2NQBB

Drosophila nucleosome structure
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
81
structure length
81
Chain Sequence
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA
publication title Comparative analysis of nucleosome structures from different species.
rcsb
source organism Homo sapiens
total genus 28
structure length 81
sequence length 81
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nqbB00
3MGQD 1HTAA 2BYMB 4YM6D 4HGAB 1M18C 5AV5B 3X1UB 2HIOC 5DNMC 3KUYB 3AZHC 3AZMA 2NQBD 3MGSD 4ZUXC 3AYWB 4EO5C 5F99A 4J8UC 5CPIB 3MVDD 1P3ID 3WKJD 4H9RA 2NZDA 3NQJB 5BS7A 5B32A 3AV2C 2F8NK 3AFAD 5B2IC 3C1CA 5E5AD 3C1BA 4XUJC 1P34C 3LELA 4JJNC 3X1SC 3UTBD 3WKJB 1F66B 5GT0D 1BH8A 3RELC 2FJ7D 1P3PB 3B6GA 5BT1D 4CSRA 1M1AA 3LZ0D 4NE5A 3LJAA 3REKD 1M19B 5GXQA 3AZJB 1BH8B 1P3BB 3X1TD 3KWQA 4CSRB 3REKB 1M1AB 4J8VA 3REJA 3LJAB 3UT9C 5B24C 2CV5A 4X23A 1ID3D 5GXQB 4H9PA 4WZSB 1P3KB 3MGRD 1U35D 1P3AA 1AOIC 3W98B 1B6WA 4KGCD 5AV9A 1TZYD 1ZLAD 4J8VB 3REJB 4XZQB 2CV5B 3WTPC 4G91C 3TU4C 4X23B 4H9PB 5AV8B 5B0ZB 3O62A 5B40C 4R8PD 5AV6A 3W97C 1ZLAB 4WU8D 3LZ1A 3MNNB 1S32C 3VH5W 1R4VA 3AN2B 1KX3B 1P3LD 3W99C 3UTAB 5B33B 5CPKA 5B0YB 1KX4D 4E44A 3AZEB 1M18A 3A6ND 2NZDC 2HIOA 3V9RB 5DNMA 3AZHA 3B0DC 3AV1D 4ZUXA 3LELC 5GT3C 5CPKB 3AV2A 3MGQC 3AZFB 5B2IA 4YM6C 1EQZD 4XUJA 3B6GC 3NQUA 1P34A 2HIOB 4JJNA 3X1SA 3AZID 3MGSC 3W96D 4WU9D 2HUEC 4KHAB 4EO5B 3RELA 4J8UB 3AZKD 3AV2B 4J8WB 1EQZB 4KUDD 4XUJB 2IO5B 3WA9D 2RVQD 3W96B 3KWQC 2PYOB 5GSUB 3AZND 4UUZB 3AZLD 4LD9D 5B2JC 5B1LD 1BH9A 5BNVA 5AVBC 2FJ7C 1A7WA 4ZBJC 3REID 4J8XD 3REHD 3MGPD 3LZ0C 1P3GC 3UT9A 3WAAB 3AZLB 4LD9B 1HQ3D 2NQBB 4Z66D 3X1VC 1P3MD 4NE3A 2YFWB 2YFVB 4H9NB 3KXBD 4J8XB 3REHB 5AVCB 1AOIA 3X1TC 5JRGC 3O62C 5KDMB 5AV6C 3R45A 5B24B 5CP6B 3WTPA 3TU4A 3AZGC 1P3MB 1P3OC 5AV5D 4M6BA 3X1UD 5BO0A 3W97A 1JFIA 1U35C 5B31G 1AOIB 1S32A 1TZYC 3AYWD 5DNNB 4AWLC 1P3FB 5CPID 3R45B 3W99A 4YS3C 5FUGB 2LY8A 3WTPB 5B1MA 5B40B 5B31B 4R8PC 3W97B 3AZMD 5C3IB 1S32B 1F66D 1TAFA 5AY8A 1P3PD 1H3OA 5B32G 5GT3A 3AZMB 1KX4C 3MGQA 1M19D 4YM6A 3AZJD 4CAYA 5F99B 5G49A 3A6NC 2NZDB 4H9RB 5B32B 1P3BD 3MGSA 5BNXA 3C1CB 1M1AD 3C1BB 3LJAD 3MVDA 5GT3B 3LELB 5CPJC 5GXQD 3VH6T 1KX5C 3B6GB 1P3KD 4Z2MG 2F8NA 3W98D 5B2JA 3UTBA 2F8NG 2HUEB 5AVBA 4J8VD 3REJD 2FJ7A 4XZQD 2CV5D 3LZ0A 4X23D 4H9OA 5AV8D 5B0ZD 1P3GA 3WA9C 3KWQB 2F8NB 3MNND 3X1VA 3AN2D 1KX3D 4ZBJB 3X1TA 3REIC 4QLCC 5B33D 5JRGA 3UTAD 4H9OB 5B0YD 1P3AB 4Z5TC 3AZGA 1HQ3C 5AV9B 3AZED 1P3OA 2AROC 3KXBC 1U35A 4KGCA 1TZYA 3O62B 5B1MC 4H9QA 5AV6B 5CPKD 3AZFD 3LZ1B 4YS3A 3AZGB 5AY8C 4HGAC 1P3OB 5AV5C 4R8PA 3B6FC 2HIOD 3X1UC 3KUYC 3AYWC 3VH5A 4J8UD 5CPIC 3AV2D 4J8WD 1M18B 4YS3B 5DNMB 3AZHB 1KX4A 4XUJD 2NQBC 2PYOD 5GSUD 4ZUXB 3A6NA 3MVDC 1P3IC 1F66C 3WKJC 1P3PC 3AV1A 3AFAC 5B2IB 5E5AC 3NQUB 1P34B 4JJNB 3WAAD 5CPJA 3X1SB 3UTBC 1M19C 3VH6W 5GT0C 3RELB 3AZJC 1KX5A 5BT1C 5AVCD 3REKC 1Q9CA 5B24D 5CPJB 5CP6D 1BH9B 5BNVB 1B67A 4KUDA 3WA9A 1P3KC 3AZNA 1AOID 3W98C 5DNND 3UT9B 1P3FD 4WV4B 3REIA 1ID3C 4QLCA 4WNNA 3WTPD 3MGPA 3MGRC 5B40D 5AV8C 5B31D 5B0ZC 4KGCC 4Z5TA 3W97D 1HQ3A 2AROA 1ZLAC 1S32D 4Z66A 3MNNC 3KXBA 1KX3C 3TU4B 4G91B 1KU5A 5B33C 5BO0B 1JFIB 5B0YC 3WTPE 2BYMA 4WU8C 4Z5TB 2AROB 5F99D 5AV5A 4G92C 3B6FA 2NZDD 3X1UA 1P3LC 5B32D 3KUYA 3W99B 3C1CD 3AYWA 5B1MB 3C1BD 5CPIA 1ULYA 5GT3D 3LELD 3NQJA 3AZFC 1TAFB 5AY8B 4NFTA 3B6GD 3B0DB 2JSSA 3AV1C 2NQBA 1H3OB 3B6FB 5JA4A 3WKJA 1F66A 1P3IA 2BYKA 3MGQB 1P3PA 3AFAA 4YM6B 4NE6A 4J8WC 5E5AA 4CAYB 1EQZC 5G49B 1N1JA 1BFMA 4DRAA 3AZIC 2IO5C 1M19A 3MGSB 5BNXB 3W96C 3KWQD 2PYOC 5GSUC 2F8ND 5GT0A 5JA4B 5B2JD 3AZJA 3B0CT 4WU9C 3MVDB 3AZKC 1P3IB 5AVBD 2BYKB 1P3BA 3AFAB 5E5AB 3REKA 4KUDC 2RVQC 1P3GD 1N1JB 3WAAC 3AZLC 5B2JB 3AZNC 3UTBB 1P3AD 5B1LC 4LD9C 5AV9D 5GT0B 5AVBB 3X1VD 2FJ7B 4Z2MH 1P3KA 4J8XC 3REHC 5AVCC 3W98A 3LZ0B 3MGPC 5JRGD 1P3GB 2F8NH 3O62D 5AV6D 1ID3A 4XZQA 5CP6C 3LZ1D 4Z66C 3AZGD 3X1VB 1P3MC 3MGRA 1P3OD 5AV8A 5B0ZA 3X1TB 5JRGB 1ZLAA 3KSYA 3MNNA 5DNNC 3AN2A 1P3FC 1KX3A 1M18D 1ID3B 3UTAA 5B33A 4YS3D 4H9SA 5DNMD 3MGRB 3AZHD 5B0YA 1U35B 5B31C 4WU8A 4KGCB 4ZUXD 1TZYB 3AZEA 4AWLB 5C3IC 4H9QB 1P3LA 3V9RA 5B2ID 4R8PB 1P34D 4JJND 3X1SD 3AZMC 3AZFA 4WU8B 3B0BA 3RELD 5F99C 4G92B 1P3LB 5BS7C 4E45A 5B32C 3C1CC 4KHAA 1KX4B 3C1BC 4J8UA 5CPJD 4J8WA 1EQZA 3A6NB 1F1EA 1KX5D 3AZIA 1P3BC 3AV1B 3W96A 2PYOA 5GSUA 4UUZA 4WU9A 1M1AC 3B0CW 2CWEA 3LJAC 3AZKA 3UT9D 5GXQC 1KX5B 3WAAA 3AZLA 3AZIB 4LD9A 5B1LA 3VH6A 4WU9B 4J8VC 3REJC 3AZKB 2YFWA 2YFVA 4H9NA 4J8XA 3REHA 5AVCA 4XZQC 2CV5C 3TU4D 4X23C 4QLCD 1WWIA 4KUDB 5KDMA 3WA9B 5B24A 3AZNB 5CP6A 1P3AC 4Z5TD 5B1LB 1P3MA 5AV9C 2AROD 3AN2C 3REIB 3W99D 4QLCB 3UTAC 4WNNB 3MGPB 4H9SC 4DRBA 5B1MD 5DNNA 1P3FA 1HQ3B 5CHLB 3AZEC 3LZ1C 2L5AA 4Z66B 5FUGA 5AY8D 3KXBB 3VH5T 5B40A 5B31A 3B6FD 3KUYD 1WWSA 5CPKC
