3AZLA

Crystal structure of human nucleosome core particle containing h4k77q mutation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azlA00
1Q9CA 3VH5W 1F66B 5AVCB 5B0ZC 3LZ0D 3C1CD 5CP6B 3AV1A 4H9SA 5B2JA 3W96C 3X1UC 5B0YA 3AZKD 3WTPE 5E5AC 1KX3A 1ZLAC 5GSUD 5BNXB 5B31C 3MGRA 1P3FC 4J8XD 5B40D 5B32C 1KX4B 3REHC 5G49B 2CV5D 1P3IB 4R8PD 4WU9C 4G91B 3LZ1B 3AZJD 3WA9B 3AZFB 4WU8A 3VH6T 1BH9B 2HUEC 5CPJD 1M19C 3B6GA 4Z66D 4E45A 4AWLC 2FJ7D 4KUDC 4Z5TC 3C1BB 2PYOB 5JRGC 1P3KD 3NQJB 1P3MB 5BT1C 5AVCC 3X1TA 3R45A 5CP6C 1P3LB 3VH5A 3WTPD 3AZID 2NZDA 4KHAB 5B0ZD 1M18D 3X1UD 3MNNA 2F8NK 3AFAB 3AZHB 1ZLAD 3B6FB 4J8VB 5B33A 1KX4C 3LELB 1P3FD 3O62A 4NE3A 4YM6A 3A6ND 3WAAB 1P3IC 4XZQA 4G91C 5B24A 3MGPA 1P3PB 3LZ1C 3NQUB 3KWQD 4ZUXA 3B0BA 4WU9D 5AVBA 5DNNB 3WA9C 2HIOB 1H3OA 5AV8A 3REIB 3AZFC 3AN2D 1P3GD 5GT0D 3REJB 5B31G 3C1BC 2PYOC 2CWEA 3LJAA 1M19D 5B32G 1BH8B 4KUDD 3X1SD 4Z5TD 2F8NB 5JRGD 3AZGB 5KDMA 1P3LC 1F66D 5AVCD 3LZ0A 3C1CA 3MGSB 3MVDB 5CP6D 1EQZB 3AFAC 3AZHC 5GSUA 3B6FC 3REKB 4J8VC 3W98B 4H9QA 3LELC 4J8XA 5B40A 4X23B 1JFIB 4QLCB 1KX4D 3WAAC 3UTBB 3B0CW 2BYKB 2CV5A 1P3PC 4NFTA 4R8PA 5DNNC 3UTAB 2HIOC 3REIC 4CSRA 1P3BB 3REJC 1HQ3D 4KGCB 5FUGA 5CPJA 1TAFA 2PYOD 3AZGC 1P3KA 2NQBC 5AY8B 1P3MD 5B2IB 4J8WD 3MGSC 3MVDC 1P3LD 1EQZC 3WKJB 1ULYA 3WTPA 3AZIA 5DNMB 3AZLD 3REKC 5B0ZA 3W98C 1M18A 3X1UA 1M1AB 4HGAB 1ZLAA 4X23C 3AFAD 3AZHD 3B6FD 4J8VD 4QLCC 1P3FA 2NQBB 3UTBC 2BYMB 3A6NA 4J8UC 3RELA 4JJND 5F99D 5GXQD 1P3PD 3KWQA 3AV2B 4WU9A 1P3BC 5DNND 5CPKB 4KGCC 2HIOD 3REID 3AN2A 4ZBJB 1P3GA 5GT0A 3REJD 2YFVB 3KXBB 1M19A 5B1MB 4KUDA 3X1SA 5AY8C 4Z5TA 5JRGA 5B2IC 2F8ND 1F66A 3AZGD 3WKJC 5DNMC 5AVCA 5CP6A 3MGSD 1M1AC 3V9RB 3W97B 3REKD 3W98D 3X1VB 2AROB 3AYWA 1P3AB 5AV9B 1U35B 1KX4A 4QLCD 5BO0A 5G49A 3UTBD 4CAYB 2F8NG 5CPIB 2RVQD 3AV2C 3W99D 5B1LB 3UTAD 5CPKC 4ZBJC 1P3BD 1HQ3A 4KGCD 3KSYA 1BH9A 4H9NB 3KXBC 5B1MC 2JSSA 5AV5B 3VH5T 3NQJA 1P3MA 5AV6B 4J8WA 5B2ID 5JA4A 1P3LA 3W97C 3WKJD 3AZLA 5DNMD 3UT9B 3MGQD 3X1VC 2AROC 5B0YB 3AFAA 4H9RB 3TU4B 3AZHA 3B6FA 1P3AC 5AV9C 1U35C 2NQBD 4H9PA 4WZSB 3W96D 5E5AD 5CPIC 4JJNA 5B31D 5F99A 5B1LC 5GXQA 1P3PA 3NQUA 5B32D 3AV2D 3REHD 5DNNA 2HIOA 3REIA 5CPKD 3REJA 1N1JA 1KX5B 1KU5A 3KXBD 5B1MD 5GT3B 5AV5C 1BH8A 4LD9B 5AV6C 2F8NA 1WWIA 3AZGA 3X1TB 1B67A 3UT9C 3B0DB 3MGSA 2F8NH 4H9SC 5B0YC 3TU4C 3REKA 3W98A 3MNNB 5BT1D 2AROD 1JFIA 1P3OB 5B33B 3AZKA 1P3AD 4QLCA 3O62B 3AZEB 2LY8A 3W99A 3KUYB 5B24B 3UTAA 4J8UB 1P3BA 1P3ID 4KGCA 4UUZA 4EO5B 5BS7C 1KX5C 3LZ1D 3AZJA 5GT3C 1A7WA 3WA9D 4LD9C 3AZFD 5AV5D 4G92B 4Z66A 3AZMB 3X1TC 5B2IA 2FJ7A 3B0DC 3C1BD 1AOIB 5DNMA 3UT9D 3MGQA 3MNNC 3TU4D 1P3OC 4Z2MG 5B33C 4J8XB 2NQBA 3O62C 3AZEC 4YM6C 3W96A 5E5AA 3B0CT 3AZNB 5B31A 3LELD 3KUYC 5B24C 5B32A 4R8PB 3AV2A 3REHA 3WAAD 1S32B 5CPKA 4EO5C 4YS3B 2YFVA 1KX5D 4NE5A 3KXBA 5CPJB 3LJAC 5B1MA 5BNVB 1TAFB 5GT3D 4G92C 3AZMC 4LD9D 1P3KB 1AOIC 2IO5B 3V9RA 3WTPB 3AZIB 1ID3B 1M18B 4J8XC 2AROA 3MVDD 1P3AA 1P3OD 1EQZD 5BNXA 3AZNC 4XUJB 3AZED 4X23D 3RELB 4R8PC 2YFWB 3KUYD 1S32C 3KWQB 4WNNB 1R4VA 4J8UD 4YS3C 1P3IA 3AN2B 1P3GB 4H9OB 3LZ1A 5GT0B 4H9NA 5CPJC 1P34B 3WA9A 4Z2MH 4M6BA 3AZFA 1P3KC 5AV5A 3X1SB 3VH6W 3AZMD 1TZYB 3C1BA 2PYOA 2IO5C 3WTPC 3AZIC 1AOID 1ID3C 3UT9A 1M18C 5AY8D 4H9RA 3TU4A 4KHAA 3AV1B 4XUJC 5B2JB 3AYWB 1M1AD 3A6NC 5BO0B 1KX3B 4J8VA 3RELC 3AZND 3LELA 3MGRB 5C3IB 3KWQC 2L5AA 3WAAA 1S32D 3AN2C 1P3GC 5GT0C 1P34C 4YS3D 1HQ3B 5BS7A 1KX5A 4DRAA 5GT3A 3X1SC 4LD9A 4WU8B 1TZYC 1F66C 3B6GB 4J8WB 3VH6A 5JA4B 1HTAA 1BFMA 3AZLB 1ID3D 3R45B 3AV1C 3MVDA 5B2JC 3AYWC 1P3OA 1EQZA 3W97D 1KX3C 2NZDB 4H9PB 3AZEA 4XUJD 3MGRC 3X1VD 5C3IC 4X23A 4JJNB 5AV9D 3RELD 5F99B 1U35D 5GXQB 3KUYA 4YM6B 3UTBA 2BYKA 4J8UA 5CPID 1HQ3C 4XZQB 5B1LD 3MGPB 1WWSA 1P34D 4ZUXB 1N1JB 5AVBB 1H3OB 5AV8B 4WU8C 3B6GC 1P3MC 3AZMA 4J8WC 1F1EA 1TZYD 3LJAB 1AOIA 3AZLC 5AY8A 5AV6D 5KDMB 3WKJA 2NZDC 3C1CB 3LZ0B 3AV1D 5B2JD 3AYWD 3AZKB 1M1AA 5B0YD 5GSUB 1KX3D 4JJNC 3AZNA 4H9QB 5F99C 5GXQC 3MGRD 5B40B 2BYMA 3W99B 1S32A 4XZQC 3MGPC 2CV5B 4YS3A 4ZUXC 5AVBC 4UUZB 4DRBA 5AV8C 3AZJB 5BNVA 4CSRB 4WU8D 5FUGB 3B6GD 4Z66B 2FJ7B 5CHLB 4WV4B 1ID3A 3MGQB 3X1TD 3LZ0C 3C1CC 3AZKC 3W97A 4E44A 5GSUC 2NZDD 5B0ZB 4NE6A 4XUJA 3X1UB 3W96B 3X1VA 3MNND 1ZLAB 5E5AB 5B40C 2RVQC 3W99C 5B31B 2YFWA 5B33D 5AV9A 1U35A 1P3FB 3UTAC 3O62D 4YM6D 4WNNA 5B32B 4CAYA 3A6NB 1B6WA 3REHB 2CV5C 5CPIA 5B1LA 4XZQD 3MGPD 5B24D 4H9OA 1P34A 3AZJC 4ZUXD 4WU9B 5AVBD 5AV8D 4Z66C 2FJ7C 1TZYA 2HUEB 3LJAD 1M19B 4AWLB 4KUDB 4Z5TB 3MGQC 5AV6A 5JRGB 4HGAC
