5B31G

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.1.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
104
structure length
104
Chain Sequence
AVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 33
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00125 Histone Core histone H2A/H2B/H3/H4
G PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b31G00
5B31D 1M19B 5BO0A 1F66C 3VH6W 3WTPD 1BH9A 2NZDB 5B2ID 3AZND 1M19C 4H9NB 3AZHD 3MGQB 5B31B 1KX3A 1P3KD 5AV8D 1M18A 1M18C 3WTPB 5AV9D 2NZDC 4HGAC 5B40A 5B40C 3MVDD 4J8UD 5B2IB 4XZQA 3MGQC 5B31C 4CSRB 3AZNB 3AZHB 3WTPC 1P3KB 3AZED 5AV8B 5AV9B 3C1BA 5B2IC 3MVDB 3AZNC 3KXBA 4J8UB 5B33D 1P3KA 1P3KC 5AV8A 5AV8C 5GSUA 5CPID 5AV9C 3AZEB 5G49A 4QLCC 4QLCA 4KUDD 4J8UC 2F8NG 5FUGB 5B33B 4WZSB 2FJ7A 1WWSA 3AZEC 3W96A 3W96C 5CPIB 5CPJD 1P3LA 3C1CB 4KUDB 5B32A 5B32C 5AV6D 5B33C 1P3AD 5B0YA 3X1UA 3X1UC 5CPIC 3KWQD 3UTAD 4J8XD 3REHD 5CPJB 5BNXB 1WWIA 1S32D 4H9OA 5AV6B 1P3AB 3REIA 4WU8A 2HIOD 1TZYD 2RVQD 5KDMA 5CPJC 3KWQB 3UTAB 2YFWA 4J8XB 5CP6D 5AV6C 4J8VD 3REHB 3TU4D 1P3AC 1S32B 3LZ0D 5GT3D 2CV5D 1JFIA 4EO5B 3LELD 1M1AB 1U35A 1R4VA 3UTAC 2HIOB 1TZYB 4H9SA 3WAAD 4J8XC 3REHA 3REHC 4Z2MG 3VH5T 1S32A 1S32C 5B2JD 5JRGD 5CP6B 4J8VB 1KX5A 3TU4B 3LJAD 1TAFA 3LZ0B 5GT3B 2CV5B 1H3OB 2IO5B 1TZYA 1TZYC 2RVQC 3LELB 3NQUB 3WAAB 5CP6A 5CP6C 3A6NA 3A6NC 4J8VC 5B2JB 5GT3A 5AV5A 1H3OA 4H9QB 3NQJB 5GT3C 5JRGB 2IO5C 4KHAB 3AV1A 3LELA 3LJAB 3LELC 3WA9B 3KUYD 3AV2A 3W99B 3WAAC 3AZKA 5JRGC 3AZKC 3NQJA 4M6BA 4CAYB 3MGPD 3KUYB 5AVBA 5AVBC 5BNVB 2LY8A 3REKD 3KUYC 5JA4A 3MGPB 1BH8A 4WNNB 4ZUXA 2YFVB 3AYWD 5AY8A 5AY8C 4Z66D 4H9RB 2HUEC 3AZLA 3AZLC 4WV4B 1F66A 3X1TD 4NE5A 3W98D 3MGPA 3MGPC 3B0CT 3REKB 2YFVA 5B24D 5F99D 1M19A 1P3BD 3AYWB 4Z66B 3AFAD 4KGCD 3X1TB 2NZDA 3W98B 1P3ID 4H9NA 5B24B 5F99B 3MGQA 3AYWC 3B6GD 3W97D 4Z66A 5B31A 4Z66C 1P3BB 3WTPA 3X1TC 3X1TA 3AFAB 3R45B 3RELD 3REJB 4KGCB 5B24A 4Z5TD 5DNMD 5B24C 5B2IA 5F99C 2JSSA 4AWLB 1P3IB 4CSRA 3AZNA 3AZHA 3AZHC 1P3BC 3B6GB 3VH5A 3W97B 1P3MD 3VH5W 1P3OD 4KGCA 4KGCC 5B0ZD 5AV9A 5B31G 3RELB 4AWLC 3C1CD 1P3IC 4DRBA 3MVDA 3MVDC 4Z5TB 5DNMB 4J8UA 3B6GA 3B6GC 4UUZB 1P3GD 1P3MB 1A7WA 1P3OB 3AZEA 5B0ZB 4Z5TC 5DNMC 3MGRD 2AROD 3AZID 4UUZA 5E5AD 5FUGA 5B33A 1P3MA 1P3MC 5CPKD 5CPIA 1P3GB 1ZLAD 3C1CA 3C1CC 4KUDA 2CWEA 4KUDC 3MGRB 2BYMB 3B0BA 4JJND 3UTBD 2AROB 3AZIB 1P3FD 5AVCD 5E5AB 4WU9D 3MGSD 1M1AD 5B32G 5CPKB 1AOID 5CPJA 3MGRC 1ZLAB 5BNXA 2L5AA 2AROC 3LZ1D 1P3PD 5AV6A 3VH6T 4JJNB 1P3AA 3UTBB 1Q9CA 1P3FB 2F8NH 4DRAA 5AVCB 2PYOD 2BYKB 5CPKC 3B0DB 3MGSB 4WU9B 3KWQA 3KWQC 1KX4D 1ZLAC 3UTAA 1AOIB 1KU5A 3X1VD 4J8XA 4JJNA 4JJNC 3UTBA 4YS3D 3LZ1B 3UTBC 1P3FA 1P3FC 1P3PB 4NE3A 5AVCC 2BYKA 3B0DC 3MGSC 4WU9C 4EO5C 1M1AA 1M1AC 3WA9D 2PYOB 2HIOA 2HIOC 3W99D 1KX4B 3LZ1C 3X1VB 1P3PC 4J8VA 3TU4A 3TU4C 4YS3B 3LZ0A 3LZ0C 2CV5A 2CV5C 1BFMA 1ID3D 5DNND 3NQUA 3V9RB 1KX4C 3WAAA 3X1VC 4NFTA 4YS3A 4YS3C 5B2JA 5B2JC 5JRGA 4H9QA 5BS7A 1ULYA 5BS7C 4KHAA 3LJAA 3LJAC 3WA9A 3V9RA 3WA9C 2F8NK 1HTAA 3W99C 1ID3B 3MNND 3W99A 5DNNB 3X1SD 1B67A 3UT9D 4Z2MH 1F1EA 4CAYA 1ID3C 2NQBD 5DNNC 3KUYA 5B1MD 4G91B 4XUJD 3MNNB 4H9PB 3X1SB 3UT9B 5BNVA 4WNNA 2NQBB 3MNNC 5B1MB 3X1SC 4XUJB 3UT9A 4H9RA 3UT9C 4G92B 1KX3D 5BO0B 2NQBC 3REJD 3REKA 3REKC 1BH9B 5B1MC 4XUJC 5B40D 4G92C 3AYWA 4XZQD 1B6WA 3VH6A 1KX3B 3W98A 3W98C 1M18B 2F8ND 3C1BD 5F99A 4HGAB 3AN2D 5B40B 1P3BA 3KXBD 4XZQB 3AFAA 3R45A 3AFAC 1KX3C 3REJA 1HQ3D 3REJC 5GSUD 4QLCD 2F8NB 1P3IA 3C1BB 3WKJD 4XZQC 5C3IB 3W97A 3AN2B 5B1LD 3W97C 3KXBB 2FJ7D 3RELA 3RELC 2F8NA 3W96D 1HQ3B 5GSUB 3C1BC 4Z5TA 5DNMA 1P3LD 5G49B 5C3IC 4QLCB 3AN2C 5GXQD 3AN2A 5B32D 4E45A 3WKJB 3KXBC 5B1LB 5B0YD 1P3OA 1P3OC 1HQ3A 1HQ3C 3X1UD 5GSUC 5B0ZA 5B0ZC 2FJ7B 4ZBJB 3O62D 3W96B 3AZGD 3WKJA 3WKJC 1P3LB 4R8PD 5B1LA 5B1LC 5GXQB 5B32B 1P3GA 5GT0D 5B0YB 3REID 1P3GC 2FJ7C 3AZFD 4ZBJC 4WU8D 3X1UB 3MGRA 2BYMA 3O62B 1P3LC 2AROA 3AZIA 5GXQA 5GXQC 4YM6D 4X23D 3AZIC 3AZGB 5E5AA 5E5AC 4R8PB 5B0YC 4H9OB 3B6FD 3AZJD 5BT1D 5CPKA 5GT0B 3REIB 1U35D 3AZFB 3O62A 4WU8B 3O62C 1ZLAA 3AZGA 3AZGC 3B0CW 5KDMB 4R8PA 4R8PC 2YFWB 4YM6B 4X23B 5AVCA 1KX5D 3MGSA 4WU9A 5GT0A 5GT0C 3REIC 1JFIB 3AZFA 3AZFC 4WU8C 3B6FB 3AZJB 1AOIA 1AOIC 4NE6A 1U35B 3LZ1A 4X23A 4YM6A 1N1JB 4YM6C 4X23C 1P3PA 1EQZD 3A6ND 3AZMD 5AV5D 2PYOA 2PYOC 1KX5B 3B6FC 3AZJA 3AZJC 5BT1C 3B6FA 3AV1D 1TAFB 1U35C 1KX4A 3AV2D 4LD9D 1P34D 1N1JA 4H9SC 3X1VA 1EQZB 3AZKD 3A6NB 1KX5C 3AZMB 5AV5B 3WTPE 3AV1B 3AV2B 4LD9B 1P34B 1EQZA 1EQZC 5AVBD 3AZMA 3AZMC 3AZKB 5AV5C 1ID3A 3AV1C 5DNNA 4J8WD 3AV2C 4LD9C 4LD9A 4ZUXD 1P34C 1P34A 5AY8D 5AVBB 5CHLB 3AZLD 1F66D 3KSYA 4G91C 3MNNA 4H9PA 4J8WB 3X1SA 5JA4B 1BH8B 4ZUXB 4E44A 1M19D 5AY8B 2HUEB 3AZLB 2NQBA 1M18D 1F66B 4J8WA 4J8WC 2NZDD 5B1MA 4XUJA 4ZUXC 3MGQD