chains in the Genus database with same CATH superfamily
3MGQD 1HTAA 2BYMB 3A1KA 4YM6D 4HGAB 1M18C 5AV5B 3X1UB 2HIOC 2Y2NA 5DNMC 3KUYB 3AZHC 3AZMA 2NQBD 3MGSD 4ZUXC 3AYWB 4EO5C 5F99A 4J8UC 5CPIB 3MVDD 1P3ID 3WKJD 4H9RA 2Y2JA 3NQJB 5BS7A 5B32A 3AV2C 2F8NK 2NZDA 3AFAD 5B2IC 3C1CA 5E5AD 3C1BA 4XUJC 1P34C 3LELA 4JJNC 3X1SC 3UTBD 3WKJB 1F66B 2Y2HA 5GT0D 1BH8A 3RELC 2FJ7D 1P3PB 3B6GA 2J8PA 5BT1D 4CSRA 1M1AA 3LZ0D 4NE5A 3LJAA 3REKD 2ZM5A 1M19B 2G5HC 5GXQA 3AZJB 2XD5A 1BH8B 1P3BB 3X1TD 3KWQA 4CSRB 3REKB 1M1AB 4J8VA 3REJA 3LJAB 3UT9C 3FDDA 5B24C 2CV5A 4X23A 1ID3D 5GXQB 4H9PA 4WZSB 1P3KB 3MGRD 1U35D 1P3AA 1AOIC 3W98B 1B6WA 4KGCD 5AV9A 1TZYD 1ZLAD 4J8VB 3REJB 4XZQB 2CV5B 3WTPC 4G91C 3TU4C 4X23B 4H9PB 5AV8B 5B0ZB 3O62A 5B40C 4R8PD 5AV6A 3W97C 1ZLAB 4WU8D 3LZ1A 3MNNB 1S32C 2UWXA 3VH5W 1R4VA 3AN2B 1KX3B 1P3LD 3W99C 3UTAB 5B33B 3A1IA 5CPKA 5B0YB 1KX4D 4E44A 3AZEB 1M18A 3A6ND 2NZDC 2HIOA 3V9RB 5DNMA 3AZHA 3B0DC 3AV1D 2Y2PA 4ZUXA 3LELC 5GT3C 5CPKB 3AV2A 3MGQC 3AZFB 5B2IA 4YM6C 1EQZD 4XUJA 3B6GC 3NQUA 1P34A 2HIOB 4JJNA 3X1SA 2Y2GA 3AZID 3EPHA 3H0MC 3MGSC 3W96D 4WU9D 2HUEC 4KHAB 4EO5B 3RELA 4J8UB 3AZKD 2Y2KA 4J8WB 3AV2B 1EQZB 4KUDD 4XUJB 2IO5B 3WA9D 2RVQD 3W96B 3KWQC 2PYOB 5GSUB 3AZND 4UUZB 3AZLD 4LD9D 5B2JC 5B1LD 1BH9A 5BNVA 5AVBC 2FJ7C 1A7WA 4ZBJC 3REID 4J8XD 3REHD 3MGPD 3LZ0C 1P3GC 3UT9A 3WAAB 3AZLB 4LD9B 1HQ3D 2NQBB 4Z66D 3X1VC 1P3MD 4NE3A 2YFWB 2YFVB 4H9NB 3KXBD 4J8XB 3REHB 5AVCB 1AOIA 3X1TC 5JRGC 3O62C 2ZY3A 5KDMB 5AV6C 3R45A 2W8SA 5CP6B 5B24B 2DQNC 3WTPA 3TU4A 3AZGC 1P3MB 1P3OC 5AV5D 4M6BA 3X1UD 5BO0A 3W97A 1JFIA 1U35C 5B31G 1AOIB 1S32A 2VQRA 1TZYC 3AYWD 5DNNB 4AWLC 1P3FB 5CPID 3R45B 3W99A 4YS3C 5FUGB 2LY8A 3WTPB 5B1MA 5B40B 5B31B 4R8PC 3W97B 3AZMD 5C3IB 1S32B 1F66D 1TAFA 5AY8A 3F6TA 3KFUG 1P3PD 1H3OA 5B32G 5GT3A 3AZMB 1KX4C 3MGQA 1M19D 4YM6A 3AZJD 4CAYA 5F99B 5G49A 3A6NC 2NZDB 4H9RB 5B32B 1P3BD 3MGSA 5BNXA 3C1CB 1M1AD 3C1BB 3LJAD 3MVDA 5GT3B 3LELB 5CPJC 5GXQD 3VH6T 1KX5C 3B6GB 1P3KD 4Z2MG 3AL0C 2F8NA 3W98D 5B2JA 3UTBA 2F8NG 2HUEB 5AVBA 4J8VD 3REJD 2FJ7A 4XZQD 2CV5D 3LZ0A 4X23D 4H9OA 5AV8D 2ZY4A 5B0ZD 1P3GA 3WA9C 3KWQB 2F8NB 3MNND 3X1VA 3H0LC 3AN2D 1KX3D 4ZBJB 3X1TA 3REIC 3IP4C 4QLCC 5B33D 5JRGA 3UTAD 2Y2LA 2RIQA 4H9OB 5B0YD 1P3AB 4Z5TC 3AZGA 1HQ3C 5AV9B 3H0RC 3AZED 1P3OA 2AROC 3KXBC 1U35A 4KGCA 1PZRA 1TZYA 3O62B 5B1MC 4H9QA 5AV6B 5CPKD 3AZFD 3LZ1B 4YS3A 3AZGB 5AY8C 4HGAC 1P3OB 5AV5C 4R8PA 3B6FC 2HIOD 3X1UC 2Y2MA 3KUYC 2G5IC 3AYWC 3VH5A 4J8UD 5CPIC 3AV2D 4J8WD 1M18B 4YS3B 5DNMB 3AZHB 1KX4A 4XUJD 2NQBC 2PYOD 5GSUD 4ZUXB 3A6NA 3MVDC 1P3IC 1F66C 3WKJC 1P3PC 3AV1A 3AFAC 5B2IB 5E5AC 3NQUB 1P34B 4JJNB 3WAAD 5CPJA 3X1SB 3UTBC 1M19C 3VH6W 5GT0C 3RELB 3AZJC 1KX5A 2ZY2A 5BT1C 5AVCD 3EPKA 3REKC 1Q9CA 5B24D 5CPJB 5CP6D 1BH9B 5BNVB 1B67A 4KUDA 3WA9A 1P3KC 3AZNA 1AOID 3W98C 5DNND 3UT9B 1P3FD 4WV4B 3REIA 1ID3C 4QLCA 4WNNA 3WTPD 3MGPA 3EPJA 3MGRC 5B40D 5AV8C 5B31D 5B0ZC 4KGCC 2Y2IA 4Z5TA 1HQ3A 3W97D 2AROA 1ZLAC 1S32D 4Z66A 3MNNC 3KXBA 1KX3C 3TU4B 4G91B 1KU5A 4WJ3C 5B33C 5BO0B 2Y2OA 1JFIB 5B0YC 3WTPE 2BYMA 4WU8C 4Z5TB 2AROB 5F99D 5AV5A 4G92C 3B6FA 2NZDD 3X1UA 1P3LC 5B32D 3KUYA 3W99B 3C1CD 3AYWA 5B1MB 3C1BD 5CPIA 1ULYA 5GT3D 3LELD 3NQJA 3AZFC 1TAFB 5AY8B 4NFTA 3B6GD 3B0DB 2JSSA 3AV1C 2NQBA 1H3OB 3B6FB 5JA4A 3WKJA 1F66A 1P3IA 3P5JB 2BYKA 3MGQB 1P3PA 3AFAA 4YM6B 4NE6A 4J8WC 5E5AA 4CAYB 1EQZC 5G49B 2JE5A 1N1JA 1BFMA 4DRAA 3AZIC 2IO5C 1M19A 3MGSB 5BNXB 3W96C 3KWQD 2PYOC 5GSUC 2F8ND 2Y2QA 5GT0A 5B2JD 5JA4B 3AZJA 3B0CT 4WU9C 3MVDB 3AZKC 1P3IB 5AVBD 2BYKB 1P3BA 3AFAB 5E5AB 3REKA 4KUDC 2RVQC 1P3GD 1N1JB 3WAAC 3AZLC 5B2JB 3AZNC 3UTBB 1P3AD 5B1LC 4LD9C 5AV9D 5GT0B 5AVBB 3X1VD 2FJ7B 2BG1A 4Z2MH 1P3KA 4J8XC 3REHC 5AVCC 3W98A 3LZ0B 3MGPC 2JCHA 5JRGD 1P3GB 2F8NH 3O62D 5AV6D 1ID3A 4XZQA 5CP6C 3LZ1D 4Z66C 3AZGD 3X1VB 1P3MC 2ZY5A 3MGRA 1P3OD 5AV8A 5B0ZA 3X1TB 5JRGB 1ZLAA 3KSYA 3MNNA 1W2EA 2XD1A 1T3UA 5DNNC 3AN2A 1P3FC 1KX3A 1M18D 1ID3B 3UTAA 5B33A 4YS3D 4H9SA 5DNMD 3MGRB 3AZHD 5B0YA 1U35B 5B31C 4WU8A 