chains in the Genus database with same CATH superfamily
1Q9CA 3VH5W 1F66B 5AVCB 5B0ZC 3LZ0D 3C1CD 5CP6B 3AV1A 4H9SA 5B2JA 3W96C 3X1UC 5B0YA 3AZKD 3WTPE 5E5AC 1KX3A 1ZLAC 5GSUD 5BNXB 5B31C 3MGRA 1P3FC 4J8XD 5B40D 3EPHA 5B32C 1KX4B 3REHC 5G49B 4DQYB 2CV5D 1P3IB 4R8PD 4WU9C 4G91B 2DF4C 3LZ1B 3AZJD 2Y2PA 3WA9B 3AZFB 4WU8A 3VH6T 1BH9B 2HUEC 5CPJD 1M19C 1PZRA 3B6GA 4Z66D 4E45A 4AWLC 2FJ7D 4KUDC 4Z5TC 3C1BB 2PYOB 5JRGC 2ZY5A 1P3KD 3NQJB 1P3MB 5BT1C 5AVCC 3X1TA 3R45A 5CP6C 1P3LB 3VH5A 3WTPD 3AZID 2NZDA 4KHAB 5B0ZD 1M18D 3X1UD 3MNNA 2F8NK 3AFAB 3AZHB 1ZLAD 3B6FB 4J8VB 5B33A 3EPJA 1KX4C 3LELB 1P3FD 3O62A 4NE3A 4YM6A 3A6ND 3A1IA 3WAAB 1P3IC 4XZQA 4G91C 5B24A 3MGPA 1P3PB 3F6TA 3LZ1C 3NQUB 3KWQD 4ZUXA 3B0BA 4WU9D 5AVBA 5DNNB 3WA9C 2HIOB 1H3OA 5AV8A 3REIB 3AZFC 3AN2D 1P3GD 5GT0D 2RIQA 3REJB 5B31G 3C1BC 2PYOC 2CWEA 3LJAA 1M19D 5B32G 1BH8B 4KUDD 3X1SD 4Z5TD 2F8NB 5JRGD 3AZGB 5KDMA 1P3LC 1F66D 5AVCD 3LZ0A 3C1CA 3MGSB 3MVDB 5CP6D 1EQZB 3AFAC 3AZHC 5GSUA 3B6FC 3REKB 4J8VC 3W98B 4H9QA 3LELC 4J8XA 3IP4C 5B40A 4X23B 1JFIB 4QLCB 1KX4D 3WAAC 3UTBB 3B0CW 2BYKB 2CV5A 1P3PC 4NFTA 4R8PA 2VQRA 5DNNC 3UTAB 2HIOC 3REIC 2G5IC 4CSRA 1P3BB 3REJC 1HQ3D 4KGCB 5FUGA 5CPJA 1TAFA 2PYOD 3AZGC 1P3KA 2NQBC 5AY8B 1P3MD 5B2IB 4J8WD 3MGSC 3MVDC 1P3LD 1EQZC 3WKJB 1ULYA 3WTPA 3AZIA 5DNMB 3AZLD 3REKC 5B0ZA 3W98C 1M18A 3X1UA 1M1AB 4HGAB 1ZLAA 4X23C 3AFAD 3AZHD 3B6FD 4J8VD 4QLCC 1P3FA 2NQBB 3UTBC 2BYMB 2Y2QA 3A6NA 4WJ3C 4J8UC 3RELA 4JJND 5F99D 5GXQD 1P3PD 3KWQA 3AV2B 3EPKA 4WU9A 1P3BC 5DNND 5CPKB 4KGCC 2HIOD 3REID 3AN2A 4ZBJB 1P3GA 5GT0A 3REJD 2YFVB 3KXBB 1M19A 5B1MB 4KUDA 3X1SA 5AY8C 4Z5TA 5JRGA 5B2IC 2F8ND 1F66A 3AZGD 3WKJC 5DNMC 5AVCA 5CP6A 3MGSD 1M1AC 3V9RB 3W97B 3REKD 3W98D 3X1VB 2AROB 3AYWA 1P3AB 5AV9B 1U35B 1KX4A 4QLCD 5BO0A 5G49A 3UTBD 4CAYB 2F8NG 5CPIB 2RVQD 3AV2C 3W99D 5B1LB 3UTAD 5CPKC 4ZBJC 1P3BD 1HQ3A 4KGCD 3KSYA 3P5JB 1BH9A 4H9NB 3KXBC 5B1MC 2JSSA 5AV5B 3VH5T 3NQJA 1P3MA 5AV6B 4J8WA 5B2ID 5JA4A 2XD1A 1P3LA 3W97C 3WKJD 3AZLA 5DNMD 3UT9B 3MGQD 5B0YB 2AROC 3X1VC 3AFAA 4H9RB 3TU4B 3AZHA 3B6FA 1P3AC 5AV9C 1U35C 1Z2CB 2NQBD 4H9PA 2JE5A 4WZSB 3W96D 5E5AD 5CPIC 4JJNA 5B31D 5F99A 5B1LC 5GXQA 1P3PA 3NQUA 5B32D 3AV2D 3REHD 5DNNA 2HIOA 3REIA 5CPKD 3REJA 1N1JA 1KX5B 1KU5A 3KXBD 5B1MD 5GT3B 5AV5C 2Y2NA 1BH8A 4LD9B 5AV6C 2F8NA 2ZM5A 1WWIA 3AZGA 3X1TB 1B67A 3UT9C 3B0DB 3MGSA 2F8NH 4H9SC 5B0YC 3TU4C 3REKA 3H0LC 3W98A 3H0RC 3MNNB 5BT1D 2AROD 1JFIA 1P3OB 5B33B 3AZKA 1P3AD 4QLCA 3O62B 3AZEB 2LY8A 3W99A 2BG1A 3KUYB 5B24B 3UTAA 4J8UB 1P3BA 4UPKA 1P3ID 4KGCA 3AL0C 4UUZA 4EO5B 5BS7C 1KX5C 3LZ1D 3AZJA 5GT3C 1A7WA 3WA9D 2ZY3A 4LD9C 3AZFD 5AV5D 4G92B 4Z66A 3AZMB 3X1TC 5B2IA 2FJ7A 3B0DC 3C1BD 2Y2HA 1AOIB 5DNMA 3UT9D 3MGQA 3MNNC 3TU4D 1P3OC 4Z2MG 5B33C 3KFUG 4J8XB 2NQBA 3O62C 3AZEC 4YM6C 3W96A 5E5AA 3B0CT 2ZY2A 3AZNB 5B31A 3LELD 3KUYC 5B24C 2Y2LA 5B32A 4R8PB 3AV2A 3REHA 3WAAD 1S32B 5CPKA 4EO5C 4YS3B 2YFVA 1KX5D 1T3UA 4NE5A 3KXBA 5CPJB 3LJAC 5B1MA 5BNVB 1TAFB 5GT3D 4G92C 3AZMC 4LD9D 1P3KB 1AOIC 2IO5B 3V9RA 3WTPB 3AZIB 2JCHA 1ID3B 1M18B 4J8XC 2AROA 2FFFB 3MVDD 1P3AA 1P3OD 2Y2IA 1EQZD 5BNXA 3AZNC 4XUJB 3AZED 4X23D 3RELB 4R8PC 2YFWB 3KUYD 1S32C 3KWQB 4WNNB 1R4VA 4J8UD 4YS3C 1P3IA 3AN2B 1P3GB 4H9OB 3LZ1A 5GT0B 4H9NA 5CPJC 1P34B 3WA9A 4Z2MH 4M6BA 3AZFA 1P3KC 5AV5A 3X1SB 3VH6W 3AZMD 2F2AC 1TZYB 3C1BA 2PYOA 2Y2MA 2IO5C 3WTPC 3AZIC 1AOID 1ID3C 3UT9A 2Y2GA 1M18C 5AY8D 4H9RA 3TU4A 2Y2OA 4KHAA 3AV1B 4XUJC 5B2JB 3AYWB 1M1AD 3A6NC 5BO0B 1KX3B 2DQNC 4J8VA 3RELC 3AZND 3LELA 3MGRB 2ZY4A 5C3IB 3KWQC 2J8PA 2L5AA 3WAAA 1S32D 3AN2C 1P3GC 5GT0C 1P34C 4YS3D 1HQ3B 5BS7A 1KX5A 3EPLA 4DRAA 5GT3A 3X1SC 4LD9A 4WU8B 1TZYC 1F66C 3B6GB 4J8WB 3VH6A 5JA4B 1HTAA 1BFMA 3AZLB 1ID3D 3R45B 3AV1C 3MVDA 5B2JC 3AYWC 1P3OA 1EQZA 3W97D 1KX3C 2NZDB 2Y2JA 4H9PB 3AZEA 4XUJD 3MGRC 3X1VD 5C3IC 4X23A 4JJNB 2W8SA 5AV9D 5F99B 3RELD 1U35D 5GXQB 3KUYA 2XD5A 4YM6B 3UTBA 2BYKA 4J8UA 5CPID 1HQ3C 4XZQB 5B1LD 3MGPB 1WWSA 1P34D 4ZUXB 1N1JB 2G5HC 5AVBB 3H0MC 1H3OB 5AV8B 4WU8C 3B6GC 1P3MC 3AZMA 4J8WC 1F1EA 1TZYD 3LJAB 1AOIA 3AZLC 5AY8A 5AV6D 2UWXA 5KDMB 3WKJA 2NZDC 3C1CB 3LZ0B 3AV1D 5B2JD 3AYWD 3AZKB 1M1AA 5B0YD 5GSUB 1KX3D 4JJNC 3AZNA 4H9QB 5F99C 5GXQC 3MGRD 5B40B 2BYMA 3W99B 2Y2KA 1S32A 4XZQC 3MGPC 2CV5B 4YS3A 4ZUXC 5AVBC 1W2EA 4UUZB 4DRBA 5AV8C 3AZJB 5BNVA 4CSRB 4WU8D 5FUGB 3B6GD 4Z66B 2FJ7B 5CHLB 4WV4B 1ID3A 3MGQB 3X1TD 3LZ0C 3C1CC 3AZKC 3W97A 4E44A 5GSUC 2NZDD 5B0ZB 3FDDA 4NE6A 4XUJA 3X1UB 3W96B 3X1VA 3MNND 1ZLAB 5E5AB 5B40C 2RVQC 3W99C 5B31B 2YFWA 5B33D 5AV9A 1U35A 1P3FB 3UTAC 3O62D 4YM6D 4WNNA 5B32B 4CAYA 3A6NB 1B6WA 3REHB 2CV5C 5CPIA 5B1LA 4XZQD 3MGPD 5B24D 4H9OA 3A1KA 1P34A 3AZJC 4ZUXD 4WU9B 5AVBD 5AV8D 4Z66C 2FJ7C 1TZYA 2HUEB 3EG5B 3LJAD 1M19B 4AWLB 4KUDB 4Z5TB 3MGQC 5AV6A 5JRGB 4HGAC
