3AYWA

Crystal structure of human nucleosome core particle containing h3k56q mutation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQQSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aywA00
4XZQC 3AZIC 4DRBA 3X1VD 2CV5A 1S32A 3LELB 5B0YA 5AY8A 3MGRA 3C1CC 3AZHC 1M18C 3B0DC 1KX5C 5B1MD 1P3FC 4KGCB 5AV5D 4YM6D 3LELA 4X23C 3A6NC 3KWQB 2AROD 3MVDC 2FJ7C 4G91B 1P3KC 5B1LC 5B33D 3UT9D 4R8PC 3AN2B 4KGCA 3KWQA 3B0BA 5CPJC 1P3BD 3VH5W 5CHLB 5GSUC 3KXBD 3C1BC 5AV8B 3AZFD 3WA9D 5DNMC 3AN2A 5BT1D 4J8VB 2NZDB 5JA4B 1ID3B 5B2JB 5GT0C 1P3MB 1A7WA 5AV8A 4NE5A 4WZSB 5B24C 3LZ0B 3AZNB 4J8VA 3B6FC 2NZDA 5JA4A 1ID3A 3REIB 5CPKC 4KUDC 5B2JA 1P3GB 4CAYB 1P3MA 3TU4B 3NQUB 3AV2B 1U35B 3O62B 3LZ0A 3AZNA 3R45B 3AYWD 3REIA 5B0ZB 1P3GA 4Z2MG 4CAYA 3TU4A 3NQUA 3AV2A 1U35A 3O62A 4AWLB 3RELB 4JJNB 1P3BC 3R45A 5AVBD 5B40D 3MNNC 5B0ZA 3W99D 3AZGB 5AV6D 5CP6D 4H9SA 1P34D 5BT1C 4DRAA 3UTBD 3MGPB 1P3OD 3RELA 4JJNA 3AFAB 4ZBJB 4J8WD 1B67A 4G92C 3AZGA 3W96B 2IO5B 4Z5TD 3MGPA 3AZJC 3AZMB 3AFAA 3WAAD 4E44A 5B32B 3W96A 1S32C 5F99B 3X1SC 3KUYC 3X1TD 3W97C 3AZMA 5GT3D 1TAFB 3MGSD 5KDMB 4LD9D 3B6GD 4WU8B 5B32A 3LELC 5F99A 3AZID 1TAFA 5KDMA 3C1CD 3LZ1B 3X1VB 4WU8A 4WV4B 3UTAC 1P3AB 3AZHD 4WU9C 1B6WA 1KX5D 3WKJD 4X23D 2PYOD 3MVDD 2HIOC 5B1MB 3LZ1A 3X1VA 5AV5B 4YM6B 1P3AA 2FJ7D 5BNVB 2AROB 1HTAA 4R8PD 4J8UC 1TZYC 3UT9B 1P3IB 3X1UB 5AV8C 5B1MA 5AV5A 5GSUD 5AVCB 5E5AC 4YM6A 3C1BD 1KX4B 5BNVA 2AROA 4J8VC 3REHC 4WNNB 3KXBB 1KU5A 4Z2MH 3UT9A 5GXQC 3AZFB 1HQ3C 3X1UA 1P3IA 3WA9B 1KX4A 3WTPB 5AVCA 3MGQB 5GT0D 3AZLD 4Z66B 4WNNA 4YS3C 3KXBA 5B24D 4ZUXD 5DNNC 3B6FD 3AZFA 3WA9A 3VH5A 3WTPA 5CPKD 4KUDD 3MGQA 4Z66A 3AZEC 3WKJC 3B0CW 2JSSA 2PYOC 3AZKB 3REJC 3REKB 1M1AC 4J8XC 2F8NG 3AYWB 4QLCC 3AZKA 3REKA 3MNND 5B31C 3AYWA 2CWEA 5B40B 3VH6A 5AV6B 5CP6B 5BS7A 5JRGC 3UTBB 2NQBC 1P3OB 1H3OB 3AZLC 2HUEC 