4KGCB 4ZUXD 1TZYB 3AZEA 4AWLB 5C3IC 4H9QB 1P3LA 3V9RA 1Z2CB 5B2ID 4R8PB 1P34D 4JJND 3X1SD 3AZMC 3AZFA 4WU8B 3EPLA 3B0BA 3RELD 5F99C 4G92B 1P3LB 5BS7C 4E45A 5B32C 2F2AC 3C1CC 4UPKA 4KHAA 1KX4B 3C1BC 4J8UA 5CPJD 4J8WA 1EQZA 3A6NB 1F1EA 1KX5D 3AZIA 1P3BC 3AV1B 3W96A 2PYOA 5GSUA 4UUZA 4WU9A 1M1AC 3B0CW 2CWEA 3LJAC 3AZKA 3UT9D 2FFFB 5GXQC 1KX5B 3WAAA 3AZLA 3AZIB 4LD9A 5B1LA 3VH6A 4WU9B 4J8VC 3REJC 3AZKB 2YFWA 2YFVA 4H9NA 4J8XA 3REHA 5AVCA 4XZQC 2CV5C 3TU4D 4X23C 4QLCD 1WWIA 4KUDB 5KDMA 3WA9B 5B24A 3AZNB 5CP6A 1P3AC 4Z5TD 5B1LB 2DF4C 1P3MA 5AV9C 2AROD 3AN2C 3REIB 3W99D 4QLCB 3UTAC 4WNNB 3MGPB 4H9SC 4DRBA 4DQYB 5B1MD 5DNNA 1P3FA 1HQ3B 3EG5B 5CHLB 3AZEC 3LZ1C 2L5AA 4Z66B 5FUGA 5AY8D 3KXBB 3VH5T 5B40A 5B31A 3B6FD 3KUYD 1WWSA 5CPKC
chains in the Genus database with same CATH topology
3MGQD 1HTAA 2BYMB 3A1KA 4YM6D 4HGAB 1M18C 5AV5B 3X1UB 2HIOC 2Y2NA 5DNMC 3KUYB 3AZHC 3AZMA 2NQBD 3MGSD 4ZUXC 3AYWB 4EO5C 5F99A 4J8UC 5CPIB 3MVDD 1P3ID 3WKJD 4H9RA 2Y2JA 3NQJB 5BS7A 5B32A 3AV2C 2F8NK 2NZDA 3AFAD 5B2IC 3C1CA 5E5AD 3C1BA 4XUJC 1P34C 3LELA 4JJNC 3X1SC 3UTBD 3WKJB 1F66B 2Y2HA 5GT0D 1BH8A 3RELC 2FJ7D 1P3PB 3B6GA 2J8PA 5BT1D 4CSRA 1M1AA 3LZ0D 4NE5A 3LJAA 3REKD 2ZM5A 1M19B 2G5HC 5GXQA 3AZJB 2XD5A 1BH8B 1P3BB 3X1TD 3KWQA 4CSRB 3REKB 1M1AB 4J8VA 3REJA 3LJAB 3UT9C 3FDDA 5B24C 2CV5A 4X23A 1ID3D 5GXQB 4H9PA 4WZSB 1P3KB 3MGRD 1U35D 1P3AA 1AOIC 3W98B 1B6WA 4KGCD 5AV9A 1TZYD 1ZLAD 4J8VB 3REJB 4XZQB 2CV5B 3WTPC 4G91C 3TU4C 4X23B 4H9PB 5AV8B 5B0ZB 3O62A 5B40C 4R8PD 5AV6A 3W97C 1ZLAB 4WU8D 3LZ1A 3MNNB 1S32C 2UWXA 3VH5W 1R4VA 3AN2B 1KX3B 1P3LD 3W99C 3UTAB 5B33B 3A1IA 5CPKA 5B0YB 1KX4D 4E44A 3AZEB 1M18A 3A6ND 2NZDC 2HIOA 3V9RB 5DNMA 3AZHA 3B0DC 3AV1D 2Y2PA 4ZUXA 3LELC 5GT3C 5CPKB 3AV2A 3MGQC 3AZFB 5B2IA 4YM6C 1EQZD 4XUJA 3B6GC 3NQUA 1P34A 2HIOB 4JJNA 3X1SA 2Y2GA 3AZID 3EPHA 3H0MC 3MGSC 3W96D 4WU9D 2HUEC 4KHAB 4EO5B 3RELA 4J8UB 3AZKD 2Y2KA 4J8WB 3AV2B 1EQZB 4KUDD 4XUJB 2IO5B 3WA9D 2RVQD 3W96B 3KWQC 2PYOB 5GSUB 3AZND 4UUZB 3AZLD 4LD9D 5B2JC 5B1LD 1BH9A 5BNVA 5AVBC 2FJ7C 1A7WA 4ZBJC 3REID 4J8XD 3REHD 3MGPD 3LZ0C 1P3GC 3UT9A 3WAAB 3AZLB 4LD9B 1HQ3D 2NQBB 4Z66D 3X1VC 1P3MD 4NE3A 2YFWB 2YFVB 4H9NB 3KXBD 4J8XB 3REHB 5AVCB 1AOIA 3X1TC 5JRGC 3O62C 2ZY3A 5KDMB 5AV6C 3R45A 2W8SA 5CP6B 5B24B 2DQNC 3WTPA 3TU4A 3AZGC 1P3MB 1P3OC 5AV5D 4M6BA 3X1UD 5BO0A 3W97A 1JFIA 1U35C 5B31G 1AOIB 1S32A 2VQRA 1TZYC 3AYWD 5DNNB 4AWLC 1P3FB 5CPID 3R45B 3W99A 4YS3C 5FUGB 2LY8A 3WTPB 5B1MA 5B40B 5B31B 4R8PC 3W97B 3AZMD 5C3IB 1S32B 1F66D 1TAFA 5AY8A 3F6TA 3KFUG 1P3PD 1H3OA 5B32G 5GT3A 3AZMB 1KX4C 3MGQA 1M19D 4YM6A 3AZJD 4CAYA 5F99B 5G49A 3A6NC 2NZDB 4H9RB 5B32B 1P3BD 3MGSA 5BNXA 3C1CB 1M1AD 3C1BB 3LJAD 3MVDA 5GT3B 3LELB 5CPJC 5GXQD 3VH6T 1KX5C 3B6GB 1P3KD 4Z2MG 3AL0C 2F8NA 3W98D 5B2JA 3UTBA 2F8NG 2HUEB 5AVBA 4J8VD 3REJD 2FJ7A 4XZQD 2CV5D 3LZ0A 4X23D 4H9OA 5AV8D 2ZY4A 5B0ZD 1P3GA 3WA9C 3KWQB 2F8NB 3MNND 3X1VA 3H0LC 3AN2D 1KX3D 4ZBJB 3X1TA 3REIC 3IP4C 4QLCC 5B33D 5JRGA 3UTAD 2Y2LA 2RIQA 4H9OB 5B0YD 1P3AB 4Z5TC 3AZGA 1HQ3C 5AV9B 3H0RC 3AZED 1P3OA 2AROC 3KXBC 1U35A 4KGCA 1PZRA 1TZYA 3O62B 5B1MC 4H9QA 5AV6B 5CPKD 3AZFD 3LZ1B 4YS3A 3AZGB 5AY8C 4HGAC 1P3OB 5AV5C 4R8PA 3B6FC 2HIOD 3X1UC 2Y2MA 3KUYC 2G5IC 3AYWC 3VH5A 4J8UD 5CPIC 3AV2D 4J8WD 1M18B 4YS3B 5DNMB 3AZHB 1KX4A 4XUJD 2NQBC 2PYOD 5GSUD 4ZUXB 3A6NA 3MVDC 1P3IC 1F66C 3WKJC 1P3PC 3AV1A 3AFAC 5B2IB 5E5AC 3NQUB 1P34B 4JJNB 3WAAD 5CPJA 3X1SB 3UTBC 1M19C 3VH6W 5GT0C 3RELB 3AZJC 1KX5A 2ZY2A 5BT1C 5AVCD 3EPKA 3REKC 1Q9CA 5B24D 5CPJB 5CP6D 1BH9B 5BNVB 1B67A 4KUDA 3WA9A 1P3KC 3AZNA 1AOID 3W98C 5DNND 3UT9B 1P3FD 4WV4B 3REIA 1ID3C 4QLCA 4WNNA 3WTPD 3MGPA 3EPJA 3MGRC 5B40D 5AV8C 5B31D 5B0ZC 4KGCC 2Y2IA 4Z5TA 1HQ3A 3W97D 2AROA 1ZLAC 1S32D 4Z66A 3MNNC 3KXBA 1KX3C 3TU4B 4G91B 1KU5A 4WJ3C 5B33C 5BO0B 2Y2OA 1JFIB 5B0YC 3WTPE 2BYMA 4WU8C 4Z5TB 2AROB 5F99D 5AV5A 4G92C 3B6FA 2NZDD 3X1UA 1P3LC 5B32D 3KUYA 3W99B 3C1CD 3AYWA 5B1MB 3C1BD 5CPIA 1ULYA 5GT3D 3LELD 3NQJA 3AZFC 1TAFB 5AY8B 4NFTA 3B6GD 3B0DB 2JSSA 3AV1C 2NQBA 1H3OB 3B6FB 5JA4A 3WKJA 1F66A 1P3IA 3P5JB 2BYKA 3MGQB 1P3PA 3AFAA 4YM6B 4NE6A 4J8WC 5E5AA 4CAYB 1EQZC 5G49B 2JE5A 1N1JA 1BFMA 4DRAA 3AZIC 2IO5C 1M19A 3MGSB 5BNXB 3W96C 3KWQD 2PYOC 5GSUC 2F8ND 2Y2QA 5GT0A 5B2JD 5JA4B 3AZJA 3B0CT 4WU9C 3MVDB 3AZKC 1P3IB 5AVBD 2BYKB 1P3BA 3AFAB 5E5AB 3REKA 4KUDC 2RVQC 1P3GD 1N1JB 3WAAC 3AZLC 5B2JB 3AZNC 3UTBB 1P3AD 5B1LC 4LD9C 5AV9D 