1S32B

Molecular recognition of the nucleosomal 'supergroove'
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
81
structure length
81
Chain Sequence
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords palindromic alpha-satellite 146 bp DNA fragment
publication title Molecular Recognition of the Nucleosomal 'Supergroove'
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2004-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1s32B00
3MGSD 2F8ND 3B0DC 1P3BD 4Z5TB 3REKB 4R8PB 5AVCA 4WU9A 4LD9C 1Q9CA 4E44A 3LJAC 4H9QB 3LELC 2BYMA 1AOIB 1TZYB 3W96C 1P3IC 5CPKB 3MGRD 2L5AA 5CP6A 3X1SC 4QLCC 4JJNA 5GT3A 4KHAA 4KUDD 4H9OB 2BYKA 3KXBA 3RELA 1P34A 5E5AB 5CPJB 2AROA 5AV6C 3AZFC 3KWQC 3AZIA 3AZGA 3B0BA 3KUYD 4WNNA 3UT9D 1EQZC 4CSRB 3W98C 3TU4D 2HUEC 2F8NK 5AV5D 4H9QA 5DNMB 3AV1B 1P3GC 1BH8A 3AZNA 5GSUD 3X1VA 1M19D 1KX5B 5B1MD 4J8XC 2CV5D 3X1TD 3WKJD 4ZBJB 2F8NH 4J8VB 3C1CD 1ZLAA 3AN2C 4CAYB 5CPJA 1S32D 2NQBD 2HIOD 3MGQC 3AZLA 3AZEC 5B33C 4CSRA 3AYWD 5JRGB 3WTPC 1M18D 3REHC 1HQ3C 4KGCC 1P3PD 2RVQD 4J8UA 5JA4A 4YS3D 3W99B 4H9SA 4J8WD 3W97D 5F99D 5GT0B 2NZDC 5BT1C 1P3FC 5BS7C 5AY8B 4YM6D 1P3AC 1KX4C 2F8NA 3B0DB 3VH6A 5GXQC 3REJD 3MNNC 3AV2B 5AVBB 4WV4B 1P3MD 3O62D 3C1BD 3B6FB 3MGRA 5AVCC 3W99A 2IO5B 4WU9D 3LZ0C 5CP6C 3AZMC 5B0YB 5AY8A 4JJNC 4HGAC 3KUYA 5GT3D 3RELC 3UT9A 3KXBD 1P34D 1TAFB 3LZ1C 2AROD 3TU4A 2YFVA 3AZJC 3AZID 4G91B 3AFAC 3AZGD 2FJ7D 3AV2A 5AV5A 5AV8B 3B6FA 5DNNC 1P3GB 4Z5TD 3REKD 1M19A 4R8PD 1KU5A 3B0CW 5B1MA 3UTAC 2CV5A 5CPIC 3X1UC 3X1TA 3WKJA 1AOID 1S32A 4XUJC 1TZYD 2NQBA 1H3OA 4Z66C 5CPKD 5C3IC 5B0YA 3X1VC 4EO5C 2PYOC 4E45A 1ZLAC 5B1LC 1TAFA 3AYWA 5E5AD 5CPJD 1P3OB 1M18A 3AZLC 3WTPB 1U35B 5AV9B 3AZIB 1HQ3B 3AZKB 4YS3A 3B0CT 4WU8B 1M1AC 5G49B 5DNMD 3AV1D 4J8UC 5B40C 3UTBB 1F66C 4H9SC 1KX5D 5B31B 1P3LC 1P3KC 3NQUA 4J8VD 1P3OA 4H9PB 3REJA 5B0ZB 3MGSC 1R4VA 1P3MA 1U35A 3O62A 1BFMA 3C1BA 1P3BC 5JRGD 3V9RA 5B24B 3MGRC 4ZUXB 2LY8A 4AWLC 3W99D 3AZMB 5B31A 4KUDC 5GT0D 4X23B 5B0ZA 4H9NA 5AY8D 2FJ7A 3UT9C 3B6GB 3WAAB 3KSYA 4H9RB 4Z5TA 5DNNB 1HTAA 3REKA 4G92C 4R8PA 5AV5C 4NFTA 3AV2D 5AVBD 1AOIA 5CPIB 5GSUC 1TZYA 4ZUXA 3VH6W 3B6FD 5CPKA 1M19C 5B1MC 2CV5C 3WKJC 3C1CC 5B32B 4H9OA 1S32C 2NQBC 2HIOC 5E5AA 5B1LB 5B0YD 3A6NC 3B6GA 1KX3B 3WAAA 3AYWC 3MVDB 1M18C 5B2JB 4H9RA 1ID3B 4XZQB 5DNMA 3VH6T 5AV8D 3AV1A 2RVQC 1P3PC 3REIB 5B31G 1P3GD 3MGPB 4J8WC 3AZHC 3W97C 1KX5A 3WTPE 5F99C 2CWEA 4NE6A 4J8VA 4CAYA 4YM6C 5B2IC 1KX3A 3WA9C 3REJC 1P3OD 5JRGA 1P3MC 3WTPD 3O62C 4XZQA 3C1BC 1U35D 4LD9B 5AV9D 3LJAB 1HQ3D 3LELB 3AZKD 3MGPA 4WU8D 4WU9C 3W96B 1P3IB 4AWLB 5GT0A 3X1SB 4QLCB 1N1JB 1B6WA 3UTBD 5GT3C 5B31D 5AV6B 3AZFB 3KWQB 3KXBC 1P34C 2AROC 3AZIC 3AZGC 5B0ZD 1BH9B 1EQZB 2FJ7C 3W98B 2HUEB 5AVBA 4LD9A 5BNVB 3R45B 3LELA 3REKC 3VH5A 4R8PC 5B32G 1AOIC 3X1SA 1TZYC 4J8XB 3NQJB 3AZNC 1N1JA 5B24D 4ZUXD 3AN2B 3AZMD 3MGQB 3A6NB 5E5AC 4UUZB 4X23D 5CPJC 3AZEB 5B33B 1BH9A 3W98A 5AV8A 3B6GD 3REHB 3WAAD 3R45A 1P3GA 4KGCB 5DNMC 3AZHB 5F99B 4J8XA 5CPID 5BO0B 2NZDB 1KX5C 5CHLB 4ZBJC 5B2IB 1P3FB 3MGQA 4J8VC 1P3AB 5B32D 1KX4B 4UUZA 3WA9B 5B33A 5B1LD 3WTPA 5GXQB 3MNNB 1KX3D 3REHA 5AV9A 1HQ3A 3MVDD 3AZKA 4KGCA 5B2JD 4WU8A 1ID3D 5G49A 5AVCB 4XZQD 2JSSA 2BYMB 3REID 3W99C 3UTBA 3MGPD 3LZ0B 5CP6B 5BS7A 4JJNB 4HGAB 4KHAB 1KX4A 3RELB 2BYKB 4H9PA 5AY8C 3LZ1B 4NE5A 3KUYC 1WWSA 3AZJB 3AFAB 4WNNB 3TU4C 3AV2C 5AVBC 3UTAB 3B6FC 4LD9D 4M6BA 5B24A 3X1UB 1BH8B 3LJAD 3LELD 2IO5C 3AZNB 4XUJB 3LZ0A 3W96D 3AZMA 4Z66B 3X1TC 1P3ID 5C3IB 5FUGB 3X1VB 4EO5B 3X1SD 4QLCD 4X23A 2YFWB 2PYOB 5B0YC 1ZLAB 3LZ1A 3AZLB 5AV6D 3AZJA 3KWQD 3AZFD 3AFAA 5DNNA 4G91C 1EQZD 3W98D 2FJ7B 5AV8C 1M1AB 3UTAA 3X1UA 4YS3C 5CPIA 4J8UB 5JA4B 4Z2MH 5B40B 4XUJA 4Z66A 1F66B 5FUGA 1JFIB 5B32A 1P3LB 4J8XD 2YFWA 1P3KB 3VH5W 2PYOA 4WZSB 5B1LA 3AN2D 3MGQD 3MGSB 4NE3A 3A6ND 2F8NB 3MVDA 1P3OC 3AZED 5B2JA 1ID3A 5B33D 1P3BB 1U35C 1M1AA 5AV9C 3REHD 3AZKC 3REIA 4WU8C 4KGCD 5B40A 3MGRB 1F66A 3VH5T 3AZHD 1JFIA 1P3LA 1P3KA 4KUDB 3UTBC 4DRAA 1WWIA 2NZDD 5BT1D 5B31C 1F1EA 1P3FD 5B2ID 3KUYB 3MGSA 1P3AD 3UT9B 1KX4D 5B0ZC 3WA9D 1P3BA 3TU4B 2YFVB 5GXQD 3MNND 4G92B 5AV5B 3LJAA 4Z5TC 5GSUB 3W96A 1P3IA 1M19B 5AVCD 5B1MB 2CV5B 3X1TB 5B24C 4QLCA 4ZUXC 3WKJB 4KUDA 3C1CB 5CPKC 1S32B 2NQBB 2HIOB 1H3OB 3LZ0D 5CP6D 5KDMB 5AV6A 3AZFA 3KWQA 4X23C 4JJND 3RELD 3AYWB 1EQZA 1M18B 3LZ1D 3B6GC 3WAAC 3AZJD 3AFAD 5BNVA 1P3PB 5BNXB 4YS3B 5GSUA 5DNND 3AV1C 4J8WB 1A7WA 3W97B 3UTAD 4Z2MG 3NQJA 3X1UD 3C1CA 3AZND 2HIOA 3AN2A 4XUJD 5KDMA 4Z66D 4YM6B 2F8NG 3X1VD 5B32C 3A6NA 2PYOD 3NQUB 3AZEA 1ZLAD 3REJB 1KX3C 3AZLD 3MVDC 1P3MB 3O62B 5B2JC 3C1BB 1P3PA 5JRGC 1ID3C 5BNXA 4XZQC 1B67A 3W97A 4J8WA 3AZHA 4WU9B 1M1AD 5F99A 3V9RB 3REIC 1ULYA 4DRBA 5BO0A 3MGPC 2NZDA 4J8UD 5B40D 4YM6A 5GT0C 1P3FA 5B2IA 1F66D 5GT3B 1P3AA 1P3LD 1P3KD 3KXBB 1P34B 3WA9A 2AROB 4H9NB 5GXQA 3AZGB 3MNNA