5B40A 3AZMC 4J8WB 1M19B 4ZUXC 5AV6A 5CP6A 1AOIC 3AZJD 3UTBA 3W98D 1P3OA 1H3OA 1F66B 4J8WA 1S32D 1M19A 5B0YD 3X1SD 3MGRD 4H9NB 1KX3B 4WU8C 3KUYD 3W97D 5C3IB 3X1TB 1F66A 5GT3B 5CPIB 4XUJB 3LELD 3AV1C 4H9NA 3LZ1C 1KX3A 1WWIA 1P3AC 4XZQB 1F1EA 3AZIB 3X1TA 5B31G 5GT3A 3UTAD 5B2IB 5CPIA 4XUJA 1P3PB 5AV9C 4WU9D 1ULYA 3AZHB 4XZQA 1M18B 3AZIA 3B0DB 1P3LC 2HIOD 1KX5B 1P3FB 2F8ND 1EQZC 3AN2D 5B2IA 3A6NB 1P3PA 3MVDB 3LJAC 1P3IC 1KX4C 5AVCC 4J8UD 3AZHA 1TZYD 5B1LB 4HGAC 1P3KB 1M18A 1ZLAB 3W98C 3B0CT 4EO5C 5AV8D 4R8PB 1KX5A 1P3FA 2CV5C 5E5AD 3A6NA 3REHD 5B0YC 5AY8C 3MVDA 4J8VD 5CPJB 3MGRC 2NZDD 1ID3D 3C1BB 3WTPC 1ZLAA 5B2JD 5B1LA 1P3KA 3MGQC 2F8NH 5GXQD 1HQ3D 1P3MD 4R8PA 5DNMB 3KSYA 3AZND 5CPJA 4YS3D 3C1BA 5GT0B 1P3GD 5DNND 5DNMA 3TU4D 5B24B 4KGCC 3B6FB 3KWQC 3AZED 4KUDB 5GT0A 4G91C 3REJD 1M1AD 4J8XD 1Q9CA 3AN2C 5B24A 3B6FA 2BYMB 3RELD 4QLCD 4KUDA 5B33B 2RVQD 3AZGD 4NE6A 5B31D 1P3BB 3MGPD 2BYMA 2NZDC 1ID3C 2F8NK 5B2JC 2YFVB 5B33A 1P3MC 5JRGD 2NQBD 1N1JB 3LZ0C 3AZNC 1P3BA 4NE3A 3REIC 3AZMD 4G92B 1P3GC 2YFVA 1AOID 1F66C 4H9RB 3TU4C 3AV2C 4H9OB 3VH6T 1U35C 1N1JA 3O62C 1KX3C 5B0ZC 4E45A 4WU8D 4H9SC 4H9RA 4H9OA 3X1SB 4AWLC 3KUYB 3RELC 4JJNC 3W97B 4KHAB 3AV1D 2RVQC 3AZGC 3LZ1D 5BNXB 5B2IC 1P3AD 1P3PC 5FUGB 3X1SA 5G49B 3MGPC 3KUYA 3W97A 5AVBB 3AFAC 4ZBJC 3W99B 4KHAA 5AV9D 1BH9B 3UTAB 3W96C 2IO5C 5BNXA 1P34B 2L5AA 5FUGA 4WU9B 5G49A 1P3LD 5AVBA 1EQZD 1BFMA 1ZLAC 3W99A 2HIOB 1BH9A 3LJAD 1P3ID 3X1UD 2F8NB 3UTAA 5B32C 1KX4D 1P34A 5AVCD 4Z5TB 5F99C 4WU9A 2CV5D 4J8UB 3WAAB 1TZYB 5AY8D 2HIOA 2F8NA 5E5AB 3REHB 3WTPD 5BO0B 4Z5TA 3MGQD 4Z66D 3MGSB 3WAAA 4J8UA 1TZYA 4LD9B 5GXQB 3B6GB 1HQ3B 3X1VC 5E5AA 3REHA 5BO0A 4YS3B 3MGSA 4KGCD 5DNNB 4LD9A 3WTPE 5GXQA 3VH6W 1HQ3A 3KWQD 3C1CB 3AZKD 3B6GA 5B1MC 3REKD 5AV5C 4H9QB 4YM6C 2LY8A 2AROC 3AZEB 4YS3A 3WKJB 4M6BA 4X23B 2PYOB 5DNNA 3REJB 3C1CA 