBA 3AZLC 4X23A 4XUJB 3UTAA 1JFIA 5B2IC 1H3OB 3LZ0B 3A6NC 3AFAB 3KWQA 5AY8C 5CPKC 4KUDA 5JRGC 3KUYD 1S32D 3EPLA 2Y2IA 3AZFB 4J8UD 4H9OA 3W96D 3X1VD 5BT1C 3AYWC 2FFFB 3AZJD 3WKJB 3REHA 4G91C 3B0CW 4J8XB 3AZNA 4YM6A 1R4VA 4AWLC 1P34D 4ZBJB 5F99D 3AZED 1HQ3B 3VH5A 2CWEA 1U35A 3C1BA 2Y2GA 5AVBA 3KXBC 3W98A 5FUGB 4ZUXD 3MNNB 3MVDC 5B0ZC 3AV2B 4G92B 2NQBB 1KX5C 2YFVA 1BH9B 5B40B 4WNNA 1M18D 4H9RA 4EO5C 2YFWA 3MGQB 3C1CD 3AV1C 1AOIC 2AROB 3R45A 3B6GC 5CPJB 3MGPD 4J8WB 3X1UB 3X1TC 1P3AA
chains in the Genus database with same CATH topology
3O62B 3AZGB 3REIB 3LZ0D 3AFAD 3VH6W 1P3FA 2HIOB 3LZ1C 4JJNC 3RELC 3B0DB 4LD9B 1S32A 4X23B 5AV8C 1KX4C 1TZYB 2JSSA 3WAAC 1P3KB 3V9RA 3WKJD 3REKC 5B31C 2FJ7C 1BFMA 3MGSB 3AZJA 2CV5D 5CP6D 1ZLAB 1KX3B 1HQ3D 4R8PD 3UT9D 5E5AA 1P34A 3AZIC 5F99A 4XZQD 3MNND 1F66B 2NZDC 5BNXA 3TU4C 3AZLB 1P3ID 4ZUXA 3AZKD 5DNND 4Z5TD 3A6NB 3MGQD 5CPKB 4UUZA 3REJD 1M18A 5CPJD 4J8WD 3A1KA 3B6FA 4H9QB 1M19D 3MGPA 3A1IA 4Z66C 2G5IC 2Y2OA 5B0YA 1P3OB 3AYWB 2CV5C 3REID 4XUJA 5B1MC 1H3OA 2Y2HA 4NE5A 3LZ0A 3VH5T 3AFAA 4AWLB 4NE3A 4KGCB 1P3AB 1M1AA 3AN2D 3AZFA 3H0LC 3AZHC 5B2JD 3WKJA 3KUYB 4J8XA 1ZLAD 4EO5B 3AV1B 4E45A 4J8UB 3W96B 3X1VB 1HQ3A 3B6GB 4M6BA 5B24C 5BO0B 2XD1A 3AZLD 5FUGA 3MNNA 5GT0C 4YS3C 2ZY5A 3AV2A 5B2ID 5BS7A 2NQBA 2ZY2A 5B40A 3A6ND 5CPKD 5AY8D 5DNNA 5F99B 3AZEB 3B0CT 4Z5TA 5JRGD 3EG5B 3W99C 3LZ1B 3MGQA 2AROA 3REJA 5GXQC 3RELB 3NQJB 5CPJA 4ZUXB 4J8WA 3LJAC 3X1UA 1M19A 5BT1D 1EQZC 3AYWD 3VH5W 4HGAB 5CPIC 3AZGA 2PYOD 5B31B 3REIA 3C1CB 4H9SA 1F1EA 1A7WA 5B1LC 2ZM5A 3LELC 4WU8C 3X1SC 5B32C 4LD9A 3KXBD 1Z2CB 2DF4C 3MVDD 1TZYA 5B0ZD 3TU4B 1P3KA 1KX5D 3MGSA 4WU9D 5AV5C 3AV1D 1AOID 3VH6T 1ZLAA 1KX3A 3B6GD 3B0BA 2Y2KA 3X1TD 1F66A 2PYOC 2UWXA 3AZLA 2CV5B 5CP6B 1ID3C 3UTBC 5B2IA 2ZY3A 4R8PB 3AZNC 4YM6C 3A6NA 3LZ1D 4JJND 3UT9B 5AY8A 5CPKA 3RELD 4XZQB 5JRGA 1U35C 3C1BC 3WTPC 4H9QA 5AVBC 5AV8D 1P3IB 1KX4D 4DRAA 3WA9C 3W98C 3WAAD 3AZKB 1P3OA 5DNNB 4J8VC 1WWIA 3REKD 5B31D 3AYWA 4WU9C 2FJ7D 4Z5TB 3REJB 1P3LC 1B67A 3IP4C 1M19B 5GSUC 4KGCA 3AZID 2RVQC 2NZDD 3TU4D 4YS3B 4WJ3C 5AV9C 2LY8A 1KX5A 1P3FC 4H9NB 3KUYA 3AN2B 3AV1A 1AOIA 1TAFB 4J8UA 3W96A 3X1VA 3B6GA 5BO0A 4Z66D 2JE5A 5CPIB 5B2JB 3EPKA 5B1MD 2G5HC 3AZEA 3X1SB 3LZ1A 5E5AC 4H9PB 3RELA 3W97C 5B32B 3NQJA 5AV6C 2F8ND 5B2IB 1KX4A 3AZHD 5DNMC 5AY8B 5B31A 5JRGB 1P3MC 3C1CA 5BNVA 5AV5B 4QLCC 5B24D 3B6FC 1ULYA 2ZY4A 1BH8A 5B0YC 5GT0D 2PYOB 4YS3D 3EPHA 4G91B 4Z2MH 3TU4A 3FDDA 2Y2PA 2XD5A 3UTBB 1P3BC 3W99D 5GXQD 3KXBB 3LJAD 3MVDB 2F8NH 3WTPE 3AZFC 2F8NK 5B0ZB 4CSRB 2W8SA 3F6TA 1EQZD 3WA9B 5CPID 1KX5B 3NQUB 4NFTA 1N1JB 4J8VB 5CP6A 4WU9B 2CV5A 1AOIB 5B1LD 4WU8D 5B1MA 3LELD 2IO5C 4J8XC 1P3LB 4R8PA 5GT3C 3X1SD 3UT9A 5AVCC 3X1TB 5B32D 5GSUB 4XZQA 2Y2MA 2BG1A 5C3IC 1P3IA 3AZKA 3MGRC 3AV2C 4G92C 2NQBC 5B33C 1P3PC 4JJNB 5AV9B 5B40C 5AV5D 2Y2NA 2AROC 5AV8B 1KX4B 3AZMC 1P3GC 3WAAB 5B24A 3X1UC 3REKB 2FJ7B 3O62C 5BNVB 1ID3D 4YS3A 3UTBD 3AZND 4YM6D 4H9NA 3AZIB 2HIOC 2F2AC 3AN2A 1BH8B 1U35D 2L5AA 1TAFA 3WTPD 3C1BD 3W97B 5AVBD 4LD9C 4X23C 2NZDB 3WA9D 3W98D 5AV6B 3UTAC 1TZYC 4J8VD 1P3KC 5CPIA 5B2JA 3KWQC 4KHAB 4KUDC 3MGSC 1P3LD 1P3MB 4WU8A 2Y2LA 4UPKA 5GSUD 3X1SA 1KX3C 3AL0C 2RVQD 4Z66B 4H9PA 5B32A 3REHC 1F66C 5B1MB 2RIQA 5AV9D 1P3BB 1P3FD 5G49B 