5B31G

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.1.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
AVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.1
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00125 Histone Core histone H2A/H2B/H3/H4
G PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b31G00
3R45A 3VH6W 4Z66A 4XZQC 3MGRD 4DRAA 4KGCD 3AZNB 3W98D 3VH5A 5JRGC 1M19C 3AN2C 1B67A 1ZLAC 5AY8C 3TU4A 3REHD 3W99C 3X1VC 2HUEB 3X1SD 3MNNB 5DNNB 3MNNA 5DNNA 4X23B 4X23A 3LELD 1P3OC 3AZLD 5B33B 2PYOB 5B33A 4YS3B 5B32B 5B32A 1P3ID 3UTBD 2CV5B 3MGSA 3REID 2CV5A 5AVBB 1M18D 1JFIA 5B0ZD 3WKJA 4WNNB 1P34B 3MGQD 3RELC 4WNNA 5AV8C 1P34A 1KX5D 2BYKB 5GXQC 3B0CW 1P3GD 2BYKA 5GT0C 4H9QA 1P3LB 1P3FD 4J8XC 1P3LA 4LD9D 4QLCD 3AV2D 1AOIB 3MGRB 5B2JC 5E5AB 3MGRA 1KX3C 4DRBA 3C1CC 2L5AA 4KGCA 4JJND 3W98B 3W98A 1U35C 3A6ND 4R8PD 5AVCC 4YM6B 4YM6A 3REHB 3REHA 3REJB 3X1SA 1P3MC 3LJAD 1HQ3C 4WU9D 2RVQD 4NE5A 5B24D 3LELA 5B0YD 3W97C 3WTPE 4J8VC 5BT1C 3UTBA 1M18B 1M18A 3REIA 3B6GB 4WU8D 1KX5A 3MGQA 1P3GA 2NQBD 1P3FA 4LD9B 4LD9A 3AZNC 4QLCA 4H9NB 4E45A 3AV2B 1BH8B 4H9NA 3AV2A 5CPKD 1BH8A 5CP6D 5CPJB 2HUEC 4CAYB 4JJNB 5CPJA 4JJNA 4CAYA 5DNNC 4X23C 3AZFD 2IO5B 5B33C 2PYOC 4YS3C 5B32C 3WA9D 1P3PC 2CV5C 3AFAB 5AVBC 5B24A 1P34C 5B0YA 5JA4B 5CPID 1P3KD 5JA4A 1P3LC 3B0BA 2FJ7B 1AOIC 4KHAB 3MGRC 5E5AC 2BYMB 2NQBA 3UTAD 2BYMA 4J8UB 5CPKA 3AZID 4YM6C 3REHC 3KWQD 3REJC 4WZSB 4Z5TD 4Z2MH 5B31G 2YFVB 2YFVA 1ID3D 3REKC 3WA9B 3WA9A 3NQJB 5AV6D 3NQJA 1M18C 3B6GC 3O62D 3AZHB 3VH6A 3AZHA 2F8ND 1P3KA 4ZUXB 2AROD 1EQZD 3AV2C 3WAAD 2NZDD 3W96D 3NQUB 5CPJC 4JJNC 4XUJB 5DNMD 4ZBJB 3AZIB 3AZIA 5C3IB 2IO5C 3WTPD 5B40D 3KWQB 2HIOB 3KWQA 4KUDC 4Z66B 5B31D 4Z5TA 1H3OB 1H3OA 3UT9D 3AFAC 1ID3B 1ID3A 1B6WA 2CWEA 3TU4B 3AZED 3V9RA 5AV5D 2FJ7C 3O62B 4M6BA 3O62A 2F8NB 2F8NA 1S32D 1P3BB 4J8UC 2AROA 1P3BA 1EQZA 3KUYD 3AZGD 3WAAB 3WAAA 2NZDA 3W96A 3MGSB 5DNMB 1JFIB 4H9SA 5DNMA 3WKJB 4H9QB 5B40A 3AZKD 3AV1D 3UT9B 1KX4C 3UT9A 1M1AD 4KGCB 1A7WA 1P3AD 3AZHC 1WWSA 1F66D 4ZUXC 3X1TC 1F1EA 5B1LD 5AV5B 3AZEA 5AV5A 3LZ1D 3X1SB 4NFTA 1TAFB 1TAFA 2F8NH 1S32A 4XUJC 3LELB 3AZLB 4ZBJC 3KUYA 3X1UD 3AZGA 3AZLA 3B6FD 3AZIC 3C1BD 5C3IC 5GSUD 3MGPD 1P3IB 2HIOC 3UTBB 1P3IA 3REIB 4Z66C 5B0ZB 5B0ZA 3MGQB 1KX5B 1P3GB 3AZJD 1P3FB 1ID3C 3LZ0D 5B2ID 4QLCB 3AZKB 3AZKA 3TU4C 3MVDD 1M1AA 1P3AA 3O62C 3MNNC 5BNXB 1F66B 3A6NB 5BNXA 4R8PB 3A6NA 1P3BC 1F66A 4R8PA 5B1LA 1BFMA 3LZ1A 1M19D 3WAAC 4UUZB 3LJAB 4UUZA 3LJAA 4WU9B 2YFWB 5BS7A 4WU9A 2YFWA 3MGSC 4H9SC 3W99D 5DNMC 3X1VD 5B24B 4G92B 3WKJC 5B0YB 5BNVB 3AZMD 3B6FA 5BNVA 3C1BA 4EO5B 5GSUA 3MGPA 1P3OD 4WU8B 4WU8A 2NQBB 3AZJA 3LZ0B 3LZ0A 5B2IA 4KGCC 4H9OB 3W98C 4H9OA 5CPKB 3RELD 5CP6B 5CP6A 5GT0D 3MVDB 4J8XD 3MVDA 5AV5C 3X1SC 5B2JD 1KX3D 2LY8A 3C1CD 3AZFB 3AZFA 3LELC 3AZLC 1U35D 1M19B 1M19A 5AVCD 1P3IC 3UTBC 3REIC 3W99A 3X1VA 4G91B 1P3MD 5B0ZC 3AZMB 3MGQC 1KX5C 3AZMA 1HQ3D 5CPIB 1P3GC 1P3FC 1P3KB 5CPIA 4LD9C 5B32G 4H9RA 4QLCC 1P3OA 3AZKC 4J8VD 3UTAB 3UTAA 3RELA 1F66C 3A6NC 4R8PC 4NE3A 5GT0A 4J8XA 3AZND 5F99D 4Z5TB 3LJAC 5BS7C 4WU9C 3C1CA 2RVQC 3VH5T 5B24C 4G92C 5B0YC 5DNND 1U35A 3B0CT 4X23D 5AVCA 4EO5C 5AV6B 1TZYD 3V9RB 5AV6A 2PYOD 1P3MA 4YS3D 5B1MD 4WU8C 1HQ3A 1BH9B 1P3PD 2NQBC 1BH9A 3LZ0C 2CV5D 2AROB 5AVBD 1EQZB 5CPKC 1P34D 5GT3D 5CP6C 3KXBD 3MVDC 5FUGB 2NZDB 3AYWD 5FUGA 5G49B 4J8VA 3W96B 5G49A 1AOID 5E5AD 3AZFC 2JSSA 3WTPB 3AZNA 5B40B 3WTPA 5F99B 5B31B 5F99A 5B31A 4Z2MG 3WA9C 5AV9D 4YM6D 3REJD 4HGAB 4G91C 4NE6A 3AZMC 5CPIC 1P3KC 1TZYB 3REKD 1TZYA 3AZEB 4WV4B 5B1MB 2PYOA 4YS3A 5B1MA 1P3PB 1P3PA 3UTAC 3VH5W 1S32B 3B6GD 5AVBA 4J8WD 5GT3B 3KUYB 5GT3A 3AZGB 3KXBB 3KXBA 3AYWB 3AYWA 3KWQC 1N1JB 4Z5TC 1N1JA 1AOIA 5E5AA 5CPJD 5BO0B 5AV9B 5BO0A 3AV1B 5AV9A 3AV1A 5AV6C 3REJA 1M1AB 4KUDD 1P3AB 1HTAA 4XZQD 4H9PB 4H9PA 3B0DB 2AROC 3AFAD 3REKB 1EQZC 1WWIA 5B1LB 3REKA 3LZ1B 5JRGD 3AN2D 1ZLAD 2NZDC 5AY8D 3W96C 3B6GA 4J8WB 2FJ7D 4J8WA 3X1UB 3B6FB 3X1UA 3C1BB 4J8UD 3WTPC 5GSUB 3MGPB 5B40C 5F99C 5B31C 1R4VA 3AZJB 3UT9C 4HGAC 5B2IB 4AWLB 2F8NK 5AV8D 5GXQD 1TZYC 3KSYA 3AZEC 4KUDB 4KUDA 5B1MC 4XZQB 4XZQA 5KDMB 5KDMA 1S32C 1KX4D 1KU5A 3AFAA 5GT3C 3KUYC 3AZGC 5JRGB 3AZHD 3KXBC 5CHLB 5JRGA 3AN2B 4ZUXD 1ZLAB 3AN2A 5AY8B 1ULYA 3AYWC 1ZLAA 5AY8A 3X1TD 2F8NG 3W99B 3X1VB 3VH6T 2FJ7A 4KHAA 4XUJD 4J8UA 4H9RB 1P3OB 3W97D 5AV9C 3AV1C 2HIOD 5BT1D 1M1AC 4Z66D 1P3AC 3RELB 5AV8B 5AV8A 5GXQB 3B0DC 5GT0B 1Q9CA 5GXQA 4J8XB 5B1LC 3LZ1C 4CSRB 3TU4D 5B2JB 4CSRA 1KX3B 5B2JA 3C1CB 1KX3A 1KX4B 1KX4A 4J8WC 3MNND 3X1UC 1U35B 3B6FC 4ZUXA 3C1BC 5AVCB 3X1TB 1P3BD 5GSUC 3MGPC 3X1TA 1P3MB 5B33D 4E44A 5B32D 1HQ3B 3AZJC 3NQUA 3MGSD 4XUJA 5B2IC 4AWLC 3WKJD 3W97B 3W97A 1P3LD 4J8VB 2HIOA 3R45B