5GT0B 5AVBB 3X1VD 2FJ7B 2BG1A 4Z2MH 1P3KA 4J8XC 3REHC 5AVCC 3W98A 3LZ0B 3MGPC 2JCHA 5JRGD 1P3GB 2F8NH 3O62D 5AV6D 1ID3A 4XZQA 5CP6C 3LZ1D 4Z66C 3AZGD 3X1VB 1P3MC 2ZY5A 3MGRA 1P3OD 5AV8A 5B0ZA 3X1TB 5JRGB 1ZLAA 3KSYA 3MNNA 1W2EA 2XD1A 1T3UA 5DNNC 3AN2A 1P3FC 1KX3A 1M18D 1ID3B 3UTAA 5B33A 4YS3D 4H9SA 5DNMD 3MGRB 3AZHD 5B0YA 1U35B 5B31C 4WU8A 4KGCB 4ZUXD 1TZYB 3AZEA 4AWLB 5C3IC 4H9QB 1P3LA 3V9RA 1Z2CB 5B2ID 4R8PB 1P34D 4JJND 3X1SD 3AZMC 3AZFA 4WU8B 3EPLA 3B0BA 3RELD 5F99C 4G92B 1P3LB 5BS7C 4E45A 5B32C 2F2AC 3C1CC 4UPKA 4KHAA 1KX4B 3C1BC 4J8UA 5CPJD 4J8WA 1EQZA 3A6NB 1F1EA 1KX5D 3AZIA 1P3BC 3AV1B 3W96A 2PYOA 5GSUA 4UUZA 4WU9A 1M1AC 3B0CW 2CWEA 3LJAC 3AZKA 3UT9D 2FFFB 5GXQC 1KX5B 3WAAA 3AZLA 3AZIB 4LD9A 5B1LA 3VH6A 4WU9B 4J8VC 3REJC 3AZKB 2YFWA 2YFVA 4H9NA 4J8XA 3REHA 5AVCA 4XZQC 2CV5C 3TU4D 4X23C 4QLCD 1WWIA 4KUDB 5KDMA 3WA9B 5B24A 3AZNB 5CP6A 1P3AC 4Z5TD 5B1LB 2DF4C 1P3MA 5AV9C 2AROD 3AN2C 3REIB 3W99D 4QLCB 3UTAC 4WNNB 3MGPB 4H9SC 4DRBA 4DQYB 5B1MD 5DNNA 1P3FA 1HQ3B 3EG5B 5CHLB 3AZEC 3LZ1C 2L5AA 4Z66B 5FUGA 5AY8D 3KXBB 3VH5T 5B40A 5B31A 3B6FD 3KUYD 1WWSA 5CPKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGQ D;  1HTA A;  2BYM B;  4YM6 D;  4HGA B;  1M18 C;  5AV5 B;  3X1U B;  2HIO C;  5DNM C;  3KUY B;  3AZH C;  3AZM A;  2NQB D;  3MGS D;  4ZUX C;  3AYW B;  4EO5 C;  5F99 A;  4J8U C;  5CPI B;  3MVD D;  1P3I D;  3WKJ D;  4H9R A;  2NZD A;  3NQJ B;  5BS7 A;  5B32 A;  3AV2 C;  2F8N K;  3AFA D;  5B2I C;  3C1C A;  5E5A D;  3C1B A;  4XUJ C;  1P34 C;  3LEL A;  4JJN C;  3X1S C;  3UTB D;  3WKJ B;  1F66 B;  5GT0 D;  1BH8 A;  3REL C;  2FJ7 D;  1P3P B;  3B6G A;  5BT1 D;  4CSR A;  1M1A A;  3LZ0 D;  4NE5 A;  3LJA A;  3REK D;  1M19 B;  5GXQ A;  3AZJ B;  1BH8 B;  1P3B B;  3X1T D;  3KWQ A;  4CSR B;  3REK B;  1M1A B;  4J8V A;  3REJ A;  3LJA B;  3UT9 C;  5B24 C;  2CV5 A;  4X23 A;  1ID3 D;  5GXQ B;  4H9P A;  4WZS B;  1P3K B;  3MGR D;  1U35 D;  1P3A A;  1AOI C;  3W98 B;  1B6W A;  4KGC D;  5AV9 A;  1TZY D;  1ZLA D;  4J8V B;  3REJ B;  4XZQ B;  2CV5 B;  3WTP C;  4G91 C;  3TU4 C;  4X23 B;  4H9P B;  5AV8 B;  5B0Z B;  3O62 A;  5B40 C;  4R8P D;  5AV6 A;  3W97 C;  1ZLA B;  4WU8 D;  3LZ1 A;  3MNN B;  1S32 C;  3VH5 W;  1R4V A;  3AN2 B;  1KX3 B;  1P3L D;  3W99 C;  3UTA B;  5B33 B;  5CPK A;  5B0Y B;  1KX4 D;  4E44 A;  3AZE B;  1M18 A;  3A6N D;  2NZD C;  2HIO A;  3V9R B;  5DNM A;  3AZH A;  3B0D C;  3AV1 D;  4ZUX A;  3LEL C;  5GT3 C;  5CPK B;  3AV2 A;  3MGQ C;  3AZF B;  5B2I A;  4YM6 C;  1EQZ D;  4XUJ A;  3B6G C;  3NQU A;  1P34 A;  2HIO B;  4JJN A;  3X1S A;  3AZI D;  3MGS C;  3W96 D;  4WU9 D;  2HUE C;  4KHA B;  4EO5 B;  3REL A;  4J8U B;  3AZK D;  3AV2 B;  4J8W B;  1EQZ B;  4KUD D;  4XUJ B;  2IO5 B;  3WA9 D;  2RVQ D;  3W96 B;  3KWQ C;  2PYO B;  5GSU B;  3AZN D;  4UUZ B;  3AZL D;  4LD9 D;  5B2J C;  5B1L D;  1BH9 A;  5BNV A;  5AVB C;  2FJ7 C;  1A7W A;  4ZBJ C;  3REI D;  4J8X D;  3REH D;  3MGP D;  3LZ0 C;  1P3G C;  3UT9 A;  3WAA B;  3AZL B;  4LD9 B;  1HQ3 D;  2NQB B;  4Z66 D;  3X1V C;  1P3M D;  4NE3 A;  2YFW B;  2YFV B;  4H9N B;  3KXB D;  4J8X B;  3REH B;  5AVC B;  1AOI A;  3X1T C;  5JRG C;  3O62 C;  5KDM B;  5AV6 C;  3R45 A;  5B24 B;  5CP6 B;  3WTP A;  3TU4 A;  3AZG C;  1P3M B;  1P3O C;  5AV5 D;  4M6B A;  3X1U D;  5BO0 A;  3W97 A;  1JFI A;  1U35 C;  5B31 G;  1AOI B;  1S32 A;  1TZY C;  3AYW D;  5DNN B;  4AWL C;  1P3F B;  5CPI D;  3R45 B;  3W99 A;  4YS3 C;  5FUG B;  2LY8 A;  3WTP B;  5B1M A;  5B40 B;  5B31 B;  4R8P C;  3W97 B;  3AZM D;  5C3I B;  1S32 B;  1F66 D;  1TAF A;  5AY8 A;  1P3P D;  1H3O A;  5B32 G;  5GT3 A;  3AZM B;  1KX4 C;  3MGQ A;  1M19 D;  4YM6 A;  3AZJ D;  4CAY A;  5F99 B;  5G49 A;  3A6N C;  2NZD B;  4H9R B;  5B32 B;  1P3B D;  3MGS A;  5BNX A;  3C1C B;  1M1A D;  3C1B B;  3LJA D;  3MVD A;  5GT3 B;  3LEL B;  5CPJ C;  5GXQ D;  3VH6 T;  1KX5 C;  3B6G B;  1P3K D;  4Z2M G;  2F8N A;  3W98 D;  5B2J A;  3UTB A;  2F8N G;  2HUE B;  5AVB A;  4J8V D;  3REJ D;  2FJ7 A;  4XZQ D;  2CV5 D;  3LZ0 A;  4X23 D;  4H9O A;  5AV8 D;  5B0Z D;  1P3G A;  3WA9 C;  3KWQ B;  2F8N B;  3MNN D;  3X1V A;  3AN2 D;  1KX3 D;  4ZBJ B;  3X1T A;  3REI C;  4QLC C;  5B33 D;  5JRG A;  3UTA D;  4H9O B;  5B0Y D;  1P3A B;  4Z5T C;  3AZG A;  1HQ3 C;  5AV9 B;  3AZE D;  1P3O A;  2ARO C;  3KXB C;  1U35 A;  4KGC A;  1TZY A;  3O62 B;  5B1M C;  4H9Q A;  5AV6 B;  5CPK D;  3AZF D;  3LZ1 B;  4YS3 A;  3AZG B;  5AY8 