5B33C 3UT9C 1M1AB 4J8XB 3X1UC 2FJ7B 4H9QA 5B32G 4QLCB 3AZEA 3WKJA 3KXBC 4UUZB 4X23A 2PYOA 3REJA 3AZFC 1M1AA 4J8XA 5GSUB 3WA9C 2FJ7A 5B31B 4H9PB 4QLCA 4Z66C 3NQJB 1R4VA 4NFTA 4UUZA 1M19D 3LZ0D 4CSRB 5GSUA 3REID 5JRGB 2NQBB 5B31A 4H9PA 3AZLB 2HUEB 1F66D 3AV2D 1U35D 3NQJA 4ZUXB 3O62D 1WWSA 4CSRA 1AOIB 3AZKC 1KX3D 3V9RB 3REKC 5CPKB 5JRGA 2YFWB 2NQBA 5B0ZD 3AZLA 3AYWC 5CPID 4XUJD 4ZUXA 1AOIA 5BS7C 4JJND 3V9RA 5CPKA 2YFWA 4XZQD 3VH5T 5AVBC 5B40C 5B2ID 3AV1B 3W99C 1P3PD 5AV6C 5CP6C 3MNNB 3AFAD 1P34C 3UTBC 1M18D 1P3OC 1P3FD 3W96D 1JFIB 4J8WC 3A6ND 5AV9B 3AV1A 1M19C 1BH8B 3MNNA 2BYKB 1ZLAD 1P3KD 5B1LD 4Z5TC 1P3LB 1EQZB 5B32D 3WAAC 1JFIA 5AV9A 5F99D 5CPJD 3LJAB 3AZJB 1BH8A 3W98B 4HGAB 2BYKA 4EO5B 5C3IC 1P3LA 3X1TC 2CV5B 5DNMD 1EQZA 5GT3C 1S32B 5CPIC 3MGSC 5B0YB 5AY8B 4XUJC 4LD9C 3MGRB 3B6GC 3LJAA 3AZJA 3W98A
chains in the Genus database with same CATH superfamily
4XZQC 3AZIC 4DRBA 3X1VD 2CV5A 1S32A 3LELB 5B0YA 5AY8A 3MGRA 3C1CC 2Y2LA 3AZHC 3H0MC 1M18C 3B0DC 1KX5C 5B1MD 1P3FC 4KGCB 5AV5D 4YM6D 3LELA 4X23C 3A6NC 3KWQB 2AROD 3MVDC 2FJ7C 4G91B 1P3KC 5B1LC 5B33D 3UT9D 4R8PC 3AN2B 4KGCA 3KWQA 3B0BA 5CPJC 1P3BD 3VH5W 5CHLB 5GSUC 3KXBD 3C1BC 2JE5A 5AV8B 3AZFD 3WA9D 5DNMC 3AN2A 2JCHA 5BT1D 4J8VB 2NZDB 2ZY3A 5JA4B 1ID3B 5B2JB 5GT0C 1P3MB 1A7WA 5AV8A 4NE5A 4WZSB 5B24C 3LZ0B 3AZNB 4J8VA 3F6TA 3B6FC 2NZDA 5JA4A 1ID3A 3REIB 5CPKC 4KUDC 5B2JA 1P3GB 4CAYB 1P3MA 3TU4B 3NQUB 3AV2B 1U35B 3O62B 3LZ0A 3AZNA 3R45B 3AYWD 3REIA 2Y2OA 5B0ZB 1P3GA 4Z2MG 4CAYA 3TU4A 2G5HC 3NQUA 3AV2A 1U35A 3O62A 4AWLB 3RELB 4JJNB 1P3BC 3R45A 5AVBD 5B40D 3MNNC 5B0ZA 3W99D 3AZGB 2XD5A 5AV6D 5CP6D 4H9SA 1P34D 5BT1C 2Y2HA 4DRAA 3UTBD 3MGPB 1P3OD 3RELA 4JJNA 3AFAB 4ZBJB 4J8WD 1B67A 4G92C 3AZGA 3W96B 2IO5B 4Z5TD 3MGPA 3AZJC 3AZMB 3AFAA 3WAAD 4E44A 5B32B 3W96A 1S32C 1W2EA 5F99B 3X1SC 3KUYC 3X1TD 3W97C 3AZMA 