chains in the Genus database with same CATH superfamily
3R45A 3VH6W 4Z66A 4XZQC 3MGRD 4DRAA 4KGCD 3AZNB 2RIQA 3W98D 3VH5A 2DQNC 5JRGC 1M19C 3AN2C 1B67A 1ZLAC 5AY8C 3TU4A 2FFFB 1W2EA 3REHD 3W99C 3X1VC 2HUEB 3X1SD 3MNNB 5DNNB 3MNNA 2ZM5A 5DNNA 4X23B 4X23A 3LELD 1P3OC 3AZLD 2Y2JA 5B33B 2PYOB 5B33A 4YS3B 5B32B 3H0LC 5B32A 1P3ID 3UTBD 2CV5B 3MGSA 3REID 2CV5A 5AVBB 1M18D 1JFIA 5B0ZD 3WKJA 4WNNB 1P34B 3MGQD 3RELC 4WNNA 3P5JB 5AV8C 1P34A 2BYKB 5GXQC 3B0CW 1P3GD 2BYKA 5GT0C 4H9QA 1P3LB 1P3FD 4J8XC 1P3LA 4LD9D 4QLCD 3AV2D 1AOIB 3MGRB 5B2JC 5E5AB 3MGRA 1KX3C 4DRBA 3C1CC 2L5AA 4KGCA 4JJND 3W98B 3W98A 1U35C 3A6ND 4R8PD 5AVCC 4YM6B 4YM6A 3REHB 3REHA 3REJB 3X1SA 1P3MC 3LJAD 1HQ3C 4WU9D 2RVQD 4NE5A 3EPLA 5B24D 3LELA 5B0YD 3W97C 3WTPE 4J8VC 5BT1C 3UTBA 1M18B 1M18A 3REIA 3B6GB 4WU8D 1KX5A 3MGQA 1P3GA 2NQBD 1P3FA 4LD9B 4LD9A 3AZNC 4QLCA 4H9NB 4E45A 3AV2B 1BH8B 4H9NA 3AV2A 5CPKD 1BH8A 5CP6D 5CPJB 2HUEC 4CAYB 4JJNB 5CPJA 4JJNA 4CAYA 2BG1A 5DNNC 4X23C 3AZFD 2IO5B 5B33C 2PYOC 2VQRA 4YS3C 5B32C 3WA9D 1P3PC 2CV5C 3AFAB 5AVBC 5B24A 3IP4C 1P34C 5B0YA 2ZY2A 5JA4B 5CPID 1P3KD 5JA4A 1P3LC 3B0BA 2FJ7B 1AOIC 4KHAB 3MGRC 5E5AC 2BYMB 2NQBA 3UTAD 2BYMA 4J8UB 5CPKA 3AZID 4YM6C 3F6TA 3REHC 3KWQD 3REJC 4WZSB 4Z5TD 4Z2MH 5B31G 2YFVB 2YFVA 1ID3D 3REKC 3WA9B 3WA9A 3NQJB 5AV6D 3NQJA 1M18C 3B6GC 3EPJA 3O62D 3AZHB 3VH6A 3AZHA 2F8ND 1P3KA 4ZUXB 2AROD 3FDDA 1EQZD 1Z2CB 3AV2C 3EPKA 4DQYB 3WAAD 2NZDD 3W96D 3NQUB 5CPJC 4JJNC 4XUJB 5DNMD 4ZBJB 3AZIB 3AZIA 5C3IB 2IO5C 3WTPD 5B40D 3KWQB 2HIOB 3KWQA 4KUDC 4Z66B 5B31D 4Z5TA 1H3OB 1H3OA 3UT9D 3AFAC 1ID3B 1ID3A 1B6WA 2CWEA 3TU4B 2Y2LA 3AZED 3V9RA 5AV5D 2ZY5A 2FJ7C 3O62B 4M6BA 3O62A 2F8NB 2F8NA 1S32D 1P3BB 4J8UC 2AROA 1P3BA 1EQZA 3KUYD 3AZGD 3WAAB 3WAAA 2NZDA 3W96A 3MGSB 5DNMB 1JFIB 4H9SA 5DNMA 3WKJB 4H9QB 5B40A 3AZKD 3AV1D 2G5IC 3UT9B 1KX4C 3UT9A 1M1AD 3EG5B 2Y2MA 1A7WA 1P3AD 4KGCB 3AZHC 1WWSA 1F66D 4ZUXC 3X1TC 1F1EA 5B1LD 5AV5B 3AZEA 5AV5A 3LZ1D 3X1SB 4NFTA 2XD1A 1TAFB 1TAFA 2F8NH 1S32A 4XUJC 2Y2HA 3LELB 3AZLB 2XD5A 4ZBJC 3KUYA 3X1UD 3AZGA 3AZLA 3B6FD 3AZIC 3C1BD 5C3IC 5GSUD 3MGPD 3KFUG 1P3IB 2HIOC 3UTBB 1P3IA 3REIB 4Z66C 5B0ZB 5B0ZA 3MGQB 1KX5B 2ZY3A 1P3GB 3AZJD 1P3FB 1ID3C 3LZ0D 5B2ID 4QLCB 2UWXA 3AZKB 3AZKA 3TU4C 3MVDD 1M1AA 1P3AA 3O62C 3MNNC 5BNXB 1F66B 3A6NB 5BNXA 4R8PB 3A6NA 1P3BC 1F66A 4R8PA 5B1LA 2Y2QA 1BFMA 3LZ1A 1M19D 3WAAC 4UUZB 3LJAB 4UUZA 3LJAA 4WU9B 2YFWB 5BS7A 4WU9A 2YFWA 3MGSC 4H9SC 3W99D 5DNMC 3X1VD 5B24B 4G92B 3WKJC 5B0YB 5BNVB 3AZMD 3B6FA 5BNVA 3C1BA 4EO5B 5GSUA 3MGPA 1P3OD 4WU8B 4WU8A 2NQBB 3AZJA 3LZ0B 3LZ0A 5B2IA 4KGCC 4H9OB 3W98C 4H9OA 5CPKB 3RELD 5CP6B 5CP6A 5GT0D 3MVDB 4J8XD 3MVDA 5AV5C 2J8PA 3X1SC 5B2JD 1KX3D 2LY8A 3C1CD 3AZFB 3AZFA 3LELC 3AZLC 1U35D 1M19B 1M19A 5AVCD 1P3IC 3UTBC 4WJ3C 3REIC 3W99A 3X1VA 4G91B 1P3MD 5B0ZC 3AZMB 3MGQC 1KX5C 3AZMA 1HQ3D 5CPIB 1P3GC 1P3FC 1P3KB 5CPIA 4LD9C 5B32G 4H9RA 4QLCC 1P3OA 3AZKC 4J8VD 3UTAB 3UTAA 3RELA 1F66C 3A6NC 4R8PC 4NE3A 5GT0A 4J8XA 3AZND 5F99D 4Z5TB 3LJAC 5BS7C 4WU9C 3C1CA 2RVQC 3VH5T 5B24C 4G92C 5B0YC 5DNND 1U35A 3B0CT 4X23D 5AVCA 4EO5C 5AV6B 1TZYD 3V9RB 5AV6A 2PYOD 1P3MA 4YS3D 5B1MD 4WU8C 2Y2GA 1HQ3A 1BH9B 1P3PD 2NQBC 1BH9A 3LZ0C 2CV5D 2AROB 5AVBD 1EQZB 5CPKC 1P34D 5GT3D 5CP6C 3KXBD 3MVDC 5FUGB 2NZDB 3AYWD 5FUGA 2JCHA 5G49B 4J8VA 5G49A 3W96B 1AOID 2Y2IA 5E5AD 3AZFC 2JSSA 3WTPB 3AZNA 5B40B 3WTPA 5F99B 5B31B 5F99A 2F2AC 5B31A 4Z2MG 3WA9C 5AV9D 4YM6D 3REJD 4HGAB 4G91C 4NE6A 3AZMC 5CPIC 1P3KC 1PZRA 1TZYB 3REKD 1TZYA 3AZEB 4WV4B 5B1MB 2PYOA 4YS3A 5B1MA 2DF4C 1P3PB 1P3PA 3UTAC 3VH5W 1S32B 3B6GD 1T3UA 5AVBA 4J8WD 5GT3B 3KUYB 5GT3A 3AZGB 3KXBB 3KXBA 3AYWB 3AYWA 3KWQC 3H0MC 1N1JB 4Z5TC 1N1JA 1AOIA 5E5AA 5CPJD 2Y2PA 3H0RC 5BO0B 5AV9B 5BO0A 3AV1B 5AV9A 3AV1A 5AV6C 3AL0C 3REJA 1M1AB 4KUDD 1P3AB 1HTAA 4XZQD 4H9PB 4H9PA 3B0DB 2AROC 3AFAD 3REKB 1EQZC 1WWIA 5B1LB 3REKA 3LZ1B 5JRGD 3AN2D 1ZLAD 2NZDC 5AY8D 3W96C 1KX5D 4J8WB 3B6GA 2FJ7D 4J8WA 3X1UB 3B6FB 3X1UA 3C1BB 4J8UD 3WTPC 5GSUB 3MGPB 5B40C 5F99C 5B31C 1R4VA 3AZJB 3UT9C 4HGAC 5B2IB 4AWLB 2F8NK 5AV8D 2G5HC 5GXQD 1TZYC 