C;  4HGA C;  1P3O B;  5AV5 C;  4R8P A;  3B6F C;  2HIO D;  3X1U C;  3KUY C;  3AYW C;  3VH5 A;  4J8U D;  5CPI C;  3AV2 D;  4J8W D;  1M18 B;  4YS3 B;  5DNM B;  3AZH B;  1KX4 A;  4XUJ D;  2NQB C;  2PYO D;  5GSU D;  4ZUX B;  3A6N A;  3MVD C;  1P3I C;  1F66 C;  3WKJ C;  1P3P C;  3AV1 A;  3AFA C;  5B2I B;  5E5A C;  3NQU B;  1P34 B;  4JJN B;  3WAA D;  5CPJ A;  3X1S B;  3UTB C;  1M19 C;  3VH6 W;  5GT0 C;  3REL B;  3AZJ C;  1KX5 A;  5BT1 C;  5AVC D;  3REK C;  1Q9C A;  5B24 D;  5CPJ B;  5CP6 D;  1BH9 B;  5BNV B;  1B67 A;  4KUD A;  3WA9 A;  1P3K C;  3AZN A;  1AOI D;  3W98 C;  5DNN D;  3UT9 B;  1P3F D;  4WV4 B;  3REI A;  1ID3 C;  4QLC A;  4WNN A;  3WTP D;  3MGP A;  3MGR C;  5B40 D;  5AV8 C;  5B31 D;  5B0Z C;  4KGC C;  4Z5T A;  3W97 D;  1HQ3 A;  2ARO A;  1ZLA C;  1S32 D;  4Z66 A;  3MNN C;  3KXB A;  1KX3 C;  3TU4 B;  4G91 B;  1KU5 A;  5B33 C;  5BO0 B;  1JFI B;  5B0Y C;  3WTP E;  2BYM A;  4WU8 C;  4Z5T B;  2ARO B;  5F99 D;  5AV5 A;  4G92 C;  3B6F A;  2NZD D;  3X1U A;  1P3L C;  5B32 D;  3KUY A;  3W99 B;  3C1C D;  3AYW A;  5B1M B;  3C1B D;  5CPI A;  1ULY A;  5GT3 D;  3LEL D;  3NQJ A;  3AZF C;  1TAF B;  5AY8 B;  4NFT A;  3B6G D;  3B0D B;  2JSS A;  3AV1 C;  2NQB A;  1H3O B;  3B6F B;  5JA4 A;  3WKJ A;  1F66 A;  1P3I A;  2BYK A;  3MGQ B;  1P3P A;  3AFA A;  4YM6 B;  4NE6 A;  4J8W C;  5E5A A;  4CAY B;  1EQZ C;  5G49 B;  1N1J A;  1BFM A;  4DRA A;  3AZI C;  2IO5 C;  1M19 A;  3MGS B;  5BNX B;  3W96 C;  3KWQ D;  2PYO C;  5GSU C;  2F8N D;  5GT0 A;  5JA4 B;  5B2J D;  3AZJ A;  3B0C T;  4WU9 C;  3MVD B;  3AZK C;  1P3I B;  5AVB D;  2BYK B;  1P3B A;  3AFA B;  5E5A B;  3REK A;  4KUD C;  2RVQ C;  1P3G D;  1N1J B;  3WAA C;  3AZL C;  5B2J B;  3AZN C;  3UTB B;  1P3A D;  5B1L C;  4LD9 C;  5AV9 D;  5GT0 B;  5AVB B;  3X1V D;  2FJ7 B;  4Z2M H;  1P3K A;  4J8X C;  3REH C;  5AVC C;  3W98 A;  3LZ0 B;  3MGP C;  5JRG D;  1P3G B;  2F8N H;  3O62 D;  5AV6 D;  1ID3 A;  4XZQ A;  5CP6 C;  3LZ1 D;  4Z66 C;  3AZG D;  3X1V B;  1P3M C;  3MGR A;  1P3O D;  5AV8 A;  5B0Z A;  3X1T B;  5JRG B;  1ZLA A;  3KSY A;  3MNN A;  5DNN C;  3AN2 A;  1P3F C;  1KX3 A;  1M18 D;  1ID3 B;  3UTA A;  5B33 A;  4YS3 D;  4H9S A;  5DNM D;  3MGR B;  3AZH D;  5B0Y A;  1U35 B;  5B31 C;  4WU8 A;  4KGC B;  4ZUX D;  1TZY B;  3AZE A;  4AWL B;  5C3I C;  4H9Q B;  1P3L A;  3V9R A;  5B2I D;  4R8P B;  1P34 D;  4JJN D;  3X1S D;  3AZM C;  3AZF A;  4WU8 B;  3B0B A;  3REL D;  5F99 C;  4G92 B;  1P3L B;  5BS7 C;  4E45 A;  5B32 C;  3C1C C;  4KHA A;  1KX4 B;  3C1B C;  4J8U A;  5CPJ D;  4J8W A;  1EQZ A;  3A6N B;  1F1E A;  1KX5 D;  3AZI A;  1P3B C;  3AV1 B;  3W96 A;  2PYO A;  5GSU A;  4UUZ A;  4WU9 A;  1M1A C;  3B0C W;  2CWE A;  3LJA C;  3AZK A;  3UT9 D;  5GXQ C;  1KX5 B;  3WAA A;  3AZL A;  3AZI B;  4LD9 A;  5B1L A;  3VH6 A;  4WU9 B;  4J8V C;  3REJ C;  3AZK B;  2YFW A;  2YFV A;  4H9N A;  4J8X A;  3REH A;  5AVC A;  4XZQ C;  2CV5 C;  3TU4 D;  4X23 C;  4QLC D;  1WWI A;  4KUD B;  5KDM A;  3WA9 B;  5B24 A;  3AZN B;  5CP6 A;  1P3A C;  4Z5T D;  5B1L B;  1P3M A;  5AV9 C;  2ARO D;  3AN2 C;  3REI B;  3W99 D;  4QLC B;  3UTA C;  4WNN B;  3MGP B;  4H9S C;  4DRB A;  5B1M D;  5DNN A;  1P3F A;  1HQ3 B;  5CHL B;  3AZE C;  3LZ1 C;  2L5A A;  4Z66 B;  5FUG A;  5AY8 D;  3KXB B;  3VH5 T;  5B40 A;  5B31 A;  3B6F D;  3KUY D;  1WWS A;  5CPK C; 
#chains in the Genus database with same CATH topology
 3MGQ D;  1HTA A;  2BYM B;  3A1K A;  4YM6 D;  4HGA B;  1M18 C;  5AV5 B;  3X1U B;  2HIO C;  2Y2N A;  5DNM C;  3KUY B;  3AZH C;  3AZM A;  2NQB D;  3MGS D;  4ZUX C;  3AYW B;  4EO5 C;  5F99 A;  4J8U C;  5CPI B;  3MVD D;  1P3I D;  3WKJ D;  4H9R A;  2Y2J A;  3NQJ B;  5BS7 A;  5B32 A;  3AV2 C;  2F8N K;  2NZD A;  3AFA D;  5B2I C;  3C1C A;  5E5A D;  3C1B A;  4XUJ C;  1P34 C;  3LEL A;  4JJN C;  3X1S C;  3UTB D;  3WKJ B;  1F66 B;  2Y2H A;  5GT0 D;  1BH8 A;  3REL C;  2FJ7 D;  1P3P B;  3B6G A;  2J8P A;  5BT1 D;  4CSR A;  1M1A A;  3LZ0 D;  4NE5 A;  3LJA A;  3REK D;  2ZM5 A;  1M19 B;  2G5H C;  5GXQ A;  3AZJ B;  2XD5 A;  1BH8 B;  1P3B B;  3X1T D;  3KWQ A;  4CSR B;  3REK B;  1M1A B;  4J8V A;  3REJ A;  3LJA B;  3UT9 C;  3FDD A;  5B24 C;  2CV5 A;  4X23 A;  1ID3 D;  5GXQ B;  4H9P A;  4WZS B;  1P3K B;  3MGR D;  1U35 D;  1P3A A;  1AOI C;  3W98 B;  1B6W A;  4KGC D;  5AV9 A;  1TZY D;  1ZLA D;  4J8V B;  3REJ B;  4XZQ B;  2CV5 B;  3WTP C;  4G91 C;  3TU4 C;  4X23 B;  4H9P B;  5AV8 B;  5B0Z B;  