5AV5A 4CAYB 2F8NB 2JCHA 3AZHB 1P3OC 2PYOA 5B31G 1ID3A 3UTBA 2IO5B 5GT3B 5B24B 5KDMB 5AVCB 5E5AD 4KGCC 1P3AC 1M1AC 3KXBA 3W97D 5GT0B 5C3IB 5AV6D 3WTPA 5JA4A 3MVDA 5B0ZA 4CSRA 4WZSB 3WA9A 3MGRB 5DNMD 3NQUA 4J8VA 1N1JA 4WU9A 5B33B 1P3PB 1P3MD 3W99B 2HUEC 1P3LA 5GXQB 3KUYC 1S32C 3LJAB 4QLCD 3X1TA 4J8UC 3W96C 5GSUA 3X1VC 1EQZB 3B6FD 3AZMB 1P3GB 3KFUG 1Q9CA 2BYMB 5B0YD 3AZJC 2BYKB 5B1LB 4WU8B 4XUJD 3LELB 1P3BD 4Z2MG 4JJNA 5AV9A 1P34C 5F99C 3AZEC 4DQYB 5AV8A 3AZFD 4ZUXC 3WAAA 3UTAB 3REKA 1JFIB 2F8NG 2FJ7A 4HGAC 3KWQB 1M18C 4KUDB 4J8XD 3C1CC 5GT3D 5AVCD 3AZIA 3MGPC 4H9OB 2NZDA 3W97A 5CHLB 4XUJC 5AV6A 1ID3B 4E44A 3REHB 3MGRD 3AV2D 3LZ0C 2NQBD 4NE6A 5B33D 3AFAC 3AZNB 4YM6B 1P3PD 4KHAA 5DNMA 5B40D 1B6WA 2DQNC 1P3MA 1U35B 3C1BB 3WTPB 5JA4B 2AROD 5AVBB 3W98B 3AZMD 4QLCA 1P3GD 4Z66A 2VQRA 3X1UD 3VH6A 3O62D 1KU5A 3WKJC 3KSYA 2YFVB 3AZGD 2Y2QA 4WNNB 4H9RB 5CP6C 2YFWB 1P3BA 3R45B 4ZBJC 1T3UA 1HQ3C 4R8PC 5G49A 2HIOD 3UT9C 4CAYA 4XZQC 1M1AB 3MNNC 2F8NA 5B32G 4X23D 4LD9D 3UTAD 1P3IC 5BS7C 1TZYD 1P3KD 3AZHA 3AZKC 1WWSA 3KWQD 5DNNC 4KUDD 1P3FB 3P5JB 4Z5TC 3MGSD 3MGQC 3REJC 2HUEB 5CPJC 4J8WC 1S32B 1KX3D 5GT3A 5KDMA 5AVCA 1M19C 3EPJA 3V9RB 5GT0A 3AZGC 3REHD 1F66D 3REIC 3H0RC 3AZJB 4H9SC 1PZRA 3MGRA 2J8PA 5B33A 1P3PA 3W99A 1BH9A 4WV4B 3B0DC 5E5AB 1W2EA 5GXQA 1P34B 3AN2C 3H0MC 3LJAA 5BNXB 1EQZA 3AZMA 1P3GA 5DNMB 1P3OD 2BYMA 2Y2JA 2BYKA 5B2JC 3O62A 5B1LA 3LELA 4UUZB 1M18B 1ZLAC 4QLCB 3B6FB 2HIOA 3MGPB 1HTAA 1P3AD 1M1AD 4KGCD 5B0YB 4DRBA 3AZLC 4X23A 4XUJB 3UTAA 1JFIA 5B2IC 1H3OB 3LZ0B 3A6NC 3AFAB 3KWQA 5AY8C 5CPKC 4KUDA 5JRGC 3KUYD 1S32D 3EPLA 2Y2IA 3AZFB 4J8UD 4H9OA 3W96D 3X1VD 5BT1C 3AYWC 2FFFB 3AZJD 3WKJB 3REHA 4G91C 3B0CW 4J8XB 3AZNA 4YM6A 1R4VA 4AWLC 1P34D 4ZBJB 5F99D 3AZED 1HQ3B 3VH5A 2CWEA 1U35A 3C1BA 2Y2GA 5AVBA 3KXBC 3W98A 5FUGB 4ZUXD 3MNNB 3MVDC 5B0ZC 3AV2B 4G92B 2NQBB 1KX5C 2YFVA 1BH9B 5B40B 4WNNA 1M18D 4H9RA 4EO5C 2YFWA 3MGQB 3C1CD 3AV1C 1AOIC 2AROB 3R45A 3B6GC 5CPJB 3MGPD 4J8WB 3X1UB 3X1TC 1P3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O62 B;  3AZG B;  3REI B;  3LZ0 D;  3AFA D;  3VH6 W;  1P3F A;  2HIO B;  3LZ1 C;  4JJN C;  3REL C;  3B0D B;  4LD9 B;  1S32 A;  4X23 B;  5AV8 C;  1KX4 C;  1TZY B;  2JSS A;  3WAA C;  1P3K B;  3V9R A;  3WKJ D;  3REK C;  5B31 C;  2FJ7 C;  1BFM A;  3MGS B;  3AZJ A;  2CV5 D;  5CP6 D;  1ZLA B;  1KX3 B;  1HQ3 D;  4R8P D;  3UT9 D;  5E5A A;  1P34 A;  3AZI C;  5F99 A;  4XZQ D;  3MNN D;  1F66 B;  2NZD C;  5BNX A;  3TU4 C;  3AZL B;  1P3I D;  4ZUX A;  3AZK D;  5DNN D;  4Z5T D;  3A6N B;  3MGQ D;  5CPK B;  4UUZ A;  3REJ D;  1M18 A;  5CPJ D;  4J8W D;  3B6F A;  4H9Q B;  1M19 D;  3MGP A;  4Z66 C;  1P3O B;  5B0Y A;  3AYW B;  2CV5 C;  3REI D;  4XUJ A;  5B1M C;  1H3O A;  4NE5 A;  3LZ0 A;  3VH5 T;  3AFA A;  4AWL B;  4NE3 A;  4KGC B;  1P3A B;  1M1A A;  3AN2 D;  3AZF A;  3AZH C;  5B2J D;  3WKJ A;  3KUY B;  4J8X A;  1ZLA D;  4EO5 B;  3AV1 B;  4E45 A;  4J8U B;  3W96 B;  3X1V B;  1HQ3 A;  3B6G B;  4M6B A;  5B24 C;  5BO0 B;  3AZL D;  5FUG A;  3MNN A;  5GT0 C;  4YS3 C;  3AV2 A;  5B2I D;  5BS7 A;  2NQB A;  5B40 A;  3A6N D;  5CPK D;  5AY8 D;  5DNN A;  5F99 B;  3AZE B;  3B0C T;  4Z5T A;  5JRG D;  3W99 C;  3LZ1 B;  3MGQ A;  2ARO A;  3REJ A;  5GXQ C;  3REL B;  3NQJ B;  5CPJ A;  4ZUX