3KSYA 3AZEC 4KUDB 4KUDA 5B1MC 4XZQB 4XZQA 5KDMB 2Y2OA 5KDMA 1S32C 1KX4D 1KU5A 3AFAA 2Y2NA 5GT3C 3KUYC 3AZGC 5JRGB 3AZHD 3A1KA 5CHLB 5JRGA 3KXBC 3AN2B 4ZUXD 1ZLAB 3AN2A 5AY8B 1ULYA 3AYWC 1ZLAA 5AY8A 3X1TD 2F8NG 2W8SA 3W99B 3X1VB 3VH6T 2FJ7A 2JE5A 4KHAA 4XUJD 4J8UA 4H9RB 1P3OB 3W97D 5AV9C 3AV1C 2HIOD 4UPKA 5BT1D 1M1AC 4Z66D 1P3AC 3RELB 5AV8B 5AV8A 5GXQB 2ZY4A 3B0DC 5GT0B 1Q9CA 5GXQA 4J8XB 5B1LC 3LZ1C 4CSRB 3TU4D 5B2JB 4CSRA 1KX3B 5B2JA 3C1CB 1KX3A 1KX4B 1KX4A 4J8WC 3MNND 3X1UC 1U35B 3B6FC 3EPHA 4ZUXA 3C1BC 5AVCB 3X1TB 1P3BD 5GSUC 3A1IA 3MGPC 3X1TA 1P3MB 5B33D 4E44A 5B32D 1HQ3B 3AZJC 3NQUA 3MGSD 4XUJA 5B2IC 4AWLC 3WKJD 3W97B 3W97A 2Y2KA 1P3LD 4J8VB 2HIOA 3R45B
chains in the Genus database with same CATH topology
3R45A 3VH6W 4Z66A 4XZQC 3MGRD 4DRAA 4KGCD 3AZNB 2RIQA 3W98D 3VH5A 2DQNC 5JRGC 1M19C 3AN2C 1B67A 1ZLAC 5AY8C 3TU4A 2FFFB 1W2EA 3REHD 3W99C 3X1VC 2HUEB 3X1SD 3MNNB 5DNNB 3MNNA 2ZM5A 5DNNA 4X23B 4X23A 3LELD 1P3OC 3AZLD 2Y2JA 5B33B 2PYOB 5B33A 4YS3B 5B32B 3H0LC 5B32A 1P3ID 3UTBD 2CV5B 3MGSA 3REID 2CV5A 5AVBB 1M18D 1JFIA 5B0ZD 3WKJA 4WNNB 1P34B 3MGQD 3RELC 4WNNA 3P5JB 5AV8C 1P34A 2BYKB 5GXQC 3B0CW 1P3GD 2BYKA 5GT0C 4H9QA 1P3LB 1P3FD 4J8XC 1P3LA 4LD9D 4QLCD 3AV2D 1AOIB 3MGRB 5B2JC 5E5AB 3MGRA 1KX3C 4DRBA 3C1CC 2L5AA 4KGCA 4JJND 3W98B 3W98A 1U35C 3A6ND 4R8PD 5AVCC 4YM6B 4YM6A 3REHB 3REHA 3REJB 3X1SA 1P3MC 3LJAD 1HQ3C 4WU9D 2RVQD 4NE5A 3EPLA 5B24D 3LELA 5B0YD 3W97C 3WTPE 4J8VC 5BT1C 3UTBA 1M18B 1M18A 3REIA 3B6GB 4WU8D 1KX5A 3MGQA 1P3GA 2NQBD 1P3FA 4LD9B 4LD9A 3AZNC 4QLCA 4H9NB 4E45A 3AV2B 1BH8B 4H9NA 3AV2A 5CPKD 1BH8A 5CP6D 5CPJB 2HUEC 4CAYB 4JJNB 5CPJA 4JJNA 4CAYA 2BG1A 5DNNC 4X23C 3AZFD 2IO5B 5B33C 2PYOC 2VQRA 4YS3C 5B32C 3WA9D 1P3PC 2CV5C 3AFAB 5AVBC 5B24A 3IP4C 1P34C 5B0YA 2ZY2A 5JA4B 5CPID 1P3KD 5JA4A 1P3LC 3B0BA 2FJ7B 1AOIC 4KHAB 3MGRC 5E5AC 2BYMB 2NQBA 3UTAD 2BYMA 4J8UB 5CPKA 3AZID 4YM6C 3F6TA 3REHC 3KWQD 3REJC 4WZSB 4Z5TD 4Z2MH 5B31G 2YFVB 2YFVA 1ID3D 3REKC 3WA9B 3WA9A 3NQJB 5AV6D 3NQJA 1M18C 3B6GC 3EPJA 3O62D 3AZHB 3VH6A 3AZHA 2F8ND 1P3KA 4ZUXB 2AROD 3FDDA 1EQZD 1Z2CB 3AV2C 3EPKA 4DQYB 3WAAD 2NZDD 3W96D 3NQUB 5CPJC 4JJNC 4XUJB 5DNMD 4ZBJB 3AZIB 3AZIA 5C3IB 2IO5C 3WTPD 5B40D 3KWQB 2HIOB 3KWQA 4KUDC 4Z66B 5B31D 4Z5TA 1H3OB 1H3OA 3UT9D 3AFAC 1ID3B 1ID3A 1B6WA 2CWEA 3TU4B 2Y2LA 3AZED 3V9RA 5AV5D 2ZY5A 2FJ7C 3O62B 4M6BA 3O62A 2F8NB 2F8NA 1S32D 1P3BB 4J8UC 2AROA 1P3BA 1EQZA 3KUYD 3AZGD 3WAAB 3WAAA 2NZDA 3W96A 3MGSB 5DNMB 1JFIB 4H9SA 5DNMA 3WKJB 4H9QB 5B40A 3AZKD 3AV1D 2G5IC 3UT9B 1KX4C 3UT9A 1M1AD 3EG5B 2Y2MA 1A7WA 1P3AD 4KGCB 3AZHC 1WWSA 1F66D 4ZUXC 3X1TC 1F1EA 5B1LD 5AV5B 3AZEA 5AV5A 3LZ1D 3X1SB 4NFTA 2XD1A 1TAFB 1TAFA 2F8NH 1S32A 4XUJC 2Y2HA 3LELB 3AZLB 2XD5A 4ZBJC 3KUYA 3X1UD 3AZGA 3AZLA 3B6FD 3AZIC 3C1BD 5C3IC 5GSUD 3MGPD 3KFUG 1P3IB 2HIOC 3UTBB 1P3IA 3REIB 4Z66C 5B0ZB 5B0ZA 3MGQB 1KX5B 2ZY3A 1P3GB 3AZJD 1P3FB 1ID3C 3LZ0D 5B2ID 4QLCB 2UWXA 3AZKB 3AZKA 3TU4C 3MVDD 1M1AA 1P3AA 3O62C 3MNNC 5BNXB 1F66B 3A6NB 5BNXA 4R8PB 3A6NA 1P3BC 1F66A 4R8PA 5B1LA 2Y2QA 1BFMA 3LZ1A 1M19D 3WAAC 4UUZB 3LJAB 4UUZA 3LJAA 4WU9B 2YFWB 5BS7A 4WU9A 2YFWA 3MGSC 4H9SC 3W99D 5DNMC 3X1VD 5B24B 4G92B 3WKJC 5B0YB 5BNVB 3AZMD 3B6FA 5BNVA 3C1BA 4EO5B 5GSUA 3MGPA 1P3OD 4WU8B 4WU8A 2NQBB 3AZJA 3LZ0B 3LZ0A 5B2IA 4KGCC 4H9OB 3W98C 4H9OA 5CPKB 3RELD 5CP6B 5CP6A 5GT0D 3MVDB 4J8XD 3MVDA 5AV5C 2J8PA 3X1SC 5B2JD 1KX3D 2LY8A 3C1CD 3AZFB 3AZFA 3LELC 3AZLC 1U35D 1M19B 1M19A 5AVCD 1P3IC 3UTBC 4WJ3C 3REIC 3W99A 3X1VA 4G91B 1P3MD 5B0ZC 3AZMB 3MGQC 1KX5C 3AZMA 1HQ3D 5CPIB 1P3GC 1P3FC 1P3KB 5CPIA 4LD9C 5B32G 4H9RA 4QLCC 1P3OA 3AZKC 4J8VD 3UTAB 3UTAA 3RELA 1F66C 3A6NC 4R8PC 4NE3A 5GT0A 4J8XA 3AZND 5F99D 4Z5TB 3LJAC 5BS7C 4WU9C 3C1CA 2RVQC 3VH5T 5B24C 4G92C 5B0YC 5DNND 1U35A 3B0CT 4X23D 5AVCA 4EO5C 5AV6B 1TZYD 3V9RB 5AV6A 2PYOD 1P3MA 4YS3D 5B1MD 4WU8C 2Y2GA 1HQ3A 1BH9B 1P3PD 2NQBC 1BH9A 3LZ0C 2CV5D 2AROB 5AVBD 1EQZB 5CPKC 1P34D 5GT3D 5CP6C 3KXBD 3MVDC 5FUGB 2NZDB 3AYWD 5FUGA 2JCHA 5G49B 4J8VA 5G49A 3W96B 1AOID 2Y2IA 5E5AD 3AZFC 2JSSA 3WTPB 3AZNA 5B40B 3WTPA 5F99B 5B31B 5F99A 2F2AC 5B31A 4Z2MG 3WA9C 5AV9D 4YM6D 3REJD 4HGAB 4G91C 4NE6A 3AZMC 5CPIC 1P3KC 1PZRA 1TZYB 3REKD 1TZYA 3AZEB 4WV4B 5B1MB 2PYOA 4YS3A 5B1MA 2DF4C 1P3PB 1P3PA 3UTAC 3VH5W 1S32B 3B6GD 1T3UA 5AVBA 4J8WD 5GT3B 3KUYB 5GT3A 3AZGB 3KXBB 3KXBA 3AYWB 3AYWA 3KWQC 3H0MC 1N1JB 4Z5TC 1N1JA 1AOIA 5E5AA 5CPJD 2Y2PA 