chains in the Genus database with same CATH superfamily
3MGSD 2F8ND 3B0DC 1P3BD 4Z5TB 3REKB 4R8PB 5AVCA 4WU9A 4LD9C 1Q9CA 4E44A 3EPLA 3LJAC 4H9QB 3LELC 2BYMA 1AOIB 1TZYB 3W96C 1P3IC 3EPKA 5CPKB 3MGRD 2L5AA 5CP6A 3X1SC 4QLCC 4JJNA 5GT3A 4KHAA 4KUDD 4H9OB 2BYKA 3KXBA 3RELA 1P34A 5E5AB 5CPJB 2AROA 5AV6C 3AZFC 3KWQC 3AZIA 3AZGA 2Y2KA 3B0BA 3KUYD 2W8SA 4WNNA 3UT9D 3H0LC 4CSRB 1EQZC 3W98C 3TU4D 2HUEC 2F8NK 5AV5D 4H9QA 5DNMB 3AV1B 1P3GC 1BH8A 3AZNA 5GSUD 3X1VA 1M19D 1KX5B 5B1MD 4J8XC 2CV5D 3X1TD 3WKJD 4ZBJB 2F8NH 4J8VB 3C1CD 1ZLAA 3AN2C 4CAYB 5CPJA 1S32D 2NQBD 2HIOD 3MGQC 3AZLA 3AZEC 5B33C 4CSRA 3AYWD 5JRGB 3WTPC 1M18D 3REHC 1HQ3C 4KGCC 1P3PD 2RVQD 4J8UA 5JA4A 4YS3D 3W99B 4H9SA 4J8WD 3W97D 4WJ3C 5F99D 5GT0B 3AL0C 2NZDC 5BT1C 1P3FC 5BS7C 5AY8B 4YM6D 1P3AC 1KX4C 2DF4C 2F8NA 3B0DB 3VH6A 5GXQC 3REJD 3MNNC 3AV2B 5AVBB 4WV4B 1P3MD 3O62D 3C1BD 3B6FB 3MGRA 5AVCC 3W99A 2IO5B 4WU9D 3LZ0C 5CP6C 3AZMC 5B0YB 5AY8A 4JJNC 4HGAC 3KUYA 5GT3D 3RELC 3UT9A 3KXBD 1P34D 1TAFB 3LZ1C 2AROD 3TU4A 2YFVA 3AZJC 3AZID 4G91B 3AFAC 3AZGD 2FJ7D 3AV2A 5AV5A 5AV8B 3B6FA 5DNNC 1P3GB 4Z5TD 3REKD 1M19A 4R8PD 1KU5A 3B0CW 5B1MA 3UTAC 2CV5A 5CPIC 3X1UC 3X1TA 3WKJA 1AOID 1S32A 4XUJC 1TZYD 2NQBA 1H3OA 4Z66C 5CPKD 3P5JB 5C3IC 5B0YA 3X1VC 4EO5C 2PYOC 4E45A 1ZLAC 5B1LC 1TAFA 3AYWA 5E5AD 5CPJD 1P3OB 1M18A 3AZLC 3WTPB 1U35B 5AV9B 3AZIB 1HQ3B 2ZY4A 3AZKB 4YS3A 3B0CT 4WU8B 1M1AC 5G49B 5DNMD 3AV1D 4J8UC 5B40C 3UTBB 1F66C 4H9SC 1KX5D 5B31B 2Y2PA 1P3KC 2Y2GA 1P3LC 3NQUA 4J8VD 1P3OA 4H9PB 3REJA 5B0ZB 3MGSC 1R4VA 1P3MA 1U35A 3O62A 1BFMA 3C1BA 1P3BC 5JRGD 3V9RA 5B24B 3MGRC 4ZUXB 2LY8A 4AWLC 3W99D 3AZMB 5B31A 4KUDC 5GT0D 4X23B 1PZRA 5B0ZA 4H9NA 5AY8D 2FJ7A 1W2EA 3UT9C 3B6GB 3WAAB 3KSYA 2G5HC 4H9RB 4Z5TA 5DNNB 1HTAA 3REKA 4G92C 4R8PA 5AV5C 4NFTA 3AV2D 5AVBD 1AOIA 5CPIB 5GSUC 1TZYA 3A1KA 3VH6W 2F2AC 4ZUXA 5CPKA 3B6FD 1M19C 5B1MC 2CV5C 3WKJC 3C1CC 5B32B 4H9OA 1S32C 2NQBC 2HIOC 5E5AA 5B1LB 5B0YD 3A6NC 3FDDA 3H0MC 3B6GA 1KX3B 3WAAA 3AYWC 3MVDB 1M18C 5B2JB 4H9RA 1ID3B 4XZQB 5DNMA 3VH6T 5AV8D 3AV1A 2RVQC 1P3PC 2BG1A 3REIB 5B31G 1P3GD 3A1IA 3MGPB 4J8WC 3AZHC 3W97C 1KX5A 3WTPE 5F99C 2CWEA 4NE6A 4J8VA 4CAYA 4YM6C 5B2IC 1KX3A 3WA9C 3REJC 1P3OD 5JRGA 1P3MC 2VQRA 3WTPD 3O62C 4XZQA 3C1BC 3KFUG 1U35D 4LD9B 5AV9D 3LJAB 1HQ3D 3LELB 3AZKD 3MGPA 4WU8D 4WU9C 3W96B 1P3IB 4AWLB 5GT0A 3X1SB 4QLCB 1N1JB 1B6WA 3EPJA 3UTBD 5GT3C 5B31D 5AV6B 3AZFB 3IP4C 3KXBC 3KWQB 1P34C 2RIQA 2AROC 3AZIC 3AZGC 5B0ZD 1BH9B 1EQZB 2FJ7C 3W98B 2HUEB 5AVBA 4LD9A 5BNVB 3R45B 3LELA 3REKC 3VH5A 4R8PC 5B32G 1AOIC 3X1SA 1TZYC 4J8XB 3NQJB 3AZNC 1N1JA 5B24D 4ZUXD 2ZY3A 2XD1A 3AN2B 3AZMD 3MGQB 2DQNC 3A6NB 5E5AC 4UUZB 4X23D 5CPJC 3AZEB 5B33B 1BH9A 3EG5B 3W98A 5AV8A 3B6GD 3REHB 3WAAD 3R45A 4DQYB 1P3GA 4KGCB 5DNMC 3AZHB 5F99B 3F6TA 4J8XA 5CPID 5BO0B 2NZDB 1KX5C 5CHLB 4ZBJC 5B2IB 1P3FB 3MGQA 4J8VC 2XD5A 1P3AB 5B32D 1KX4B 4UUZA 3WA9B 5B33A 5B1LD 3WTPA 5GXQB 3MNNB 2FFFB 1KX3D 3REHA 5AV9A 1HQ3A 3MVDD 3AZKA 4KGCA 5B2JD 4WU8A 2G5IC 1ID3D 5G49A 5AVCB 2J8PA 4XZQD 2JSSA 2BYMB 3REID 3W99C 2Y2QA 2Y2LA 3MGPD 3UTBA 3LZ0B 5CP6B 5BS7A 4JJNB 4HGAB 4KHAB 1KX4A 3RELB 2BYKB 4H9PA 5AY8C 3LZ1B 4NE5A 3KUYC 1WWSA 3AZJB 3AFAB 1T3UA 4WNNB 3TU4C 2UWXA 2JE5A 3AV2C 5AVBC 3UTAB 3B6FC 4LD9D 4M6BA 5B24A 3X1UB 1BH8B 3LJAD 3LELD 2IO5C 3AZNB 4XUJB 3LZ0A 3W96D 3AZMA 4Z66B 3X1TC 1P3ID 2Y2JA 5C3IB 5FUGB 3X1VB 4EO5B 3X1SD 4QLCD 4X23A 2YFWB 2PYOB 5B0YC 1ZLAB 3LZ1A 3AZLB 5AV6D 3AZJA 3KWQD 3AZFD 3AFAA 2Y2MA 5DNNA 4G91C 1EQZD 3W98D 2FJ7B 5AV8C 1M1AB 3UTAA 3EPHA 3X1UA 4YS3C 5CPIA 4J8UB 5JA4B 4Z2MH 5B40B 4XUJA 4Z66A 1F66B 5FUGA 1JFIB 5B32A 2ZY2A 4J8XD 2YFWA 1P3LB 3VH5W 1P3KB 2PYOA 4WZSB 5B1LA 3AN2D 3MGQD 3MGSB 4NE3A 3A6ND 2F8NB 3MVDA 1P3OC 3AZED 5B2JA 1ID3A 5B33D 1P3BB 1U35C 1M1AA 5AV9C 3REHD 3AZKC 3REIA 4WU8C 4KGCD 5B40A 3MGRB 1F66A 3VH5T 3AZHD 1JFIA 1P3LA 1P3KA 4KUDB 3UTBC 4DRAA 1WWIA 2NZDD 5BT1D 5B31C 1F1EA 1P3FD 5B2ID 3KUYB 3MGSA 1P3AD 3UT9B 1KX4D 5B0ZC 3WA9D 1P3BA 3TU4B 2YFVB 5GXQD 3MNND 