5GT3D 1TAFB 3MGSD 5KDMB 3A1IA 4LD9D 3B6GD 4WU8B 5B32A 3LELC 5F99A 3AZID 3EPJA 2Y2JA 1TAFA 5KDMA 2Y2IA 3C1CD 3LZ1B 3X1VB 4WU8A 4WV4B 3UTAC 1P3AB 3AZHD 1Z2CB 4WU9C 1B6WA 1KX5D 3WKJD 4X23D 2PYOD 3MVDD 2HIOC 5B1MB 3LZ1A 3X1VA 5AV5B 4YM6B 1P3AA 2FJ7D 5BNVB 2AROB 1HTAA 4R8PD 4J8UC 1TZYC 3UT9B 1P3IB 3X1UB 5AV8C 5B1MA 5AV5A 2ZY5A 5AVCB 5E5AC 5GSUD 4YM6A 3C1BD 1KX4B 5BNVA 2AROA 4J8VC 3REHC 3EG5B 4WNNB 3KXBB 1KU5A 4Z2MH 3UT9A 5GXQC 3AZFB 1HQ3C 3X1UA 1P3IA 3WA9B 1KX4A 3WTPB 5AVCA 3MGQB 5GT0D 3AZLD 4Z66B 4WNNA 4YS3C 3KXBA 5B24D 4ZUXD 5DNNC 3B6FD 3AZFA 3WA9A 2J8PA 3VH5A 3WTPA 5CPKD 4KUDD 3MGQA 4Z66A 3AZEC 3WKJC 3B0CW 2JSSA 2PYOC 3AZKB 2Y2QA 3REJC 3REKB 1M1AC 4J8XC 2F8NG 3AYWB 4QLCC 3AZKA 3REKA 3MNND 5B31C 3AYWA 2CWEA 5B40B 2ZY4A 3VH6A 5AV6B 5CP6B 5BS7A 5JRGC 3UTBB 2NQBC 1P3OB 1H3OB 3AZLC 2HUEC 5B40A 3AZMC 4J8WB 1M19B 4ZUXC 5AV6A 5CP6A 1AOIC 2Y2GA 2Y2NA 3AZJD 2G5IC 3UTBA 3W98D 1P3OA 1H3OA 1F66B 4J8WA 1S32D 1M19A 5B0YD 3X1SD 3MGRD 4H9NB 1KX3B 4WU8C 3KUYD 3W97D 5C3IB 3X1TB 1F66A 5GT3B 5CPIB 4XUJB 3LELD 3AV1C 4H9NA 3LZ1C 3P5JB 1KX3A 1WWIA 1P3AC 4XZQB 1F1EA 3AZIB 3X1TA 3EPKA 5B31G 5GT3A 3UTAD 5B2IB 5CPIA 4XUJA 1P3PB 5AV9C 4WU9D 1ULYA 3AZHB 4XZQA 1M18B 3AZIA 3B0DB 1P3LC 2HIOD 1KX5B 1P3FB 2F8ND 1EQZC 3AN2D 5B2IA 3A6NB 1P3PA 3MVDB 3LJAC 1P3IC 2XD1A 1KX4C 5AVCC 4J8UD 3AZHA 1TZYD 5B1LB 4HGAC 1P3KB 1M18A 1ZLAB 3W98C 3B0CT 4EO5C 5AV8D 4R8PB 1KX5A 1P3FA 2CV5C 5E5AD 3A6NA 3REHD 5B0YC 5AY8C 3MVDA 4J8VD 5CPJB 3MGRC 2NZDD 3H0LC 1ID3D 3C1BB 3WTPC 1ZLAA 5B2JD 5B1LA 1P3KA 3MGQC 2F8NH 5GXQD 1HQ3D 1P3MD 4R8PA 5DNMB 3KSYA 3AZND 5CPJA 4YS3D 3C1BA 5GT0B 1P3GD 5DNND 5DNMA 3TU4D 5B24B 4KGCC 3B6FB 3KWQC 3AZED 4KUDB 5GT0A 4G91C 1PZRA 3REJD 1M1AD 4J8XD 1Q9CA 3AN2C 5B24A 2F2AC 3EPHA 3B6FA 2BYMB 3RELD 4QLCD 4KUDA 5B33B 2RVQD 3AZGD 4NE6A 5B31D 1P3BB 3MGPD 2BYMA 2NZDC 1ID3C 2F8NK 5B2JC 2ZM5A 