B;  4J8W A;  3LJA C;  3X1U A;  1M19 A;  5BT1 D;  1EQZ C;  3AYW D;  3VH5 W;  4HGA B;  5CPI C;  3AZG A;  2PYO D;  5B31 B;  3REI A;  3C1C B;  4H9S A;  1F1E A;  1A7W A;  5B1L C;  4WU8 C;  3LEL C;  3X1S C;  5B32 C;  4LD9 A;  3KXB D;  3MVD D;  1TZY A;  5B0Z D;  3TU4 B;  1P3K A;  1KX5 D;  3MGS A;  4WU9 D;  5AV5 C;  3AV1 D;  1AOI D;  3VH6 T;  1ZLA A;  1KX3 A;  3B6G D;  3B0B A;  3X1T D;  1F66 A;  2PYO C;  3AZL A;  2CV5 B;  5CP6 B;  1ID3 C;  3UTB C;  5B2I A;  4R8P B;  3AZN C;  4YM6 C;  3A6N A;  3LZ1 D;  4JJN D;  3UT9 B;  5AY8 A;  5CPK A;  3REL D;  4XZQ B;  5JRG A;  1U35 C;  3C1B C;  3WTP C;  4H9Q A;  5AVB C;  5AV8 D;  1P3I B;  1KX4 D;  4DRA A;  3WA9 C;  3W98 C;  3WAA D;  3AZK B;  1P3O A;  5DNN B;  4J8V C;  1WWI A;  3REK D;  5B31 D;  3AYW A;  4WU9 C;  2FJ7 D;  4Z5T B;  3REJ B;  1P3L C;  1B67 A;  1M19 B;  5GSU C;  4KGC A;  3AZI D;  2RVQ C;  2NZD D;  3TU4 D;  4YS3 B;  5AV9 C;  2LY8 A;  1KX5 A;  1P3F C;  4H9N B;  3KUY A;  3AN2 B;  3AV1 A;  1AOI A;  1TAF B;  4J8U A;  3W96 A;  3X1V A;  3B6G A;  5BO0 A;  4Z66 D;  5CPI B;  5B2J B;  5B1M D;  3AZE A;  3X1S B;  3LZ1 A;  5E5A C;  4H9P B;  3REL A;  3W97 C;  5B32 B;  3NQJ A;  5AV6 C;  2F8N D;  5B2I B;  1KX4 A;  3AZH D;  5DNM C;  5AY8 B;  5B31 A;  5JRG B;  1P3M C;  3C1C A;  5BNV A;  5AV5 B;  4QLC C;  5B24 D;  3B6F C;  1ULY A;  1BH8 A;  5GT0 D;  5B0Y C;  2PYO B;  4YS3 D;  4G91 B;  4Z2M H;  3TU4 A;  3UTB B;  1P3B C;  3W99 D;  5GXQ D;  3KXB B;  3LJA D;  3MVD B;  2F8N H;  3WTP E;  3AZF C;  2F8N K;  5B0Z B;  4CSR B;  1EQZ D;  3WA9 B;  5CPI D;  1KX5 B;  3NQU B;  4NFT A;  1N1J B;  4J8V B;  5CP6 A;  4WU9 B;  2CV5 A;  1AOI B;  5B1L D;  4WU8 D;  5B1M A;  3LEL D;  2IO5 C;  4J8X C;  1P3L B;  4R8P A;  5GT3 C;  3X1S D;  3UT9 A;  5AVC C;  3X1T B;  5B32 D;  5GSU B;  4XZQ A;  5C3I C;  1P3I A;  3AZK A;  3MGR C;  3AV2 C;  4G92 C;  2NQB C;  5B33 C;  1P3P C;  4JJN B;  5AV9 B;  5B40 C;  5AV5 D;  2ARO C;  5AV8 B;  1KX4 B;  3AZM C;  1P3G C;  3WAA B;  5B24 A;  3X1U C;  3REK B;  2FJ7 B;  3O62 C;  5BNV B;  1ID3 D;  4YS3 A;  3UTB D;  3AZN D;  4YM6 D;  4H9N A;  3AZI B;  2HIO C;  3AN2 A;  1BH8 B;  1U35 D;  2L5A A;  1TAF A;  3WTP D;  3C1B D;  3W97 B;  5AVB D;  4LD9 C;  4X23 C;  2NZD B;  3WA9 D;  3W98 D;  5AV6 B;  3UTA C;  1TZY C;  4J8V D;  1P3K C;  5CPI A;  5B2J A;  3KWQ C;  4KHA B;  4KUD C;  3MGS C;  1P3L D;  1P3M B;  4WU8 A;  5GSU D;  3X1S A;  1KX3 C;  2RVQ D;  4Z66 B;  4H9P A;  5B32 A;  3REH C;  1F66 C;  5B1M B;  5AV9 D;  1P3B B;  1P3F D;  5G49 B;  5AV5 A;  4CAY B;  2F8N B;  3AZH B;  1P3O C;  2PYO A;  5B31 G;  1ID3 A;  3UTB A;  2IO5 B;  5GT3 B;  5B24 B;  5KDM B;  5AVC B;  5E5A D;  4KGC C;  1P3A C;  1M1A C;  3KXB A;  3W97 D;  5GT0 B;  5C3I B;  5AV6 D;  3WTP A;  5JA4 A;  3MVD A;  5B0Z A;  4CSR A;  4WZS B;  3WA9 A;  3MGR B;  5DNM D;  3NQU A;  4J8V A;  1N1J A;  4WU9 A;  5B33 B;  1P3P B;  1P3M D;  3W99 B;  2HUE C;  1P3L A;  5GXQ B;  3KUY C;  1S32 C;  3LJA B;  4QLC D;  3X1T A;  4J8U C;  3W96 C;  5GSU A;  3X1V C;  1EQZ B;  3B6F D;  3AZM B;  1P3G B;  1Q9C A;  2BYM B;  5B0Y D;  3AZJ C;  2BYK B;  5B1L B;  4WU8 B;  4XUJ D;  3LEL B;  1P3B D;  4Z2M G;  4JJN A;  5AV9 A;  1P34 C;  5F99 C;  3AZE C;  5AV8 A;  3AZF D;  4ZUX C;  3WAA A;  3UTA B;  3REK A;  1JFI B;  2F8N G;  2FJ7 A;  4HGA