4G92B 5AV5B 3LJAA 4Z5TC 5GSUB 3W96A 1P3IA 1M19B 4UPKA 5AVCD 5B1MB 2CV5B 3X1TB 5B24C 4QLCA 4ZUXC 3WKJB 4KUDA 3C1CB 5CPKC 1S32B 2NQBB 2HIOB 1H3OB 3LZ0D 5CP6D 5KDMB 5AV6A 3AZFA 3KWQA 4X23C 4JJND 3RELD 2Y2IA 3AYWB 1EQZA 2ZM5A 3LZ1D 1M18B 3B6GC 3WAAC 3AZJD 3AFAD 5BNVA 1P3PB 5BNXB 4YS3B 5GSUA 5DNND 3AV1C 4J8WB 1A7WA 3W97B 2Y2HA 3UTAD 4Z2MG 3NQJA 3X1UD 3C1CA 3AZND 2HIOA 3AN2A 4XUJD 5KDMA 4Z66D 4YM6B 2F8NG 3X1VD 5B32C 3H0RC 3A6NA 2PYOD 3NQUB 2ZY5A 3AZEA 1ZLAD 3REJB 1KX3C 3AZLD 3MVDC 2Y2OA 1P3MB 3O62B 5B2JC 3C1BB 1P3PA 5JRGC 1ID3C 5BNXA 2JCHA 4XZQC 1B67A 3W97A 4J8WA 3AZHA 4WU9B 1M1AD 5F99A 3V9RB 3REIC 1ULYA 4DRBA 1Z2CB 5BO0A 3MGPC 2NZDA 4J8UD 5B40D 4YM6A 5GT0C 1P3FA 5B2IA 1F66D 5GT3B 1P3AA 1P3LD 1P3KD 3KXBB 1P34B 3WA9A 2AROB 2Y2NA 4H9NB 5GXQA 3AZGB 3MNNA
chains in the Genus database with same CATH topology
3MGSD 2F8ND 3B0DC 1P3BD 4Z5TB 3REKB 4R8PB 5AVCA 4WU9A 4LD9C 1Q9CA 4E44A 3EPLA 3LJAC 4H9QB 3LELC 2BYMA 1AOIB 1TZYB 3W96C 1P3IC 3EPKA 5CPKB 3MGRD 2L5AA 5CP6A 3X1SC 4QLCC 4JJNA 5GT3A 4KHAA 4KUDD 4H9OB 2BYKA 3KXBA 3RELA 1P34A 5E5AB 5CPJB 2AROA 5AV6C 3AZFC 3KWQC 3AZIA 3AZGA 2Y2KA 3B0BA 3KUYD 2W8SA 4WNNA 3UT9D 3H0LC 4CSRB 1EQZC 3W98C 3TU4D 2HUEC 2F8NK 5AV5D 4H9QA 5DNMB 3AV1B 1P3GC 1BH8A 3AZNA 5GSUD 3X1VA 1M19D 1KX5B 5B1MD 4J8XC 2CV5D 3X1TD 3WKJD 4ZBJB 2F8NH 4J8VB 3C1CD 1ZLAA 3AN2C 4CAYB 5CPJA 1S32D 2NQBD 2HIOD 3MGQC 3AZLA 3AZEC 5B33C 4CSRA 3AYWD 5JRGB 3WTPC 1M18D 3REHC 1HQ3C 4KGCC 1P3PD 2RVQD 4J8UA 5JA4A 4YS3D 3W99B 4H9SA 4J8WD 3W97D 4WJ3C 5F99D 5GT0B 3AL0C 2NZDC 5BT1C 1P3FC 5BS7C 5AY8B 4YM6D 1P3AC 1KX4C 2DF4C 2F8NA 3B0DB 3VH6A 5GXQC 3REJD 3MNNC 3AV2B 5AVBB 4WV4B 1P3MD 3O62D 3C1BD 3B6FB 3MGRA 5AVCC 3W99A 2IO5B 4WU9D 3LZ0C 5CP6C 3AZMC 5B0YB 5AY8A 4JJNC 4HGAC 3KUYA 5GT3D 3RELC 3UT9A 3KXBD 1P34D 1TAFB 3LZ1C 2AROD 3TU4A 2YFVA 3AZJC 3AZID 4G91B 3AFAC 3AZGD 2FJ7D 3AV2A 5AV5A 5AV8B 3B6FA 5DNNC 1P3GB 4Z5TD 3REKD 1M19A 4R8PD 1KU5A 3B0CW 5B1MA 3UTAC 2CV5A 5CPIC 3X1UC 3X1TA 3WKJA 1AOID 1S32A 4XUJC 1TZYD 2NQBA 1H3OA 4Z66C 5CPKD 3P5JB 5C3IC 5B0YA 3X1VC 4EO5C 2PYOC 4E45A 1ZLAC 5B1LC 1TAFA 3AYWA 5E5AD 5CPJD 1P3OB 1M18A 3AZLC 3WTPB 1U35B 5AV9B 3AZIB 1HQ3B 2ZY4A 3AZKB 4YS3A 3B0CT 4WU8B 1M1AC 5G49B 5DNMD 3AV1D 4J8UC 5B40C 3UTBB 1F66C 4H9SC 1KX5D 5B31B 2Y2PA 1P3KC 2Y2GA 1P3LC 3NQUA 4J8VD 1P3OA 4H9PB 3REJA 5B0ZB 3MGSC 1R4VA 1P3MA 1U35A 3O62A 1BFMA 3C1BA 1P3BC 5JRGD 3V9RA 5B24B 3MGRC 4ZUXB 2LY8A 4AWLC 3W99D 3AZMB 5B31A 4KUDC 5GT0D 4X23B 1PZRA 5B0ZA 4H9NA 5AY8D 2FJ7A 1W2EA 3UT9C 3B6GB 3WAAB 3KSYA 2G5HC 4H9RB 4Z5TA 5DNNB 1HTAA 3REKA 4G92C 4R8PA 5AV5C 4NFTA 3AV2D 5AVBD 1AOIA 5CPIB 5GSUC 1TZYA 3A1KA 3VH6W 2F2AC 4ZUXA 5CPKA 3B6FD 1M19C 5B1MC 2CV5C 3WKJC 3C1CC 5B32B 4H9OA 1S32C 2NQBC 2HIOC 5E5AA 5B1LB 5B0YD 3A6NC 3FDDA 3H0MC 3B6GA 1KX3B 3WAAA 3AYWC 3MVDB 1M18C 5B2JB 4H9RA 1ID3B 4XZQB 5DNMA 3VH6T 5AV8D 3AV1A 2RVQC 1P3PC 2BG1A 3REIB 5B31G 1P3GD 3A1IA 3MGPB 4J8WC 3AZHC 3W97C 1KX5A 3WTPE 5F99C 2CWEA 4NE6A 4J8VA 4CAYA 4YM6C 5B2IC 1KX3A 3WA9C 3REJC 1P3OD 5JRGA 1P3MC 2VQRA 3WTPD 3O62C 4XZQA 3C1BC 3KFUG 1U35D 4LD9B 5AV9D 3LJAB 1HQ3D 3LELB 3AZKD 3MGPA 4WU8D 4WU9C 3W96B 1P3IB 4AWLB 5GT0A 3X1SB 4QLCB 1N1JB 1B6WA 3EPJA 3UTBD 5GT3C 5B31D 5AV6B 3AZFB 3IP4C 3KXBC 3KWQB 1P34C 2RIQA 2AROC 3AZIC 3AZGC 5B0ZD 1BH9B 1EQZB 2FJ7C 3W98B 2HUEB 5AVBA 4LD9A 5BNVB 3R45B 3LELA 3REKC 3VH5A 4R8PC 5B32G 1AOIC 3X1SA 1TZYC 4J8XB 3NQJB 3AZNC 1N1JA 5B24D 4ZUXD 2ZY3A 2XD1A 3AN2B 3AZMD 3MGQB 2DQNC 3A6NB 5E5AC 4UUZB 4X23D 5CPJC 3AZEB 5B33B 1BH9A 3EG5B 3W98A 5AV8A 3B6GD 3REHB 3WAAD 3R45A 4DQYB 1P3GA 4KGCB 5DNMC 3AZHB 5F99B 3F6TA 4J8XA 5CPID 5BO0B 2NZDB 1KX5C 5CHLB 4ZBJC 5B2IB 1P3FB 3MGQA 4J8VC 2XD5A 1P3AB 5B32D 1KX4B 4UUZA 3WA9B 5B33A 5B1LD 3WTPA 5GXQB 3MNNB 2FFFB 1KX3D 3REHA 5AV9A 1HQ3A 3MVDD 3AZKA 4KGCA 5B2JD 4WU8A 2G5IC 1ID3D 5G49A 5AVCB 2J8PA 4XZQD 2JSSA 2BYMB 3REID 3W99C 2Y2QA 2Y2LA 3MGPD 3UTBA 3LZ0B 5CP6B 5BS7A 4JJNB 4HGAB 4KHAB 1KX4A 3RELB 2BYKB 4H9PA 5AY8C 3LZ1B 4NE5A 3KUYC 1WWSA 3AZJB 3AFAB 1T3UA 4WNNB 3TU4C 2UWXA 2JE5A 3AV2C 5AVBC 3UTAB 3B6FC 4LD9D 4M6BA 5B24A 3X1UB 1BH8B 3LJAD 3LELD 2IO5C 3AZNB 4XUJB 3LZ0A 3W96D 3AZMA 4Z66B 3X1TC 1P3ID 2Y2JA 5C3IB 5FUGB 3X1VB 4EO5B 3X1SD 4QLCD 4X23A 2YFWB 2PYOB 5B0YC 1ZLAB 3LZ1A 3AZLB 5AV6D 3AZJA 3KWQD 3AZFD 3AFAA 2Y2MA 5DNNA 4G91C 1EQZD 3W98D 2FJ7B 5AV8C 1M1AB 3UTAA 3EPHA 3X1UA 4YS3C 5CPIA 4J8UB 5JA4B 4Z2MH 5B40B 4XUJA 4Z66A 1F66B 5FUGA 1JFIB 5B32A 2ZY2A 4J8XD 2YFWA 