chains in the Genus database with same CATH superfamily
5B31D 1M19B 5BO0A 1F66C 3VH6W 3WTPD 1BH9A 2Y2IA 2NZDB 5B2ID 3AZND 1M19C 4H9NB 3AZHD 2XD5A 3MGQB 5B31B 1KX3A 1P3KD 5AV8D 1M18A 1M18C 3WTPB 5AV9D 2NZDC 4HGAC 5B40A 5B40C 3MVDD 3F6TA 4J8UD 5B2IB 4XZQA 3MGQC 5B31C 4CSRB 3AZNB 3AZHB 3WTPC 1P3KB 3AZED 5AV8B 5AV9B 3C1BA 5B2IC 3MVDB 3AZNC 3KXBA 4J8UB 5B33D 2G5IC 1P3KA 1P3KC 5AV8A 5AV8C 5GSUA 5CPID 5AV9C 3AZEB 5G49A 4QLCC 4QLCA 4KUDD 4J8UC 2F8NG 5FUGB 5B33B 4WZSB 2FJ7A 1WWSA 2DF4C 3AZEC 3W96A 3W96C 5CPIB 5CPJD 1P3LA 3C1CB 4KUDB 5B32A 5B32C 5AV6D 5B33C 1P3AD 5B0YA 3X1UA 3X1UC 5CPIC 3KWQD 3UTAD 4J8XD 3REHD 5CPJB 5BNXB 2ZM5A 3AL0C 1WWIA 1S32D 4H9OA 5AV6B 1P3AB 3REIA 2F2AC 4WU8A 2HIOD 1TZYD 2RVQD 2Y2LA 2UWXA 5KDMA 5CPJC 3KWQB 2Y2HA 3UTAB 2YFWA 4J8XB 5CP6D 5AV6C 4J8VD 3REHB 3TU4D 1W2EA 1P3AC 2Y2MA 1S32B 3LZ0D 5GT3D 2CV5D 1JFIA 4EO5B 3LELD 1M1AB 1U35A 1R4VA 2ZY5A 3UTAC 2HIOB 1TZYB 2XD1A 4H9SA 3WAAD 4J8XC 3REHA 3REHC 2ZY4A 4Z2MG 3VH5T 1S32A 1S32C 5B2JD 5JRGD 5CP6B 4J8VB 1KX5A 3TU4B 3LJAD 1TAFA 3LZ0B 5GT3B 2CV5B 1H3OB 2IO5B 1TZYA 1TZYC 2RVQC 3LELB 2DQNC 3NQUB 3A1IA 3WAAB 5CP6A 5CP6C 3A6NA 3A6NC 4J8VC 5B2JB 5GT3A 5AV5A 1H3OA 4H9QB 3NQJB 5GT3C 5JRGB 2IO5C 4KHAB 3AV1A 3LELA 3LJAB 3LELC 3WA9B 3KUYD 3AV2A 3W99B 3WAAC 2Y2JA 3AZKA 5JRGC 3AZKC 3NQJA 4M6BA 4CAYB 3MGPD 3KUYB 2BG1A 5AVBA 5AVBC 5BNVB 2Y2QA 2LY8A 3REKD 3KUYC 5JA4A 3MGPB 1BH8A 4WNNB 4ZUXA 2YFVB 3AYWD 5AY8A 5AY8C 4Z66D 3A1KA 4H9RB 2HUEC 3AZLA 3AZLC 4WV4B 1F66A 3X1TD 4NE5A 3W98D 2ZY2A 3MGPC 3MGPA 3B0CT 3REKB 2YFVA 5B24D 5F99D 1M19A 3H0MC 3AYWB 1P3BD 4Z66B 3AFAD 4KGCD 3X1TB 2NZDA 3W98B 1P3ID 4H9NA 5B24B 5F99B 3MGQA 3AYWC 3B6GD 3W97D 4Z66A 5B31A 4Z66C 1P3BB 3WTPA 3X1TC 3X1TA 3AFAB 3R45B 3RELD 3REJB 4KGCB 5B24A 4Z5TD 5DNMD 5B24C 5B2IA 5F99C 2JSSA 4AWLB 1P3IB 4CSRA 3AZNA 3AZHA 3AZHC 1P3BC 3B6GB 3VH5A 3W97B 3EPKA 1P3MD 3VH5W 1P3OD 4KGCA 4KGCC 5B0ZD 5AV9A 5B31G 3RELB 4AWLC 3C1CD 1P3IC 4DRBA 3MVDA 3MVDC 4Z5TB 5DNMB 4J8UA 3B6GA 3B6GC 4UUZB 1P3GD 1P3MB 1A7WA 1P3OB 3AZEA 3EPJA 5B0ZB 4Z5TC 5DNMC 3P5JB 3MGRD 4DQYB 2AROD 3AZID 4UUZA 5E5AD 5FUGA 5B33A 1P3MA 1P3MC 5CPKD 5CPIA 1P3GB 1ZLAD 3C1CA 3C1CC 4KUDA 2CWEA 4KUDC 3MGRB 2BYMB 3B0BA 4JJND 3UTBD 2AROB 3AZIB 1P3FD 5AVCD 5E5AB 4WU9D 2G5HC 3MGSD 1M1AD 3EPHA 5B32G 5CPKB 1AOID 5CPJA 3MGRC 1ZLAB 5BNXA 2L5AA 2AROC 3LZ1D 1P3PD 3EG5B 5AV6A 3VH6T 4JJNB 1P3AA 3UTBB 1Q9CA 1P3FB 2F8NH 4DRAA 5AVCB 2PYOD 2BYKB 5CPKC 3B0DB 3MGSB 4WU9B 3KWQA 3KWQC 1KX4D 1ZLAC 3UTAA 1AOIB 1KU5A 3X1VD 4J8XA 4JJNA 4JJNC 3UTBA 4YS3D 3LZ1B 3UTBC 1P3FA 1P3FC 1P3PB 4NE3A 5AVCC 2BYKA 3B0DC 3MGSC 4WU9C 4EO5C 1M1AA 1M1AC 3KFUG 3WA9D 2PYOB 2HIOA 2HIOC 3W99D 1PZRA 2Y2PA 1KX4B 2W8SA 3LZ1C 3X1VB 1P3PC 4J8VA 3TU4A 3TU4C 4YS3B 3LZ0A 3LZ0C 2CV5A 2CV5C 1BFMA 1ID3D 5DNND 3NQUA 3V9RB 1KX4C 3WAAA 3X1VC 4NFTA 1Z2CB 4YS3A 4YS3C 5B2JA 5B2JC 5JRGA 4H9QA 5BS7A 1ULYA 5BS7C 4KHAA 3LJAA 3LJAC 3WA9A 3V9RA 3WA9C 2F8NK 1HTAA 3W99C 1ID3B 3MNND 3W99A 5DNNB 3X1SD 1B67A 3UT9D 4Z2MH 1F1EA 4CAYA 1ID3C 2NQBD 5DNNC 3KUYA 5B1MD 4G91B 4XUJD 3MNNB 4H9PB 3X1SB 3UT9B 5BNVA 4WNNA 2NQBB 3MNNC 5B1MB 3X1SC 4XUJB 3UT9A 4H9RA 3UT9C 4G92B 1KX3D 5BO0B 2NQBC 3REJD 3REKA 3REKC 1BH9B 5B1MC 4XUJC 5B40D 4G92C 3AYWA 2J8PA 4XZQD 2VQRA 1B6WA 3FDDA 3VH6A 1KX3B 3W98A 3W98C 1M18B 2F8ND 3C1BD 5F99A 4HGAB 3AN2D 5B40B 1P3BA 3KXBD 4XZQB 3AFAA 3R45A 3AFAC 1KX3C 3REJA 1HQ3D 3REJC 5GSUD 2JE5A 4QLCD 2F8NB 1P3IA 2RIQA 3C1BB 3WKJD 4XZQC 5C3IB 3W97A 3AN2B 5B1LD 3W97C 3KXBB 2FJ7D 3RELA 3RELC 2F8NA 3W96D 1HQ3B 5GSUB 3C1BC 4Z5TA 5DNMA 1P3LD 5G49B 2Y2KA 5C3IC 4QLCB 4UPKA 5GXQD 3AN2C 3AN2A 5B32D 4E45A 3WKJB 3KXBC 5B1LB 5B0YD 1P3OA 1P3OC 1HQ3A 1HQ3C 3X1UD 5GSUC 5B0ZA 5B0ZC 2FJ7B 4ZBJB 3O62D 3W96B 3AZGD 3WKJA 3WKJC 1P3LB 4R8PD 5B1LA 5B1LC 5GXQB 2Y2GA 5B32B 3H0RC 1P3GA 5GT0D 5B0YB 3REID 2Y2NA 1P3GC 3AZFD 2FJ7C 4ZBJC 3EPLA 4WU8D 3X1UB 3MGRA 2BYMA 3O62B 1P3LC 2AROA 3AZIA 5GXQA 5GXQC 4YM6D 4X23D 3AZIC 3AZGB 2Y2OA 5E5AA 5E5AC 4R8PB 5B0YC 4H9OB 3B6FD 3AZJD 3IP4C 5BT1D 2JCHA 5CPKA 5GT0B 3REIB 1U35D 3AZFB 3O62A 4WU8B 3O62C 1ZLAA 3AZGA 