chains in the Genus database with same CATH topology
1Q9CA 3VH5W 1F66B 5AVCB 5B0ZC 3LZ0D 3C1CD 5CP6B 3AV1A 4H9SA 5B2JA 3W96C 3X1UC 5B0YA 3AZKD 3WTPE 5E5AC 1KX3A 1ZLAC 5GSUD 5BNXB 5B31C 3MGRA 1P3FC 4J8XD 5B40D 3EPHA 5B32C 1KX4B 3REHC 5G49B 4DQYB 2CV5D 1P3IB 4R8PD 4WU9C 4G91B 2DF4C 3LZ1B 3AZJD 2Y2PA 3WA9B 3AZFB 4WU8A 3VH6T 1BH9B 2HUEC 5CPJD 1M19C 1PZRA 3B6GA 4Z66D 4E45A 4AWLC 2FJ7D 4KUDC 4Z5TC 3C1BB 2PYOB 5JRGC 2ZY5A 1P3KD 3NQJB 1P3MB 5BT1C 5AVCC 3X1TA 3R45A 5CP6C 1P3LB 3VH5A 3WTPD 3AZID 2NZDA 4KHAB 5B0ZD 1M18D 3X1UD 3MNNA 2F8NK 3AFAB 3AZHB 1ZLAD 3B6FB 4J8VB 5B33A 3EPJA 1KX4C 3LELB 1P3FD 3O62A 4NE3A 4YM6A 3A6ND 3A1IA 3WAAB 1P3IC 4XZQA 4G91C 5B24A 3MGPA 1P3PB 3F6TA 3LZ1C 3NQUB 3KWQD 4ZUXA 3B0BA 4WU9D 5AVBA 5DNNB 3WA9C 2HIOB 1H3OA 5AV8A 3REIB 3AZFC 3AN2D 1P3GD 5GT0D 2RIQA 3REJB 5B31G 3C1BC 2PYOC 2CWEA 3LJAA 1M19D 5B32G 1BH8B 4KUDD 3X1SD 4Z5TD 2F8NB 5JRGD 3AZGB 5KDMA 1P3LC 1F66D 5AVCD 3LZ0A 3C1CA 3MGSB 3MVDB 5CP6D 1EQZB 3AFAC 3AZHC 5GSUA 3B6FC 3REKB 4J8VC 3W98B 4H9QA 3LELC 4J8XA 3IP4C 5B40A 4X23B 1JFIB 4QLCB 1KX4D 3WAAC 3UTBB 3B0CW 2BYKB 2CV5A 1P3PC 4NFTA 4R8PA 2VQRA 5DNNC 3UTAB 2HIOC 3REIC 2G5IC 4CSRA 1P3BB 3REJC 1HQ3D 4KGCB 5FUGA 5CPJA 1TAFA 2PYOD 3AZGC 1P3KA 2NQBC 5AY8B 1P3MD 5B2IB 4J8WD 3MGSC 3MVDC 1P3LD 1EQZC 3WKJB 1ULYA 3WTPA 3AZIA 5DNMB 3AZLD 3REKC 5B0ZA 3W98C 1M18A 3X1UA 1M1AB 4HGAB 1ZLAA 4X23C 3AFAD 3AZHD 3B6FD 4J8VD 4QLCC 1P3FA 2NQBB 3UTBC 2BYMB 2Y2QA 3A6NA 4WJ3C 4J8UC 3RELA 4JJND 5F99D 5GXQD 1P3PD 3KWQA 3AV2B 3EPKA 4WU9A 1P3BC 5DNND 5CPKB 4KGCC 2HIOD 3REID 3AN2A 4ZBJB 1P3GA 5GT0A 3REJD 2YFVB 3KXBB 1M19A 5B1MB 4KUDA 3X1SA 5AY8C 4Z5TA 5JRGA 5B2IC 2F8ND 1F66A 3AZGD 3WKJC 5DNMC 5AVCA 5CP6A 3MGSD 1M1AC 3V9RB 3W97B 3REKD 3W98D 3X1VB 2AROB 3AYWA 1P3AB 5AV9B 1U35B 1KX4A 4QLCD 5BO0A 5G49A 3UTBD 4CAYB 2F8NG 5CPIB 2RVQD 3AV2C 3W99D 5B1LB 3UTAD 5CPKC 4ZBJC 1P3BD 1HQ3A 4KGCD 3KSYA 3P5JB 1BH9A 4H9NB 3KXBC 5B1MC 2JSSA 5AV5B 3VH5T 3NQJA 1P3MA 5AV6B 4J8WA 5B2ID 5JA4A 2XD1A 1P3LA 3W97C 3WKJD 3AZLA 5DNMD 3UT9B 3MGQD 5B0YB 2AROC 3X1VC 3AFAA 4H9RB 3TU4B 3AZHA 3B6FA 1P3AC 5AV9C 1U35C 1Z2CB 2NQBD 4H9PA 2JE5A 4WZSB 3W96D 5E5AD 5CPIC 4JJNA 5B31D 5F99A 5B1LC 5GXQA 1P3PA 3NQUA 5B32D 3AV2D 3REHD 5DNNA 2HIOA 3REIA 5CPKD 3REJA 1N1JA 1KX5B 1KU5A 3KXBD 5B1MD 5GT3B 5AV5C 2Y2NA 1BH8A 4LD9B 5AV6C 2F8NA 2ZM5A 1WWIA 3AZGA 3X1TB 1B67A 3UT9C 3B0DB 3MGSA 2F8NH 4H9SC 5B0YC 3TU4C 3REKA 3H0LC 3W98A 3H0RC 3MNNB 5BT1D 2AROD 1JFIA 1P3OB 5B33B 3AZKA 1P3AD 4QLCA 3O62B 3AZEB 2LY8A 3W99A 2BG1A 3KUYB 5B24B 3UTAA 4J8UB 1P3BA 4UPKA 1P3ID 4KGCA 3AL0C 4UUZA 4EO5B 5BS7C 1KX5C 3LZ1D 3AZJA 5GT3C 1A7WA 3WA9D 2ZY3A 4LD9C 3AZFD 5AV5D 4G92B 4Z66A 3AZMB 3X1TC 5B2IA 2FJ7A 3B0DC 3C1BD 2Y2HA 1AOIB 5DNMA 3UT9D 3MGQA 3MNNC 3TU4D 1P3OC 4Z2MG 5B33C 3KFUG 4J8XB 2NQBA 3O62C 3AZEC 4YM6C 3W96A 5E5AA 3B0CT 2ZY2A 3AZNB 5B31A 3LELD 3KUYC 5B24C 2Y2LA 5B32A 4R8PB 3AV2A 3REHA 3WAAD 1S32B 5CPKA 4EO5C 4YS3B 2YFVA 1KX5D 1T3UA 4NE5A 3KXBA 5CPJB 3LJAC 5B1MA 5BNVB 1TAFB 5GT3D 4G92C 3AZMC 4LD9D 1P3KB 1AOIC 2IO5B 3V9RA 3WTPB 3AZIB 2JCHA 1ID3B 1M18B 4J8XC 2AROA 2FFFB 3MVDD 1P3AA 1P3OD 2Y2IA 1EQZD 5BNXA 3AZNC 4XUJB 3AZED 4X23D 3RELB 4R8PC 2YFWB 3KUYD 1S32C 3KWQB 4WNNB 1R4VA 4J8UD 4YS3C 1P3IA 3AN2B 1P3GB 4H9OB 3LZ1A 5GT0B 4H9NA 5CPJC 1P34B 3WA9A 4Z2MH 4M6BA 3AZFA 1P3KC 5AV5A 3X1SB 3VH6W 3AZMD 2F2AC 1TZYB 3C1BA 2PYOA 2Y2MA 2IO5C 3WTPC 3AZIC 1AOID 1ID3C 3UT9A 2Y2GA 1M18C 5AY8D 4H9RA 3TU4A 2Y2OA 4KHAA 3AV1B 4XUJC 5B2JB 3AYWB 1M1AD 3A6NC 5BO0B 1KX3B 2DQNC 4J8VA 3RELC 3AZND 3LELA 3MGRB 2ZY4A 5C3IB 3KWQC 2J8PA 2L5AA 3WAAA 1S32D 3AN2C 1P3GC 5GT0C 1P34C 4YS3D 1HQ3B 5BS7A 1KX5A 3EPLA 4DRAA 5GT3A 3X1SC 4LD9A 4WU8B 1TZYC 1F66C 3B6GB 4J8WB 3VH6A 5JA4B 1HTAA 1BFMA 3AZLB 1ID3D 3R45B 3AV1C 3MVDA 5B2JC 3AYWC 1P3OA 1EQZA 3W97D 1KX3C 2NZDB 2Y2JA 4H9PB 3AZEA 4XUJD 3MGRC 3X1VD 5C3IC 