1P3LB 3VH5W 1P3KB 2PYOA 4WZSB 5B1LA 3AN2D 3MGQD 3MGSB 4NE3A 3A6ND 2F8NB 3MVDA 1P3OC 3AZED 5B2JA 1ID3A 5B33D 1P3BB 1U35C 1M1AA 5AV9C 3REHD 3AZKC 3REIA 4WU8C 4KGCD 5B40A 3MGRB 1F66A 3VH5T 3AZHD 1JFIA 1P3LA 1P3KA 4KUDB 3UTBC 4DRAA 1WWIA 2NZDD 5BT1D 5B31C 1F1EA 1P3FD 5B2ID 3KUYB 3MGSA 1P3AD 3UT9B 1KX4D 5B0ZC 3WA9D 1P3BA 3TU4B 2YFVB 5GXQD 3MNND 4G92B 5AV5B 3LJAA 4Z5TC 5GSUB 3W96A 1P3IA 1M19B 4UPKA 5AVCD 5B1MB 2CV5B 3X1TB 5B24C 4QLCA 4ZUXC 3WKJB 4KUDA 3C1CB 5CPKC 1S32B 2NQBB 2HIOB 1H3OB 3LZ0D 5CP6D 5KDMB 5AV6A 3AZFA 3KWQA 4X23C 4JJND 3RELD 2Y2IA 3AYWB 1EQZA 2ZM5A 3LZ1D 1M18B 3B6GC 3WAAC 3AZJD 3AFAD 5BNVA 1P3PB 5BNXB 4YS3B 5GSUA 5DNND 3AV1C 4J8WB 1A7WA 3W97B 2Y2HA 3UTAD 4Z2MG 3NQJA 3X1UD 3C1CA 3AZND 2HIOA 3AN2A 4XUJD 5KDMA 4Z66D 4YM6B 2F8NG 3X1VD 5B32C 3H0RC 3A6NA 2PYOD 3NQUB 2ZY5A 3AZEA 1ZLAD 3REJB 1KX3C 3AZLD 3MVDC 2Y2OA 1P3MB 3O62B 5B2JC 3C1BB 1P3PA 5JRGC 1ID3C 5BNXA 2JCHA 4XZQC 1B67A 3W97A 4J8WA 3AZHA 4WU9B 1M1AD 5F99A 3V9RB 3REIC 1ULYA 4DRBA 1Z2CB 5BO0A 3MGPC 2NZDA 4J8UD 5B40D 4YM6A 5GT0C 1P3FA 5B2IA 1F66D 5GT3B 1P3AA 1P3LD 1P3KD 3KXBB 1P34B 3WA9A 2AROB 2Y2NA 4H9NB 5GXQA 3AZGB 3MNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGS D;  2F8N D;  3B0D C;  1P3B D;  4Z5T B;  3REK B;  4R8P B;  5AVC A;  4WU9 A;  4LD9 C;  1Q9C A;  4E44 A;  3LJA C;  4H9Q B;  3LEL C;  2BYM A;  1AOI B;  1TZY B;  3W96 C;  1P3I C;  5CPK B;  3MGR D;  2L5A A;  5CP6 A;  3X1S C;  4QLC C;  4JJN A;  5GT3 A;  4KHA A;  4KUD D;  4H9O B;  2BYK A;  3KXB A;  3REL A;  1P34 A;  5E5A B;  5CPJ B;  2ARO A;  5AV6 C;  3AZF C;  3KWQ C;  3AZI A;  3AZG A;  3B0B A;  3KUY D;  4WNN A;  3UT9 D;  1EQZ C;  4CSR B;  3W98 C;  3TU4 D;  2HUE C;  2F8N K;  5AV5 D;  4H9Q A;  5DNM B;  3AV1 B;  1P3G C;  1BH8 A;  3AZN A;  5GSU D;  3X1V A;  1M19 D;  1KX5 B;  5B1M D;  4J8X C;  2CV5 D;  3X1T D;  3WKJ D;  4ZBJ B;  2F8N H;  4J8V B;  3C1C D;  1ZLA A;  3AN2 C;  4CAY B;  5CPJ A;  1S32 D;  2NQB D;  2HIO D;  3MGQ C;  3AZL A;  3AZE C;  5B33 C;  4CSR A;  3AYW D;  5JRG B;  3WTP C;  1M18 D;  3REH C;  1HQ3 C;  4KGC C;  1P3P D;  2RVQ D;  4J8U A;  5JA4 A;  4YS3 D;  3W99 B;  4H9S A;  4J8W D;  3W97 D;  5F99 D;  5GT0 B;  2NZD C;  5BT1 C;  1P3F C;  5BS7 C;  5AY8 B;  4YM6 D;  1P3A C;  1KX4 C;  2F8N A;  3B0D B;  3VH6 A;  5GXQ C;  3REJ D;  3MNN C;  3AV2 B;  5AVB B;  4WV4 B;  1P3M D;  3O62 D;  3C1B D;  3B6F B;  3MGR A;  5AVC C;  3W99 A;  2IO5 B;  4WU9 D;  3LZ0 C;  5CP6 C;  3AZM C;  5B0Y B;  5AY8 A;  4JJN C;  4HGA C;  3KUY A;  5GT3 D;  3REL C;  3UT9 A;  3KXB D;  1P34 D;  1TAF B;  3LZ1 C;  2ARO D;  3TU4 A;  2YFV A;  3AZJ C;  3AZI D;  4G91 B;  3AFA C;  3AZG D;  2FJ7 D;  3AV2 A;  5AV5 A;  5AV8 B;  3B6F A;  5DNN C;  1P3G B;  4Z5T D;  3REK D;  1M19 A;  4R8P D;  1KU5 A;  3B0C W;  5B1M A;  3UTA C;  2CV5 A;  5CPI C;  3X1U C;  3X1T A;  3WKJ A;  1AOI D;  1S32 A;  4XUJ C;  1TZY D;  2NQB A;  1H3O A;  4Z66 C;  5CPK D;  5C3I C;  5B0Y A;  3X1V C;  4EO5 C;  2PYO C;  4E45 A;  1ZLA C;  5B1L C;  1TAF A;  3AYW A;  5E5A D;  5CPJ D;  1P3O B;  1M18 A;  3AZL C;  3WTP B;  1U35 B;  5AV9 B;  3AZI B;  1HQ3 B;  3AZK B;  4YS3 A;  3B0C T;  4WU8 B;  1M1A C;  5G49 B;  5DNM D;  3AV1 D;  4J8U C;  5B40 C;  3UTB B;  1F66 C;  4H9S C;  1KX5 D;  5B31 B;  1P3L C;  1P3K C;  3NQU A;  4J8V D;  1P3O A;  4H9P B;  3REJ A;  5B0Z B;  3MGS C;  1R4V A;  1P3M A;  1U35 A;  3O62 A;  1BFM A;  3C1B A;  1P3B C;  5JRG D;  3V9R A;  5B24 B;  3MGR C;  4ZUX B;  2LY8 A;  4AWL C;  3W99 D;  3AZM B;  5B31 A;  4KUD C;  5GT0 D;  4X23 B;  5B0Z A;  4H9N A;  5AY8 D;  2FJ7 A;  3UT9 C;  3B6G B;  3WAA B;  3KSY A;  4H9R B;  4Z5T A;  5DNN B;  1HTA A;  3REK A;  4G92 C;  4R8P A;  5AV5 C;  4NFT A;  3AV2 D;  5AVB D;  1AOI A;  5CPI B;  5GSU C;  1TZY A;  4ZUX A;  3VH6 W;  3B6F D;  5CPK A;  1M19 C;  5B1M C;  2CV5 C;  3WKJ C;  3C1C C;  5B32 B;  4H9O A;  1S32 C;  2NQB C;  2HIO C;  5E5A A;  5B1L B;  5B0Y D;  3A6N C;  3B6G A;  1KX3 B;  3WAA A;  3AYW C;  3MVD B;  1M18 C;  5B2J B;  4H9R A;  1ID3 B;  4XZQ B;  5DNM A;  3VH6 T;  5AV8 D;  3AV1 A;  2RVQ C;  1P3P C;  3REI B;  5B31 G;  1P3G D;  3MGP B;  4J8W C;  3AZH C;  3W97 C;  1KX5 A;  3WTP E;  5F99 C;  2CWE A;  4NE6 A;  4J8V A;  4CAY A;  4YM6 C;  5B2I C;  1KX3 A;  3WA9 C;  3REJ C;  1P3O D;  5JRG A;  1P3M C;  3WTP D;  3O62 C;  4XZQ A;  3C1B C;  1U35 D;  4LD9 B;  5AV9 D;  3LJA B;  1HQ3 D;  3LEL B;  3AZK D;  3MGP A;  4WU8 D;  4WU9 C;  3W96 B;  1P3I B;  4AWL B;  5GT0 A;  