3AZGC 3B0CW 5KDMB 4R8PA 4R8PC 2YFWB 4YM6B 4X23B 5AVCA 1KX5D 3MGSA 4WU9A 5GT0A 5GT0C 3REIC 1JFIB 3AZFA 3AZFC 4WU8C 3B6FB 4WJ3C 3AZJB 1AOIA 1AOIC 4NE6A 1U35B 2FFFB 3LZ1A 4X23A 4YM6A 1N1JB 4YM6C 4X23C 1P3PA 1EQZD 3A6ND 3AZMD 5AV5D 2PYOA 2PYOC 1KX5B 3B6FC 3AZJA 3AZJC 5BT1C 3B6FA 3AV1D 1TAFB 1U35C 2ZY3A 3AV2D 1KX4A 4LD9D 1P34D 1N1JA 4H9SC 3X1VA 1EQZB 3AZKD 3A6NB 1KX5C 3AZMB 5AV5B 3WTPE 3AV1B 3AV2B 4LD9B 1P34B 1EQZA 1EQZC 5AVBD 3AZMA 3AZMC 3AZKB 5AV5C 1ID3A 3AV1C 5DNNA 4J8WD 3AV2C 4LD9C 4LD9A 4ZUXD 1P34C 1P34A 5AY8D 5AVBB 5CHLB 3AZLD 1F66D 1T3UA 3KSYA 4G91C 3MNNA 3H0LC 4H9PA 4J8WB 3X1SA 5JA4B 1BH8B 4ZUXB 4E44A 1M19D 5AY8B 2HUEB 3AZLB 2NQBA 1M18D 1F66B 4J8WA 4J8WC 2NZDD 5B1MA 4XUJA 4ZUXC 3MGQD
chains in the Genus database with same CATH topology
5B31D 1M19B 5BO0A 1F66C 3VH6W 3WTPD 1BH9A 2Y2IA 2NZDB 5B2ID 3AZND 1M19C 4H9NB 3AZHD 2XD5A 3MGQB 5B31B 1KX3A 1P3KD 5AV8D 1M18A 1M18C 3WTPB 5AV9D 2NZDC 4HGAC 5B40A 5B40C 3MVDD 3F6TA 4J8UD 5B2IB 4XZQA 3MGQC 5B31C 4CSRB 3AZNB 3AZHB 3WTPC 1P3KB 3AZED 5AV8B 5AV9B 3C1BA 5B2IC 3MVDB 3AZNC 3KXBA 4J8UB 5B33D 2G5IC 1P3KA 1P3KC 5AV8A 5AV8C 5GSUA 5CPID 5AV9C 3AZEB 5G49A 4QLCC 4QLCA 4KUDD 4J8UC 2F8NG 5FUGB 5B33B 4WZSB 2FJ7A 1WWSA 2DF4C 3AZEC 3W96A 3W96C 5CPIB 5CPJD 1P3LA 3C1CB 4KUDB 5B32A 5B32C 5AV6D 5B33C 1P3AD 5B0YA 3X1UA 3X1UC 5CPIC 3KWQD 3UTAD 4J8XD 3REHD 5CPJB 5BNXB 2ZM5A 3AL0C 1WWIA 1S32D 4H9OA 5AV6B 1P3AB 3REIA 2F2AC 4WU8A 2HIOD 1TZYD 2RVQD 2Y2LA 2UWXA 5KDMA 5CPJC 3KWQB 2Y2HA 3UTAB 2YFWA 4J8XB 5CP6D 5AV6C 4J8VD 3REHB 3TU4D 1W2EA 1P3AC 2Y2MA 1S32B 3LZ0D 5GT3D 2CV5D 1JFIA 4EO5B 3LELD 1M1AB 1U35A 1R4VA 2ZY5A 3UTAC 2HIOB 1TZYB 2XD1A 4H9SA 3WAAD 4J8XC 3REHA 3REHC 2ZY4A 4Z2MG 3VH5T 1S32A 1S32C 5B2JD 5JRGD 5CP6B 4J8VB 1KX5A 3TU4B 3LJAD 1TAFA 3LZ0B 5GT3B 2CV5B 1H3OB 2IO5B 1TZYA 1TZYC 2RVQC 3LELB 2DQNC 3NQUB 3A1IA 3WAAB 5CP6A 5CP6C 3A6NA 3A6NC 4J8VC 5B2JB 5GT3A 5AV5A 1H3OA 4H9QB 3NQJB 5GT3C 5JRGB 2IO5C 4KHAB 3AV1A 3LELA 3LJAB 3LELC 3WA9B 3KUYD 3AV2A 3W99B 3WAAC 2Y2JA 3AZKA 5JRGC 3AZKC 3NQJA 4M6BA 4CAYB 3MGPD 3KUYB 2BG1A 5AVBA 5AVBC 5BNVB 2Y2QA 2LY8A 3REKD 3KUYC 5JA4A 3MGPB 1BH8A 4WNNB 4ZUXA 2YFVB 3AYWD 5AY8A 5AY8C 4Z66D 3A1KA 4H9RB 2HUEC 3AZLA 3AZLC 4WV4B 1F66A 3X1TD 4NE5A 3W98D 2ZY2A 3MGPC 3MGPA 3B0CT 3REKB 2YFVA 5B24D 5F99D 1M19A 3H0MC 3AYWB 1P3BD 4Z66B 3AFAD 4KGCD 3X1TB 2NZDA 3W98B 1P3ID 4H9NA 5B24B 5F99B 3MGQA 3AYWC 3B6GD 3W97D 4Z66A 5B31A 4Z66C 1P3BB 3WTPA 3X1TC 3X1TA 3AFAB 3R45B 3RELD 3REJB 4KGCB 5B24A 4Z5TD 5DNMD 5B24C 5B2IA 5F99C 2JSSA 4AWLB 1P3IB 4CSRA 3AZNA 3AZHA 3AZHC 1P3BC 3B6GB 3VH5A 3W97B 3EPKA 1P3MD 3VH5W 1P3OD 4KGCA 4KGCC 5B0ZD 5AV9A 5B31G 3RELB 4AWLC 3C1CD 1P3IC 4DRBA 3MVDA 3MVDC 4Z5TB 5DNMB 4J8UA 3B6GA 3B6GC 4UUZB 1P3GD 1P3MB 1A7WA 1P3OB 3AZEA 3EPJA 5B0ZB 4Z5TC 5DNMC 3P5JB 3MGRD 4DQYB 2AROD 3AZID 4UUZA 5E5AD 5FUGA 5B33A 1P3MA 1P3MC 5CPKD 5CPIA 1P3GB 1ZLAD 3C1CA 3C1CC 4KUDA 2CWEA 4KUDC 3MGRB 2BYMB 3B0BA 4JJND 3UTBD 2AROB 3AZIB 1P3FD 5AVCD 5E5AB 4WU9D 2G5HC 3MGSD 1M1AD 3EPHA 5B32G 5CPKB 1AOID 5CPJA 3MGRC 1ZLAB 5BNXA 2L5AA 2AROC 3LZ1D 1P3PD 3EG5B 5AV6A 3VH6T 4JJNB 1P3AA 3UTBB 1Q9CA 1P3FB 2F8NH 4DRAA 5AVCB 2PYOD 2BYKB 5CPKC 3B0DB 3MGSB 4WU9B 3KWQA 3KWQC 1KX4D 1ZLAC 3UTAA 1AOIB 1KU5A 3X1VD 4J8XA 4JJNA 4JJNC 3UTBA 4YS3D 3LZ1B 3UTBC 1P3FA 1P3FC 1P3PB 4NE3A 5AVCC 2BYKA 3B0DC 3MGSC 4WU9C 4EO5C 1M1AA 1M1AC 3KFUG 3WA9D 2PYOB 2HIOA 2HIOC 3W99D 1PZRA 2Y2PA 1KX4B 2W8SA 3LZ1C 3X1VB 1P3PC 4J8VA 3TU4A 3TU4C 4YS3B 3LZ0A 3LZ0C 2CV5A 2CV5C 1BFMA 1ID3D 5DNND 3NQUA 3V9RB 1KX4C 3WAAA 3X1VC 4NFTA 1Z2CB 4YS3A 4YS3C 5B2JA 5B2JC 5JRGA 4H9QA 5BS7A 1ULYA 5BS7C 4KHAA 3LJAA 3LJAC 3WA9A 3V9RA 3WA9C 2F8NK 1HTAA 3W99C 1ID3B 3MNND 3W99A 5DNNB 3X1SD 1B67A 3UT9D 4Z2MH 1F1EA 4CAYA 1ID3C 2NQBD 5DNNC 3KUYA 5B1MD 4G91B 4XUJD 3MNNB 4H9PB 3X1SB 3UT9B 5BNVA 4WNNA 2NQBB 3MNNC 5B1MB 3X1SC 4XUJB 3UT9A 4H9RA 3UT9C 4G92B 1KX3D 5BO0B 2NQBC 3REJD 3REKA 3REKC 1BH9B 5B1MC 4XUJC 5B40D 4G92C 3AYWA 2J8PA 4XZQD 2VQRA 1B6WA 3FDDA 3VH6A 1KX3B 3W98A 3W98C 1M18B 2F8ND 3C1BD 5F99A 4HGAB 3AN2D 5B40B 1P3BA 3KXBD 4XZQB 3AFAA 3R45A 3AFAC 1KX3C 3REJA 1HQ3D 3REJC 5GSUD 2JE5A 4QLCD 2F8NB 1P3IA 2RIQA 3C1BB 3WKJD 4XZQC 5C3IB 3W97A 3AN2B 5B1LD 3W97C 3KXBB 2FJ7D 3RELA 3RELC 2F8NA 3W96D 1HQ3B 5GSUB 3C1BC 4Z5TA 5DNMA 1P3LD 5G49B 2Y2KA 5C3IC 4QLCB 4UPKA 5GXQD 3AN2C 3AN2A 5B32D 4E45A 3WKJB 3KXBC 5B1LB 5B0YD 1P3OA 1P3OC 1HQ3A 1HQ3C 3X1UD 5GSUC 5B0ZA 5B0ZC 2FJ7B 4ZBJB 