4X23A 4JJNB 2W8SA 5AV9D 5F99B 3RELD 1U35D 5GXQB 3KUYA 2XD5A 4YM6B 3UTBA 2BYKA 4J8UA 5CPID 1HQ3C 4XZQB 5B1LD 3MGPB 1WWSA 1P34D 4ZUXB 1N1JB 2G5HC 5AVBB 3H0MC 1H3OB 5AV8B 4WU8C 3B6GC 1P3MC 3AZMA 4J8WC 1F1EA 1TZYD 3LJAB 1AOIA 3AZLC 5AY8A 5AV6D 2UWXA 5KDMB 3WKJA 2NZDC 3C1CB 3LZ0B 3AV1D 5B2JD 3AYWD 3AZKB 1M1AA 5B0YD 5GSUB 1KX3D 4JJNC 3AZNA 4H9QB 5F99C 5GXQC 3MGRD 5B40B 2BYMA 3W99B 2Y2KA 1S32A 4XZQC 3MGPC 2CV5B 4YS3A 4ZUXC 5AVBC 1W2EA 4UUZB 4DRBA 5AV8C 3AZJB 5BNVA 4CSRB 4WU8D 5FUGB 3B6GD 4Z66B 2FJ7B 5CHLB 4WV4B 1ID3A 3MGQB 3X1TD 3LZ0C 3C1CC 3AZKC 3W97A 4E44A 5GSUC 2NZDD 5B0ZB 3FDDA 4NE6A 4XUJA 3X1UB 3W96B 3X1VA 3MNND 1ZLAB 5E5AB 5B40C 2RVQC 3W99C 5B31B 2YFWA 5B33D 5AV9A 1U35A 1P3FB 3UTAC 3O62D 4YM6D 4WNNA 5B32B 4CAYA 3A6NB 1B6WA 3REHB 2CV5C 5CPIA 5B1LA 4XZQD 3MGPD 5B24D 4H9OA 3A1KA 1P34A 3AZJC 4ZUXD 4WU9B 5AVBD 5AV8D 4Z66C 2FJ7C 1TZYA 2HUEB 3EG5B 3LJAD 1M19B 4AWLB 4KUDB 4Z5TB 3MGQC 5AV6A 5JRGB 4HGAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9C A;  3VH5 W;  1F66 B;  5AVC B;  5B0Z C;  3LZ0 D;  3C1C D;  5CP6 B;  3AV1 A;  4H9S A;  5B2J A;  3W96 C;  3X1U C;  5B0Y A;  3AZK D;  3WTP E;  5E5A C;  1KX3 A;  1ZLA C;  5GSU D;  5BNX B;  5B31 C;  3MGR A;  1P3F C;  4J8X D;  5B40 D;  5B32 C;  1KX4 B;  3REH C;  5G49 B;  2CV5 D;  1P3I B;  4R8P D;  4WU9 C;  4G91 B;  3LZ1 B;  3AZJ D;  3WA9 B;  3AZF B;  4WU8 A;  3VH6 T;  1BH9 B;  2HUE C;  5CPJ D;  1M19 C;  3B6G A;  4Z66 D;  4E45 A;  4AWL C;  2FJ7 D;  4KUD C;  4Z5T C;  3C1B B;  2PYO B;  5JRG C;  1P3K D;  3NQJ B;  1P3M B;  5BT1 C;  5AVC C;  3X1T A;  3R45 A;  5CP6 C;  1P3L B;  3VH5 A;  3WTP D;  3AZI D;  2NZD A;  4KHA B;  5B0Z D;  1M18 D;  3X1U D;  3MNN A;  2F8N K;  3AFA B;  3AZH B;  1ZLA D;  3B6F B;  4J8V B;  5B33 A;  1KX4 C;  3LEL B;  1P3F D;  3O62 A;  4NE3 A;  4YM6 A;  3A6N D;  3WAA B;  1P3I C;  4XZQ A;  4G91 C;  5B24 A;  3MGP A;  1P3P B;  3LZ1 C;  3NQU B;  3KWQ D;  4ZUX A;  3B0B A;  4WU9 D;  5AVB A;  5DNN B;  3WA9 C;  2HIO B;  1H3O A;  5AV8 A;  3REI B;  3AZF C;  3AN2 D;  1P3G D;  5GT0 D;  3REJ B;  5B31 G;  3C1B C;  2PYO C;  2CWE A;  3LJA A;  1M19 D;  5B32 G;  1BH8 B;  4KUD D;  3X1S D;  4Z5T D;  2F8N B;  5JRG D;  3AZG B;  5KDM A;  1P3L C;  1F66 D;  5AVC D;  3LZ0 A;  3C1C A;  3MGS B;  3MVD B;  5CP6 D;  1EQZ B;  3AFA C;  3AZH C;  5GSU A;  3B6F C;  3REK B;  4J8V C;  3W98 B;  4H9Q A;  3LEL C;  4J8X A;  5B40 A;  4X23 B;  1JFI B;  4QLC B;  1KX4 D;  3WAA C;  3UTB B;  3B0C W;  2BYK B;  2CV5 A;  1P3P C;  4NFT A;  4R8P A;  5DNN C;  3UTA B;  2HIO C;  3REI C;  4CSR A;  1P3B B;  3REJ C;  1HQ3 D;  4KGC B;  5FUG A;  5CPJ A;  1TAF A;  2PYO D;  3AZG C;  1P3K A;  2NQB C;  5AY8 B;  1P3M D;  5B2I B;  4J8W D;  3MGS C;  3MVD C;  1P3L D;  1EQZ C;  3WKJ B;  1ULY A;  3WTP A;  3AZI A;  5DNM B;  3AZL D;  3REK C;  5B0Z A;  3W98 C;  1M18 A;  3X1U A;  1M1A B;  4HGA B;  1ZLA A;  4X23 C;  3AFA D;  3AZH D;  3B6F D;  4J8V D;  4QLC C;  1P3F A;  2NQB B;  3UTB C;  2BYM B;  3A6N A;  4J8U C;  3REL A;  4JJN D;  5F99 D;  5GXQ D;  1P3P D;  3KWQ A;  3AV2 B;  4WU9 A;  1P3B C;  5DNN D;  5CPK B;  4KGC C;  2HIO D;  3REI D;  3AN2 A;  4ZBJ B;  1P3G A;  5GT0 A;  3REJ D;  2YFV B;  3KXB B;  1M19 A;  5B1M B;  4KUD A;  3X1S A;  5AY8 C;  4Z5T A;  5JRG A;  5B2I C;  2F8N D;  1F66 A;  3AZG D;  3WKJ C;  5DNM C;  5AVC A;  5CP6 A;  3MGS D;  1M1A C;  3V9R B;  3W97 B;  3REK D;  3W98 D;  3X1V B;  2ARO B;  3AYW A;  1P3A B;  5AV9 B;  1U35 B;  1KX4 A;  4QLC D;  5BO0 A;  5G49 A;  3UTB D;  4CAY B;  2F8N G;  5CPI B;  2RVQ D;  3AV2 C;  3W99 D;  5B1L B;  3UTA D;  5CPK C;  4ZBJ C;  1P3B D;  1HQ3 A;  4KGC D;  3KSY A;  1BH9 A;  4H9N B;  3KXB C;  5B1M C;  2JSS A;  5AV5 B;  3VH5 T;  3NQJ A;  1P3M A;  5AV6 B;  4J8W A;  5B2I D;  5JA4 A;  1P3L A;  3W97 C;  3WKJ D;  3AZL A;  5DNM D;  3UT9 B;  3MGQ D;  3X1V C;  2ARO C;  5B0Y B;  3AFA A;  4H9R B;  3TU4 B;  3AZH A;  3B6F A;  1P3A C;  5AV9 C;  1U35 C;  2NQB D;  4H9P A;  4WZS B;  3W96 D;  5E5A D;  5CPI C;  4JJN A;  5B31 D;  5F99 A;  5B1L C;  5GXQ A;  1P3P A;  3NQU A;  5B32 D;  3AV2 D;  3REH D;  5DNN A;  2HIO A;  3REI A;  5CPK D;  3REJ A;  1N1J A;  1KX5 B;  1KU5 A;  3KXB D;  5B1M D;  5GT3 B;  5AV5 C;  1BH8 A;  4LD9 B;  5AV6 C;  2F8N A;  1WWI A;  3AZG A;  3X1T B;  1B67 A;  3UT9 C;  3B0D B;  3MGS A;  2F8N H;  4H9S C;  5B0Y C;  3TU4 C;  3REK A;  3W98 A;  3MNN B;  5BT1 D;  2ARO D;  1JFI A;  1P3O B;  5B33 B;  