3X1S B;  4QLC B;  1N1J B;  1B6W A;  3UTB D;  5GT3 C;  5B31 D;  5AV6 B;  3AZF B;  3KWQ B;  3KXB C;  1P34 C;  2ARO C;  3AZI C;  3AZG C;  5B0Z D;  1BH9 B;  1EQZ B;  2FJ7 C;  3W98 B;  2HUE B;  5AVB A;  4LD9 A;  5BNV B;  3R45 B;  3LEL A;  3REK C;  3VH5 A;  4R8P C;  5B32 G;  1AOI C;  3X1S A;  1TZY C;  4J8X B;  3NQJ B;  3AZN C;  1N1J A;  5B24 D;  4ZUX D;  3AN2 B;  3AZM D;  3MGQ B;  3A6N B;  5E5A C;  4UUZ B;  4X23 D;  5CPJ C;  3AZE B;  5B33 B;  1BH9 A;  3W98 A;  5AV8 A;  3B6G D;  3REH B;  3WAA D;  3R45 A;  1P3G A;  4KGC B;  5DNM C;  3AZH B;  5F99 B;  4J8X A;  5CPI D;  5BO0 B;  2NZD B;  1KX5 C;  5CHL B;  4ZBJ C;  5B2I B;  1P3F B;  3MGQ A;  4J8V C;  1P3A B;  5B32 D;  1KX4 B;  4UUZ A;  3WA9 B;  5B33 A;  5B1L D;  3WTP A;  5GXQ B;  3MNN B;  1KX3 D;  3REH A;  5AV9 A;  1HQ3 A;  3MVD D;  3AZK A;  4KGC A;  5B2J D;  4WU8 A;  1ID3 D;  5G49 A;  5AVC B;  4XZQ D;  2JSS A;  2BYM B;  3REI D;  3W99 C;  3UTB A;  3MGP D;  3LZ0 B;  5CP6 B;  5BS7 A;  4JJN B;  4HGA B;  4KHA B;  1KX4 A;  3REL B;  2BYK B;  4H9P A;  5AY8 C;  3LZ1 B;  4NE5 A;  3KUY C;  1WWS A;  3AZJ B;  3AFA B;  4WNN B;  3TU4 C;  3AV2 C;  5AVB C;  3UTA B;  3B6F C;  4LD9 D;  4M6B A;  5B24 A;  3X1U B;  1BH8 B;  3LJA D;  3LEL D;  2IO5 C;  3AZN B;  4XUJ B;  3LZ0 A;  3W96 D;  3AZM A;  4Z66 B;  3X1T C;  1P3I D;  5C3I B;  5FUG B;  3X1V B;  4EO5 B;  3X1S D;  4QLC D;  4X23 A;  2YFW B;  2PYO B;  5B0Y C;  1ZLA B;  3LZ1 A;  3AZL B;  5AV6 D;  3AZJ A;  3KWQ D;  3AZF D;  3AFA A;  5DNN A;  4G91 C;  1EQZ D;  3W98 D;  2FJ7 B;  5AV8 C;  1M1A B;  3UTA A;  3X1U A;  4YS3 C;  5CPI A;  4J8U B;  5JA4 B;  4Z2M H;  5B40 B;  4XUJ A;  4Z66 A;  1F66 B;  5FUG A;  1JFI B;  5B32 A;  1P3L B;  4J8X D;  2YFW A;  1P3K B;  3VH5 W;  2PYO A;  4WZS B;  5B1L A;  3AN2 D;  3MGQ D;  3MGS B;  4NE3 A;  3A6N D;  2F8N B;  3MVD A;  1P3O C;  3AZE D;  5B2J A;  1ID3 A;  5B33 D;  1P3B B;  1U35 C;  1M1A A;  5AV9 C;  3REH D;  3AZK C;  3REI A;  4WU8 C;  4KGC D;  5B40 A;  3MGR B;  1F66 A;  3VH5 T;  3AZH D;  1JFI A;  1P3L A;  1P3K A;  4KUD B;  3UTB C;  4DRA A;  1WWI A;  2NZD D;  5BT1 D;  5B31 C;  1F1E A;  1P3F D;  5B2I D;  3KUY B;  3MGS A;  1P3A D;  3UT9 B;  1KX4 D;  5B0Z C;  3WA9 D;  1P3B A;  3TU4 B;  2YFV B;  5GXQ D;  3MNN D;  4G92 B;  5AV5 B;  3LJA A;  4Z5T C;  5GSU B;  3W96 A;  1P3I A;  1M19 B;  5AVC D;  5B1M B;  2CV5 B;  3X1T B;  5B24 C;  4QLC A;  4ZUX C;  3WKJ B;  4KUD A;  3C1C B;  5CPK C;  1S32 B;  2NQB B;  2HIO B;  1H3O B;  3LZ0 D;  5CP6 D;  5KDM B;  5AV6 A;  3AZF A;  3KWQ A;  4X23 C;  4JJN D;  3REL D;  3AYW B;  1EQZ A;  1M18 B;  3LZ1 D;  3B6G C;  3WAA C;  3AZJ D;  3AFA D;  5BNV A;  1P3P B;  5BNX B;  4YS3 B;  5GSU A;  5DNN D;  3AV1 C;  4J8W B;  1A7W A;  3W97 B;  3UTA D;  4Z2M G;  3NQJ A;  3X1U D;  3C1C A;  3AZN D;  2HIO A;  3AN2 A;  4XUJ D;  5KDM A;  4Z66 D;  4YM6 B;  2F8N G;  3X1V D;  5B32 C;  3A6N A;  2PYO D;  3NQU B;  3AZE A;  1ZLA D;  3REJ B;  1KX3 C;  3AZL D;  3MVD C;  1P3M B;  3O62 B;  5B2J C;  3C1B B;  1P3P A;  5JRG C;  1ID3 C;  5BNX A;  4XZQ C;  1B67 A;  3W97 A;  4J8W A;  3AZH A;  4WU9 B;  1M1A D;  5F99 A;  3V9R B;  3REI C;  1ULY A;  4DRB A;  5BO0 A;  3MGP C;  2NZD A;  4J8U D;  5B40 D;  4YM6 A;  5GT0 C;  1P3F A;  5B2I A;  1F66 D;  5GT3 B;  1P3A A;  1P3L D;  1P3K D;  3KXB B;  1P34 B;  3WA9 A;  2ARO B;  4H9N B;  5GXQ A;  3AZG B;  3MNN A; 
#chains in the Genus database with same CATH topology
 3MGS D;  2F8N D;  3B0D C;  1P3B D;  4Z5T B;  3REK B;  4R8P B;  5AVC A;  4WU9 A;  4LD9 C;  1Q9C A;  4E44 A;  3EPL A;  3LJA C;  4H9Q B;  3LEL C;  2BYM A;  1AOI B;  1TZY B;  3W96 C;  1P3I C;  3EPK A;  5CPK B;  3MGR D;  2L5A A;  5CP6 A;  3X1S C;  4QLC C;  4JJN A;  5GT3 A;  4KHA A;  4KUD D;  4H9O B;  2BYK A;  3KXB A;  3REL A;  1P34 A;  5E5A B;  5CPJ B;  2ARO A;  5AV6 C;  3AZF C;  3KWQ C;  3AZI A;  3AZG A;  2Y2K A;  3B0B A;  3KUY D;  2W8S A;  4WNN A;  3UT9 D;  3H0L C;  4CSR B;  1EQZ C;  3W98 C;  3TU4 D;  2HUE C;  2F8N K;  5AV5 D;  4H9Q A;  5DNM B;  3AV1 B;  1P3G C;  1BH8 A;  3AZN A;  5GSU D;  3X1V A;  1M19 D;  1KX5 B;  5B1M D;  4J8X C;  2CV5 D;  3X1T D;  3WKJ D;  4ZBJ B;  2F8N H;  4J8V B;  3C1C D;  1ZLA A;  3AN2 C;  4CAY B;  5CPJ A;  1S32 D;  2NQB D;  2HIO D;  3MGQ C;  3AZL A;  3AZE C;  5B33 C;  4CSR A;  3AYW D;  5JRG B;  3WTP C;  1M18 D;  3REH C;  1HQ3 C;  4KGC C;  1P3P D;  2RVQ D;  4J8U A;  5JA4 A;  4YS3 D;  3W99 B;  4H9S A;  4J8W D;  3W97 D;  4WJ3 C;  5F99 