3O62D 3W96B 3AZGD 3WKJA 3WKJC 1P3LB 4R8PD 5B1LA 5B1LC 5GXQB 2Y2GA 5B32B 3H0RC 1P3GA 5GT0D 5B0YB 3REID 2Y2NA 1P3GC 3AZFD 2FJ7C 4ZBJC 3EPLA 4WU8D 3X1UB 3MGRA 2BYMA 3O62B 1P3LC 2AROA 3AZIA 5GXQA 5GXQC 4YM6D 4X23D 3AZIC 3AZGB 2Y2OA 5E5AA 5E5AC 4R8PB 5B0YC 4H9OB 3B6FD 3AZJD 3IP4C 5BT1D 2JCHA 5CPKA 5GT0B 3REIB 1U35D 3AZFB 3O62A 4WU8B 3O62C 1ZLAA 3AZGA 3AZGC 3B0CW 5KDMB 4R8PA 4R8PC 2YFWB 4YM6B 4X23B 5AVCA 1KX5D 3MGSA 4WU9A 5GT0A 5GT0C 3REIC 1JFIB 3AZFA 3AZFC 4WU8C 3B6FB 4WJ3C 3AZJB 1AOIA 1AOIC 4NE6A 1U35B 2FFFB 3LZ1A 4X23A 4YM6A 1N1JB 4YM6C 4X23C 1P3PA 1EQZD 3A6ND 3AZMD 5AV5D 2PYOA 2PYOC 1KX5B 3B6FC 3AZJA 3AZJC 5BT1C 3B6FA 3AV1D 1TAFB 1U35C 2ZY3A 3AV2D 1KX4A 4LD9D 1P34D 1N1JA 4H9SC 3X1VA 1EQZB 3AZKD 3A6NB 1KX5C 3AZMB 5AV5B 3WTPE 3AV1B 3AV2B 4LD9B 1P34B 1EQZA 1EQZC 5AVBD 3AZMA 3AZMC 3AZKB 5AV5C 1ID3A 3AV1C 5DNNA 4J8WD 3AV2C 4LD9C 4LD9A 4ZUXD 1P34C 1P34A 5AY8D 5AVBB 5CHLB 3AZLD 1F66D 1T3UA 3KSYA 4G91C 3MNNA 3H0LC 4H9PA 4J8WB 3X1SA 5JA4B 1BH8B 4ZUXB 4E44A 1M19D 5AY8B 2HUEB 3AZLB 2NQBA 1M18D 1F66B 4J8WA 4J8WC 2NZDD 5B1MA 4XUJA 4ZUXC 3MGQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 D;  1M19 B;  5BO0 A;  1F66 C;  3VH6 W;  3WTP D;  1BH9 A;  2NZD B;  5B2I D;  3AZN D;  1M19 C;  4H9N B;  3AZH D;  3MGQ B;  5B31 B;  1KX3 A;  1P3K D;  5AV8 D;  1M18 A;  1M18 C;  3WTP B;  5AV9 D;  2NZD C;  4HGA C;  5B40 A;  5B40 C;  3MVD D;  4J8U D;  5B2I B;  4XZQ A;  3MGQ C;  5B31 C;  4CSR B;  3AZN B;  3AZH B;  3WTP C;  1P3K B;  3AZE D;  5AV8 B;  5AV9 B;  3C1B A;  5B2I C;  3MVD B;  3AZN C;  3KXB A;  4J8U B;  5B33 D;  1P3K A;  1P3K C;  5AV8 A;  5AV8 C;  5GSU A;  5CPI D;  5AV9 C;  3AZE B;  5G49 A;  4QLC C;  4QLC A;  4KUD D;  4J8U C;  2F8N G;  5FUG B;  5B33 B;  4WZS B;  2FJ7 A;  1WWS A;  3AZE C;  3W96 A;  3W96 C;  5CPI B;  5CPJ D;  1P3L A;  3C1C B;  4KUD B;  5B32 A;  5B32 C;  5AV6 D;  5B33 C;  1P3A D;  5B0Y A;  3X1U A;  3X1U C;  5CPI C;  3KWQ D;  3UTA D;  4J8X D;  3REH D;  5CPJ B;  5BNX B;  1WWI A;  1S32 D;  4H9O A;  5AV6 B;  1P3A B;  3REI A;  4WU8 A;  2HIO D;  1TZY D;  2RVQ D;  5KDM A;  5CPJ C;  3KWQ B;  3UTA B;  2YFW A;  4J8X B;  5CP6 D;  5AV6 C;  4J8V D;  3REH B;  3TU4 D;  1P3A C;  1S32 B;  3LZ0 D;  5GT3 D;  2CV5 D;  1JFI A;  4EO5 B;  3LEL D;  1M1A B;  1U35 A;  1R4V A;  3UTA C;  2HIO B;  1TZY B;  4H9S A;  3WAA D;  4J8X C;  3REH A;  3REH C;  4Z2M G;  3VH5 T;  1S32 A;  1S32 C;  5B2J D;  5JRG D;  5CP6 B;  4J8V B;  1KX5 A;  3TU4 B;  3LJA D;  1TAF A;  3LZ0 B;  5GT3 B;  2CV5 B;  1H3O B;  2IO5 B;  1TZY A;  1TZY C;  2RVQ C;  3LEL B;  3NQU B;  3WAA B;  5CP6 A;  5CP6 C;  3A6N A;  3A6N C;  4J8V C;  5B2J B;  5GT3 A;  5AV5 A;  1H3O A;  4H9Q B;  3NQJ B;  5GT3 C;  5JRG B;  2IO5 C;  4KHA B;  3AV1 A;  3LEL A;  3LJA B;  3LEL C;  3WA9 B;  3KUY D;  3AV2 A;  3W99 B;  3WAA C;  3AZK A;  5JRG C;  3AZK C;  3NQJ A;  4M6B A;  4CAY B;  3MGP D;  3KUY B;  5AVB A;  5AVB C;  5BNV B;  2LY8 A;  3REK D;  3KUY C;  5JA4 A;  3MGP B;  1BH8 A;  4WNN B;  4ZUX A;  2YFV B;  3AYW D;  5AY8 A;  5AY8 C;  4Z66 D;  4H9R B;  2HUE C;  3AZL A;  3AZL C;  4WV4 B;  1F66 A;  3X1T D;  4NE5 A;  3W98 D;  3MGP A;  3MGP C;  3B0C T;  3REK B;  2YFV A;  5B24 D;  5F99 D;  1M19 A;  1P3B D;  3AYW B;  4Z66 B;  3AFA D;  4KGC D;  3X1T B;  2NZD A;  3W98 B;  1P3I D;  4H9N A;  5B24 B;  5F99 B;  3MGQ A;  3AYW C;  3B6G D;  3W97 D;  4Z66 A;  5B31 A;  4Z66 C;  1P3B B;  3WTP A;  3X1T C;  3X1T A;  3AFA B;  3R45 B;  3REL D;  3REJ B;  4KGC B;  5B24 A;  4Z5T D;  5DNM D;  5B24 C;  5B2I A;  5F99 C;  2JSS A;  4AWL B;  1P3I B;  4CSR A;  3AZN A;  3AZH A;  3AZH C;  1P3B C;  3B6G B;  3VH5 A;  3W97 B;  1P3M D;  3VH5 W;  1P3O D;  4KGC A;  4KGC C;  5B0Z D;  5AV9 A;  5B31 G;  3REL B;  4AWL C;  3C1C D;  1P3I C;  4DRB A;  3MVD A;  3MVD C;  4Z5T B;  5DNM B;  4J8U A;  3B6G A;  3B6G C;  4UUZ B;  1P3G D;  1P3M B;  1A7W A;  1P3O B;  3AZE A;  5B0Z B;  4Z5T C;  5DNM C;  3MGR D;  2ARO D;  3AZI D;  4UUZ A;  5E5A D;  5FUG A;  5B33 A;  1P3M A;  1P3M C;  5CPK D;  5CPI A;  1P3G B;  1ZLA D;  3C1C A;  3C1C C;  4KUD A;  2CWE A;  4KUD C;  3MGR B;  2BYM B;  3B0B A;  4JJN D;  3UTB D;  2ARO B;  3AZI B;  1P3F D;  5AVC D;  5E5A B;  4WU9 D;  3MGS D;  1M1A D;  5B32 G;  5CPK B;  1AOI D;  5CPJ A;  3MGR C;  1ZLA B;  5BNX A;  2L5A A;  2ARO C;  3LZ1 D;  1P3P D;  5AV6 A;  3VH6 T;  4JJN B;  1P3A A;  3UTB B;  1Q9C A;  1P3F B;  2F8N H;  4DRA A;  5AVC B;  2PYO D;  2BYK B;  5CPK