C;  3KWQ B;  1M18 C;  4KUD B;  4J8X D;  3C1C C;  5GT3 D;  5AVC D;  3AZI A;  3MGP C;  4H9O B;  2NZD A;  3W97 A;  5CHL B;  4XUJ C;  5AV6 A;  1ID3 B;  4E44 A;  3REH B;  3MGR D;  3AV2 D;  3LZ0 C;  2NQB D;  4NE6 A;  5B33 D;  3AFA C;  3AZN B;  4YM6 B;  1P3P D;  4KHA A;  5DNM A;  5B40 D;  1B6W A;  1P3M A;  1U35 B;  3C1B B;  3WTP B;  5JA4 B;  2ARO D;  5AVB B;  3W98 B;  3AZM D;  4QLC A;  1P3G D;  4Z66 A;  3X1U D;  3VH6 A;  3O62 D;  1KU5 A;  3WKJ C;  3KSY A;  2YFV B;  3AZG D;  4WNN B;  4H9R B;  5CP6 C;  2YFW B;  1P3B A;  3R45 B;  4ZBJ C;  1HQ3 C;  4R8P C;  5G49 A;  2HIO D;  3UT9 C;  4CAY A;  4XZQ C;  1M1A B;  3MNN C;  2F8N A;  5B32 G;  4X23 D;  4LD9 D;  3UTA D;  1P3I C;  5BS7 C;  1TZY D;  1P3K D;  3AZH A;  3AZK C;  1WWS A;  3KWQ D;  5DNN C;  4KUD D;  1P3F B;  4Z5T C;  3MGS D;  3MGQ C;  3REJ C;  2HUE B;  5CPJ C;  4J8W C;  1S32 B;  1KX3 D;  5GT3 A;  5KDM A;  5AVC A;  1M19 C;  3V9R B;  5GT0 A;  3AZG C;  3REH D;  1F66 D;  3REI C;  3AZJ B;  4H9S C;  3MGR A;  5B33 A;  1P3P A;  3W99 A;  1BH9 A;  4WV4 B;  3B0D C;  5E5A B;  1P34 B;  5GXQ A;  3AN2 C;  3LJA A;  5BNX B;  1EQZ A;  3AZM A;  1P3G A;  5DNM B;  1P3O D;  2BYM A;  2BYK A;  5B2J C;  3O62 A;  5B1L A;  3LEL A;  4UUZ B;  1M18 B;  1ZLA C;  4QLC B;  3B6F B;  2HIO A;  3MGP B;  1HTA A;  1P3A D;  1M1A D;  4KGC D;  5B0Y B;  4DRB A;  3AZL C;  4X23 A;  4XUJ B;  3UTA A;  1JFI A;  5B2I C;  1H3O B;  3LZ0 B;  3A6N C;  3AFA B;  3KWQ A;  5AY8 C;  5CPK C;  4KUD A;  5JRG C;  3KUY D;  1S32 D;  3AZF B;  4J8U D;  4H9O A;  3W96 D;  3X1V D;  5BT1 C;  3AYW C;  3AZJ D;  3WKJ B;  3REH A;  4G91 C;  3B0C W;  4J8X B;  3AZN A;  4YM6 A;  1R4V A;  4AWL C;  1P34 D;  4ZBJ B;  5F99 D;  3AZE D;  1HQ3 B;  3VH5 A;  2CWE A;  1U35 A;  3C1B A;  5AVB A;  3KXB C;  3W98 A;  5FUG B;  4ZUX D;  3MNN B;  3MVD C;  5B0Z C;  3AV2 B;  4G92 B;  2NQB B;  1KX5 C;  2YFV A;  1BH9 B;  5B40 B;  4WNN A;  1M18 D;  4H9R A;  4EO5 C;  2YFW A;  3MGQ B;  3C1C D;  3AV1 C;  1AOI C;  2ARO B;  3R45 A;  3B6G C;  5CPJ B;  3MGP D;  4J8W B;  3X1U B;  3X1T C;  1P3A A; 
#chains in the Genus database with same CATH topology
 3O62 B;  3AZG B;  3REI B;  3LZ0 D;  3AFA D;  3VH6 W;  1P3F A;  2HIO B;  3LZ1 C;  4JJN C;  3REL C;  3B0D B;  4LD9 B;  1S32 A;  4X23 B;  5AV8 C;  1KX4 C;  1TZY B;  2JSS A;  3WAA C;  1P3K B;  3V9R A;  3WKJ D;  3REK C;  5B31 C;  2FJ7 C;  1BFM A;  3MGS B;  3AZJ A;  2CV5 D;  5CP6 D;  1ZLA B;  1KX3 B;  1HQ3 D;  4R8P D;  3UT9 D;  5E5A A;  1P34 A;  3AZI C;  5F99 A;  4XZQ D;  3MNN D;  1F66 B;  2NZD C;  5BNX A;  3TU4 C;  3AZL B;  1P3I D;  4ZUX A;  3AZK D;  5DNN D;  4Z5T D;  3A6N B;  3MGQ D;  5CPK B;  4UUZ A;  3REJ D;  1M18 A;  5CPJ D;  4J8W D;  3A1K A;  3B6F A;  4H9Q B;  1M19 D;  3MGP A;  3A1I A;  4Z66 C;  2G5I C;  2Y2O A;  5B0Y A;  1P3O B;  3AYW B;  2CV5 C;  3REI D;  4XUJ A;  5B1M C;  1H3O A;  2Y2H A;  4NE5 A;  3LZ0 A;  3VH5 T;  3AFA A;  4AWL B;  4NE3 A;  4KGC B;  1P3A B;  1M1A A;  3AN2 D;  3AZF A;  3H0L C;  3AZH C;  5B2J D;  3WKJ A;  3KUY B;  4J8X A;  1ZLA D;  4EO5 B;  3AV1 B;  4E45 A;  4J8U B;  3W96 B;  3X1V B;  1HQ3 A;  3B6G B;  4M6B A;  5B24 C;  5BO0 B;  2XD1 A;  3AZL D;  5FUG A;  3MNN A;  5GT0 C;  4YS3 C;  2ZY5 A;  3AV2 A;  5B2I D;  5BS7 A;  2NQB A;  2ZY2 A;  5B40 A;  3A6N D;  5CPK D;  5AY8 