D;  5GT0 B;  3AL0 C;  2NZD C;  5BT1 C;  1P3F C;  5BS7 C;  5AY8 B;  4YM6 D;  1P3A C;  1KX4 C;  2DF4 C;  2F8N A;  3B0D B;  3VH6 A;  5GXQ C;  3REJ D;  3MNN C;  3AV2 B;  5AVB B;  4WV4 B;  1P3M D;  3O62 D;  3C1B D;  3B6F B;  3MGR A;  5AVC C;  3W99 A;  2IO5 B;  4WU9 D;  3LZ0 C;  5CP6 C;  3AZM C;  5B0Y B;  5AY8 A;  4JJN C;  4HGA C;  3KUY A;  5GT3 D;  3REL C;  3UT9 A;  3KXB D;  1P34 D;  1TAF B;  3LZ1 C;  2ARO D;  3TU4 A;  2YFV A;  3AZJ C;  3AZI D;  4G91 B;  3AFA C;  3AZG D;  2FJ7 D;  3AV2 A;  5AV5 A;  5AV8 B;  3B6F A;  5DNN C;  1P3G B;  4Z5T D;  3REK D;  1M19 A;  4R8P D;  1KU5 A;  3B0C W;  5B1M A;  3UTA C;  2CV5 A;  5CPI C;  3X1U C;  3X1T A;  3WKJ A;  1AOI D;  1S32 A;  4XUJ C;  1TZY D;  2NQB A;  1H3O A;  4Z66 C;  5CPK D;  3P5J B;  5C3I C;  5B0Y A;  3X1V C;  4EO5 C;  2PYO C;  4E45 A;  1ZLA C;  5B1L C;  1TAF A;  3AYW A;  5E5A D;  5CPJ D;  1P3O B;  1M18 A;  3AZL C;  3WTP B;  1U35 B;  5AV9 B;  3AZI B;  1HQ3 B;  2ZY4 A;  3AZK B;  4YS3 A;  3B0C T;  4WU8 B;  1M1A C;  5G49 B;  5DNM D;  3AV1 D;  4J8U C;  5B40 C;  3UTB B;  1F66 C;  4H9S C;  1KX5 D;  5B31 B;  2Y2P A;  1P3K C;  2Y2G A;  1P3L C;  3NQU A;  4J8V D;  1P3O A;  4H9P B;  3REJ A;  5B0Z B;  3MGS C;  1R4V A;  1P3M A;  1U35 A;  3O62 A;  1BFM A;  3C1B A;  1P3B C;  5JRG D;  3V9R A;  5B24 B;  3MGR C;  4ZUX B;  2LY8 A;  4AWL C;  3W99 D;  3AZM B;  5B31 A;  4KUD C;  5GT0 D;  4X23 B;  1PZR A;  5B0Z A;  4H9N A;  5AY8 D;  2FJ7 A;  1W2E A;  3UT9 C;  3B6G B;  3WAA B;  3KSY A;  2G5H C;  4H9R B;  4Z5T A;  5DNN B;  1HTA A;  3REK A;  4G92 C;  4R8P A;  5AV5 C;  4NFT A;  3AV2 D;  5AVB D;  1AOI A;  5CPI B;  5GSU C;  1TZY A;  3A1K A;  3VH6 W;  2F2A C;  4ZUX A;  5CPK A;  3B6F D;  1M19 C;  5B1M C;  2CV5 C;  3WKJ C;  3C1C C;  5B32 B;  4H9O A;  1S32 C;  2NQB C;  2HIO C;  5E5A A;  5B1L B;  5B0Y D;  3A6N C;  3FDD A;  3H0M C;  3B6G A;  1KX3 B;  3WAA A;  3AYW C;  3MVD B;  1M18 C;  5B2J B;  4H9R A;  1ID3 B;  4XZQ B;  5DNM A;  3VH6 T;  5AV8 D;  3AV1 A;  2RVQ C;  1P3P C;  2BG1 A;  3REI B;  5B31 G;  1P3G D;  3A1I A;  3MGP B;  4J8W C;  3AZH C;  3W97 C;  1KX5 A;  3WTP E;  5F99 C;  2CWE A;  4NE6 A;  4J8V A;  4CAY A;  4YM6 C;  5B2I C;  1KX3 A;  3WA9 C;  3REJ C;  1P3O D;  5JRG A;  1P3M C;  2VQR A;  3WTP D;  3O62 C;  4XZQ A;  3C1B C;  3KFU G;  1U35 D;  4LD9 B;  5AV9 D;  3LJA B;  1HQ3 D;  3LEL B;  3AZK D;  3MGP A;  4WU8 D;  4WU9 C;  3W96 B;  1P3I B;  4AWL B;  5GT0 A;  3X1S B;  4QLC B;  1N1J B;  1B6W A;  3EPJ A;  3UTB D;  5GT3 C;  5B31 D;  5AV6 B;  3AZF B;  3IP4 C;  3KXB C;  3KWQ B;  1P34 C;  2RIQ A;  2ARO C;  3AZI C;  3AZG C;  5B0Z D;  1BH9 B;  1EQZ B;  2FJ7 C;  3W98 B;  2HUE B;  5AVB A;  4LD9 A;  5BNV B;  3R45 B;  3LEL A;  3REK C;  3VH5 A;  4R8P C;  5B32 G;  1AOI C;  3X1S A;  1TZY C;  4J8X B;  3NQJ B;  3AZN C;  1N1J A;  5B24 D;  4ZUX D;  2ZY3 A;  2XD1 A;  3AN2 B;  3AZM D;  3MGQ B;  2DQN C;  3A6N B;  5E5A C;  4UUZ B;  4X23 D;  5CPJ C;  3AZE B;  5B33 B;  1BH9 A;  3EG5 B;  3W98 A;  5AV8 A;  3B6G D;  3REH B;  3WAA D;  3R45 A;  4DQY B;  1P3G A;  4KGC B;  5DNM C;  3AZH B;  5F99 B;  3F6T A;  4J8X A;  5CPI D;  5BO0 B;  2NZD B;  1KX5 C;  5CHL B;  4ZBJ C;  5B2I B;  1P3F B;  3MGQ A;  4J8V C;  2XD5 A;  1P3A B;  5B32 D;  1KX4 B;  4UUZ A;  3WA9 B;  5B33 A;  5B1L D;  3WTP A;  5GXQ B;  3MNN B;  2FFF B;  1KX3 D;  3REH A;  5AV9 A;  1HQ3 A;  3MVD D;  3AZK A;  4KGC A;  5B2J D;  4WU8 A;  2G5I C;  1ID3 D;  5G49 A;  5AVC B;  2J8P A;  4XZQ D;  2JSS A;  2BYM B;  3REI D;  3W99 C;  2Y2Q A;  2Y2L A;  3MGP D;  3UTB A;  3LZ0 B;  5CP6 B;  5BS7 A;  4JJN B;  4HGA B;  4KHA B;  1KX4 A;  3REL B;  2BYK B;  4H9P A;  5AY8 C;  3LZ1 B;  4NE5 A;  3KUY C;  1WWS A;  3AZJ B;  3AFA B;  1T3U A;  4WNN B;  3TU4 C;  2UWX A;  2JE5 A;  3AV2 C;  5AVB C;  3UTA B;  3B6F C;  4LD9 D;  4M6B A;  5B24 A;  3X1U B;  1BH8 B;  3LJA D;  3LEL D;  2IO5 C;  3AZN B;  4XUJ B;  3LZ0 A;  3W96 D;  3AZM A;  4Z66 B;  3X1T C;  1P3I D;  2Y2J A;  5C3I B;  5FUG B;  3X1V B;  4EO5 B;  3X1S D;  4QLC D;  4X23 A;  2YFW B;  2PYO B;  5B0Y C;  1ZLA B;  3LZ1 A;  3AZL B;  5AV6 D;  3AZJ A;  3KWQ D;  3AZF D;  3AFA A;  2Y2M A;  5DNN A;  4G91 C;  1EQZ D;  3W98 D;  2FJ7 B;  5AV8 C;  1M1A B;  3UTA A;  3EPH A;  3X1U A;  4YS3 C;  5CPI A;  4J8U B;  5JA4 B;  4Z2M H;  5B40 B;  4XUJ A;  4Z66 A;  1F66 B;  5FUG A;  1JFI B;  5B32 A;  2ZY2 A;  4J8X D;  2YFW A;  1P3L B;  3VH5 W;  1P3K B;  2PYO A;  4WZS B;  5B1L A;  3AN2 D;  3MGQ D;  3MGS