C;  3B0D B;  3MGS B;  4WU9 B;  3KWQ A;  3KWQ C;  1KX4 D;  1ZLA C;  3UTA A;  1AOI B;  1KU5 A;  3X1V D;  4J8X A;  4JJN A;  4JJN C;  3UTB A;  4YS3 D;  3LZ1 B;  3UTB C;  1P3F A;  1P3F C;  1P3P B;  4NE3 A;  5AVC C;  2BYK A;  3B0D C;  3MGS C;  4WU9 C;  4EO5 C;  1M1A A;  1M1A C;  3WA9 D;  2PYO B;  2HIO A;  2HIO C;  3W99 D;  1KX4 B;  3LZ1 C;  3X1V B;  1P3P C;  4J8V A;  3TU4 A;  3TU4 C;  4YS3 B;  3LZ0 A;  3LZ0 C;  2CV5 A;  2CV5 C;  1BFM A;  1ID3 D;  5DNN D;  3NQU A;  3V9R B;  1KX4 C;  3WAA A;  3X1V C;  4NFT A;  4YS3 A;  4YS3 C;  5B2J A;  5B2J C;  5JRG A;  4H9Q A;  5BS7 A;  1ULY A;  5BS7 C;  4KHA A;  3LJA A;  3LJA C;  3WA9 A;  3V9R A;  3WA9 C;  2F8N K;  1HTA A;  3W99 C;  1ID3 B;  3MNN D;  3W99 A;  5DNN B;  3X1S D;  1B67 A;  3UT9 D;  4Z2M H;  1F1E A;  4CAY A;  1ID3 C;  2NQB D;  5DNN C;  3KUY A;  5B1M D;  4G91 B;  4XUJ D;  3MNN B;  4H9P B;  3X1S B;  3UT9 B;  5BNV A;  4WNN A;  2NQB B;  3MNN C;  5B1M B;  3X1S C;  4XUJ B;  3UT9 A;  4H9R A;  3UT9 C;  4G92 B;  1KX3 D;  5BO0 B;  2NQB C;  3REJ D;  3REK A;  3REK C;  1BH9 B;  5B1M C;  4XUJ C;  5B40 D;  4G92 C;  3AYW A;  4XZQ D;  1B6W A;  3VH6 A;  1KX3 B;  3W98 A;  3W98 C;  1M18 B;  2F8N D;  3C1B D;  5F99 A;  4HGA B;  3AN2 D;  5B40 B;  1P3B A;  3KXB D;  4XZQ B;  3AFA A;  3R45 A;  3AFA C;  1KX3 C;  3REJ A;  1HQ3 D;  3REJ C;  5GSU D;  4QLC D;  2F8N B;  1P3I A;  3C1B B;  3WKJ D;  4XZQ C;  5C3I B;  3W97 A;  3AN2 B;  5B1L D;  3W97 C;  3KXB B;  2FJ7 D;  3REL A;  3REL C;  2F8N A;  3W96 D;  1HQ3 B;  5GSU B;  3C1B C;  4Z5T A;  5DNM A;  1P3L D;  5G49 B;  5C3I C;  4QLC B;  3AN2 C;  5GXQ D;  3AN2 A;  5B32 D;  4E45 A;  3WKJ B;  3KXB C;  5B1L B;  5B0Y D;  1P3O A;  1P3O C;  1HQ3 A;  1HQ3 C;  3X1U D;  5GSU C;  5B0Z A;  5B0Z C;  2FJ7 B;  4ZBJ B;  3O62 D;  3W96 B;  3AZG D;  3WKJ A;  3WKJ C;  1P3L B;  4R8P D;  5B1L A;  5B1L C;  5GXQ B;  5B32 B;  1P3G A;  5GT0 D;  5B0Y B;  3REI D;  1P3G C;  2FJ7 C;  3AZF D;  4ZBJ C;  4WU8 D;  3X1U B;  3MGR A;  2BYM A;  3O62 B;  1P3L C;  2ARO A;  3AZI A;  5GXQ A;  5GXQ C;  4YM6 D;  4X23 D;  3AZI C;  3AZG B;  5E5A A;  5E5A C;  4R8P B;  5B0Y C;  4H9O B;  3B6F D;  3AZJ D;  5BT1 D;  5CPK A;  5GT0 B;  3REI B;  1U35 D;  3AZF B;  3O62 A;  4WU8 B;  3O62 C;  1ZLA A;  3AZG A;  3AZG C;  3B0C W;  5KDM B;  4R8P A;  4R8P C;  2YFW B;  4YM6 B;  4X23 B;  5AVC A;  1KX5 D;  3MGS A;  4WU9 A;  5GT0 A;  5GT0 C;  3REI C;  1JFI B;  3AZF A;  3AZF C;  4WU8 C;  3B6F B;  3AZJ B;  1AOI A;  1AOI C;  4NE6 A;  1U35 B;  3LZ1 A;  4X23 A;  4YM6 A;  1N1J B;  4YM6 C;  4X23 C;  1P3P A;  1EQZ D;  3A6N D;  3AZM D;  5AV5 D;  2PYO A;  2PYO C;  1KX5 B;  3B6F C;  3AZJ A;  3AZJ C;  5BT1 C;  3B6F A;  3AV1 D;  1TAF B;  1U35 C;  1KX4 A;  3AV2 D;  4LD9 D;  1P34 D;  1N1J A;  4H9S C;  3X1V A;  1EQZ B;  3AZK D;  3A6N B;  1KX5 C;  3AZM B;  5AV5 B;  3WTP E;  3AV1 B;  3AV2 B;  4LD9 B;  1P34 B;  1EQZ A;  1EQZ C;  5AVB D;  3AZM A;  3AZM C;  3AZK B;  5AV5 C;  1ID3 A;  3AV1 C;  5DNN A;  4J8W D;  3AV2 C;  4LD9 C;  4LD9 A;  4ZUX D;  1P34 C;  1P34 A;  5AY8 D;  5AVB B;  5CHL B;  3AZL D;  1F66 D;  3KSY A;  4G91 C;  3MNN A;  4H9P A;  4J8W B;  3X1S A;  5JA4 B;  1BH8 B;  4ZUX B;  4E44 A;  1M19 D;  5AY8 B;  2HUE B;  3AZL B;  2NQB A;  1M18 D;  1F66 B;  4J8W A;  4J8W C;  2NZD D;  5B1M A;  4XUJ A;  4ZUX C;  3MGQ D; 
#chains in the Genus database with same CATH topology
 5B31 D;  1M19 B;  5BO0 A;  1F66 C;  3VH6 W;  3WTP D;  1BH9 A;  2Y2I A;  2NZD B;  5B2I D;  3AZN D;  1M19 C;  4H9N B;  3AZH D;  2XD5 A;  3MGQ B;  5B31 B;  1KX3 A;  1P3K D;  5AV8 D;  1M18 A;  1M18 C;  3WTP B;  5AV9 D;  2NZD C;  4HGA C;  5B40 A;  5B40 C;  3MVD D;  3F6T A;  4J8U D;  5B2I B;  4XZQ A;  3MGQ C;  5B31 C;  4CSR B;  3AZN B;  3AZH B;  3WTP C;  1P3K B;  3AZE D;  5AV8 B;  5AV9 B;  3C1B A;  5B2I C;  3MVD B;  3AZN C;  3KXB A;  4J8U B;  5B33 D;  2G5I C;  1P3K A;  1P3K C;  5AV8 A;  5AV8 C;  5GSU A;  5CPI D;  5AV9 C;  3AZE B;  5G49 A;  4QLC C;  4QLC A;  4KUD D;  4J8U C;  2F8N G;  5FUG B;  5B33 B;  4WZS B;  2FJ7 A;  1WWS A;  2DF4 C;  3AZE C;  3W96 A;  3W96 C;  5CPI B;  5CPJ D;  1P3L A;  3C1C B;  4KUD B;  5B32 A;  5B32 C;  5AV6 D;  5B33 C;  1P3A D;  5B0Y A;  3X1U A;  3X1U C;  5CPI C;  3KWQ D;  3UTA D;  4J8X D;  3REH D;  5CPJ B;  5BNX B;  2ZM5 A;  3AL0 C;  1WWI A;  1S32 D;  4H9O A;  5AV6 B;  1P3A B;  3REI A;  2F2A C;  4WU8 A;  2HIO D;  1TZY D;  2RVQ D;  2Y2L A;  2UWX A;  5KDM A;  5CPJ C;  