D;  5DNN A;  5F99 B;  3AZE B;  3B0C T;  4Z5T A;  5JRG D;  3EG5 B;  3W99 C;  3LZ1 B;  3MGQ A;  2ARO A;  3REJ A;  5GXQ C;  3REL B;  3NQJ B;  5CPJ A;  4ZUX B;  4J8W A;  3LJA C;  3X1U A;  1M19 A;  5BT1 D;  1EQZ C;  3AYW D;  3VH5 W;  4HGA B;  5CPI C;  3AZG A;  2PYO D;  5B31 B;  3REI A;  3C1C B;  4H9S A;  1F1E A;  1A7W A;  5B1L C;  2ZM5 A;  3LEL C;  4WU8 C;  3X1S C;  5B32 C;  4LD9 A;  3KXB D;  1Z2C B;  2DF4 C;  3MVD D;  1TZY A;  5B0Z D;  3TU4 B;  1P3K A;  1KX5 D;  3MGS A;  4WU9 D;  5AV5 C;  3AV1 D;  1AOI D;  3VH6 T;  1ZLA A;  1KX3 A;  3B6G D;  3B0B A;  2Y2K A;  3X1T D;  1F66 A;  2PYO C;  2UWX A;  3AZL A;  2CV5 B;  5CP6 B;  1ID3 C;  3UTB C;  5B2I A;  2ZY3 A;  4R8P B;  3AZN C;  4YM6 C;  3A6N A;  3LZ1 D;  4JJN D;  3UT9 B;  5AY8 A;  5CPK A;  3REL D;  4XZQ B;  5JRG A;  1U35 C;  3C1B C;  3WTP C;  4H9Q A;  5AVB C;  5AV8 D;  1P3I B;  1KX4 D;  4DRA A;  3WA9 C;  3W98 C;  3WAA D;  3AZK B;  1P3O A;  5DNN B;  4J8V C;  1WWI A;  3REK D;  5B31 D;  3AYW A;  4WU9 C;  2FJ7 D;  4Z5T B;  3REJ B;  1P3L C;  1B67 A;  3IP4 C;  1M19 B;  5GSU C;  4KGC A;  3AZI D;  2RVQ C;  2NZD D;  3TU4 D;  4YS3 B;  4WJ3 C;  5AV9 C;  2LY8 A;  1KX5 A;  1P3F C;  4H9N B;  3KUY A;  3AN2 B;  3AV1 A;  1AOI A;  1TAF B;  4J8U A;  3W96 A;  3X1V A;  3B6G A;  5BO0 A;  4Z66 D;  2JE5 A;  5CPI B;  5B2J B;  3EPK A;  5B1M D;  2G5H C;  3AZE A;  3X1S B;  3LZ1 A;  5E5A C;  4H9P B;  3REL A;  3W97 C;  5B32 B;  3NQJ A;  5AV6 C;  2F8N D;  5B2I B;  1KX4 A;  3AZH D;  5DNM C;  5AY8 B;  5B31 A;  5JRG B;  1P3M C;  3C1C A;  5BNV A;  5AV5 B;  4QLC C;  5B24 D;  3B6F C;  1ULY A;  2ZY4 A;  1BH8 A;  5B0Y C;  5GT0 D;  2PYO B;  4YS3 D;  3EPH A;  4G91 B;  4Z2M H;  3TU4 A;  3FDD A;  2Y2P A;  2XD5 A;  3UTB B;  1P3B C;  3W99 D;  5GXQ D;  3KXB B;  3LJA D;  3MVD B;  2F8N H;  3WTP E;  3AZF C;  2F8N K;  5B0Z B;  4CSR B;  2W8S A;  3F6T A;  1EQZ D;  3WA9 B;  5CPI D;  1KX5 B;  3NQU B;  4NFT A;  1N1J B;  4J8V B;  5CP6 A;  4WU9 B;  2CV5 A;  1AOI B;  5B1L D;  4WU8 D;  5B1M A;  3LEL D;  2IO5 C;  4J8X C;  1P3L B;  4R8P A;  5GT3 C;  3X1S D;  3UT9 A;  5AVC C;  3X1T B;  5B32 D;  5GSU B;  4XZQ A;  2Y2M A;  2BG1 A;  5C3I C;  1P3I A;  3AZK A;  3MGR C;  3AV2 C;  4G92 C;  2NQB C;  5B33 C;  1P3P C;  4JJN B;  5AV9 B;  5B40 C;  5AV5 D;  2Y2N A;  2ARO C;  5AV8 B;  1KX4 B;  3AZM C;  1P3G C;  3WAA B;  5B24 A;  3X1U C;  3REK B;  2FJ7 B;  3O62 C;  5BNV B;  1ID3 D;  4YS3 A;  3UTB D;  3AZN D;  4YM6 D;  4H9N A;  3AZI B;  2HIO C;  2F2A C;  3AN2 A;  1BH8 B;  1U35 D;  2L5A A;  1TAF A;  3WTP D;  3C1B D;  3W97 B;  5AVB D;  4LD9 C;  4X23 C;  2NZD B;  3WA9 D;  3W98 D;  5AV6 B;  3UTA C;  1TZY C;  4J8V D;  1P3K C;  5CPI A;  5B2J A;  3KWQ C;  4KHA B;  4KUD C;  3MGS C;  1P3L D;  1P3M B;  4WU8 A;  2Y2L A;  4UPK A;  5GSU D;  3X1S A;  1KX3 C;  3AL0 C;  2RVQ D;  4Z66 B;  4H9P A;  5B32 A;  3REH C;  1F66 C;  5B1M B;  2RIQ A;  5AV9 D;  1P3B B;  1P3F D;  5G49 B;  5AV5 A;  4CAY B;  2F8N B;  2JCH A;  3AZH B;  1P3O C;  2PYO A;  5B31 G;  1ID3 A;  3UTB A;  2IO5 B;  5GT3 B;  5B24 B;  5KDM B;  5AVC B;  5E5A D;  4KGC C;  1P3A C;  1M1A C;  3KXB A;  3W97 D;  5GT0 B;  5C3I B;  5AV6 D;  3WTP A;  5JA4 A;  3MVD A;  5B0Z A;  4CSR A;  4WZS B;  3WA9 A;  3MGR B;  5DNM D;  3NQU A;  4J8V A;  1N1J A;  4WU9 A;  5B33 B;  1P3P B;  1P3M D;  3W99 B;  2HUE C;  1P3L A;  5GXQ B;  3KUY C;  1S32 C;  3LJA B;  4QLC D;  3X1T A;  4J8U C;  3W96 C;  5GSU A;  3X1V C;  1EQZ B;  3B6F D;  3AZM B;  1P3G B;  3KFU G;  1Q9C A;  2BYM B;  5B0Y D;  3AZJ C;  2BYK B;  5B1L B;  4WU8 B;  4XUJ D;  3LEL B;  1P3B D;  4Z2M G;  4JJN A;  5AV9 A;  1P34 C;  5F99 C;  3AZE C;  4DQY B;  5AV8 A;  3AZF D;  4ZUX C;  3WAA A;  3UTA B;  3REK A;  1JFI B;  2F8N G;  2FJ7 A;  4HGA C;  3KWQ B;  1M18 C;  4KUD B;  4J8X D;  3C1C C;  5GT3 D;  5AVC D;  3AZI A;  3MGP C;  4H9O B;  2NZD A;  3W97 A;  5CHL B;  4XUJ C;  5AV6 A;  1ID3 B;  4E44 A;  3REH B;  3MGR D;  3AV2 D;  3LZ0 C;  2NQB D;  4NE6 A;  5B33 D;  3AFA C;  3AZN B;  4YM6 B;  1P3P D;  4KHA A;  5DNM A;  5B40 D;  1B6W A;  2DQN C;  1P3M A;  1U35 B;  3C1B B;  3WTP B;  5JA4 B;  2ARO D;  5AVB B;  3W98 B;  3AZM D;  4QLC A;  1P3G D;  4Z66 A;  2VQR A;  3X1U D;  3VH6 A;  3O62 D;  1KU5 A;  3WKJ C;  3KSY A;  2YFV B;  3AZG D;  2Y2Q A;  4WNN B;  4H9R B;  5CP6 C;  2YFW B;  1P3B A;  3R45 B;  4ZBJ C;  1T3U A;  1HQ3 C;  4R8P C;  5G49 A;  2HIO D;  3UT9 C;  4CAY A;  4XZQ C;  1M1A B;  3MNN C;  2F8N A;  5B32 G;  4X23 D;  4LD9 D;  3UTA D;  1P3I C;  5BS7 C;  1TZY D;  1P3K D;  3AZH A;  3AZK C;  1WWS A;  3KWQ D;  5DNN C;  4KUD D;  1P3F B;  3P5J B;  4Z5T C;  3MGS D;  3MGQ C;  3REJ C;  2HUE B;  5CPJ C;  4J8W C;  1S32 B;  1KX3 D;  5GT3 A;  5KDM A;  5AVC A;  1M19 C;  3EPJ A;  3V9R B;  5GT0 A;  3AZG C;  3REH D;  1F66 D;  3REI C;  3H0R C;  3AZJ B;  4H9S C;  1PZR A;  3MGR A;  2J8P A;  5B33 A;  1P3P A;  3W99 A;  1BH9 A;  4WV4 B;  3B0D C;  5E5A B;  1W2E A;  5GXQ A;  1P34 B;  3AN2 C;  3H0M C;  3LJA A;  5BNX B;  1EQZ A;  3AZM A;  1P3G A;  5DNM B;  1P3O D;  2BYM A;  2Y2J A;  2BYK A;  5B2J C;  3O62 A;  5B1L A;  3LEL A;  4UUZ B;  1M18 B;  1ZLA C;  4QLC B;  3B6F B;  2HIO A;  3MGP B;  1HTA A;  1P3A D;  1M1A D;  4KGC D;  5B0Y B;  4DRB A;  3AZL C;  4X23 A;  4XUJ B;  3UTA A;  1JFI A;  5B2I C;  1H3O B;  3LZ0 B;  3A6N C;  3AFA B;  3KWQ A;  5AY8 C;  5CPK C;  4KUD A;  5JRG C;  3KUY D;  1S32 D;  3EPL A;  2Y2I A;  3AZF B;  4J8U D;  4H9O A;  3W96 D;  3X1V D;  5BT1 C;  3AYW C;  2FFF B;  3AZJ D;  3WKJ B;  3REH A;  4G91 C;  3B0C W;  4J8X B;  3AZN A;  4YM6 A;  1R4V A;  4AWL C;  1P34 D;  4ZBJ B;  5F99 D;  3AZE D;  1HQ3 B;  3VH5 A;  2CWE A;  1U35 A;  3C1B A;  2Y2G A;  5AVB A;  3KXB C;  3W98 A;  5FUG B;  4ZUX D;  3MNN B;  3MVD C;  5B0Z C;  3AV2 B;  4G92 B;  2NQB B;  1KX5 C;  2YFV A;  1BH9 B;  5B40 B;  4WNN A;  1M18 D;  4H9R A;  4EO5 C;  2YFW A;  3MGQ B;  3C1C D;  3AV1 C;  1AOI C;  2ARO B;  3R45 A;  3B6G C;  5CPJ B;  3MGP D;  4J8W B;  3X1U B;  3X1T C;  1P3A A; 
#chains in the Genus database with same CATH homology
 3O62 B;  3AZG B;  3REI B;  3LZ0 D;  3AFA D;  3VH6 W;  1P3F A;  2HIO B;  3LZ1 C;  4JJN C;  3REL C;  3B0D B;  4LD9 B;  1S32 A;  4X23 B;  5AV8 C;  1KX4 C;  1TZY B;  2JSS A;  3WAA C;  1P3K B;  3V9R A;  3WKJ D;  3REK C;  5B31 C;  2FJ7 C;  1BFM A;  3MGS B;  3AZJ A;  2CV5 D;  5CP6 D;  1ZLA B;  1KX3 B;  1HQ3 D;  4R8P D;  3UT9 D;  5E5A A;  1P34 A;  3AZI C;  5F99 A;  4XZQ D;  3MNN D;  1F66 B;  2NZD C;  5BNX A;  3TU4 C;  3AZL B;  1P3I D;  4ZUX A;  3AZK D;  5DNN D;  4Z5T D;  3A6N B;  3MGQ D;  5CPK B;  4UUZ A;  3REJ D;  1M18 A;  5CPJ D;  4J8W D;  3A1K A;  