3H0RC 5BO0B 5AV9B 5BO0A 3AV1B 5AV9A 3AV1A 5AV6C 3AL0C 3REJA 1M1AB 4KUDD 1P3AB 1HTAA 4XZQD 4H9PB 4H9PA 3B0DB 2AROC 3AFAD 3REKB 1EQZC 1WWIA 5B1LB 3REKA 3LZ1B 5JRGD 3AN2D 1ZLAD 2NZDC 5AY8D 3W96C 1KX5D 4J8WB 3B6GA 2FJ7D 4J8WA 3X1UB 3B6FB 3X1UA 3C1BB 4J8UD 3WTPC 5GSUB 3MGPB 5B40C 5F99C 5B31C 1R4VA 3AZJB 3UT9C 4HGAC 5B2IB 4AWLB 2F8NK 5AV8D 2G5HC 5GXQD 1TZYC 3KSYA 3AZEC 4KUDB 4KUDA 5B1MC 4XZQB 4XZQA 5KDMB 2Y2OA 5KDMA 1S32C 1KX4D 1KU5A 3AFAA 2Y2NA 5GT3C 3KUYC 3AZGC 5JRGB 3AZHD 3A1KA 5CHLB 5JRGA 3KXBC 3AN2B 4ZUXD 1ZLAB 3AN2A 5AY8B 1ULYA 3AYWC 1ZLAA 5AY8A 3X1TD 2F8NG 2W8SA 3W99B 3X1VB 3VH6T 2FJ7A 2JE5A 4KHAA 4XUJD 4J8UA 4H9RB 1P3OB 3W97D 5AV9C 3AV1C 2HIOD 4UPKA 5BT1D 1M1AC 4Z66D 1P3AC 3RELB 5AV8B 5AV8A 5GXQB 2ZY4A 3B0DC 5GT0B 1Q9CA 5GXQA 4J8XB 5B1LC 3LZ1C 4CSRB 3TU4D 5B2JB 4CSRA 1KX3B 5B2JA 3C1CB 1KX3A 1KX4B 1KX4A 4J8WC 3MNND 3X1UC 1U35B 3B6FC 3EPHA 4ZUXA 3C1BC 5AVCB 3X1TB 1P3BD 5GSUC 3A1IA 3MGPC 3X1TA 1P3MB 5B33D 4E44A 5B32D 1HQ3B 3AZJC 3NQUA 3MGSD 4XUJA 5B2IC 4AWLC 3WKJD 3W97B 3W97A 2Y2KA 1P3LD 4J8VB 2HIOA 3R45B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R45 A;  3VH6 W;  4Z66 A;  4XZQ C;  3MGR D;  4DRA A;  4KGC D;  3AZN B;  3W98 D;  3VH5 A;  5JRG C;  1M19 C;  3AN2 C;  1B67 A;  1ZLA C;  5AY8 C;  3TU4 A;  3REH D;  3W99 C;  3X1V C;  2HUE B;  3X1S D;  3MNN B;  5DNN B;  3MNN A;  5DNN A;  4X23 B;  4X23 A;  3LEL D;  1P3O C;  3AZL D;  5B33 B;  2PYO B;  5B33 A;  4YS3 B;  5B32 B;  5B32 A;  1P3I D;  3UTB D;  2CV5 B;  3MGS A;  3REI D;  2CV5 A;  5AVB B;  1M18 D;  1JFI A;  5B0Z D;  3WKJ A;  4WNN B;  1P34 B;  3MGQ D;  3REL C;  4WNN A;  5AV8 C;  1P34 A;  1KX5 D;  2BYK B;  5GXQ C;  3B0C W;  1P3G D;  2BYK A;  5GT0 C;  4H9Q A;  1P3L B;  1P3F D;  4J8X C;  1P3L A;  4LD9 D;  4QLC D;  3AV2 D;  1AOI B;  3MGR B;  5B2J C;  5E5A B;  3MGR A;  1KX3 C;  4DRB A;  3C1C C;  2L5A A;  4KGC A;  4JJN D;  3W98 B;  3W98 A;  1U35 C;  3A6N D;  4R8P D;  5AVC C;  4YM6 B;  4YM6 A;  3REH B;  3REH A;  3REJ B;  3X1S A;  1P3M C;  3LJA D;  1HQ3 C;  4WU9 D;  2RVQ D;  4NE5 A;  5B24 D;  3LEL A;  5B0Y D;  3W97 C;  3WTP E;  4J8V C;  5BT1 C;  3UTB A;  1M18 B;  1M18 A;  3REI A;  3B6G B;  4WU8 D;  1KX5 A;  3MGQ A;  1P3G A;  2NQB D;  1P3F A;  4LD9 B;  4LD9 A;  3AZN C;  4QLC A;  4H9N B;  4E45 A;  3AV2 B;  1BH8 B;  4H9N A;  3AV2 A;  5CPK D;  1BH8 A;  5CP6 D;  5CPJ B;  2HUE C;  4CAY B;  4JJN B;  5CPJ A;  4JJN A;  4CAY A;  5DNN C;  4X23 C;  3AZF D;  2IO5 B;  5B33 C;  2PYO C;  4YS3 C;  5B32 C;  3WA9 D;  1P3P C;  2CV5 C;  3AFA B;  5AVB C;  5B24 A;  1P34 C;  5B0Y A;  5JA4 B;  5CPI D;  1P3K D;  5JA4 A;  1P3L C;  3B0B A;  2FJ7 B;  1AOI C;  4KHA B;  3MGR C;  5E5A C;  2BYM B;  2NQB A;  3UTA D;  2BYM A;  4J8U B;  5CPK A;  3AZI D;  4YM6 C;  3REH C;  3KWQ D;  3REJ C;  4WZS B;  4Z5T D;  4Z2M H;  5B31 G;  2YFV B;  2YFV A;  1ID3 D;  3REK C;  3WA9 B;  3WA9 A;  3NQJ B;  5AV6 D;  3NQJ A;  1M18 C;  3B6G C;  3O62 D;  3AZH B;  3VH6 A;  3AZH A;  2F8N D;  1P3K A;  4ZUX B;  2ARO D;  1EQZ D;  3AV2 C;  3WAA D;  2NZD D;  3W96 D;  3NQU B;  5CPJ C;  4JJN C;  4XUJ B;  5DNM D;  4ZBJ B;  3AZI B;  3AZI A;  5C3I B;  2IO5 C;  3WTP D;  5B40 D;  3KWQ B;  2HIO B;  3KWQ A;  4KUD C;  4Z66 B;  5B31 D;  4Z5T A;  1H3O B;  1H3O A;  3UT9 D;  3AFA C;  1ID3 B;  1ID3 A;  1B6W A;  2CWE A;  3TU4 B;  3AZE D;  3V9R A;  5AV5 D;  2FJ7 C;  3O62 B;  4M6B A;  3O62 A;  2F8N B;  2F8N A;  1S32 D;  1P3B B;  4J8U C;  2ARO A;  1P3B A;  1EQZ A;  3KUY D;  3AZG D;  3WAA B;  3WAA A;  2NZD A;  3W96 A;  3MGS B;  5DNM B;  1JFI B;  4H9S A;  5DNM A;  3WKJ B;  4H9Q B;  5B40 A;  3AZK D;  3AV1 D;  3UT9 B;  1KX4 C;  3UT9 A;  1M1A D;  4KGC B;  1A7W A;  1P3A D;  3AZH C;  1WWS A;  1F66 D;  4ZUX C;  3X1T C;  1F1E A;  5B1L D;  5AV5 B;  3AZE A;  5AV5 A;  3LZ1 D;  3X1S B;  4NFT A;  1TAF B;  1TAF A;  2F8N H;  1S32 A;  4XUJ C;  3LEL B;  3AZL B;  4ZBJ C;  3KUY A;  3X1U D;  3AZG A;  3AZL A;  3B6F D;  3AZI C;  3C1B D;  5C3I C;  5GSU D;  3MGP D;  1P3I B;  2HIO C;  3UTB B;  1P3I A;  3REI B;  4Z66 C;  5B0Z B;  5B0Z A;  3MGQ B;  1KX5 B;  1P3G B;  3AZJ D;  1P3F B;  1ID3 C;  3LZ0 D;  5B2I D;  4QLC B;  3AZK B;  3AZK A;  3TU4 C;  3MVD D;  1M1A A;  1P3A A;  3O62 C;  3MNN C;  5BNX B;  1F66 B;  3A6N B;  5BNX A;  4R8P B;  3A6N A;  1P3B C;  1F66 A;  4R8P A;  5B1L A;  1BFM A;  3LZ1 A;  1M19 D;  3WAA C;  4UUZ B;  3LJA B;  4UUZ A;  3LJA A;  4WU9 B;  2YFW B;  5BS7 A;  4WU9 A;  2YFW