3KWQ B;  2Y2H A;  3UTA B;  2YFW A;  4J8X B;  5CP6 D;  5AV6 C;  4J8V D;  3REH B;  3TU4 D;  1W2E A;  1P3A C;  2Y2M A;  1S32 B;  3LZ0 D;  5GT3 D;  2CV5 D;  1JFI A;  4EO5 B;  3LEL D;  1M1A B;  1U35 A;  1R4V A;  2ZY5 A;  3UTA C;  2HIO B;  1TZY B;  2XD1 A;  4H9S A;  3WAA D;  4J8X C;  3REH A;  3REH C;  2ZY4 A;  4Z2M G;  3VH5 T;  1S32 A;  1S32 C;  5B2J D;  5JRG D;  5CP6 B;  4J8V B;  1KX5 A;  3TU4 B;  3LJA D;  1TAF A;  3LZ0 B;  5GT3 B;  2CV5 B;  1H3O B;  2IO5 B;  1TZY A;  1TZY C;  2RVQ C;  3LEL B;  2DQN C;  3NQU B;  3A1I A;  3WAA B;  5CP6 A;  5CP6 C;  3A6N A;  3A6N C;  4J8V C;  5B2J B;  5GT3 A;  5AV5 A;  1H3O A;  4H9Q B;  3NQJ B;  5GT3 C;  5JRG B;  2IO5 C;  4KHA B;  3AV1 A;  3LEL A;  3LJA B;  3LEL C;  3WA9 B;  3KUY D;  3AV2 A;  3W99 B;  3WAA C;  2Y2J A;  3AZK A;  5JRG C;  3AZK C;  3NQJ A;  4M6B A;  4CAY B;  3MGP D;  3KUY B;  2BG1 A;  5AVB A;  5AVB C;  5BNV B;  2Y2Q A;  2LY8 A;  3REK D;  3KUY C;  5JA4 A;  3MGP B;  1BH8 A;  4WNN B;  4ZUX A;  2YFV B;  3AYW D;  5AY8 A;  5AY8 C;  4Z66 D;  3A1K A;  4H9R B;  2HUE C;  3AZL A;  3AZL C;  4WV4 B;  1F66 A;  3X1T D;  4NE5 A;  3W98 D;  2ZY2 A;  3MGP C;  3MGP A;  3B0C T;  3REK B;  2YFV A;  5B24 D;  5F99 D;  1M19 A;  3H0M C;  3AYW B;  1P3B D;  4Z66 B;  3AFA D;  4KGC D;  3X1T B;  2NZD A;  3W98 B;  1P3I D;  4H9N A;  5B24 B;  5F99 B;  3MGQ A;  3AYW C;  3B6G D;  3W97 D;  4Z66 A;  5B31 A;  4Z66 C;  1P3B B;  3WTP A;  3X1T C;  3X1T A;  3AFA B;  3R45 B;  3REL D;  3REJ B;  4KGC B;  5B24 A;  4Z5T D;  5DNM D;  5B24 C;  5B2I A;  5F99 C;  2JSS A;  4AWL B;  1P3I B;  4CSR A;  3AZN A;  3AZH A;  3AZH C;  1P3B C;  3B6G B;  3VH5 A;  3W97 B;  3EPK A;  1P3M D;  3VH5 W;  1P3O D;  4KGC A;  4KGC C;  5B0Z D;  5AV9 A;  5B31 G;  3REL B;  4AWL C;  3C1C D;  1P3I C;  4DRB A;  3MVD A;  3MVD C;  4Z5T B;  5DNM B;  4J8U A;  3B6G A;  3B6G C;  4UUZ B;  1P3G D;  1P3M B;  1A7W A;  1P3O B;  3AZE A;  3EPJ A;  5B0Z B;  4Z5T C;  5DNM C;  3P5J B;  3MGR D;  4DQY B;  2ARO D;  3AZI D;  4UUZ A;  5E5A D;  5FUG A;  5B33 A;  1P3M A;  1P3M C;  5CPK D;  5CPI A;  1P3G B;  1ZLA D;  3C1C A;  3C1C C;  4KUD A;  2CWE A;  4KUD C;  3MGR B;  2BYM B;  3B0B A;  4JJN D;  3UTB D;  2ARO B;  3AZI B;  1P3F D;  5AVC D;  5E5A B;  4WU9 D;  2G5H C;  3MGS D;  1M1A D;  3EPH A;  5B32 G;  5CPK B;  1AOI D;  5CPJ A;  3MGR C;  1ZLA B;  5BNX A;  2L5A A;  2ARO C;  3LZ1 D;  1P3P D;  3EG5 B;  5AV6 A;  3VH6 T;  4JJN B;  1P3A A;  3UTB B;  1Q9C A;  1P3F B;  2F8N H;  4DRA A;  5AVC B;  2PYO D;  2BYK B;  5CPK C;  3B0D B;  3MGS B;  4WU9 B;  3KWQ A;  3KWQ C;  1KX4 D;  1ZLA C;  3UTA A;  1AOI B;  1KU5 A;  3X1V D;  4J8X A;  4JJN A;  4JJN C;  3UTB A;  4YS3 D;  3LZ1 B;  3UTB C;  1P3F A;  1P3F C;  1P3P B;  4NE3 A;  5AVC C;  2BYK A;  3B0D C;  3MGS C;  4WU9 C;  4EO5 C;  1M1A A;  1M1A C;  3KFU G;  3WA9 D;  2PYO B;  2HIO A;  2HIO C;  3W99 D;  1PZR A;  2Y2P A;  1KX4 B;  2W8S A;  3LZ1 C;  3X1V B;  1P3P C;  4J8V A;  3TU4 A;  3TU4 C;  4YS3 B;  3LZ0 A;  3LZ0 C;  2CV5 A;  2CV5 C;  1BFM A;  1ID3 D;  5DNN D;  3NQU A;  3V9R B;  1KX4 C;  3WAA A;  3X1V C;  4NFT A;  1Z2C B;  4YS3 A;  4YS3 C;  5B2J A;  5B2J C;  5JRG A;  4H9Q A;  5BS7 A;  1ULY A;  5BS7 C;  4KHA A;  3LJA A;  3LJA C;  3WA9 A;  3V9R A;  3WA9 C;  2F8N K;  1HTA A;  3W99 C;  1ID3 B;  3MNN D;  3W99 A;  5DNN B;  3X1S D;  1B67 A;  3UT9 D;  4Z2M H;  1F1E A;  4CAY A;  1ID3 C;  2NQB D;  5DNN C;  3KUY A;  5B1M D;  4G91 B;  4XUJ D;  3MNN B;  4H9P B;  3X1S B;  3UT9 B;  5BNV A;  4WNN A;  2NQB B;  3MNN C;  5B1M B;  3X1S C;  4XUJ B;  3UT9 A;  4H9R A;  3UT9 C;  4G92 B;  1KX3 D;  5BO0 B;  2NQB C;  3REJ D;  3REK A;  3REK C;  1BH9 B;  5B1M C;  4XUJ C;  5B40 D;  4G92 C;  3AYW A;  2J8P A;  4XZQ D;  2VQR A;  1B6W A;  3FDD A;  3VH6 A;  1KX3 B;  3W98 A;  3W98 C;  1M18 B;  2F8N D;  3C1B D;  5F99 A;  4HGA B;  3AN2 D;  5B40 B;  1P3B A;  3KXB D;  4XZQ B;  3AFA A;  3R45 A;  3AFA C;  1KX3 C;  3REJ A;  1HQ3 D;  3REJ C;  5GSU D;  2JE5 A;  4QLC D;  2F8N B;  1P3I A;  2RIQ A;  3C1B B;  3WKJ D;  4XZQ C;  5C3I B;  3W97 A;  3AN2 B;  5B1L D;  3W97 C;  3KXB B;  2FJ7 D;  3REL A;  3REL C;  2F8N A;  3W96 D;  1HQ3 B;  5GSU B;  3C1B C;  4Z5T A;  5DNM A;  1P3L D;  5G49 B;  2Y2K A;  5C3I C;  4QLC B;  4UPK A;  5GXQ D;  3AN2 C;  3AN2 A;  5B32 D;  4E45 A;  3WKJ B;  3KXB C;  5B1L B;  5B0Y D;  1P3O A;  1P3O C;  1HQ3 A;  1HQ3 C;  3X1U D;  5GSU C;  5B0Z A;  5B0Z C;  2FJ7 B;  4ZBJ B;  3O62 D;  3W96 B;  