2YFVB 5B33A 1P3MC 5JRGD 2NQBD 1N1JB 3LZ0C 3AZNC 1P3BA 4WJ3C 4NE3A 3REIC 3AZMD 2DF4C 4G92B 1P3GC 2YFVA 1AOID 1F66C 4H9RB 3TU4C 3AV2C 4H9OB 3VH6T 1U35C 1N1JA 3O62C 1KX3C 2UWXA 5B0ZC 2Y2KA 4E45A 4WU8D 4H9SC 4H9RA 4H9OA 3X1SB 4AWLC 3KUYB 3RELC 4JJNC 3W97B 4KHAB 3AV1D 2RVQC 3AZGC 3LZ1D 5BNXB 5B2IC 1P3AD 3AL0C 1P3PC 5FUGB 3X1SA 5G49B 3MGPC 3KUYA 3W97A 5AVBB 3AFAC 4ZBJC 3W99B 4KHAA 5AV9D 1BH9B 3UTAB 3W96C 2IO5C 5BNXA 1P34B 2L5AA 5FUGA 4WU9B 5G49A 1P3LD 5AVBA 1EQZD 1BFMA 1ZLAC 3W99A 2HIOB 1BH9A 3LJAD 1P3ID 3X1UD 2F8NB 3UTAA 5B32C 1KX4D 1P34A 5AVCD 4Z5TB 5F99C 4UPKA 4WU9A 2CV5D 4J8UB 3WAAB 1TZYB 5AY8D 2HIOA 2F8NA 2W8SA 5E5AB 3REHB 3WTPD 5BO0B 4Z5TA 3MGQD 4Z66D 2Y2MA 3MGSB 3WAAA 4J8UA 1TZYA 4LD9B 5GXQB 3B6GB 1HQ3B 3X1VC 5E5AA 3REHA 5BO0A 2Y2PA 4YS3B 3MGSA 4KGCD 5DNNB 4LD9A 3WTPE 5GXQA 3VH6W 1HQ3A 3KWQD 3C1CB 3AZKD 3B6GA 5B1MC 3REKD 5AV5C 4H9QB 4YM6C 2LY8A 2AROC 2VQRA 2FFFB 3AZEB 4YS3A 3WKJB 2BG1A 3IP4C 4M6BA 4X23B 2PYOB 5DNNA 3REJB 3C1CA 5B33C 3UT9C 1M1AB 4J8XB 3X1UC 3FDDA 2FJ7B 4H9QA 3A1KA 5B32G 3H0RC 4QLCB 3AZEA 3WKJA 3KXBC 4UUZB 4X23A 2PYOA 3REJA 3AZFC 1M1AA 4J8XA 5GSUB 3WA9C 2FJ7A 5B31B 4H9PB 4QLCA 4Z66C 3NQJB 1R4VA 4NFTA 4UUZA 1M19D 3LZ0D 4CSRB 5GSUA 3REID 5JRGB 2NQBB 5B31A 3EPLA 4H9PA 3AZLB 2HUEB 1F66D 3AV2D 1U35D 3NQJA 4ZUXB 3O62D 1WWSA 2RIQA 4CSRA 1AOIB 3AZKC 1KX3D 3V9RB 3REKC 5CPKB 5JRGA 2YFWB 2NQBA 5B0ZD 3AZLA 3AYWC 5CPID 4XUJD 4ZUXA 1AOIA 5BS7C 4JJND 3V9RA 5CPKA 3KFUG 2YFWA 4XZQD 3VH5T 5AVBC 5B40C 5B2ID 3AV1B 3W99C 1P3PD 5AV6C 1T3UA 5CP6C 3MNNB 3AFAD 1P34C 3UTBC 1M18D 1P3OC 1P3FD 3W96D 1JFIB 4J8WC 3A6ND 5AV9B 3AV1A 1M19C 2ZY2A 1BH8B 3MNNA 2BYKB 1ZLAD 1P3KD 5B1LD 4Z5TC 1P3LB 1EQZB 5B32D 3WAAC 1JFIA 5AV9A 5F99D 5CPJD 3LJAB 4DQYB 3AZJB 1BH8A 2DQNC 3W98B 4HGAB 2BYKA 4EO5B 5C3IC 1P3LA 3X1TC 2CV5B 5DNMD 1EQZA 5GT3C 1S32B 5CPIC 3MGSC 5B0YB 5AY8B 4XUJC 4LD9C 3MGRB 3B6GC 3LJAA 3AZJA 3W98A