A;  3MGS C;  4H9S C;  3W99 D;  5DNM C;  3X1V D;  5B24 B;  4G92 B;  3WKJ C;  5B0Y B;  5BNV B;  3AZM D;  3B6F A;  5BNV A;  3C1B A;  4EO5 B;  5GSU A;  3MGP A;  1P3O D;  4WU8 B;  4WU8 A;  2NQB B;  3AZJ A;  3LZ0 B;  3LZ0 A;  5B2I A;  4KGC C;  4H9O B;  3W98 C;  4H9O A;  5CPK B;  3REL D;  5CP6 B;  5CP6 A;  5GT0 D;  3MVD B;  4J8X D;  3MVD A;  5AV5 C;  3X1S C;  5B2J D;  1KX3 D;  2LY8 A;  3C1C D;  3AZF B;  3AZF A;  3LEL C;  3AZL C;  1U35 D;  1M19 B;  1M19 A;  5AVC D;  1P3I C;  3UTB C;  3REI C;  3W99 A;  3X1V A;  4G91 B;  1P3M D;  5B0Z C;  3AZM B;  3MGQ C;  1KX5 C;  3AZM A;  1HQ3 D;  5CPI B;  1P3G C;  1P3F C;  1P3K B;  5CPI A;  4LD9 C;  5B32 G;  4H9R A;  4QLC C;  1P3O A;  3AZK C;  4J8V D;  3UTA B;  3UTA A;  3REL A;  1F66 C;  3A6N C;  4R8P C;  4NE3 A;  5GT0 A;  4J8X A;  3AZN D;  5F99 D;  4Z5T B;  3LJA C;  5BS7 C;  4WU9 C;  3C1C A;  2RVQ C;  3VH5 T;  5B24 C;  4G92 C;  5B0Y C;  5DNN D;  1U35 A;  3B0C T;  4X23 D;  5AVC A;  4EO5 C;  5AV6 B;  1TZY D;  3V9R B;  5AV6 A;  2PYO D;  1P3M A;  4YS3 D;  5B1M D;  4WU8 C;  1HQ3 A;  1BH9 B;  1P3P D;  2NQB C;  1BH9 A;  3LZ0 C;  2CV5 D;  2ARO B;  5AVB D;  1EQZ B;  5CPK C;  1P34 D;  5GT3 D;  5CP6 C;  3KXB D;  3MVD C;  5FUG B;  2NZD B;  3AYW D;  5FUG A;  5G49 B;  4J8V A;  3W96 B;  5G49 A;  1AOI D;  5E5A D;  3AZF C;  2JSS A;  3WTP B;  3AZN A;  5B40 B;  3WTP A;  5F99 B;  5B31 B;  5F99 A;  5B31 A;  4Z2M G;  3WA9 C;  5AV9 D;  4YM6 D;  3REJ D;  4HGA B;  4G91 C;  4NE6 A;  3AZM C;  5CPI C;  1P3K C;  1TZY B;  3REK D;  1TZY A;  3AZE B;  4WV4 B;  5B1M B;  2PYO A;  4YS3 A;  5B1M A;  1P3P B;  1P3P A;  3UTA C;  3VH5 W;  1S32 B;  3B6G D;  5AVB A;  4J8W D;  5GT3 B;  3KUY B;  5GT3 A;  3AZG B;  3KXB B;  3KXB A;  3AYW B;  3AYW A;  3KWQ C;  1N1J B;  4Z5T C;  1N1J A;  1AOI A;  5E5A A;  5CPJ D;  5BO0 B;  5AV9 B;  5BO0 A;  3AV1 B;  5AV9 A;  3AV1 A;  5AV6 C;  3REJ A;  1M1A B;  4KUD D;  1P3A B;  1HTA A;  4XZQ D;  4H9P B;  4H9P A;  3B0D B;  2ARO C;  3AFA D;  3REK B;  1EQZ C;  1WWI A;  5B1L B;  3REK A;  3LZ1 B;  5JRG D;  3AN2 D;  1ZLA D;  2NZD C;  5AY8 D;  3W96 C;  3B6G A;  4J8W B;  2FJ7 D;  4J8W A;  3X1U B;  3B6F B;  3X1U A;  3C1B B;  4J8U D;  3WTP C;  5GSU B;  3MGP B;  5B40 C;  5F99 C;  5B31 C;  1R4V A;  3AZJ B;  3UT9 C;  4HGA C;  5B2I B;  4AWL B;  2F8N K;  5AV8 D;  5GXQ D;  1TZY C;  3KSY A;  3AZE C;  4KUD B;  4KUD A;  5B1M C;  4XZQ B;  4XZQ A;  5KDM B;  5KDM A;  1S32 C;  1KX4 D;  1KU5 A;  3AFA A;  5GT3 C;  3KUY C;  3AZG C;  5JRG B;  3AZH D;  3KXB C;  5CHL B;  5JRG A;  3AN2 B;  4ZUX D;  1ZLA B;  3AN2 A;  5AY8 B;  1ULY A;  3AYW C;  1ZLA A;  5AY8 A;  3X1T D;  2F8N G;  3W99 B;  3X1V B;  3VH6 T;  2FJ7 A;  4KHA A;  4XUJ D;  4J8U A;  4H9R B;  1P3O B;  3W97 D;  5AV9 C;  3AV1 C;  2HIO D;  5BT1 D;  1M1A C;  4Z66 D;  1P3A C;  3REL B;  5AV8 B;  5AV8 A;  5GXQ B;  3B0D C;  5GT0 B;  1Q9C A;  5GXQ A;  4J8X B;  5B1L C;  3LZ1 C;  4CSR B;  3TU4 D;  5B2J B;  4CSR A;  1KX3 B;  5B2J A;  3C1C B;  1KX3 A;  1KX4 B;  1KX4 A;  4J8W C;  3MNN D;  3X1U C;  1U35 B;  3B6F C;  4ZUX A;  3C1B C;  5AVC B;  3X1T B;  1P3B D;  5GSU C;  3MGP C;  3X1T A;  1P3M B;  5B33 D;  4E44 A;  5B32 D;  1HQ3 B;  3AZJ C;  3NQU A;  3MGS D;  4XUJ A;  5B2I C;  4AWL C;  3WKJ D;  3W97 B;  3W97 A;  1P3L D;  4J8V B;  2HIO A;  3R45 B; 
#chains in the Genus database with same CATH topology
 3R45 A;  3VH6 W;  4Z66 A;  4XZQ C;  3MGR D;  4DRA A;  4KGC D;  3AZN B;  2RIQ A;  3W98 D;  3VH5 A;  2DQN C;  5JRG C;  1M19 C;  3AN2 C;  1B67 A;  1ZLA C;  5AY8 C;  3TU4 A;  2FFF B;  1W2E A;  3REH D;  3W99 C;  3X1V C;  2HUE B;  3X1S D;  3MNN B;  5DNN B;  3MNN A;  2ZM5 A;  5DNN A;  4X23 B;  4X23 A;  3LEL D;  1P3O C;  3AZL D;  2Y2J A;  5B33 B;  2PYO B;  5B33 A;  4YS3 B;  5B32 B;  3H0L C;  5B32 A;  1P3I D;  3UTB D;  2CV5 B;  3MGS A;  3REI D;  2CV5 A;  5AVB B;  1M18 D;  1JFI A;  5B0Z D;  3WKJ A;  4WNN B;  1P34 B;  3MGQ D;  3REL C;  4WNN A;  3P5J B;  5AV8 C;  1P34 A;  2BYK B;  5GXQ C;  3B0C W;  1P3G D;  2BYK A;  5GT0 C;  4H9Q A;  1P3L B;  1P3F D;  4J8X C;  1P3L A;  4LD9 D;  4QLC D;  3AV2 D;  1AOI B;  3MGR B;  5B2J C;  5E5A B;  3MGR A;  1KX3 C;  4DRB A;  3C1C C;  2L5A A;  4KGC A;  4JJN D;  3W98 B;  3W98 A;  1U35 C;  3A6N D;  4R8P D;  5AVC C;  4YM6 B;  4YM6 A;  3REH B;  3REH A;  3REJ B;  3X1S A;  1P3M C;  3LJA D;  1HQ3 C;  4WU9 D;  2RVQ D;  4NE5 A;  3EPL A;  5B24 D;  3LEL A;  5B0Y D;  3W97 C;  3WTP E;  4J8V