3AZK A;  1P3A D;  4QLC A;  3O62 B;  3AZE B;  2LY8 A;  3W99 A;  3KUY B;  5B24 B;  3UTA A;  4J8U B;  1P3B A;  1P3I D;  4KGC A;  4UUZ A;  4EO5 B;  5BS7 C;  1KX5 C;  3LZ1 D;  3AZJ A;  5GT3 C;  1A7W A;  3WA9 D;  4LD9 C;  3AZF D;  5AV5 D;  4G92 B;  4Z66 A;  3AZM B;  3X1T C;  5B2I A;  2FJ7 A;  3B0D C;  3C1B D;  1AOI B;  5DNM A;  3UT9 D;  3MGQ A;  3MNN C;  3TU4 D;  1P3O C;  4Z2M G;  5B33 C;  4J8X B;  2NQB A;  3O62 C;  3AZE C;  4YM6 C;  3W96 A;  5E5A A;  3B0C T;  3AZN B;  5B31 A;  3LEL D;  3KUY C;  5B24 C;  5B32 A;  4R8P B;  3AV2 A;  3REH A;  3WAA D;  1S32 B;  5CPK A;  4EO5 C;  4YS3 B;  2YFV A;  1KX5 D;  4NE5 A;  3KXB A;  5CPJ B;  3LJA C;  5B1M A;  5BNV B;  1TAF B;  5GT3 D;  4G92 C;  3AZM C;  4LD9 D;  1P3K B;  1AOI C;  2IO5 B;  3V9R A;  3WTP B;  3AZI B;  1ID3 B;  1M18 B;  4J8X C;  2ARO A;  3MVD D;  1P3A A;  1P3O D;  1EQZ D;  5BNX A;  3AZN C;  4XUJ B;  3AZE D;  4X23 D;  3REL B;  4R8P C;  2YFW B;  3KUY D;  1S32 C;  3KWQ B;  4WNN B;  1R4V A;  4J8U D;  4YS3 C;  1P3I A;  3AN2 B;  1P3G B;  4H9O B;  3LZ1 A;  5GT0 B;  4H9N A;  5CPJ C;  1P34 B;  3WA9 A;  4Z2M H;  4M6B A;  3AZF A;  1P3K C;  5AV5 A;  3X1S B;  3VH6 W;  3AZM D;  1TZY B;  3C1B A;  2PYO A;  2IO5 C;  3WTP C;  3AZI C;  1AOI D;  1ID3 C;  3UT9 A;  1M18 C;  5AY8 D;  4H9R A;  3TU4 A;  4KHA A;  3AV1 B;  4XUJ C;  5B2J B;  3AYW B;  1M1A D;  3A6N C;  5BO0 B;  1KX3 B;  4J8V A;  3REL C;  3AZN D;  3LEL A;  3MGR B;  5C3I B;  3KWQ C;  2L5A A;  3WAA A;  1S32 D;  3AN2 C;  1P3G C;  5GT0 C;  1P34 C;  4YS3 D;  1HQ3 B;  5BS7 A;  1KX5 A;  4DRA A;  5GT3 A;  3X1S C;  4LD9 A;  4WU8 B;  1TZY C;  1F66 C;  3B6G B;  4J8W B;  3VH6 A;  5JA4 B;  1HTA A;  1BFM A;  3AZL B;  1ID3 D;  3R45 B;  3AV1 C;  3MVD A;  5B2J C;  3AYW C;  1P3O A;  1EQZ A;  3W97 D;  1KX3 C;  2NZD B;  4H9P B;  3AZE A;  4XUJ D;  3MGR C;  3X1V D;  5C3I C;  4X23 A;  4JJN B;  5AV9 D;  3REL D;  5F99 B;  1U35 D;  5GXQ B;  3KUY A;  4YM6 B;  3UTB A;  2BYK A;  4J8U A;  5CPI D;  1HQ3 C;  4XZQ B;  5B1L D;  3MGP B;  1WWS A;  1P34 D;  4ZUX B;  1N1J B;  5AVB B;  1H3O B;  5AV8 B;  4WU8 C;  3B6G C;  1P3M C;  3AZM A;  4J8W C;  1F1E A;  1TZY D;  3LJA B;  1AOI A;  3AZL C;  5AY8 A;  5AV6 D;  5KDM B;  3WKJ A;  2NZD C;  3C1C B;  3LZ0 B;  3AV1 D;  5B2J D;  3AYW D;  3AZK B;  1M1A A;  5B0Y D;  5GSU B;  1KX3 D;  4JJN C;  3AZN A;  4H9Q B;  5F99 C;  5GXQ C;  3MGR D;  5B40 B;  2BYM A;  3W99 B;  1S32 A;  4XZQ C;  3MGP C;  2CV5 B;  4YS3 A;  4ZUX C;  5AVB C;  4UUZ B;  4DRB A;  5AV8 C;  3AZJ B;  5BNV A;  4CSR B;  4WU8 D;  5FUG B;  3B6G D;  4Z66 B;  2FJ7 B;  5CHL B;  4WV4 B;  1ID3 A;  3MGQ B;  3X1T D;  3LZ0 C;  3C1C C;  3AZK C;  3W97 A;  4E44 A;  5GSU C;  2NZD D;  5B0Z B;  4NE6 A;  4XUJ A;  3X1U B;  3W96 B;  3X1V A;  3MNN D;  1ZLA B;  5E5A B;  5B40 C;  2RVQ C;  3W99 C;  5B31 B;  2YFW A;  5B33 D;  5AV9 A;  1U35 A;  1P3F B;  3UTA C;  3O62 D;  4YM6 D;  4WNN A;  5B32 B;  4CAY A;  3A6N B;  1B6W A;  3REH B;  2CV5 C;  5CPI A;  5B1L A;  4XZQ D;  3MGP D;  5B24 D;  4H9O A;  1P34 A;  3AZJ C;  4ZUX D;  4WU9 B;  5AVB D;  5AV8 D;  4Z66 C;  2FJ7 C;  1TZY A;  2HUE B;  3LJA D;  1M19 B;  4AWL B;  4KUD B;  4Z5T B;  3MGQ C;  5AV6 A;  5JRG B;  4HGA C; 
#chains in the Genus database with same CATH topology
 1Q9C A;  3VH5 W;  1F66 B;  5AVC B;  5B0Z C;  3LZ0 D;  3C1C D;  5CP6 B;  3AV1 A;  4H9S A;  5B2J A;  3W96 C;  3X1U C;  5B0Y A;  3AZK D;  3WTP E;  5E5A C;  1KX3 A;  1ZLA C;  5GSU D;  5BNX B;  5B31 C;  3MGR A;  1P3F C;  4J8X D;  5B40 D;  3EPH A;  5B32 C;  1KX4 B;  3REH C;  5G49 B;  4DQY B;  2CV5 D;  1P3I B;  4R8P D;  4WU9 C;  4G91 B;  2DF4 C;  3LZ1 B;  3AZJ D;  2Y2P A;  3WA9 B;  3AZF B;  4WU8 A;  3VH6 T;  1BH9 B;  2HUE C;  5CPJ D;  1M19 C;  1PZR A;  3B6G A;  4Z66 D;  4E45 A;  4AWL C;  2FJ7 D;  4KUD C;  4Z5T C;  3C1B B;  2PYO B;  5JRG C;  2ZY5 A;  1P3K D;  3NQJ B;  1P3M B;  5BT1 C;  5AVC C;  3X1T A;  3R45 A;  5CP6 C;  1P3L B;  3VH5 A;  3WTP D;  3AZI D;  2NZD A;  4KHA B;  5B0Z D;  1M18 D;  3X1U D;  3MNN A;  2F8N K;  3AFA B;  3AZH B;  1ZLA D;  3B6F B;  4J8V B;  5B33 A;  3EPJ A;  1KX4 C;  3LEL B;  1P3F D;  3O62 A;  4NE3 A;  4YM6 A;  3A6N D;  3A1I A;  3WAA B;  1P3I C;  4XZQ A;  4G91 C;  5B24 A;  3MGP A;  1P3P B;  3F6T A;  3LZ1 C;  3NQU B;  3KWQ D;  4ZUX A;  3B0B A;  4WU9 D;  5AVB A;  5DNN B;  3WA9 C;  2HIO B;  1H3O A;  5AV8 A;  3REI B;  3AZF C;  3AN2 D;  1P3G D;  5GT0 D;  2RIQ A;  3REJ B;  5B31 G;  3C1B C;  2PYO C;  2CWE A;  3LJA A;  1M19 D;  5B32 G;  1BH8 B;  4KUD D;  3X1S D;  4Z5T D;  2F8N B;  5JRG D;  3AZG B;  5KDM A;  1P3L C;  1F66 D;  5AVC D;  3LZ0 A;  3C1C A;  3MGS B;  3MVD B;  5CP6 D;  1EQZ B;  3AFA C;  3AZH C;  5GSU A;  3B6F C;  3REK B;  4J8V C;  3W98 B;  4H9Q A;  3LEL C;  4J8X A;  3IP4 C;  5B40 A;  4X23 B;  1JFI B;  4QLC B;  1KX4 D;  3WAA C;  3UTB B;  3B0C W;  2BYK B;  2CV5 A;  1P3P C;  4NFT A;  4R8P A;  2VQR A;  5DNN C;  3UTA B;  2HIO C;  3REI C;  2G5I C;  4CSR A;  1P3B B;  3REJ C;  1HQ3 D;  4KGC B;  5FUG A;  5CPJ A;  1TAF A;  2PYO D;  3AZG C;  1P3K A;  2NQB C;  5AY8 B;  1P3M D;  5B2I B;  4J8W D;  3MGS C;  3MVD C;  1P3L D;  1EQZ C;  3WKJ B;  1ULY A;  3WTP A;  3AZI A;  5DNM B;  3AZL D;  3REK C;  5B0Z A;  3W98 C;  1M18 A;  3X1U A;  1M1A B;  4HGA B;  1ZLA A;  4X23 C;  3AFA D;  3AZH D;  3B6F D;  4J8V D;  4QLC C;  1P3F A;  2NQB B;  3UTB C;  2BYM B;  2Y2Q A;  3A6N A;  4WJ3 C;  4J8U C;  3REL A;  4JJN D;  5F99 D;  5GXQ D;  1P3P D;  3KWQ A;  3AV2 B;  3EPK A;  4WU9 A;  1P3B C;  5DNN D;  5CPK B;  4KGC C;  2HIO D;  3REI D;  3AN2 A;  4ZBJ B;  1P3G A;  5GT0 A;  3REJ D;  2YFV B;  3KXB B;  1M19 A;  5B1M B;  4KUD A;  3X1S A;  5AY8 C;  4Z5T A;  5JRG A;  5B2I C;  2F8N D;  1F66 A;  3AZG D;  3WKJ C;  5DNM C;  5AVC A;  5CP6 A;  3MGS D;  1M1A C;  3V9R B;  3W97 B;  3REK D;  3W98 D;  3X1V B;  2ARO B;  3AYW A;  1P3A B;  5AV9 B;  1U35 B;  1KX4 A;  4QLC D;  5BO0 A;  5G49 A;  3UTB D;  4CAY B;  2F8N G;  5CPI B;  2RVQ D;  3AV2 C;  3W99 D;  5B1L B;  3UTA D;  5CPK C;  4ZBJ C;  1P3B D;  1HQ3 A;  4KGC D;  3KSY A;  3P5J B;  1BH9 A;  4H9N B;  3KXB C;  5B1M C;  2JSS A;  5AV5 B;  3VH5 T;  3NQJ A;  1P3M A;  5AV6 B;  4J8W A;  5B2I D;  5JA4 A;  2XD1 A;  1P3L A;  3W97 C;  3WKJ D;  3AZL A;  5DNM D;  3UT9 B;  3MGQ D;  5B0Y B;  2ARO C;  3X1V C;  3AFA A;  4H9R B;  3TU4 B;  3AZH A;  3B6F A;  1P3A C;  5AV9 C;  1U35 C;  1Z2C B;  2NQB D;  4H9P A;  2JE5 A;  4WZS B;  3W96 D;  5E5A D;  5CPI C;  4JJN A;  5B31 D;  5F99 A;  5B1L C;  5GXQ A;  1P3P A;  3NQU A;  5B32 D;  3AV2 D;  3REH D;  5DNN A;  2HIO A;  3REI A;  5CPK D;  3REJ A;  1N1J A;  1KX5 B;  1KU5 A;  3KXB D;  5B1M D;  5GT3 B;  5AV5 C;  2Y2N A;  1BH8 A;  4LD9 B;  5AV6 C;  2F8N A;  2ZM5 A;  1WWI A;  3AZG A;  3X1T B;  1B67 A;  3UT9 C;  3B0D B;  3MGS A;  2F8N H;  4H9S C;  5B0Y C;  3TU4 C;  3REK A;  3H0L C;  3W98 A;  3H0R C;  3MNN B;  5BT1 D;  2ARO D;  1JFI A;  1P3O B;  5B33 B;  3AZK A;  1P3A D;  4QLC A;  3O62 B;  3AZE B;  2LY8 A;  3W99 A;  2BG1 A;  3KUY B;  5B24 B;  3UTA A;  4J8U B;  1P3B A;  4UPK A;  1P3I D;  4KGC A;  3AL0 C;  4UUZ A;  4EO5 B;  5BS7 C;  1KX5 C;  3LZ1 D;  3AZJ A;  5GT3 C;  1A7W A;  3WA9 D;  2ZY3 A;  4LD9 C;  3AZF D;  5AV5 D;  4G92 B;  4Z66 A;  3AZM B;  3X1T C;  5B2I A;  2FJ7 A;  3B0D C;  3C1B D;  2Y2H A;  1AOI B;  5DNM A;  3UT9 D;  3MGQ A;  3MNN C;  3TU4 D;  1P3O C;  4Z2M G;  5B33 C;  3KFU G;  4J8X B;  2NQB A;  3O62 C;  3AZE C;  4YM6 C;  3W96 A;  5E5A A;  3B0C T;  2ZY2 A;  3AZN B;  5B31 A;  3LEL D;  3KUY C;  5B24 C;  2Y2L A;  5B32 A;  4R8P B;  3AV2 A;  3REH A;  3WAA D;  1S32 B;  5CPK A;  4EO5 C;  4YS3 B;  2YFV A;  1KX5 D;  1T3U A;  4NE5 A;  3KXB A;  5CPJ B;  3LJA C;  5B1M A;  5BNV B;  1TAF B;  5GT3 D;  4G92 C;  3AZM C;  4LD9 D;  1P3K B;  1AOI C;  2IO5 B;  3V9R A;  3WTP B;  3AZI B;  2JCH A;  1ID3 B;  1M18 B;  4J8X C;  2ARO A;  2FFF B;  3MVD D;  1P3A A;  1P3O D;  2Y2I A;  1EQZ D;  5BNX A;  3AZN C;  4XUJ B;  3AZE D;  4X23 D;  3REL B;  4R8P C;  2YFW B;  3KUY D;  1S32 C;  3KWQ B;  4WNN B;  1R4V A;  4J8U D;  4YS3 C;  1P3I A;  3AN2 B;  1P3G B;  4H9O B;  3LZ1 A;  5GT0 B;  4H9N A;  5CPJ C;  1P34 B;  3WA9 A;  4Z2M H;  4M6B A;  3AZF A;  1P3K C;  5AV5 A;  3X1S B;  3VH6 W;  3AZM D;  2F2A C;  1TZY B;  3C1B A;  2PYO A;  2Y2M A;  2IO5 C;  3WTP C;  3AZI C;  1AOI D;  1ID3 C;  3UT9 A;  2Y2G A;  1M18 C;  5AY8 D;  4H9R A;  3TU4 A;  2Y2O A;  4KHA A;  3AV1 B;  4XUJ C;  5B2J B;  3AYW B;  1M1A D;  3A6N C;  5BO0 B;  1KX3 B;  2DQN C;  4J8V A;  3REL C;  3AZN D;  3LEL A;  3MGR B;  2ZY4 A;  5C3I B;  3KWQ C;  2J8P A;  2L5A A;  3WAA A;  1S32 D;  3AN2 C;  1P3G C;  5GT0 C;  1P34 C;  4YS3 D;  1HQ3 B;  5BS7 A;  1KX5 A;  3EPL A;  4DRA A;  5GT3 A;  3X1S C;  4LD9 A;  4WU8 B;  1TZY C;  1F66 C;  3B6G B;  4J8W B;  3VH6 A;  5JA4 B;  1HTA A;  1BFM A;  3AZL B;  1ID3 D;  3R45 B;  3AV1 C;  3MVD