B;  4NE3 A;  3A6N D;  2F8N B;  3MVD A;  1P3O C;  3AZE D;  5B2J A;  1ID3 A;  5B33 D;  1P3B B;  1U35 C;  1M1A A;  5AV9 C;  3REH D;  3AZK C;  3REI A;  4WU8 C;  4KGC D;  5B40 A;  3MGR B;  1F66 A;  3VH5 T;  3AZH D;  1JFI A;  1P3L A;  1P3K A;  4KUD B;  3UTB C;  4DRA A;  1WWI A;  2NZD D;  5BT1 D;  5B31 C;  1F1E A;  1P3F D;  5B2I D;  3KUY B;  3MGS A;  1P3A D;  3UT9 B;  1KX4 D;  5B0Z C;  3WA9 D;  1P3B A;  3TU4 B;  2YFV B;  5GXQ D;  3MNN D;  4G92 B;  5AV5 B;  3LJA A;  4Z5T C;  5GSU B;  3W96 A;  1P3I A;  1M19 B;  4UPK A;  5AVC D;  5B1M B;  2CV5 B;  3X1T B;  5B24 C;  4QLC A;  4ZUX C;  3WKJ B;  4KUD A;  3C1C B;  5CPK C;  1S32 B;  2NQB B;  2HIO B;  1H3O B;  3LZ0 D;  5CP6 D;  5KDM B;  5AV6 A;  3AZF A;  3KWQ A;  4X23 C;  4JJN D;  3REL D;  2Y2I A;  3AYW B;  1EQZ A;  2ZM5 A;  3LZ1 D;  1M18 B;  3B6G C;  3WAA C;  3AZJ D;  3AFA D;  5BNV A;  1P3P B;  5BNX B;  4YS3 B;  5GSU A;  5DNN D;  3AV1 C;  4J8W B;  1A7W A;  3W97 B;  2Y2H A;  3UTA D;  4Z2M G;  3NQJ A;  3X1U D;  3C1C A;  3AZN D;  2HIO A;  3AN2 A;  4XUJ D;  5KDM A;  4Z66 D;  4YM6 B;  2F8N G;  3X1V D;  5B32 C;  3H0R C;  3A6N A;  2PYO D;  3NQU B;  2ZY5 A;  3AZE A;  1ZLA D;  3REJ B;  1KX3 C;  3AZL D;  3MVD C;  2Y2O A;  1P3M B;  3O62 B;  5B2J C;  3C1B B;  1P3P A;  5JRG C;  1ID3 C;  5BNX A;  2JCH A;  4XZQ C;  1B67 A;  3W97 A;  4J8W A;  3AZH A;  4WU9 B;  1M1A D;  5F99 A;  3V9R B;  3REI C;  1ULY A;  4DRB A;  1Z2C B;  5BO0 A;  3MGP C;  2NZD A;  4J8U D;  5B40 D;  4YM6 A;  5GT0 C;  1P3F A;  5B2I A;  1F66 D;  5GT3 B;  1P3A A;  1P3L D;  1P3K D;  3KXB B;  1P34 B;  3WA9 A;  2ARO B;  2Y2N A;  4H9N B;  5GXQ A;  3AZG B;  3MNN A; 
#chains in the Genus database with same CATH homology
 3MGS D;  2F8N D;  3B0D C;  1P3B D;  4Z5T B;  3REK B;  4R8P B;  5AVC A;  4WU9 A;  4LD9 C;  1Q9C A;  4E44 A;  3EPL A;  3LJA C;  4H9Q B;  3LEL C;  2BYM A;  1AOI B;  1TZY B;  3W96 C;  1P3I C;  3EPK A;  5CPK B;  3MGR D;  2L5A A;  5CP6 A;  3X1S C;  4QLC C;  4JJN A;  5GT3 A;  4KHA A;  4KUD D;  4H9O B;  2BYK A;  3KXB A;  3REL A;  1P34 A;  5E5A B;  5CPJ B;  2ARO A;  5AV6 C;  3AZF C;  3KWQ C;  3AZI A;  3AZG A;  2Y2K A;  3B0B A;  3KUY D;  2W8S A;  4WNN A;  3UT9 D;  3H0L C;  4CSR B;  1EQZ C;  3W98 C;  3TU4 D;  2HUE C;  2F8N K;  5AV5 D;  4H9Q A;  5DNM B;  3AV1 B;  1P3G C;  1BH8 A;  3AZN A;  5GSU D;  3X1V A;  1M19 D;  1KX5 B;  5B1M D;  4J8X C;  2CV5 D;  3X1T D;  3WKJ D;  4ZBJ B;  2F8N H;  4J8V B;  3C1C D;  1ZLA A;  3AN2 C;  4CAY B;  5CPJ A;  1S32 D;  2NQB D;  2HIO D;  3MGQ C;  3AZL A;  3AZE C;  5B33 C;  4CSR A;  3AYW D;  5JRG B;  3WTP C;  1M18 D;  3REH C;  1HQ3 C;  4KGC C;  1P3P D;  2RVQ D;  4J8U A;  5JA4 A;  4YS3 D;  3W99 B;  4H9S A;  4J8W D;  3W97 D;  4WJ3 C;  5F99 D;  5GT0 B;  3AL0 C;  2NZD C;  5BT1 C;  1P3F C;  5BS7 C;  5AY8 B;  4YM6 D;  1P3A C;  1KX4 C;  2DF4 C;  2F8N A;  3B0D B;  3VH6 A;  5GXQ C;  3REJ D;  3MNN C;  3AV2 B;  5AVB B;  4WV4 B;  1P3M D;  3O62 D;  3C1B D;  3B6F B;  3MGR A;  5AVC C;  3W99 A;  2IO5 B;  4WU9 D;  3LZ0 C;  5CP6 C;  3AZM C;  5B0Y B;  5AY8 A;  4JJN C;  4HGA C;  3KUY A;  5GT3 D;  3REL C;  3UT9 A;  3KXB D;  1P34 D;  1TAF B;  3LZ1 C;  2ARO D;  3TU4 A;  2YFV A;  3AZJ C;  3AZI D;  4G91 B;  3AFA C;  3AZG D;  2FJ7 D;  3AV2 A;  5AV5 A;  5AV8 B;  3B6F A;  5DNN C;  1P3G B;  4Z5T D;  3REK D;  1M19 A;  4R8P D;  1KU5 A;  3B0C W;  5B1M A;  3UTA C;  2CV5 A;  5CPI C;  3X1U C;  3X1T A;  3WKJ A;  1AOI D;  1S32 A;  4XUJ C;  1TZY D;  2NQB A;  1H3O A;  4Z66 C;  5CPK D;  3P5J B;  5C3I C;  5B0Y A;  3X1V C;  4EO5 C;  2PYO C;  4E45 A;  1ZLA C;  5B1L C;  1TAF A;  3AYW A;  5E5A D;  5CPJ D;  1P3O B;  1M18 A;  3AZL C;  3WTP B;  1U35 B;  5AV9 B;  3AZI B;  1HQ3 B;  2ZY4 A;  3AZK B;  4YS3 A;  3B0C T;  4WU8 B;  1M1A C;  5G49 B;  5DNM D;  3AV1 D;  4J8U C;  5B40 C;  3UTB B;  1F66 C;  4H9S C;  1KX5 D;  5B31 B;  2Y2P A;  1P3K C;  2Y2G A;  1P3L C;  3NQU A;  4J8V D;  1P3O A;  4H9P B;  3REJ A;  5B0Z B;  3MGS C;  1R4V A;  1P3M A;  1U35 A;  3O62 A;  1BFM A;  3C1B A;  1P3B C;  5JRG D;  3V9R A;  5B24 B;  3MGR C;  4ZUX B;  2LY8 A;  4AWL C;  3W99 D;  3AZM B;  5B31 A;  4KUD C;  5GT0 D;  4X23 B;  1PZR A;  5B0Z A;  4H9N A;  5AY8 D;  2FJ7 A;  1W2E A;  3UT9 C;  3B6G B;  3WAA B;  3KSY A;  2G5H C;  4H9R B;  4Z5T A;  5DNN B;  1HTA A;  3REK A;  4G92 C;  4R8P A;  5AV5 C;  4NFT A;  3AV2 D;  5AVB D;  1AOI A;  5CPI B;  5GSU C;  1TZY A;  3A1K A;  3VH6 W;  2F2A C;  4ZUX A;  5CPK A;  3B6F