3AZG D;  3WKJ A;  3WKJ C;  1P3L B;  4R8P D;  5B1L A;  5B1L C;  5GXQ B;  2Y2G A;  5B32 B;  3H0R C;  1P3G A;  5GT0 D;  5B0Y B;  3REI D;  2Y2N A;  1P3G C;  3AZF D;  2FJ7 C;  4ZBJ C;  3EPL A;  4WU8 D;  3X1U B;  3MGR A;  2BYM A;  3O62 B;  1P3L C;  2ARO A;  3AZI A;  5GXQ A;  5GXQ C;  4YM6 D;  4X23 D;  3AZI C;  3AZG B;  2Y2O A;  5E5A A;  5E5A C;  4R8P B;  5B0Y C;  4H9O B;  3B6F D;  3AZJ D;  3IP4 C;  5BT1 D;  2JCH A;  5CPK A;  5GT0 B;  3REI B;  1U35 D;  3AZF B;  3O62 A;  4WU8 B;  3O62 C;  1ZLA A;  3AZG A;  3AZG C;  3B0C W;  5KDM B;  4R8P A;  4R8P C;  2YFW B;  4YM6 B;  4X23 B;  5AVC A;  1KX5 D;  3MGS A;  4WU9 A;  5GT0 A;  5GT0 C;  3REI C;  1JFI B;  3AZF A;  3AZF C;  4WU8 C;  3B6F B;  4WJ3 C;  3AZJ B;  1AOI A;  1AOI C;  4NE6 A;  1U35 B;  2FFF B;  3LZ1 A;  4X23 A;  4YM6 A;  1N1J B;  4YM6 C;  4X23 C;  1P3P A;  1EQZ D;  3A6N D;  3AZM D;  5AV5 D;  2PYO A;  2PYO C;  1KX5 B;  3B6F C;  3AZJ A;  3AZJ C;  5BT1 C;  3B6F A;  3AV1 D;  1TAF B;  1U35 C;  2ZY3 A;  3AV2 D;  1KX4 A;  4LD9 D;  1P34 D;  1N1J A;  4H9S C;  3X1V A;  1EQZ B;  3AZK D;  3A6N B;  1KX5 C;  3AZM B;  5AV5 B;  3WTP E;  3AV1 B;  3AV2 B;  4LD9 B;  1P34 B;  1EQZ A;  1EQZ C;  5AVB D;  3AZM A;  3AZM C;  3AZK B;  5AV5 C;  1ID3 A;  3AV1 C;  5DNN A;  4J8W D;  3AV2 C;  4LD9 C;  4LD9 A;  4ZUX D;  1P34 C;  1P34 A;  5AY8 D;  5AVB B;  5CHL B;  3AZL D;  1F66 D;  1T3U A;  3KSY A;  4G91 C;  3MNN A;  3H0L C;  4H9P A;  4J8W B;  3X1S A;  5JA4 B;  1BH8 B;  4ZUX B;  4E44 A;  1M19 D;  5AY8 B;  2HUE B;  3AZL B;  2NQB A;  1M18 D;  1F66 B;  4J8W A;  4J8W C;  2NZD D;  5B1M A;  4XUJ A;  4ZUX C;  3MGQ D; 
#chains in the Genus database with same CATH homology
 5B31 D;  1M19 B;  5BO0 A;  1F66 C;  3VH6 W;  3WTP D;  1BH9 A;  2Y2I A;  2NZD B;  5B2I D;  3AZN D;  1M19 C;  4H9N B;  3AZH D;  2XD5 A;  3MGQ B;  5B31 B;  1KX3 A;  1P3K D;  5AV8 D;  1M18 A;  1M18 C;  3WTP B;  5AV9 D;  2NZD C;  4HGA C;  5B40 A;  5B40 C;  3MVD D;  3F6T A;  4J8U D;  5B2I B;  4XZQ A;  3MGQ C;  5B31 C;  4CSR B;  3AZN B;  3AZH B;  3WTP C;  1P3K B;  3AZE D;  5AV8 B;  5AV9 B;  3C1B A;  5B2I C;  3MVD B;  3AZN C;  3KXB A;  4J8U B;  5B33 D;  2G5I C;  1P3K A;  1P3K C;  5AV8 A;  5AV8 C;  5GSU A;  5CPI D;  5AV9 C;  3AZE B;  5G49 A;  4QLC C;  4QLC A;  4KUD D;  4J8U C;  2F8N G;  5FUG B;  5B33 B;  4WZS B;  2FJ7 A;  1WWS A;  2DF4 C;  3AZE C;  3W96 A;  3W96 C;  5CPI B;  5CPJ D;  1P3L A;  3C1C B;  4KUD B;  5B32 A;  5B32 C;  5AV6 D;  5B33 C;  1P3A D;  5B0Y A;  3X1U A;  3X1U C;  5CPI C;  3KWQ D;  3UTA D;  4J8X D;  3REH D;  5CPJ B;  5BNX B;  2ZM5 A;  3AL0 C;  1WWI A;  1S32 D;  4H9O A;  5AV6 B;  1P3A B;  3REI A;  2F2A C;  4WU8 A;  2HIO D;  1TZY D;  2RVQ D;  2Y2L A;  2UWX A;  5KDM A;  5CPJ C;  3KWQ B;  2Y2H A;  3UTA B;  2YFW A;  4J8X B;  5CP6 D;  5AV6 C;  4J8V D;  3REH B;  3TU4 D;  1W2E A;  1P3A C;  2Y2M A;  1S32 B;  3LZ0 D;  5GT3 D;  2CV5 D;  1JFI A;  4EO5 B;  3LEL D;  1M1A B;  1U35 A;  1R4V A;  2ZY5 A;  3UTA C;  2HIO B;  1TZY B;  2XD1 A;  4H9S A;  3WAA D;  4J8X C;  3REH A;  3REH C;  2ZY4 A;  4Z2M G;  3VH5 T;  1S32 A;  1S32 C;  5B2J D;  5JRG D;  5CP6 B;  4J8V B;  1KX5 A;  3TU4 B;  3LJA D;  1TAF A;  3LZ0 B;  5GT3 B;  2CV5 B;  1H3O B;  2IO5 B;  1TZY A;  1TZY C;  2RVQ C;  3LEL B;  2DQN C;  3NQU B;  3A1I A;  3WAA B;  5CP6 A;  5CP6 C;  3A6N A;  3A6N C;  4J8V C;  5B2J B;  5GT3 A;  5AV5 A;  1H3O A;  4H9Q B;  3NQJ B;  5GT3 C;  5JRG B;  2IO5 C;  4KHA B;  3AV1 A;  3LEL A;  3LJA B;  3LEL C;  3WA9 B;  3KUY D;  3AV2 A;  3W99 B;  3WAA C;  2Y2J A;  3AZK A;  5JRG C;  3AZK C;  3NQJ A;  4M6B A;  4CAY B;  3MGP D;  3KUY B;  2BG1 A;  5AVB A;  5AVB C;  5BNV B;  2Y2Q A;  2LY8 A;  3REK D;  3KUY C;  5JA4 A;  3MGP B;  1BH8 A;  4WNN B;  4ZUX A;  2YFV B;  3AYW D;  5AY8 A;  5AY8 C;  4Z66 D;  3A1K A;  4H9R B;  2HUE C;  3AZL A;  3AZL C;  4WV4 B;  1F66 A;  3X1T D;  4NE5 A;  3W98 D;  2ZY2 A;  3MGP C;  3MGP A;  3B0C T;  3REK B;  2YFV A;  5B24 D;  5F99 D;  1M19 A;  3H0M C;  3AYW B;  1P3B D;  4Z66 B;  3AFA D;  4KGC D;  3X1T B;  2NZD A;  3W98 B;  1P3I D;  4H9N A;  5B24 B;  5F99 B;  3MGQ A;  3AYW C;  3B6G D;  3W97 D;  4Z66 A;  5B31 A;  4Z66 C;  1P3B B;  3WTP A;  3X1T C;  3X1T A;  3AFA B;  3R45 B;  3REL D;  3REJ B;  4KGC B;  5B24 A;  4Z5T D;  5DNM D;  5B24 C;  5B2I A;  5F99 C;  2JSS A;  4AWL B;  1P3I B;  4CSR A;  3AZN A;  3AZH A;  3AZH C;  1P3B C;  3B6G B;  3VH5 A;  3W97 B;  3EPK A;  1P3M D;  3VH5 W;  