A;  5B2J C;  3AYW C;  1P3O A;  1EQZ A;  3W97 D;  1KX3 C;  2NZD B;  2Y2J A;  4H9P B;  3AZE A;  4XUJ D;  3MGR C;  3X1V D;  5C3I C;  4X23 A;  4JJN B;  2W8S A;  5AV9 D;  5F99 B;  3REL D;  1U35 D;  5GXQ B;  3KUY A;  2XD5 A;  4YM6 B;  3UTB A;  2BYK A;  4J8U A;  5CPI D;  1HQ3 C;  4XZQ B;  5B1L D;  3MGP B;  1WWS A;  1P34 D;  4ZUX B;  1N1J B;  2G5H C;  5AVB B;  3H0M C;  1H3O B;  5AV8 B;  4WU8 C;  3B6G C;  1P3M C;  3AZM A;  4J8W C;  1F1E A;  1TZY D;  3LJA B;  1AOI A;  3AZL C;  5AY8 A;  5AV6 D;  2UWX A;  5KDM B;  3WKJ A;  2NZD C;  3C1C B;  3LZ0 B;  3AV1 D;  5B2J D;  3AYW D;  3AZK B;  1M1A A;  5B0Y D;  5GSU B;  1KX3 D;  4JJN C;  3AZN A;  4H9Q B;  5F99 C;  5GXQ C;  3MGR D;  5B40 B;  2BYM A;  3W99 B;  2Y2K A;  1S32 A;  4XZQ C;  3MGP C;  2CV5 B;  4YS3 A;  4ZUX C;  5AVB C;  1W2E A;  4UUZ B;  4DRB A;  5AV8 C;  3AZJ B;  5BNV A;  4CSR B;  4WU8 D;  5FUG B;  3B6G D;  4Z66 B;  2FJ7 B;  5CHL B;  4WV4 B;  1ID3 A;  3MGQ B;  3X1T D;  3LZ0 C;  3C1C C;  3AZK C;  3W97 A;  4E44 A;  5GSU C;  2NZD D;  5B0Z B;  3FDD A;  4NE6 A;  4XUJ A;  3X1U B;  3W96 B;  3X1V A;  3MNN D;  1ZLA B;  5E5A B;  5B40 C;  2RVQ C;  3W99 C;  5B31 B;  2YFW A;  5B33 D;  5AV9 A;  1U35 A;  1P3F B;  3UTA C;  3O62 D;  4YM6 D;  4WNN A;  5B32 B;  4CAY A;  3A6N B;  1B6W A;  3REH B;  2CV5 C;  5CPI A;  5B1L A;  4XZQ D;  3MGP D;  5B24 D;  4H9O A;  3A1K A;  1P34 A;  3AZJ C;  4ZUX D;  4WU9 B;  5AVB D;  5AV8 D;  4Z66 C;  2FJ7 C;  1TZY A;  2HUE B;  3EG5 B;  3LJA D;  1M19 B;  4AWL B;  4KUD B;  4Z5T B;  3MGQ C;  5AV6 A;  5JRG B;  4HGA C; 
#chains in the Genus database with same CATH homology
 1Q9C A;  3VH5 W;  1F66 B;  5AVC B;  5B0Z C;  3LZ0 D;  3C1C D;  5CP6 B;  3AV1 A;  4H9S A;  5B2J A;  3W96 C;  3X1U C;  5B0Y A;  3AZK D;  3WTP E;  5E5A C;  1KX3 A;  1ZLA C;  5GSU D;  5BNX B;  5B31 C;  3MGR A;  1P3F C;  4J8X D;  5B40 D;  3EPH A;  5B32 C;  1KX4 B;  3REH C;  5G49 B;  4DQY B;  2CV5 D;  1P3I B;  4R8P D;  4WU9 C;  4G91 B;  2DF4 C;  3LZ1 B;  3AZJ D;  2Y2P A;  3WA9 B;  3AZF B;  4WU8 A;  3VH6 T;  1BH9 B;  2HUE C;  5CPJ D;  1M19 C;  1PZR A;  3B6G A;  4Z66 D;  4E45 A;  4AWL C;  2FJ7 D;  4KUD C;  4Z5T C;  3C1B B;  2PYO B;  5JRG C;  2ZY5 A;  1P3K D;  3NQJ B;  1P3M B;  5BT1 C;  5AVC C;  3X1T A;  3R45 A;  5CP6 C;  1P3L B;  3VH5 A;  3WTP D;  3AZI D;  2NZD A;  4KHA B;  5B0Z D;  1M18 D;  3X1U D;  3MNN A;  2F8N K;  3AFA B;  3AZH B;  1ZLA D;  3B6F B;  4J8V B;  5B33 A;  3EPJ A;  1KX4 C;  3LEL B;  1P3F D;  3O62 A;  4NE3 A;  4YM6 A;  3A6N D;  3A1I A;  3WAA B;  1P3I C;  4XZQ A;  4G91 C;  5B24 A;  3MGP A;  1P3P B;  3F6T A;  3LZ1 C;  3NQU B;  3KWQ D;  4ZUX A;  3B0B A;  4WU9 D;  5AVB A;  5DNN B;  3WA9 C;  2HIO B;  1H3O A;  5AV8 A;  3REI B;  3AZF C;  3AN2 D;  1P3G D;  5GT0 D;  2RIQ A;  3REJ B;  5B31 G;  3C1B C;  2PYO C;  2CWE A;  3LJA A;  1M19 D;  5B32 G;  1BH8 B;  4KUD D;  3X1S D;  4Z5T D;  2F8N B;  5JRG D;  3AZG B;  5KDM A;  1P3L C;  1F66 D;  5AVC D;  3LZ0 A;  3C1C A;  3MGS B;  3MVD B;  5CP6 D;  1EQZ B;  3AFA C;  3AZH C;  5GSU A;  3B6F C;  3REK B;  4J8V C;  3W98 B;  4H9Q A;  3LEL C;  4J8X A;  3IP4 C;  5B40 A;  4X23 B;  1JFI B;  4QLC B;  1KX4 D;  3WAA C;  3UTB B;  3B0C W;  2BYK B;  2CV5 A;  1P3P C;  4NFT A;  4R8P A;  2VQR A;  5DNN C;  3UTA B;  2HIO C;  3REI C;  2G5I C;  4CSR A;  1P3B B;  3REJ C;  1HQ3 D;  4KGC B;  5FUG A;  5CPJ A;  1TAF A;  2PYO D;  3AZG C;  1P3K A;  2NQB C;  5AY8 B;  1P3M D;  5B2I B;  4J8W D;  3MGS C;  3MVD C;  1P3L D;  1EQZ C;  3WKJ B;  1ULY A;  3WTP A;  3AZI A;  5DNM B;  3AZL D;  3REK C;  5B0Z A;  3W98 C;  1M18 A;  3X1U A;  1M1A B;  4HGA B;  1ZLA A;  4X23 C;  3AFA D;  3AZH D;  3B6F D;  4J8V D;  4QLC C;  1P3F A;  2NQB B;  3UTB C;  2BYM B;  2Y2Q A;  3A6N A;  4WJ3 C;  4J8U C;  3REL A;  4JJN D;  5F99 D;  5GXQ D;  1P3P D;  3KWQ A;  3AV2 B;  3EPK A;  4WU9 A;  1P3B C;  5DNN D;  5CPK B;  4KGC C;  2HIO D;  3REI D;  3AN2 A;  4ZBJ B;  1P3G A;  5GT0 A;  3REJ D;  2YFV B;  3KXB B;  1M19 A;  5B1M B;  4KUD A;  3X1S A;  5AY8 C;  4Z5T A;  5JRG A;  5B2I C;  2F8N D;  1F66 A;  3AZG D;  3WKJ C;  5DNM C;  5AVC A;  5CP6 A;  3MGS D;  1M1A C;  3V9R B;  3W97 B;  3REK D;  3W98 D;  3X1V B;  2ARO B;  3AYW A;  1P3A B;  5AV9 B;  1U35 B;  1KX4 A;  4QLC D;  5BO0 A;  5G49 A;  3UTB D;  4CAY B;  2F8N G;  5CPI B;  2RVQ D;  3AV2 C;  3W99 D;  5B1L B;  3UTA D;  5CPK C;  4ZBJ C;  1P3B D;  1HQ3 A;  4KGC D;  3KSY A;  