3B6F A;  4H9Q B;  1M19 D;  3MGP A;  3A1I A;  4Z66 C;  2G5I C;  2Y2O A;  5B0Y A;  1P3O B;  3AYW B;  2CV5 C;  3REI D;  4XUJ A;  5B1M C;  1H3O A;  2Y2H A;  4NE5 A;  3LZ0 A;  3VH5 T;  3AFA A;  4AWL B;  4NE3 A;  4KGC B;  1P3A B;  1M1A A;  3AN2 D;  3AZF A;  3H0L C;  3AZH C;  5B2J D;  3WKJ A;  3KUY B;  4J8X A;  1ZLA D;  4EO5 B;  3AV1 B;  4E45 A;  4J8U B;  3W96 B;  3X1V B;  1HQ3 A;  3B6G B;  4M6B A;  5B24 C;  5BO0 B;  2XD1 A;  3AZL D;  5FUG A;  3MNN A;  5GT0 C;  4YS3 C;  2ZY5 A;  3AV2 A;  5B2I D;  5BS7 A;  2NQB A;  2ZY2 A;  5B40 A;  3A6N D;  5CPK D;  5AY8 D;  5DNN A;  5F99 B;  3AZE B;  3B0C T;  4Z5T A;  5JRG D;  3EG5 B;  3W99 C;  3LZ1 B;  3MGQ A;  2ARO A;  3REJ A;  5GXQ C;  3REL B;  3NQJ B;  5CPJ A;  4ZUX B;  4J8W A;  3LJA C;  3X1U A;  1M19 A;  5BT1 D;  1EQZ C;  3AYW D;  3VH5 W;  4HGA B;  5CPI C;  3AZG A;  2PYO D;  5B31 B;  3REI A;  3C1C B;  4H9S A;  1F1E A;  1A7W A;  5B1L C;  2ZM5 A;  3LEL C;  4WU8 C;  3X1S C;  5B32 C;  4LD9 A;  3KXB D;  1Z2C B;  2DF4 C;  3MVD D;  1TZY A;  5B0Z D;  3TU4 B;  1P3K A;  1KX5 D;  3MGS A;  4WU9 D;  5AV5 C;  3AV1 D;  1AOI D;  3VH6 T;  1ZLA A;  1KX3 A;  3B6G D;  3B0B A;  2Y2K A;  3X1T D;  1F66 A;  2PYO C;  2UWX A;  3AZL A;  2CV5 B;  5CP6 B;  1ID3 C;  3UTB C;  5B2I A;  2ZY3 A;  4R8P B;  3AZN C;  4YM6 C;  3A6N A;  3LZ1 D;  4JJN D;  3UT9 B;  5AY8 A;  5CPK A;  3REL D;  4XZQ B;  5JRG A;  1U35 C;  3C1B C;  3WTP C;  4H9Q A;  5AVB C;  5AV8 D;  1P3I B;  1KX4 D;  4DRA A;  3WA9 C;  3W98 C;  3WAA D;  3AZK B;  1P3O A;  5DNN B;  4J8V C;  1WWI A;  3REK D;  5B31 D;  3AYW A;  4WU9 C;  2FJ7 D;  4Z5T B;  3REJ B;  1P3L C;  1B67 A;  3IP4 C;  1M19 B;  5GSU C;  4KGC A;  3AZI D;  2RVQ C;  2NZD D;  3TU4 D;  4YS3 B;  4WJ3 C;  5AV9 C;  2LY8 A;  1KX5 A;  1P3F C;  4H9N B;  3KUY A;  3AN2 B;  3AV1 A;  1AOI A;  1TAF B;  4J8U A;  3W96 A;  3X1V A;  3B6G A;  5BO0 A;  4Z66 D;  2JE5 A;  5CPI B;  5B2J B;  3EPK A;  5B1M D;  2G5H C;  3AZE A;  3X1S B;  3LZ1 A;  5E5A C;  4H9P B;  3REL A;  3W97 C;  5B32 B;  3NQJ A;  5AV6 C;  2F8N D;  5B2I B;  1KX4 A;  3AZH D;  5DNM C;  5AY8 B;  5B31 A;  5JRG B;  1P3M C;  3C1C A;  5BNV A;  5AV5 B;  4QLC C;  5B24 D;  3B6F C;  1ULY A;  2ZY4 A;  1BH8 A;  5B0Y C;  5GT0 D;  2PYO B;  4YS3 D;  3EPH A;  4G91 B;  4Z2M H;  3TU4 A;  3FDD A;  2Y2P A;  2XD5 A;  3UTB B;  1P3B C;  3W99 D;  5GXQ D;  3KXB B;  3LJA D;  3MVD B;  2F8N H;  3WTP E;  3AZF C;  2F8N K;  5B0Z B;  4CSR B;  2W8S A;  3F6T A;  1EQZ D;  3WA9 B;  5CPI D;  1KX5 B;  3NQU B;  4NFT A;  1N1J B;  4J8V B;  5CP6 A;  4WU9 B;  2CV5 A;  1AOI B;  5B1L D;  4WU8 D;  5B1M A;  3LEL D;  2IO5 C;  4J8X C;  1P3L B;  4R8P A;  5GT3 C;  3X1S D;  3UT9 A;  5AVC C;  3X1T B;  5B32 D;  5GSU B;  4XZQ A;  2Y2M A;  2BG1 A;  5C3I C;  1P3I A;  3AZK A;  3MGR C;  3AV2 C;  4G92 C;  2NQB C;  5B33 C;  1P3P C;  4JJN B;  5AV9 B;  5B40 C;  5AV5 D;  2Y2N A;  2ARO C;  5AV8 B;  1KX4 B;  3AZM C;  1P3G C;  3WAA B;  5B24 A;  3X1U C;  3REK B;  2FJ7 B;  3O62 C;  5BNV B;  1ID3 D;  4YS3 A;  3UTB D;  3AZN D;  4YM6 D;  4H9N A;  3AZI B;  2HIO C;  2F2A C;  3AN2 A;  1BH8 B;  1U35 D;  2L5A A;  1TAF A;  3WTP D;  3C1B D;  3W97 B;  5AVB D;  4LD9 C;  4X23 C;  2NZD B;  3WA9 D;  3W98 D;  5AV6 B;  3UTA C;  1TZY C;  4J8V D;  1P3K C;  5CPI A;  5B2J A;  3KWQ C;  4KHA B;  4KUD