3O62 A;  5B40 C;  4R8P D;  5AV6 A;  3W97 C;  1ZLA B;  4WU8 D;  3LZ1 A;  3MNN B;  1S32 C;  2UWX A;  3VH5 W;  1R4V A;  3AN2 B;  1KX3 B;  1P3L D;  3W99 C;  3UTA B;  5B33 B;  3A1I A;  5CPK A;  5B0Y B;  1KX4 D;  4E44 A;  3AZE B;  1M18 A;  3A6N D;  2NZD C;  2HIO A;  3V9R B;  5DNM A;  3AZH A;  3B0D C;  3AV1 D;  2Y2P A;  4ZUX A;  3LEL C;  5GT3 C;  5CPK B;  3AV2 A;  3MGQ C;  3AZF B;  5B2I A;  4YM6 C;  1EQZ D;  4XUJ A;  3B6G C;  3NQU A;  1P34 A;  2HIO B;  4JJN A;  3X1S A;  2Y2G A;  3AZI D;  3EPH A;  3H0M C;  3MGS C;  3W96 D;  4WU9 D;  2HUE C;  4KHA B;  4EO5 B;  3REL A;  4J8U B;  3AZK D;  2Y2K A;  4J8W B;  3AV2 B;  1EQZ B;  4KUD D;  4XUJ B;  2IO5 B;  3WA9 D;  2RVQ D;  3W96 B;  3KWQ C;  2PYO B;  5GSU B;  3AZN D;  4UUZ B;  3AZL D;  4LD9 D;  5B2J C;  5B1L D;  1BH9 A;  5BNV A;  5AVB C;  2FJ7 C;  1A7W A;  4ZBJ C;  3REI D;  4J8X D;  3REH D;  3MGP D;  3LZ0 C;  1P3G C;  3UT9 A;  3WAA B;  3AZL B;  4LD9 B;  1HQ3 D;  2NQB B;  4Z66 D;  3X1V C;  1P3M D;  4NE3 A;  2YFW B;  2YFV B;  4H9N B;  3KXB D;  4J8X B;  3REH B;  5AVC B;  1AOI A;  3X1T C;  5JRG C;  3O62 C;  2ZY3 A;  5KDM B;  5AV6 C;  3R45 A;  2W8S A;  5CP6 B;  5B24 B;  2DQN C;  3WTP A;  3TU4 A;  3AZG C;  1P3M B;  1P3O C;  5AV5 D;  4M6B A;  3X1U D;  5BO0 A;  3W97 A;  1JFI A;  1U35 C;  5B31 G;  1AOI B;  1S32 A;  2VQR A;  1TZY C;  3AYW D;  5DNN B;  4AWL C;  1P3F B;  5CPI D;  3R45 B;  3W99 A;  4YS3 C;  5FUG B;  2LY8 A;  3WTP B;  5B1M A;  5B40 B;  5B31 B;  4R8P C;  3W97 B;  3AZM D;  5C3I B;  1S32 B;  1F66 D;  1TAF A;  5AY8 A;  3F6T A;  3KFU G;  1P3P D;  1H3O A;  5B32 G;  5GT3 A;  3AZM B;  1KX4 C;  3MGQ A;  1M19 D;  4YM6 A;  3AZJ D;  4CAY A;  5F99 B;  5G49 A;  3A6N C;  2NZD B;  4H9R B;  5B32 B;  1P3B D;  3MGS A;  5BNX A;  3C1C B;  1M1A D;  3C1B B;  3LJA D;  3MVD A;  5GT3 B;  3LEL B;  5CPJ C;  5GXQ D;  3VH6 T;  1KX5 C;  3B6G B;  1P3K D;  4Z2M G;  3AL0 C;  2F8N A;  3W98 D;  5B2J A;  3UTB A;  2F8N G;  2HUE B;  5AVB A;  4J8V D;  3REJ D;  2FJ7 A;  4XZQ D;  2CV5 D;  3LZ0 A;  4X23 D;  4H9O A;  5AV8 D;  2ZY4 A;  5B0Z D;  1P3G A;  3WA9 C;  3KWQ B;  2F8N B;  3MNN D;  3X1V A;  3H0L C;  3AN2 D;  1KX3 D;  4ZBJ B;  3X1T A;  3REI C;  3IP4 C;  4QLC C;  5B33 D;  5JRG A;  3UTA D;  2Y2L A;  2RIQ A;  4H9O B;  5B0Y D;  1P3A B;  4Z5T C;  3AZG A;  1HQ3 C;  5AV9 B;  3H0R C;  3AZE D;  1P3O A;  2ARO C;  3KXB C;  1U35 A;  4KGC A;  1PZR A;  1TZY A;  3O62 B;  5B1M C;  4H9Q A;  5AV6 B;  5CPK D;  3AZF D;  3LZ1 B;  4YS3 A;  3AZG B;  5AY8 C;  4HGA C;  1P3O B;  5AV5 C;  4R8P A;  3B6F C;  2HIO D;  3X1U C;  2Y2M A;  3KUY C;  2G5I C;  3AYW C;  3VH5 A;  4J8U D;  5CPI C;  3AV2 D;  4J8W D;  1M18 B;  4YS3 B;  5DNM B;  3AZH B;  1KX4 A;  4XUJ D;  2NQB C;  2PYO D;  5GSU D;  4ZUX B;  3A6N A;  3MVD C;  1P3I C;  1F66 C;  3WKJ C;  1P3P C;  3AV1 A;  3AFA C;  5B2I B;  5E5A C;  3NQU B;  1P34 B;  4JJN B;  3WAA D;  5CPJ A;  3X1S B;  3UTB C;  1M19 C;  3VH6 W;  5GT0 C;  3REL B;  3AZJ C;  1KX5 A;  2ZY2 A;  5BT1 C;  5AVC D;  3EPK A;  3REK C;  1Q9C A;  5B24 D;  5CPJ B;  5CP6 D;  1BH9 B;  5BNV B;  1B67 A;  4KUD A;  3WA9 A;  1P3K C;  3AZN A;  1AOI D;  3W98 C;  5DNN D;  3UT9 B;  1P3F D;  4WV4 B;  3REI A;  1ID3 C;  4QLC A;  4WNN A;  3WTP D;  3MGP A;  3EPJ A;  3MGR C;  5B40 D;  5AV8 C;  5B31 D;  5B0Z C;  4KGC C;  2Y2I A;  4Z5T A;  1HQ3 A;  3W97 D;  2ARO A;  1ZLA C;  1S32 D;  4Z66 A;  3MNN C;  3KXB A;  1KX3 C;  3TU4 B;  4G91 B;  1KU5 A;  4WJ3 C;  5B33 C;  5BO0 B;  2Y2O A;  1JFI B;  5B0Y C;  3WTP E;  2BYM A;  4WU8 C;  4Z5T B;  2ARO B;  5F99 D;  5AV5 A;  4G92 C;  3B6F A;  2NZD D;  3X1U A;  1P3L C;  5B32 D;  3KUY A;  3W99 B;  3C1C D;  3AYW A;  5B1M B;  3C1B D;  5CPI A;  1ULY A;  5GT3 D;  3LEL D;  3NQJ A;  3AZF C;  1TAF B;  5AY8 B;  4NFT A;  3B6G D;  3B0D B;  2JSS A;  3AV1 C;  2NQB A;  1H3O B;  3B6F B;  5JA4 A;  3WKJ A;  1F66 A;  1P3I A;  3P5J B;  2BYK A;  3MGQ B;  1P3P A;  3AFA A;  4YM6 B;  4NE6 A;  4J8W C;  5E5A A;  4CAY B;  1EQZ C;  5G49 B;  2JE5 A;  1N1J A;  1BFM A;  4DRA A;  3AZI C;  2IO5 C;  1M19 A;  3MGS B;  5BNX B;  3W96 C;  3KWQ D;  2PYO C;  5GSU C;  2F8N D;  2Y2Q A;  5GT0 A;  5B2J D;  5JA4 B;  3AZJ A;  3B0C T;  4WU9 C;  3MVD B;  3AZK C;  1P3I B;  5AVB D;  2BYK B;  1P3B A;  3AFA B;  5E5A B;  3REK A;  4KUD C;  2RVQ C;  1P3G D;  1N1J B;  3WAA C;  3AZL C;  5B2J B;  3AZN C;  3UTB B;  1P3A D;  5B1L C;  4LD9 C;  5AV9 D;  5GT0 B;  5AVB B;  3X1V D;  2FJ7 B;  2BG1 A;  4Z2M