1P3O D;  4KGC A;  4KGC C;  5B0Z D;  5AV9 A;  5B31 G;  3REL B;  4AWL C;  3C1C D;  1P3I C;  4DRB A;  3MVD A;  3MVD C;  4Z5T B;  5DNM B;  4J8U A;  3B6G A;  3B6G C;  4UUZ B;  1P3G D;  1P3M B;  1A7W A;  1P3O B;  3AZE A;  3EPJ A;  5B0Z B;  4Z5T C;  5DNM C;  3P5J B;  3MGR D;  4DQY B;  2ARO D;  3AZI D;  4UUZ A;  5E5A D;  5FUG A;  5B33 A;  1P3M A;  1P3M C;  5CPK D;  5CPI A;  1P3G B;  1ZLA D;  3C1C A;  3C1C C;  4KUD A;  2CWE A;  4KUD C;  3MGR B;  2BYM B;  3B0B A;  4JJN D;  3UTB D;  2ARO B;  3AZI B;  1P3F D;  5AVC D;  5E5A B;  4WU9 D;  2G5H C;  3MGS D;  1M1A D;  3EPH A;  5B32 G;  5CPK B;  1AOI D;  5CPJ A;  3MGR C;  1ZLA B;  5BNX A;  2L5A A;  2ARO C;  3LZ1 D;  1P3P D;  3EG5 B;  5AV6 A;  3VH6 T;  4JJN B;  1P3A A;  3UTB B;  1Q9C A;  1P3F B;  2F8N H;  4DRA A;  5AVC B;  2PYO D;  2BYK B;  5CPK C;  3B0D B;  3MGS B;  4WU9 B;  3KWQ A;  3KWQ C;  1KX4 D;  1ZLA C;  3UTA A;  1AOI B;  1KU5 A;  3X1V D;  4J8X A;  4JJN A;  4JJN C;  3UTB A;  4YS3 D;  3LZ1 B;  3UTB C;  1P3F A;  1P3F C;  1P3P B;  4NE3 A;  5AVC C;  2BYK A;  3B0D C;  3MGS C;  4WU9 C;  4EO5 C;  1M1A A;  1M1A C;  3KFU G;  3WA9 D;  2PYO B;  2HIO A;  2HIO C;  3W99 D;  1PZR A;  2Y2P A;  1KX4 B;  2W8S A;  3LZ1 C;  3X1V B;  1P3P C;  4J8V A;  3TU4 A;  3TU4 C;  4YS3 B;  3LZ0 A;  3LZ0 C;  2CV5 A;  2CV5 C;  1BFM A;  1ID3 D;  5DNN D;  3NQU A;  3V9R B;  1KX4 C;  3WAA A;  3X1V C;  4NFT A;  1Z2C B;  4YS3 A;  4YS3 C;  5B2J A;  5B2J C;  5JRG A;  4H9Q A;  5BS7 A;  1ULY A;  5BS7 C;  4KHA A;  3LJA A;  3LJA C;  3WA9 A;  3V9R A;  3WA9 C;  2F8N K;  1HTA A;  3W99 C;  1ID3 B;  3MNN D;  3W99 A;  5DNN B;  3X1S D;  1B67 A;  3UT9 D;  4Z2M H;  1F1E A;  4CAY A;  1ID3 C;  2NQB D;  5DNN C;  3KUY A;  5B1M D;  4G91 B;  4XUJ D;  3MNN B;  4H9P B;  3X1S B;  3UT9 B;  5BNV A;  4WNN A;  2NQB B;  3MNN C;  5B1M B;  3X1S C;  4XUJ B;  3UT9 A;  4H9R A;  3UT9 C;  4G92 B;  1KX3 D;  5BO0 B;  2NQB C;  3REJ D;  3REK A;  3REK C;  1BH9 B;  5B1M C;  4XUJ C;  5B40 D;  4G92 C;  3AYW A;  2J8P A;  4XZQ D;  2VQR A;  1B6W A;  3FDD A;  3VH6 A;  1KX3 B;  3W98 A;  3W98 C;  1M18 B;  2F8N D;  3C1B D;  5F99 A;  4HGA B;  3AN2 D;  5B40 B;  1P3B A;  3KXB D;  4XZQ B;  3AFA A;  3R45 A;  3AFA C;  1KX3 C;  3REJ A;  1HQ3 D;  3REJ C;  5GSU D;  2JE5 A;  4QLC D;  2F8N B;  1P3I A;  2RIQ A;  3C1B B;  3WKJ D;  4XZQ C;  5C3I B;  3W97 A;  3AN2 B;  5B1L D;  3W97 C;  3KXB B;  2FJ7 D;  3REL A;  3REL C;  2F8N A;  3W96 D;  1HQ3 B;  5GSU B;  3C1B C;  4Z5T A;  5DNM A;  1P3L D;  5G49 B;  2Y2K A;  5C3I C;  4QLC B;  4UPK A;  5GXQ D;  3AN2 C;  3AN2 A;  5B32 D;  4E45 A;  3WKJ B;  3KXB C;  5B1L B;  5B0Y D;  1P3O A;  1P3O C;  1HQ3 A;  1HQ3 C;  3X1U D;  5GSU C;  5B0Z A;  5B0Z C;  2FJ7 B;  4ZBJ B;  3O62 D;  3W96 B;  3AZG D;  3WKJ A;  3WKJ C;  1P3L B;  4R8P D;  5B1L A;  5B1L C;  5GXQ B;  2Y2G A;  5B32 B;  3H0R C;  1P3G A;  5GT0 D;  5B0Y B;  3REI D;  2Y2N A;  1P3G C;  3AZF D;  2FJ7 C;  4ZBJ C;  3EPL A;  4WU8 D;  3X1U B;  3MGR A;  2BYM A;  3O62 B;  1P3L C;  2ARO A;  3AZI A;  5GXQ A;  5GXQ C;  4YM6 D;  4X23 D;  3AZI C;  3AZG B;  2Y2O A;  5E5A A;  5E5A C;  4R8P B;  5B0Y C;  4H9O B;  3B6F D;  3AZJ D;  3IP4 C;  5BT1 D;  2JCH A;  5CPK A;  5GT0 B;  3REI B;  1U35 D;  3AZF B;  3O62 A;  4WU8 B;  3O62 C;  1ZLA A;  3AZG A;  3AZG C;  3B0C W;  5KDM B;  4R8P A;  4R8P C;  2YFW B;  4YM6 B;  4X23 B;  5AVC A;  1KX5 D;  3MGS A;  4WU9 A;  5GT0 A;  5GT0 C;  3REI C;  1JFI B;  3AZF A;  3AZF C;  4WU8 C;  3B6F B;  4WJ3 C;  3AZJ B;  1AOI A;  1AOI C;  4NE6 A;  1U35 B;  2FFF B;  3LZ1 A;  4X23 A;  4YM6 A;  1N1J B;  4YM6 C;  4X23 C;  1P3P A;  1EQZ D;  3A6N D;  3AZM D;  5AV5 D;  2PYO A;  2PYO C;  1KX5 B;  3B6F C;  3AZJ A;  3AZJ C;  5BT1 C;  3B6F A;  3AV1 D;  1TAF B;  1U35 C;  2ZY3 A;  3AV2 D;  1KX4 A;  4LD9 D;  1P34 D;  1N1J A;  4H9S C;  3X1V A;  1EQZ B;  3AZK D;  3A6N B;  1KX5 C;  3AZM B;  5AV5 B;  3WTP E;  3AV1 B;  3AV2 B;  4LD9 B;  1P34 B;  1EQZ A;  1EQZ C;  5AVB D;  3AZM A;  3AZM C;  3AZK B;  5AV5 C;  1ID3 A;  3AV1 C;  5DNN A;  4J8W D;  3AV2 C;  4LD9 C;  4LD9 A;  4ZUX D;  1P34 C;  1P34 A;  5AY8 D;  5AVB B;  5CHL B;  3AZL D;  1F66 D;  1T3U A;  3KSY A;  4G91 C;  3MNN A;  3H0L C;  4H9P A;  4J8W B;  3X1S A;  5JA4 B;  1BH8 B;  4ZUX B;  4E44 A;  1M19 D;  5AY8 B;  2HUE B;  3AZL B;  2NQB A;  1M18 D;  1F66 B;  4J8W A;  4J8W C;  2NZD D;  5B1M A;  4XUJ A;  4ZUX C;  3MGQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...