C;  5BT1 C;  3UTB A;  1M18 B;  1M18 A;  3REI A;  3B6G B;  4WU8 D;  1KX5 A;  3MGQ A;  1P3G A;  2NQB D;  1P3F A;  4LD9 B;  4LD9 A;  3AZN C;  4QLC A;  4H9N B;  4E45 A;  3AV2 B;  1BH8 B;  4H9N A;  3AV2 A;  5CPK D;  1BH8 A;  5CP6 D;  5CPJ B;  2HUE C;  4CAY B;  4JJN B;  5CPJ A;  4JJN A;  4CAY A;  2BG1 A;  5DNN C;  4X23 C;  3AZF D;  2IO5 B;  5B33 C;  2PYO C;  2VQR A;  4YS3 C;  5B32 C;  3WA9 D;  1P3P C;  2CV5 C;  3AFA B;  5AVB C;  5B24 A;  3IP4 C;  1P34 C;  5B0Y A;  2ZY2 A;  5JA4 B;  5CPI D;  1P3K D;  5JA4 A;  1P3L C;  3B0B A;  2FJ7 B;  1AOI C;  4KHA B;  3MGR C;  5E5A C;  2BYM B;  2NQB A;  3UTA D;  2BYM A;  4J8U B;  5CPK A;  3AZI D;  4YM6 C;  3F6T A;  3REH C;  3KWQ D;  3REJ C;  4WZS B;  4Z5T D;  4Z2M H;  5B31 G;  2YFV B;  2YFV A;  1ID3 D;  3REK C;  3WA9 B;  3WA9 A;  3NQJ B;  5AV6 D;  3NQJ A;  1M18 C;  3B6G C;  3EPJ A;  3O62 D;  3AZH B;  3VH6 A;  3AZH A;  2F8N D;  1P3K A;  4ZUX B;  2ARO D;  3FDD A;  1EQZ D;  1Z2C B;  3AV2 C;  3EPK A;  4DQY B;  3WAA D;  2NZD D;  3W96 D;  3NQU B;  5CPJ C;  4JJN C;  4XUJ B;  5DNM D;  4ZBJ B;  3AZI B;  3AZI A;  5C3I B;  2IO5 C;  3WTP D;  5B40 D;  3KWQ B;  2HIO B;  3KWQ A;  4KUD C;  4Z66 B;  5B31 D;  4Z5T A;  1H3O B;  1H3O A;  3UT9 D;  3AFA C;  1ID3 B;  1ID3 A;  1B6W A;  2CWE A;  3TU4 B;  2Y2L A;  3AZE D;  3V9R A;  5AV5 D;  2ZY5 A;  2FJ7 C;  3O62 B;  4M6B A;  3O62 A;  2F8N B;  2F8N A;  1S32 D;  1P3B B;  4J8U C;  2ARO A;  1P3B A;  1EQZ A;  3KUY D;  3AZG D;  3WAA B;  3WAA A;  2NZD A;  3W96 A;  3MGS B;  5DNM B;  1JFI B;  4H9S A;  5DNM A;  3WKJ B;  4H9Q B;  5B40 A;  3AZK D;  3AV1 D;  2G5I C;  3UT9 B;  1KX4 C;  3UT9 A;  1M1A D;  3EG5 B;  2Y2M A;  1A7W A;  1P3A D;  4KGC B;  3AZH C;  1WWS A;  1F66 D;  4ZUX C;  3X1T C;  1F1E A;  5B1L D;  5AV5 B;  3AZE A;  5AV5 A;  3LZ1 D;  3X1S B;  4NFT A;  2XD1 A;  1TAF B;  1TAF A;  2F8N H;  1S32 A;  4XUJ C;  2Y2H A;  3LEL B;  3AZL B;  2XD5 A;  4ZBJ C;  3KUY A;  3X1U D;  3AZG A;  3AZL A;  3B6F D;  3AZI C;  3C1B D;  5C3I C;  5GSU D;  3MGP D;  3KFU G;  1P3I B;  2HIO C;  3UTB B;  1P3I A;  3REI B;  4Z66 C;  5B0Z B;  5B0Z A;  3MGQ B;  1KX5 B;  2ZY3 A;  1P3G B;  3AZJ D;  1P3F B;  1ID3 C;  3LZ0 D;  5B2I D;  4QLC B;  2UWX A;  3AZK B;  3AZK A;  3TU4 C;  3MVD D;  1M1A A;  1P3A A;  3O62 C;  3MNN C;  5BNX B;  1F66 B;  3A6N B;  5BNX A;  4R8P B;  3A6N A;  1P3B C;  1F66 A;  4R8P A;  5B1L A;  2Y2Q A;  1BFM A;  3LZ1 A;  1M19 D;  3WAA C;  4UUZ B;  3LJA B;  4UUZ A;  3LJA A;  4WU9 B;  2YFW B;  5BS7 A;  4WU9 A;  2YFW A;  3MGS C;  4H9S C;  3W99 D;  5DNM C;  3X1V D;  5B24 B;  4G92 B;  3WKJ C;  5B0Y B;  5BNV B;  3AZM D;  3B6F A;  5BNV A;  3C1B A;  4EO5 B;  5GSU A;  3MGP A;  1P3O D;  4WU8 B;  4WU8 A;  2NQB B;  3AZJ A;  3LZ0 B;  3LZ0 A;  5B2I A;  4KGC C;  4H9O B;  3W98 C;  4H9O A;  5CPK B;  3REL D;  5CP6 B;  5CP6 A;  5GT0 D;  3MVD B;  4J8X D;  3MVD A;  5AV5 C;  2J8P A;  3X1S C;  5B2J D;  1KX3 D;  2LY8 A;  3C1C D;  3AZF B;  3AZF A;  3LEL C;  3AZL C;  1U35 D;  1M19 B;  1M19 A;  5AVC D;  1P3I C;  3UTB C;  4WJ3 C;  3REI C;  3W99 A;  3X1V A;  4G91 B;  1P3M D;  5B0Z C;  3AZM B;  3MGQ C;  1KX5 C;  3AZM A;  1HQ3 D;  5CPI B;  1P3G C;  1P3F C;  1P3K B;  5CPI A;  4LD9 C;  5B32 G;  4H9R A;  4QLC C;  1P3O A;  3AZK C;  4J8V D;  3UTA B;  3UTA A;  3REL A;  1F66 C;  3A6N C;  4R8P C;  4NE3 A;  5GT0 A;  4J8X A;  3AZN D;  5F99 D;  4Z5T B;  3LJA C;  5BS7 C;  4WU9 C;  3C1C A;  2RVQ C;  3VH5 T;  5B24 C;  4G92 C;  5B0Y C;  5DNN D;  1U35 A;  3B0C T;  4X23 D;  5AVC A;  4EO5 C;  5AV6 B;  1TZY D;  3V9R B;  5AV6 A;  2PYO D;  1P3M A;  4YS3 D;  5B1M D;  4WU8 C;  2Y2G A;  1HQ3 A;  1BH9 B;  1P3P D;  2NQB C;  1BH9 A;  3LZ0 C;  2CV5 D;  2ARO B;  5AVB D;  1EQZ B;  5CPK C;  1P34 D;  5GT3 D;  5CP6 C;  3KXB D;  3MVD C;  5FUG B;  2NZD B;  3AYW D;  5FUG A;  2JCH A;  5G49 B;  4J8V A;  5G49 A;  3W96 B;  1AOI D;  2Y2I A;  5E5A D;  3AZF C;  2JSS A;  3WTP B;  3AZN A;  5B40 B;  3WTP A;  5F99 B;  5B31 B;  5F99 A;  2F2A C;  5B31 A;  4Z2M G;  3WA9 C;  5AV9 D;  4YM6 D;  3REJ D;  4HGA B;  4G91 C;  4NE6 A;  3AZM C;  5CPI C;  1P3K C;  1PZR A;  1TZY B;  3REK D;  1TZY A;  3AZE B;  4WV4 B;  5B1M B;  2PYO A;  4YS3 A;  5B1M A;  2DF4 C;  1P3P B;  1P3P A;  3UTA C;  3VH5 W;  1S32 B;  3B6G D;  1T3U A;  5AVB A;  4J8W D;  5GT3 B;  3KUY B;  5GT3 A;  3AZG B;  3KXB B;  3KXB A;  3AYW B;  3AYW A;  3KWQ C;  3H0M C;  1N1J B;  4Z5T C;  1N1J A;  1AOI A;  5E5A A;  5CPJ D;  