H;  1P3K A;  4J8X C;  3REH C;  5AVC C;  3W98 A;  3LZ0 B;  3MGP C;  2JCH A;  5JRG D;  1P3G B;  2F8N H;  3O62 D;  5AV6 D;  1ID3 A;  4XZQ A;  5CP6 C;  3LZ1 D;  4Z66 C;  3AZG D;  3X1V B;  1P3M C;  2ZY5 A;  3MGR A;  1P3O D;  5AV8 A;  5B0Z A;  3X1T B;  5JRG B;  1ZLA A;  3KSY A;  3MNN A;  1W2E A;  2XD1 A;  1T3U A;  5DNN C;  3AN2 A;  1P3F C;  1KX3 A;  1M18 D;  1ID3 B;  3UTA A;  5B33 A;  4YS3 D;  4H9S A;  5DNM D;  3MGR B;  3AZH D;  5B0Y A;  1U35 B;  5B31 C;  4WU8 A;  4KGC B;  4ZUX D;  1TZY B;  3AZE A;  4AWL B;  5C3I C;  4H9Q B;  1P3L A;  3V9R A;  1Z2C B;  5B2I D;  4R8P B;  1P34 D;  4JJN D;  3X1S D;  3AZM C;  3AZF A;  4WU8 B;  3EPL A;  3B0B A;  3REL D;  5F99 C;  4G92 B;  1P3L B;  5BS7 C;  4E45 A;  5B32 C;  2F2A C;  3C1C C;  4UPK A;  4KHA A;  1KX4 B;  3C1B C;  4J8U A;  5CPJ D;  4J8W A;  1EQZ A;  3A6N B;  1F1E A;  1KX5 D;  3AZI A;  1P3B C;  3AV1 B;  3W96 A;  2PYO A;  5GSU A;  4UUZ A;  4WU9 A;  1M1A C;  3B0C W;  2CWE A;  3LJA C;  3AZK A;  3UT9 D;  2FFF B;  5GXQ C;  1KX5 B;  3WAA A;  3AZL A;  3AZI B;  4LD9 A;  5B1L A;  3VH6 A;  4WU9 B;  4J8V C;  3REJ C;  3AZK B;  2YFW A;  2YFV A;  4H9N A;  4J8X A;  3REH A;  5AVC A;  4XZQ C;  2CV5 C;  3TU4 D;  4X23 C;  4QLC D;  1WWI A;  4KUD B;  5KDM A;  3WA9 B;  5B24 A;  3AZN B;  5CP6 A;  1P3A C;  4Z5T D;  5B1L B;  2DF4 C;  1P3M A;  5AV9 C;  2ARO D;  3AN2 C;  3REI B;  3W99 D;  4QLC B;  3UTA C;  4WNN B;  3MGP B;  4H9S C;  4DRB A;  4DQY B;  5B1M D;  5DNN A;  1P3F A;  1HQ3 B;  3EG5 B;  5CHL B;  3AZE C;  3LZ1 C;  2L5A A;  4Z66 B;  5FUG A;  5AY8 D;  3KXB B;  3VH5 T;  5B40 A;  5B31 A;  3B6F D;  3KUY D;  1WWS A;  5CPK C; 
#chains in the Genus database with same CATH homology
 3MGQ D;  1HTA A;  2BYM B;  3A1K A;  4YM6 D;  4HGA B;  1M18 C;  5AV5 B;  3X1U B;  2HIO C;  2Y2N A;  5DNM C;  3KUY B;  3AZH C;  3AZM A;  2NQB D;  3MGS D;  4ZUX C;  3AYW B;  4EO5 C;  5F99 A;  4J8U C;  5CPI B;  3MVD D;  1P3I D;  3WKJ D;  4H9R A;  2Y2J A;  3NQJ B;  5BS7 A;  5B32 A;  3AV2 C;  2F8N K;  2NZD A;  3AFA D;  5B2I C;  3C1C A;  5E5A D;  3C1B A;  4XUJ C;  1P34 C;  3LEL A;  4JJN C;  3X1S C;  3UTB D;  3WKJ B;  1F66 B;  2Y2H A;  5GT0 D;  1BH8 A;  3REL C;  2FJ7 D;  1P3P B;  3B6G A;  2J8P A;  5BT1 D;  4CSR A;  1M1A A;  3LZ0 D;  4NE5 A;  3LJA A;  3REK D;  2ZM5 A;  1M19 B;  2G5H C;  5GXQ A;  3AZJ B;  2XD5 A;  1BH8 B;  1P3B B;  3X1T D;  3KWQ A;  4CSR B;  3REK B;  1M1A B;  4J8V A;  3REJ A;  3LJA B;  3UT9 C;  3FDD A;  5B24 C;  2CV5 A;  4X23 A;  1ID3 D;  5GXQ B;  4H9P A;  4WZS B;  1P3K B;  3MGR D;  1U35 D;  1P3A A;  1AOI C;  3W98 B;  1B6W A;  4KGC D;  5AV9 A;  1TZY D;  1ZLA D;  4J8V B;  3REJ B;  4XZQ B;  2CV5 B;  3WTP C;  4G91 C;  3TU4 C;  4X23 B;  4H9P B;  5AV8 B;  5B0Z B;  3O62 A;  5B40 C;  4R8P D;  5AV6 A;  3W97 C;  1ZLA B;  4WU8 D;  3LZ1 A;  3MNN B;  1S32 C;  2UWX A;  3VH5 W;  1R4V A;  3AN2 B;  1KX3 B;  1P3L D;  3W99 C;  3UTA B;  5B33 B;  3A1I A;  5CPK A;  5B0Y B;  1KX4 D;  4E44 A;  3AZE B;  1M18 A;  3A6N D;  2NZD C;  2HIO A;  3V9R B;  5DNM A;  3AZH A;  3B0D C;  3AV1 D;  2Y2P A;  4ZUX A;  3LEL C;  5GT3 C;  5CPK B;  3AV2 A;  3MGQ C;  3AZF B;  5B2I A;  4YM6 C;  1EQZ D;  4XUJ A;  3B6G C;  3NQU A;  1P34 A;  2HIO B;  4JJN A;  3X1S A;  2Y2G A;  3AZI D;  3EPH A;  3H0M C;  3MGS C;  3W96 D;  4WU9 D;  2HUE C;  4KHA B;  4EO5 B;  3REL A;  4J8U B;  3AZK D;  2Y2K A;  4J8W B;  3AV2 B;  1EQZ B;  4KUD D;  4XUJ B;  2IO5 B;  3WA9 D;  2RVQ D;  3W96 B;  3KWQ C;  2PYO B;  5GSU B;  3AZN D;  4UUZ B;  3AZL D;  4LD9 D;  5B2J C;  5B1L D;  1BH9 A;  5BNV A;  5AVB C;  2FJ7 C;  1A7W A;  4ZBJ C;  3REI D;  4J8X D;  3REH D;  3MGP D;  3LZ0 C;  1P3G C;  3UT9 A;  3WAA B;  3AZL B;  4LD9 B;  1HQ3 D;  2NQB B;  4Z66 D;  3X1V C;  1P3M D;  4NE3 A;  2YFW B;  2YFV B;  4H9N B;  3KXB D;  4J8X B;  3REH B;  5AVC B;  1AOI A;  3X1T C;  5JRG C;  3O62 C;  2ZY3 A;  5KDM B;  5AV6 C;  3R45 A;  2W8S A;  5CP6 B;  5B24 B;  2DQN C;  3WTP A;  3TU4 A;  3AZG C;  1P3M B;  1P3O C;  5AV5 D;  4M6B A;  3X1U D;  5BO0 A;  3W97 A;  1JFI A;  1U35 C;  5B31 G;  1AOI B;  1S32 A;  2VQR A;  1TZY C;  3AYW D;  5DNN B;  4AWL C;  1P3F B;  5CPI D;  3R45 B;  3W99 A;  4YS3 C;  5FUG B;  2LY8 A;  3WTP B;  5B1M A;  5B40 B;  5B31 B;  4R8P C;  3W97 B;  3AZM D;  5C3I B;  1S32 B;  1F66 D;  1TAF A;  5AY8 A;  3F6T A;  3KFU G;  1P3P D;  1H3O A;  5B32 G;  5GT3 A;  3AZM B;  1KX4 C;  3MGQ A;  1M19 D;  4YM6 A;  3AZJ D;  4CAY A;  5F99 B;  5G49 A;  