3P5J B;  1BH9 A;  4H9N B;  3KXB C;  5B1M C;  2JSS A;  5AV5 B;  3VH5 T;  3NQJ A;  1P3M A;  5AV6 B;  4J8W A;  5B2I D;  5JA4 A;  2XD1 A;  1P3L A;  3W97 C;  3WKJ D;  3AZL A;  5DNM D;  3UT9 B;  3MGQ D;  5B0Y B;  2ARO C;  3X1V C;  3AFA A;  4H9R B;  3TU4 B;  3AZH A;  3B6F A;  1P3A C;  5AV9 C;  1U35 C;  1Z2C B;  2NQB D;  4H9P A;  2JE5 A;  4WZS B;  3W96 D;  5E5A D;  5CPI C;  4JJN A;  5B31 D;  5F99 A;  5B1L C;  5GXQ A;  1P3P A;  3NQU A;  5B32 D;  3AV2 D;  3REH D;  5DNN A;  2HIO A;  3REI A;  5CPK D;  3REJ A;  1N1J A;  1KX5 B;  1KU5 A;  3KXB D;  5B1M D;  5GT3 B;  5AV5 C;  2Y2N A;  1BH8 A;  4LD9 B;  5AV6 C;  2F8N A;  2ZM5 A;  1WWI A;  3AZG A;  3X1T B;  1B67 A;  3UT9 C;  3B0D B;  3MGS A;  2F8N H;  4H9S C;  5B0Y C;  3TU4 C;  3REK A;  3H0L C;  3W98 A;  3H0R C;  3MNN B;  5BT1 D;  2ARO D;  1JFI A;  1P3O B;  5B33 B;  3AZK A;  1P3A D;  4QLC A;  3O62 B;  3AZE B;  2LY8 A;  3W99 A;  2BG1 A;  3KUY B;  5B24 B;  3UTA A;  4J8U B;  1P3B A;  4UPK A;  1P3I D;  4KGC A;  3AL0 C;  4UUZ A;  4EO5 B;  5BS7 C;  1KX5 C;  3LZ1 D;  3AZJ A;  5GT3 C;  1A7W A;  3WA9 D;  2ZY3 A;  4LD9 C;  3AZF D;  5AV5 D;  4G92 B;  4Z66 A;  3AZM B;  3X1T C;  5B2I A;  2FJ7 A;  3B0D C;  3C1B D;  2Y2H A;  1AOI B;  5DNM A;  3UT9 D;  3MGQ A;  3MNN C;  3TU4 D;  1P3O C;  4Z2M G;  5B33 C;  3KFU G;  4J8X B;  2NQB A;  3O62 C;  3AZE C;  4YM6 C;  3W96 A;  5E5A A;  3B0C T;  2ZY2 A;  3AZN B;  5B31 A;  3LEL D;  3KUY C;  5B24 C;  2Y2L A;  5B32 A;  4R8P B;  3AV2 A;  3REH A;  3WAA D;  1S32 B;  5CPK A;  4EO5 C;  4YS3 B;  2YFV A;  1KX5 D;  1T3U A;  4NE5 A;  3KXB A;  5CPJ B;  3LJA C;  5B1M A;  5BNV B;  1TAF B;  5GT3 D;  4G92 C;  3AZM C;  4LD9 D;  1P3K B;  1AOI C;  2IO5 B;  3V9R A;  3WTP B;  3AZI B;  2JCH A;  1ID3 B;  1M18 B;  4J8X C;  2ARO A;  2FFF B;  3MVD D;  1P3A A;  1P3O D;  2Y2I A;  1EQZ D;  5BNX A;  3AZN C;  4XUJ B;  3AZE D;  4X23 D;  3REL B;  4R8P C;  2YFW B;  3KUY D;  1S32 C;  3KWQ B;  4WNN B;  1R4V A;  4J8U D;  4YS3 C;  1P3I A;  3AN2 B;  1P3G B;  4H9O B;  3LZ1 A;  5GT0 B;  4H9N A;  5CPJ C;  1P34 B;  3WA9 A;  4Z2M H;  4M6B A;  3AZF A;  1P3K C;  5AV5 A;  3X1S B;  3VH6 W;  3AZM D;  2F2A C;  1TZY B;  3C1B A;  2PYO A;  2Y2M A;  2IO5 C;  3WTP C;  3AZI C;  1AOI D;  1ID3 C;  3UT9 A;  2Y2G A;  1M18 C;  5AY8 D;  4H9R A;  3TU4 A;  2Y2O A;  4KHA A;  3AV1 B;  4XUJ C;  5B2J B;  3AYW B;  1M1A D;  3A6N C;  5BO0 B;  1KX3 B;  2DQN C;  4J8V A;  3REL C;  3AZN D;  3LEL A;  3MGR B;  2ZY4 A;  5C3I B;  3KWQ C;  2J8P A;  2L5A A;  3WAA A;  1S32 D;  3AN2 C;  1P3G C;  5GT0 C;  1P34 C;  4YS3 D;  1HQ3 B;  5BS7 A;  1KX5 A;  3EPL A;  4DRA A;  5GT3 A;  3X1S C;  4LD9 A;  4WU8 B;  1TZY C;  1F66 C;  3B6G B;  4J8W B;  3VH6 A;  5JA4 B;  1HTA A;  1BFM A;  3AZL B;  1ID3 D;  3R45 B;  3AV1 C;  3MVD A;  5B2J C;  3AYW C;  1P3O A;  1EQZ A;  3W97 D;  1KX3 C;  2NZD B;  2Y2J A;  4H9P B;  3AZE A;  4XUJ D;  3MGR C;  3X1V D;  5C3I C;  4X23 A;  4JJN B;  2W8S A;  5AV9 D;  5F99 B;  3REL D;  1U35 D;  5GXQ B;  3KUY A;  2XD5 A;  4YM6 B;  3UTB A;  2BYK A;  4J8U A;  5CPI D;  1HQ3 C;  4XZQ B;  5B1L D;  3MGP B;  1WWS A;  1P34 D;  4ZUX B;  1N1J B;  2G5H C;  5AVB B;  3H0M C;  1H3O B;  5AV8 B;  4WU8 C;  3B6G C;  1P3M C;  3AZM A;  4J8W C;  1F1E A;  1TZY D;  3LJA B;  1AOI A;  3AZL C;  5AY8 A;  5AV6 D;  2UWX A;  5KDM B;  3WKJ A;  2NZD C;  3C1C B;  3LZ0 B;  3AV1 D;  5B2J D;  3AYW D;  3AZK B;  1M1A A;  5B0Y D;  5GSU B;  1KX3 D;  4JJN C;  3AZN A;  4H9Q B;  5F99 C;  5GXQ C;  3MGR D;  5B40 B;  2BYM A;  3W99 B;  2Y2K A;  1S32 A;  4XZQ C;  3MGP C;  2CV5 B;  4YS3 A;  4ZUX C;  5AVB C;  1W2E A;  4UUZ B;  4DRB A;  5AV8 C;  3AZJ B;  5BNV A;  4CSR B;  4WU8 D;  5FUG B;  3B6G D;  4Z66 B;  2FJ7 B;  5CHL B;  4WV4 B;  1ID3 A;  3MGQ B;  3X1T D;  3LZ0 C;  3C1C C;  3AZK C;  3W97 A;  4E44 A;  5GSU C;  2NZD D;  5B0Z B;  3FDD A;  4NE6 A;  4XUJ A;  3X1U B;  3W96 B;  3X1V A;  3MNN D;  1ZLA B;  5E5A B;  5B40 C;  2RVQ C;  3W99 C;  5B31 B;  2YFW A;  5B33 D;  5AV9 A;  1U35 A;  1P3F B;  3UTA C;  3O62 D;  4YM6 D;  4WNN A;  5B32 B;  4CAY A;  3A6N B;  1B6W A;  3REH B;  2CV5 C;  5CPI A;  5B1L A;  4XZQ D;  3MGP D;  5B24 D;  4H9O A;  3A1K A;  1P34 A;  3AZJ C;  4ZUX D;  4WU9 B;  5AVB D;  5AV8 D;  4Z66 C;  2FJ7 C;  1TZY A;  2HUE B;  3EG5 B;  3LJA D;  1M19 B;  4AWL B;  4KUD B;  4Z5T B;  3MGQ C;  5AV6 A;  5JRG B;  4HGA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...