2Y2P A;  3H0R C;  5BO0 B;  5AV9 B;  5BO0 A;  3AV1 B;  5AV9 A;  3AV1 A;  5AV6 C;  3AL0 C;  3REJ A;  1M1A B;  4KUD D;  1P3A B;  1HTA A;  4XZQ D;  4H9P B;  4H9P A;  3B0D B;  2ARO C;  3AFA D;  3REK B;  1EQZ C;  1WWI A;  5B1L B;  3REK A;  3LZ1 B;  5JRG D;  3AN2 D;  1ZLA D;  2NZD C;  5AY8 D;  3W96 C;  1KX5 D;  4J8W B;  3B6G A;  2FJ7 D;  4J8W A;  3X1U B;  3B6F B;  3X1U A;  3C1B B;  4J8U D;  3WTP C;  5GSU B;  3MGP B;  5B40 C;  5F99 C;  5B31 C;  1R4V A;  3AZJ B;  3UT9 C;  4HGA C;  5B2I B;  4AWL B;  2F8N K;  5AV8 D;  2G5H C;  5GXQ D;  1TZY C;  3KSY A;  3AZE C;  4KUD B;  4KUD A;  5B1M C;  4XZQ B;  4XZQ A;  5KDM B;  2Y2O A;  5KDM A;  1S32 C;  1KX4 D;  1KU5 A;  3AFA A;  2Y2N A;  5GT3 C;  3KUY C;  3AZG C;  5JRG B;  3AZH D;  3A1K A;  5CHL B;  5JRG A;  3KXB C;  3AN2 B;  4ZUX D;  1ZLA B;  3AN2 A;  5AY8 B;  1ULY A;  3AYW C;  1ZLA A;  5AY8 A;  3X1T D;  2F8N G;  2W8S A;  3W99 B;  3X1V B;  3VH6 T;  2FJ7 A;  2JE5 A;  4KHA A;  4XUJ D;  4J8U A;  4H9R B;  1P3O B;  3W97 D;  5AV9 C;  3AV1 C;  2HIO D;  4UPK A;  5BT1 D;  1M1A C;  4Z66 D;  1P3A C;  3REL B;  5AV8 B;  5AV8 A;  5GXQ B;  2ZY4 A;  3B0D C;  5GT0 B;  1Q9C A;  5GXQ A;  4J8X B;  5B1L C;  3LZ1 C;  4CSR B;  3TU4 D;  5B2J B;  4CSR A;  1KX3 B;  5B2J A;  3C1C B;  1KX3 A;  1KX4 B;  1KX4 A;  4J8W C;  3MNN D;  3X1U C;  1U35 B;  3B6F C;  3EPH A;  4ZUX A;  3C1B C;  5AVC B;  3X1T B;  1P3B D;  5GSU C;  3A1I A;  3MGP C;  3X1T A;  1P3M B;  5B33 D;  4E44 A;  5B32 D;  1HQ3 B;  3AZJ C;  3NQU A;  3MGS D;  4XUJ A;  5B2I C;  4AWL C;  3WKJ D;  3W97 B;  3W97 A;  2Y2K A;  1P3L D;  4J8V B;  2HIO A;  3R45 B; 
#chains in the Genus database with same CATH homology
 3R45 A;  3VH6 W;  4Z66 A;  4XZQ C;  3MGR D;  4DRA A;  4KGC D;  3AZN B;  2RIQ A;  3W98 D;  3VH5 A;  2DQN C;  5JRG C;  1M19 C;  3AN2 C;  1B67 A;  1ZLA C;  5AY8 C;  3TU4 A;  2FFF B;  1W2E A;  3REH D;  3W99 C;  3X1V C;  2HUE B;  3X1S D;  3MNN B;  5DNN B;  3MNN A;  2ZM5 A;  5DNN A;  4X23 B;  4X23 A;  3LEL D;  1P3O C;  3AZL D;  2Y2J A;  5B33 B;  2PYO B;  5B33 A;  4YS3 B;  5B32 B;  3H0L C;  5B32 A;  1P3I D;  3UTB D;  2CV5 B;  3MGS A;  3REI D;  2CV5 A;  5AVB B;  1M18 D;  1JFI A;  5B0Z D;  3WKJ A;  4WNN B;  1P34 B;  3MGQ D;  3REL C;  4WNN A;  3P5J B;  5AV8 C;  1P34 A;  2BYK B;  5GXQ C;  3B0C W;  1P3G D;  2BYK A;  5GT0 C;  4H9Q A;  1P3L B;  1P3F D;  4J8X C;  1P3L A;  4LD9 D;  4QLC D;  3AV2 D;  1AOI B;  3MGR B;  5B2J C;  5E5A B;  3MGR A;  1KX3 C;  4DRB A;  3C1C C;  2L5A A;  4KGC A;  4JJN D;  3W98 B;  3W98 A;  1U35 C;  3A6N D;  4R8P D;  5AVC C;  4YM6 B;  4YM6 A;  3REH B;  3REH A;  3REJ B;  3X1S A;  1P3M C;  3LJA D;  1HQ3 C;  4WU9 D;  2RVQ D;  4NE5 A;  3EPL A;  5B24 D;  3LEL A;  5B0Y D;  3W97 C;  3WTP E;  4J8V C;  5BT1 C;  3UTB A;  1M18 B;  1M18 A;  3REI A;  3B6G B;  4WU8 D;  1KX5 A;  3MGQ A;  1P3G A;  2NQB D;  1P3F A;  4LD9 B;  4LD9 A;  3AZN C;  4QLC A;  4H9N B;  4E45 A;  3AV2 B;  1BH8 B;  4H9N A;  3AV2 A;  5CPK D;  1BH8 A;  5CP6 D;  5CPJ B;  2HUE C;  4CAY B;  4JJN B;  5CPJ A;  4JJN A;  4CAY A;  2BG1 A;  5DNN C;  4X23 C;  3AZF D;  2IO5 B;  5B33 C;  2PYO C;  2VQR A;  4YS3 C;  5B32 C;  3WA9 D;  1P3P C;  2CV5 C;  3AFA B;  5AVB C;  5B24 A;  3IP4 C;  1P34 C;  5B0Y A;  2ZY2 A;  5JA4 B;  5CPI D;  1P3K D;  5JA4 A;  1P3L C;  3B0B A;  2FJ7 B;  1AOI C;  4KHA B;  3MGR C;  5E5A C;  2BYM B;  2NQB A;  3UTA D;  2BYM A;  4J8U B;  5CPK A;  3AZI D;  4YM6 C;  3F6T A;  3REH C;  3KWQ D;  3REJ C;  4WZS B;  4Z5T D;  4Z2M H;  5B31 G;  2YFV B;  2YFV A;  1ID3 D;  3REK C;  3WA9 B;  3WA9 A;  3NQJ B;  5AV6 D;  3NQJ A;  1M18 C;  3B6G C;  3EPJ A;  3O62 D;  3AZH B;  3VH6 A;  3AZH A;  2F8N D;  1P3K A;  4ZUX B;  2ARO D;  3FDD A;  1EQZ D;  1Z2C B;  3AV2 C;  3EPK A;  4DQY B;  3WAA D;  2NZD D;  3W96 D;  3NQU B;  5CPJ C;  4JJN C;  4XUJ B;  5DNM D;  4ZBJ B;  3AZI B;  3AZI A;  5C3I B;  2IO5 C;  3WTP D;  5B40 D;  3KWQ B;  2HIO B;  3KWQ A;  4KUD C;  4Z66 B;  5B31 D;  4Z5T A;  1H3O B;  1H3O A;  3UT9 D;  3AFA C;  1ID3 B;  1ID3 A;  1B6W A;  2CWE A;  3TU4 B;  2Y2L A;  3AZE D;  3V9R A;  5AV5 D;  2ZY5 A;  2FJ7 C;  3O62 B;  4M6B A;  3O62 A;  2F8N B;  2F8N A;  1S32 D;  1P3B B;  4J8U C;  2ARO A;  1P3B A;  1EQZ A;  3KUY D;  3AZG D;  3WAA B;  3WAA A;  2NZD A;  3W96 A;  3MGS B;  5DNM B;  1JFI B;  4H9S A;  5DNM A;  3WKJ B;  4H9Q B;  5B40 A;  3AZK D;  3AV1 D;  2G5I C;  3UT9 B;  1KX4 C;  3UT9 A;  1M1A D;  3EG5 B;  2Y2M A;  1A7W