3A6N C;  2NZD B;  4H9R B;  5B32 B;  1P3B D;  3MGS A;  5BNX A;  3C1C B;  1M1A D;  3C1B B;  3LJA D;  3MVD A;  5GT3 B;  3LEL B;  5CPJ C;  5GXQ D;  3VH6 T;  1KX5 C;  3B6G B;  1P3K D;  4Z2M G;  3AL0 C;  2F8N A;  3W98 D;  5B2J A;  3UTB A;  2F8N G;  2HUE B;  5AVB A;  4J8V D;  3REJ D;  2FJ7 A;  4XZQ D;  2CV5 D;  3LZ0 A;  4X23 D;  4H9O A;  5AV8 D;  2ZY4 A;  5B0Z D;  1P3G A;  3WA9 C;  3KWQ B;  2F8N B;  3MNN D;  3X1V A;  3H0L C;  3AN2 D;  1KX3 D;  4ZBJ B;  3X1T A;  3REI C;  3IP4 C;  4QLC C;  5B33 D;  5JRG A;  3UTA D;  2Y2L A;  2RIQ A;  4H9O B;  5B0Y D;  1P3A B;  4Z5T C;  3AZG A;  1HQ3 C;  5AV9 B;  3H0R C;  3AZE D;  1P3O A;  2ARO C;  3KXB C;  1U35 A;  4KGC A;  1PZR A;  1TZY A;  3O62 B;  5B1M C;  4H9Q A;  5AV6 B;  5CPK D;  3AZF D;  3LZ1 B;  4YS3 A;  3AZG B;  5AY8 C;  4HGA C;  1P3O B;  5AV5 C;  4R8P A;  3B6F C;  2HIO D;  3X1U C;  2Y2M A;  3KUY C;  2G5I C;  3AYW C;  3VH5 A;  4J8U D;  5CPI C;  3AV2 D;  4J8W D;  1M18 B;  4YS3 B;  5DNM B;  3AZH B;  1KX4 A;  4XUJ D;  2NQB C;  2PYO D;  5GSU D;  4ZUX B;  3A6N A;  3MVD C;  1P3I C;  1F66 C;  3WKJ C;  1P3P C;  3AV1 A;  3AFA C;  5B2I B;  5E5A C;  3NQU B;  1P34 B;  4JJN B;  3WAA D;  5CPJ A;  3X1S B;  3UTB C;  1M19 C;  3VH6 W;  5GT0 C;  3REL B;  3AZJ C;  1KX5 A;  2ZY2 A;  5BT1 C;  5AVC D;  3EPK A;  3REK C;  1Q9C A;  5B24 D;  5CPJ B;  5CP6 D;  1BH9 B;  5BNV B;  1B67 A;  4KUD A;  3WA9 A;  1P3K C;  3AZN A;  1AOI D;  3W98 C;  5DNN D;  3UT9 B;  1P3F D;  4WV4 B;  3REI A;  1ID3 C;  4QLC A;  4WNN A;  3WTP D;  3MGP A;  3EPJ A;  3MGR C;  5B40 D;  5AV8 C;  5B31 D;  5B0Z C;  4KGC C;  2Y2I A;  4Z5T A;  1HQ3 A;  3W97 D;  2ARO A;  1ZLA C;  1S32 D;  4Z66 A;  3MNN C;  3KXB A;  1KX3 C;  3TU4 B;  4G91 B;  1KU5 A;  4WJ3 C;  5B33 C;  5BO0 B;  2Y2O A;  1JFI B;  5B0Y C;  3WTP E;  2BYM A;  4WU8 C;  4Z5T B;  2ARO B;  5F99 D;  5AV5 A;  4G92 C;  3B6F A;  2NZD D;  3X1U A;  1P3L C;  5B32 D;  3KUY A;  3W99 B;  3C1C D;  3AYW A;  5B1M B;  3C1B D;  5CPI A;  1ULY A;  5GT3 D;  3LEL D;  3NQJ A;  3AZF C;  1TAF B;  5AY8 B;  4NFT A;  3B6G D;  3B0D B;  2JSS A;  3AV1 C;  2NQB A;  1H3O B;  3B6F B;  5JA4 A;  3WKJ A;  1F66 A;  1P3I A;  3P5J B;  2BYK A;  3MGQ B;  1P3P A;  3AFA A;  4YM6 B;  4NE6 A;  4J8W C;  5E5A A;  4CAY B;  1EQZ C;  5G49 B;  2JE5 A;  1N1J A;  1BFM A;  4DRA A;  3AZI C;  2IO5 C;  1M19 A;  3MGS B;  5BNX B;  3W96 C;  3KWQ D;  2PYO C;  5GSU C;  2F8N D;  2Y2Q A;  5GT0 A;  5B2J D;  5JA4 B;  3AZJ A;  3B0C T;  4WU9 C;  3MVD B;  3AZK C;  1P3I B;  5AVB D;  2BYK B;  1P3B A;  3AFA B;  5E5A B;  3REK A;  4KUD C;  2RVQ C;  1P3G D;  1N1J B;  3WAA C;  3AZL C;  5B2J B;  3AZN C;  3UTB B;  1P3A D;  5B1L C;  4LD9 C;  5AV9 D;  5GT0 B;  5AVB B;  3X1V D;  2FJ7 B;  2BG1 A;  4Z2M H;  1P3K A;  4J8X C;  3REH C;  5AVC C;  3W98 A;  3LZ0 B;  3MGP C;  2JCH A;  5JRG D;  1P3G B;  2F8N H;  3O62 D;  5AV6 D;  1ID3 A;  4XZQ A;  5CP6 C;  3LZ1 D;  4Z66 C;  3AZG D;  3X1V B;  1P3M C;  2ZY5 A;  3MGR A;  1P3O D;  5AV8 A;  5B0Z A;  3X1T B;  5JRG B;  1ZLA A;  3KSY A;  3MNN A;  1W2E A;  2XD1 A;  1T3U A;  5DNN C;  3AN2 A;  1P3F C;  1KX3 A;  1M18 D;  1ID3 B;  3UTA A;  5B33 A;  4YS3 D;  4H9S A;  5DNM D;  3MGR B;  3AZH D;  5B0Y A;  1U35 B;  5B31 C;  4WU8 A;  4KGC B;  4ZUX D;  1TZY B;  3AZE A;  4AWL B;  5C3I C;  4H9Q B;  1P3L A;  3V9R A;  1Z2C B;  5B2I D;  4R8P B;  1P34 D;  4JJN D;  3X1S D;  3AZM C;  3AZF A;  4WU8 B;  3EPL A;  3B0B A;  3REL D;  5F99 C;  4G92 B;  1P3L B;  5BS7 C;  4E45 A;  5B32 C;  2F2A C;  3C1C C;  4UPK A;  4KHA A;  1KX4 B;  3C1B C;  4J8U A;  5CPJ D;  4J8W A;  1EQZ A;  3A6N B;  1F1E A;  1KX5 D;  3AZI A;  1P3B C;  3AV1 B;  3W96 A;  2PYO A;  5GSU A;  4UUZ A;  4WU9 A;  1M1A C;  3B0C W;  2CWE A;  3LJA C;  3AZK A;  3UT9 D;  2FFF B;  5GXQ C;  1KX5 B;  3WAA A;  3AZL A;  3AZI B;  4LD9 A;  5B1L A;  3VH6 A;  4WU9 B;  4J8V C;  3REJ C;  3AZK B;  2YFW A;  2YFV A;  4H9N A;  4J8X A;  3REH A;  5AVC A;  4XZQ C;  2CV5 C;  3TU4 D;  4X23 C;  4QLC D;  1WWI A;  4KUD B;  5KDM A;  3WA9 B;  5B24 A;  3AZN B;  5CP6 A;  1P3A C;  4Z5T D;  5B1L B;  2DF4 C;  1P3M A;  5AV9 C;  2ARO D;  3AN2 C;  3REI B;  3W99 D;  4QLC B;  3UTA C;  4WNN B;  3MGP B;  4H9S C;  4DRB A;  4DQY B;  5B1M D;  5DNN A;  1P3F A;  1HQ3 B;  3EG5 B;  5CHL B;  3AZE C;  3LZ1 C;  2L5A A;  4Z66 B;  5FUG A;  5AY8 D;  3KXB B;  3VH5 T;  5B40 A;  5B31 A;  3B6F D;  3KUY D;  1WWS A;  5CPK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...