C;  3MGS C;  1P3L D;  1P3M B;  4WU8 A;  2Y2L A;  4UPK A;  5GSU D;  3X1S A;  1KX3 C;  3AL0 C;  2RVQ D;  4Z66 B;  4H9P A;  5B32 A;  3REH C;  1F66 C;  5B1M B;  2RIQ A;  5AV9 D;  1P3B B;  1P3F D;  5G49 B;  5AV5 A;  4CAY B;  2F8N B;  2JCH A;  3AZH B;  1P3O C;  2PYO A;  5B31 G;  1ID3 A;  3UTB A;  2IO5 B;  5GT3 B;  5B24 B;  5KDM B;  5AVC B;  5E5A D;  4KGC C;  1P3A C;  1M1A C;  3KXB A;  3W97 D;  5GT0 B;  5C3I B;  5AV6 D;  3WTP A;  5JA4 A;  3MVD A;  5B0Z A;  4CSR A;  4WZS B;  3WA9 A;  3MGR B;  5DNM D;  3NQU A;  4J8V A;  1N1J A;  4WU9 A;  5B33 B;  1P3P B;  1P3M D;  3W99 B;  2HUE C;  1P3L A;  5GXQ B;  3KUY C;  1S32 C;  3LJA B;  4QLC D;  3X1T A;  4J8U C;  3W96 C;  5GSU A;  3X1V C;  1EQZ B;  3B6F D;  3AZM B;  1P3G B;  3KFU G;  1Q9C A;  2BYM B;  5B0Y D;  3AZJ C;  2BYK B;  5B1L B;  4WU8 B;  4XUJ D;  3LEL B;  1P3B D;  4Z2M G;  4JJN A;  5AV9 A;  1P34 C;  5F99 C;  3AZE C;  4DQY B;  5AV8 A;  3AZF D;  4ZUX C;  3WAA A;  3UTA B;  3REK A;  1JFI B;  2F8N G;  2FJ7 A;  4HGA C;  3KWQ B;  1M18 C;  4KUD B;  4J8X D;  3C1C C;  5GT3 D;  5AVC D;  3AZI A;  3MGP C;  4H9O B;  2NZD A;  3W97 A;  5CHL B;  4XUJ C;  5AV6 A;  1ID3 B;  4E44 A;  3REH B;  3MGR D;  3AV2 D;  3LZ0 C;  2NQB D;  4NE6 A;  5B33 D;  3AFA C;  3AZN B;  4YM6 B;  1P3P D;  4KHA A;  5DNM A;  5B40 D;  1B6W A;  2DQN C;  1P3M A;  1U35 B;  3C1B B;  3WTP B;  5JA4 B;  2ARO D;  5AVB B;  3W98 B;  3AZM D;  4QLC A;  1P3G D;  4Z66 A;  2VQR A;  3X1U D;  3VH6 A;  3O62 D;  1KU5 A;  3WKJ C;  3KSY A;  2YFV B;  3AZG D;  2Y2Q A;  4WNN B;  4H9R B;  5CP6 C;  2YFW B;  1P3B A;  3R45 B;  4ZBJ C;  1T3U A;  1HQ3 C;  4R8P C;  5G49 A;  2HIO D;  3UT9 C;  4CAY A;  4XZQ C;  1M1A B;  3MNN C;  2F8N A;  5B32 G;  4X23 D;  4LD9 D;  3UTA D;  1P3I C;  5BS7 C;  1TZY D;  1P3K D;  3AZH A;  3AZK C;  1WWS A;  3KWQ D;  5DNN C;  4KUD D;  1P3F B;  3P5J B;  4Z5T C;  3MGS D;  3MGQ C;  3REJ C;  2HUE B;  5CPJ C;  4J8W C;  1S32 B;  1KX3 D;  5GT3 A;  5KDM A;  5AVC A;  1M19 C;  3EPJ A;  3V9R B;  5GT0 A;  3AZG C;  3REH D;  1F66 D;  3REI C;  3H0R C;  3AZJ B;  4H9S C;  1PZR A;  3MGR A;  2J8P A;  5B33 A;  1P3P A;  3W99 A;  1BH9 A;  4WV4 B;  3B0D C;  5E5A B;  1W2E A;  5GXQ A;  1P34 B;  3AN2 C;  3H0M C;  3LJA A;  5BNX B;  1EQZ A;  3AZM A;  1P3G A;  5DNM B;  1P3O D;  2BYM A;  2Y2J A;  2BYK A;  5B2J C;  3O62 A;  5B1L A;  3LEL A;  4UUZ B;  1M18 B;  1ZLA C;  4QLC B;  3B6F B;  2HIO A;  3MGP B;  1HTA A;  1P3A D;  1M1A D;  4KGC D;  5B0Y B;  4DRB A;  3AZL C;  4X23 A;  4XUJ B;  3UTA A;  1JFI A;  5B2I C;  1H3O B;  3LZ0 B;  3A6N C;  3AFA B;  3KWQ A;  5AY8 C;  5CPK C;  4KUD A;  5JRG C;  3KUY D;  1S32 D;  3EPL A;  2Y2I A;  3AZF B;  4J8U D;  4H9O A;  3W96 D;  3X1V D;  5BT1 C;  3AYW C;  2FFF B;  3AZJ D;  3WKJ B;  3REH A;  4G91 C;  3B0C W;  4J8X B;  3AZN A;  4YM6 A;  1R4V A;  4AWL C;  1P34 D;  4ZBJ B;  5F99 D;  3AZE D;  1HQ3 B;  3VH5 A;  2CWE A;  1U35 A;  3C1B A;  2Y2G A;  5AVB A;  3KXB C;  3W98 A;  5FUG B;  4ZUX D;  3MNN B;  3MVD C;  5B0Z C;  3AV2 B;  4G92 B;  2NQB B;  1KX5 C;  2YFV A;  1BH9 B;  5B40 B;  4WNN A;  1M18 D;  4H9R A;  4EO5 C;  2YFW A;  3MGQ B;  3C1C D;  3AV1 C;  1AOI C;  2ARO B;  3R45 A;  3B6G C;  5CPJ B;  3MGP D;  4J8W B;  3X1U B;  3X1T C;  1P3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...