D;  1M19 C;  5B1M C;  2CV5 C;  3WKJ C;  3C1C C;  5B32 B;  4H9O A;  1S32 C;  2NQB C;  2HIO C;  5E5A A;  5B1L B;  5B0Y D;  3A6N C;  3FDD A;  3H0M C;  3B6G A;  1KX3 B;  3WAA A;  3AYW C;  3MVD B;  1M18 C;  5B2J B;  4H9R A;  1ID3 B;  4XZQ B;  5DNM A;  3VH6 T;  5AV8 D;  3AV1 A;  2RVQ C;  1P3P C;  2BG1 A;  3REI B;  5B31 G;  1P3G D;  3A1I A;  3MGP B;  4J8W C;  3AZH C;  3W97 C;  1KX5 A;  3WTP E;  5F99 C;  2CWE A;  4NE6 A;  4J8V A;  4CAY A;  4YM6 C;  5B2I C;  1KX3 A;  3WA9 C;  3REJ C;  1P3O D;  5JRG A;  1P3M C;  2VQR A;  3WTP D;  3O62 C;  4XZQ A;  3C1B C;  3KFU G;  1U35 D;  4LD9 B;  5AV9 D;  3LJA B;  1HQ3 D;  3LEL B;  3AZK D;  3MGP A;  4WU8 D;  4WU9 C;  3W96 B;  1P3I B;  4AWL B;  5GT0 A;  3X1S B;  4QLC B;  1N1J B;  1B6W A;  3EPJ A;  3UTB D;  5GT3 C;  5B31 D;  5AV6 B;  3AZF B;  3IP4 C;  3KXB C;  3KWQ B;  1P34 C;  2RIQ A;  2ARO C;  3AZI C;  3AZG C;  5B0Z D;  1BH9 B;  1EQZ B;  2FJ7 C;  3W98 B;  2HUE B;  5AVB A;  4LD9 A;  5BNV B;  3R45 B;  3LEL A;  3REK C;  3VH5 A;  4R8P C;  5B32 G;  1AOI C;  3X1S A;  1TZY C;  4J8X B;  3NQJ B;  3AZN C;  1N1J A;  5B24 D;  4ZUX D;  2ZY3 A;  2XD1 A;  3AN2 B;  3AZM D;  3MGQ B;  2DQN C;  3A6N B;  5E5A C;  4UUZ B;  4X23 D;  5CPJ C;  3AZE B;  5B33 B;  1BH9 A;  3EG5 B;  3W98 A;  5AV8 A;  3B6G D;  3REH B;  3WAA D;  3R45 A;  4DQY B;  1P3G A;  4KGC B;  5DNM C;  3AZH B;  5F99 B;  3F6T A;  4J8X A;  5CPI D;  5BO0 B;  2NZD B;  1KX5 C;  5CHL B;  4ZBJ C;  5B2I B;  1P3F B;  3MGQ A;  4J8V C;  2XD5 A;  1P3A B;  5B32 D;  1KX4 B;  4UUZ A;  3WA9 B;  5B33 A;  5B1L D;  3WTP A;  5GXQ B;  3MNN B;  2FFF B;  1KX3 D;  3REH A;  5AV9 A;  1HQ3 A;  3MVD D;  3AZK A;  4KGC A;  5B2J D;  4WU8 A;  2G5I C;  1ID3 D;  5G49 A;  5AVC B;  2J8P A;  4XZQ D;  2JSS A;  2BYM B;  3REI D;  3W99 C;  2Y2Q A;  2Y2L A;  3MGP D;  3UTB A;  3LZ0 B;  5CP6 B;  5BS7 A;  4JJN B;  4HGA B;  4KHA B;  1KX4 A;  3REL B;  2BYK B;  4H9P A;  5AY8 C;  3LZ1 B;  4NE5 A;  3KUY C;  1WWS A;  3AZJ B;  3AFA B;  1T3U A;  4WNN B;  3TU4 C;  2UWX A;  2JE5 A;  3AV2 C;  5AVB C;  3UTA B;  3B6F C;  4LD9 D;  4M6B A;  5B24 A;  3X1U B;  1BH8 B;  3LJA D;  3LEL D;  2IO5 C;  3AZN B;  4XUJ B;  3LZ0 A;  3W96 D;  3AZM A;  4Z66 B;  3X1T C;  1P3I D;  2Y2J A;  5C3I B;  5FUG B;  3X1V B;  4EO5 B;  3X1S D;  4QLC D;  4X23 A;  2YFW B;  2PYO B;  5B0Y C;  1ZLA B;  3LZ1 A;  3AZL B;  5AV6 D;  3AZJ A;  3KWQ D;  3AZF D;  3AFA A;  2Y2M A;  5DNN A;  4G91 C;  1EQZ D;  3W98 D;  2FJ7 B;  5AV8 C;  1M1A B;  3UTA A;  3EPH A;  3X1U A;  4YS3 C;  5CPI A;  4J8U B;  5JA4 B;  4Z2M H;  5B40 B;  4XUJ A;  4Z66 A;  1F66 B;  5FUG A;  1JFI B;  5B32 A;  2ZY2 A;  4J8X D;  2YFW A;  1P3L B;  3VH5 W;  1P3K B;  2PYO A;  4WZS B;  5B1L A;  3AN2 D;  3MGQ D;  3MGS B;  4NE3 A;  3A6N D;  2F8N B;  3MVD A;  1P3O C;  3AZE D;  5B2J A;  1ID3 A;  5B33 D;  1P3B B;  1U35 C;  1M1A A;  5AV9 C;  3REH D;  3AZK C;  3REI A;  4WU8 C;  4KGC D;  5B40 A;  3MGR B;  1F66 A;  3VH5 T;  3AZH D;  1JFI A;  1P3L A;  1P3K A;  4KUD B;  3UTB C;  4DRA A;  1WWI A;  2NZD D;  5BT1 D;  5B31 C;  1F1E A;  1P3F D;  5B2I D;  3KUY B;  3MGS A;  1P3A D;  3UT9 B;  1KX4 D;  5B0Z C;  3WA9 D;  1P3B A;  3TU4 B;  2YFV B;  5GXQ D;  3MNN D;  4G92 B;  5AV5 B;  3LJA A;  4Z5T C;  5GSU B;  3W96 A;  1P3I A;  1M19 B;  4UPK A;  5AVC D;  5B1M B;  2CV5 B;  3X1T B;  5B24 C;  4QLC A;  4ZUX C;  3WKJ B;  4KUD A;  3C1C B;  5CPK C;  1S32 B;  2NQB B;  2HIO B;  1H3O B;  3LZ0 D;  5CP6 D;  5KDM B;  5AV6 A;  3AZF A;  3KWQ A;  4X23 C;  4JJN D;  3REL D;  2Y2I A;  3AYW B;  1EQZ A;  2ZM5 A;  3LZ1 D;  1M18 B;  3B6G C;  3WAA C;  3AZJ D;  3AFA D;  5BNV A;  1P3P B;  5BNX B;  4YS3 B;  5GSU A;  5DNN D;  3AV1 C;  4J8W B;  1A7W A;  3W97 B;  2Y2H A;  3UTA D;  4Z2M G;  3NQJ A;  3X1U D;  3C1C A;  3AZN D;  2HIO A;  3AN2 A;  4XUJ D;  5KDM A;  4Z66 D;  4YM6 B;  2F8N G;  3X1V D;  5B32 C;  3H0R C;  3A6N A;  2PYO D;  3NQU B;  2ZY5 A;  3AZE A;  1ZLA D;  3REJ B;  1KX3 C;  3AZL D;  3MVD C;  2Y2O A;  1P3M B;  3O62 B;  5B2J C;  3C1B B;  1P3P A;  5JRG C;  1ID3 C;  5BNX A;  2JCH A;  4XZQ C;  1B67 A;  3W97 A;  4J8W A;  3AZH A;  4WU9 B;  1M1A D;  5F99 A;  3V9R B;  3REI C;  1ULY A;  4DRB A;  1Z2C B;  5BO0 A;  3MGP C;  2NZD A;  4J8U D;  5B40 D;  4YM6 A;  5GT0 C;  1P3F A;  5B2I A;  1F66 D;  5GT3 B;  1P3A A;  1P3L D;  1P3K D;  3KXB B;  1P34 B;  3WA9 A;  2ARO B;  2Y2N A;  4H9N B;  5GXQ A;  3AZG B;  3MNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...