A;  1P3A D;  4KGC B;  3AZH C;  1WWS A;  1F66 D;  4ZUX C;  3X1T C;  1F1E A;  5B1L D;  5AV5 B;  3AZE A;  5AV5 A;  3LZ1 D;  3X1S B;  4NFT A;  2XD1 A;  1TAF B;  1TAF A;  2F8N H;  1S32 A;  4XUJ C;  2Y2H A;  3LEL B;  3AZL B;  2XD5 A;  4ZBJ C;  3KUY A;  3X1U D;  3AZG A;  3AZL A;  3B6F D;  3AZI C;  3C1B D;  5C3I C;  5GSU D;  3MGP D;  3KFU G;  1P3I B;  2HIO C;  3UTB B;  1P3I A;  3REI B;  4Z66 C;  5B0Z B;  5B0Z A;  3MGQ B;  1KX5 B;  2ZY3 A;  1P3G B;  3AZJ D;  1P3F B;  1ID3 C;  3LZ0 D;  5B2I D;  4QLC B;  2UWX A;  3AZK B;  3AZK A;  3TU4 C;  3MVD D;  1M1A A;  1P3A A;  3O62 C;  3MNN C;  5BNX B;  1F66 B;  3A6N B;  5BNX A;  4R8P B;  3A6N A;  1P3B C;  1F66 A;  4R8P A;  5B1L A;  2Y2Q A;  1BFM A;  3LZ1 A;  1M19 D;  3WAA C;  4UUZ B;  3LJA B;  4UUZ A;  3LJA A;  4WU9 B;  2YFW B;  5BS7 A;  4WU9 A;  2YFW A;  3MGS C;  4H9S C;  3W99 D;  5DNM C;  3X1V D;  5B24 B;  4G92 B;  3WKJ C;  5B0Y B;  5BNV B;  3AZM D;  3B6F A;  5BNV A;  3C1B A;  4EO5 B;  5GSU A;  3MGP A;  1P3O D;  4WU8 B;  4WU8 A;  2NQB B;  3AZJ A;  3LZ0 B;  3LZ0 A;  5B2I A;  4KGC C;  4H9O B;  3W98 C;  4H9O A;  5CPK B;  3REL D;  5CP6 B;  5CP6 A;  5GT0 D;  3MVD B;  4J8X D;  3MVD A;  5AV5 C;  2J8P A;  3X1S C;  5B2J D;  1KX3 D;  2LY8 A;  3C1C D;  3AZF B;  3AZF A;  3LEL C;  3AZL C;  1U35 D;  1M19 B;  1M19 A;  5AVC D;  1P3I C;  3UTB C;  4WJ3 C;  3REI C;  3W99 A;  3X1V A;  4G91 B;  1P3M D;  5B0Z C;  3AZM B;  3MGQ C;  1KX5 C;  3AZM A;  1HQ3 D;  5CPI B;  1P3G C;  1P3F C;  1P3K B;  5CPI A;  4LD9 C;  5B32 G;  4H9R A;  4QLC C;  1P3O A;  3AZK C;  4J8V D;  3UTA B;  3UTA A;  3REL A;  1F66 C;  3A6N C;  4R8P C;  4NE3 A;  5GT0 A;  4J8X A;  3AZN D;  5F99 D;  4Z5T B;  3LJA C;  5BS7 C;  4WU9 C;  3C1C A;  2RVQ C;  3VH5 T;  5B24 C;  4G92 C;  5B0Y C;  5DNN D;  1U35 A;  3B0C T;  4X23 D;  5AVC A;  4EO5 C;  5AV6 B;  1TZY D;  3V9R B;  5AV6 A;  2PYO D;  1P3M A;  4YS3 D;  5B1M D;  4WU8 C;  2Y2G A;  1HQ3 A;  1BH9 B;  1P3P D;  2NQB C;  1BH9 A;  3LZ0 C;  2CV5 D;  2ARO B;  5AVB D;  1EQZ B;  5CPK C;  1P34 D;  5GT3 D;  5CP6 C;  3KXB D;  3MVD C;  5FUG B;  2NZD B;  3AYW D;  5FUG A;  2JCH A;  5G49 B;  4J8V A;  5G49 A;  3W96 B;  1AOI D;  2Y2I A;  5E5A D;  3AZF C;  2JSS A;  3WTP B;  3AZN A;  5B40 B;  3WTP A;  5F99 B;  5B31 B;  5F99 A;  2F2A C;  5B31 A;  4Z2M G;  3WA9 C;  5AV9 D;  4YM6 D;  3REJ D;  4HGA B;  4G91 C;  4NE6 A;  3AZM C;  5CPI C;  1P3K C;  1PZR A;  1TZY B;  3REK D;  1TZY A;  3AZE B;  4WV4 B;  5B1M B;  2PYO A;  4YS3 A;  5B1M A;  2DF4 C;  1P3P B;  1P3P A;  3UTA C;  3VH5 W;  1S32 B;  3B6G D;  1T3U A;  5AVB A;  4J8W D;  5GT3 B;  3KUY B;  5GT3 A;  3AZG B;  3KXB B;  3KXB A;  3AYW B;  3AYW A;  3KWQ C;  3H0M C;  1N1J B;  4Z5T C;  1N1J A;  1AOI A;  5E5A A;  5CPJ D;  2Y2P A;  3H0R C;  5BO0 B;  5AV9 B;  5BO0 A;  3AV1 B;  5AV9 A;  3AV1 A;  5AV6 C;  3AL0 C;  3REJ A;  1M1A B;  4KUD D;  1P3A B;  1HTA A;  4XZQ D;  4H9P B;  4H9P A;  3B0D B;  2ARO C;  3AFA D;  3REK B;  1EQZ C;  1WWI A;  5B1L B;  3REK A;  3LZ1 B;  5JRG D;  3AN2 D;  1ZLA D;  2NZD C;  5AY8 D;  3W96 C;  1KX5 D;  4J8W B;  3B6G A;  2FJ7 D;  4J8W A;  3X1U B;  3B6F B;  3X1U A;  3C1B B;  4J8U D;  3WTP C;  5GSU B;  3MGP B;  5B40 C;  5F99 C;  5B31 C;  1R4V A;  3AZJ B;  3UT9 C;  4HGA C;  5B2I B;  4AWL B;  2F8N K;  5AV8 D;  2G5H C;  5GXQ D;  1TZY C;  3KSY A;  3AZE C;  4KUD B;  4KUD A;  5B1M C;  4XZQ B;  4XZQ A;  5KDM B;  2Y2O A;  5KDM A;  1S32 C;  1KX4 D;  1KU5 A;  3AFA A;  2Y2N A;  5GT3 C;  3KUY C;  3AZG C;  5JRG B;  3AZH D;  3A1K A;  5CHL B;  5JRG A;  3KXB C;  3AN2 B;  4ZUX D;  1ZLA B;  3AN2 A;  5AY8 B;  1ULY A;  3AYW C;  1ZLA A;  5AY8 A;  3X1T D;  2F8N G;  2W8S A;  3W99 B;  3X1V B;  3VH6 T;  2FJ7 A;  2JE5 A;  4KHA A;  4XUJ D;  4J8U A;  4H9R B;  1P3O B;  3W97 D;  5AV9 C;  3AV1 C;  2HIO D;  4UPK A;  5BT1 D;  1M1A C;  4Z66 D;  1P3A C;  3REL B;  5AV8 B;  5AV8 A;  5GXQ B;  2ZY4 A;  3B0D C;  5GT0 B;  1Q9C A;  5GXQ A;  4J8X B;  5B1L C;  3LZ1 C;  4CSR B;  3TU4 D;  5B2J B;  4CSR A;  1KX3 B;  5B2J A;  3C1C B;  1KX3 A;  1KX4 B;  1KX4 A;  4J8W C;  3MNN D;  3X1U C;  1U35 B;  3B6F C;  3EPH A;  4ZUX A;  3C1B C;  5AVC B;  3X1T B;  1P3B D;  5GSU C;  3A1I A;  3MGP C;  3X1T A;  1P3M B;  5B33 D;  4E44 A;  5B32 D;  1HQ3 B;  3AZJ C;  3NQU A;  3MGS D;  4XUJ A;  5B2I C;  4AWL C;  3WKJ D;  3W97 B;  3W97 A;  2Y2K A;  1P3L D;  4J8V B;  2HIO A;  3R45 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...