chains in the Genus database with same CATH topology
4XZQC 3AZIC 4DRBA 3X1VD 2CV5A 1S32A 3LELB 5B0YA 5AY8A 3MGRA 3C1CC 2Y2LA 3AZHC 3H0MC 1M18C 3B0DC 1KX5C 5B1MD 1P3FC 4KGCB 5AV5D 4YM6D 3LELA 4X23C 3A6NC 3KWQB 2AROD 3MVDC 2FJ7C 4G91B 1P3KC 5B1LC 5B33D 3UT9D 4R8PC 3AN2B 4KGCA 3KWQA 3B0BA 5CPJC 1P3BD 3VH5W 5CHLB 5GSUC 3KXBD 3C1BC 2JE5A 5AV8B 3AZFD 3WA9D 5DNMC 3AN2A 2JCHA 5BT1D 4J8VB 2NZDB 2ZY3A 5JA4B 1ID3B 5B2JB 5GT0C 1P3MB 1A7WA 5AV8A 4NE5A 4WZSB 5B24C 3LZ0B 3AZNB 4J8VA 3F6TA 3B6FC 2NZDA 5JA4A 1ID3A 3REIB 5CPKC 4KUDC 5B2JA 1P3GB 4CAYB 1P3MA 3TU4B 3NQUB 3AV2B 1U35B 3O62B 3LZ0A 3AZNA 3R45B 3AYWD 3REIA 2Y2OA 5B0ZB 1P3GA 4Z2MG 4CAYA 3TU4A 2G5HC 3NQUA 3AV2A 1U35A 3O62A 4AWLB 3RELB 4JJNB 1P3BC 3R45A 5AVBD 5B40D 3MNNC 5B0ZA 3W99D 3AZGB 2XD5A 5AV6D 5CP6D 4H9SA 1P34D 5BT1C 2Y2HA 4DRAA 3UTBD 3MGPB 1P3OD 3RELA 4JJNA 3AFAB 4ZBJB 4J8WD 1B67A 4G92C 3AZGA 3W96B 2IO5B 4Z5TD 3MGPA 3AZJC 3AZMB 3AFAA 3WAAD 4E44A 5B32B 3W96A 1S32C 1W2EA 5F99B 3X1SC 3KUYC 3X1TD 3W97C 3AZMA 5GT3D 1TAFB 3MGSD 5KDMB 3A1IA 4LD9D 3B6GD 4WU8B 5B32A 3LELC 5F99A 3AZID 3EPJA 2Y2JA 1TAFA 5KDMA 2Y2IA 3C1CD 3LZ1B 3X1VB 4WU8A 4WV4B 3UTAC 1P3AB 3AZHD 1Z2CB 4WU9C 1B6WA 1KX5D 3WKJD 4X23D 2PYOD 3MVDD 2HIOC 5B1MB 3LZ1A 3X1VA 5AV5B 4YM6B 1P3AA 2FJ7D 5BNVB 2AROB 1HTAA 4R8PD 4J8UC 1TZYC 3UT9B 1P3IB 3X1UB 5AV8C 5B1MA 5AV5A 2ZY5A 5AVCB 5E5AC 5GSUD 4YM6A 3C1BD 1KX4B 5BNVA 2AROA 4J8VC 3REHC 3EG5B 4WNNB 3KXBB 1KU5A 4Z2MH 3UT9A 5GXQC 3AZFB 1HQ3C 3X1UA 1P3IA 3WA9B 1KX4A 3WTPB 5AVCA 3MGQB 5GT0D 3AZLD 4Z66B 4WNNA 4YS3C 3KXBA 5B24D 4ZUXD 5DNNC 3B6FD 3AZFA 3WA9A 2J8PA 3VH5A 3WTPA 5CPKD 4KUDD 3MGQA 4Z66A 3AZEC 3WKJC 3B0CW 2JSSA 2PYOC 3AZKB 2Y2QA 3REJC 3REKB 1M1AC 4J8XC 2F8NG 3AYWB 4QLCC 3AZKA 3REKA 3MNND 5B31C 3AYWA 2CWEA 5B40B 2ZY4A 3VH6A 5AV6B 5CP6B 5BS7A 5JRGC 3UTBB 2NQBC 1P3OB 1H3OB 3AZLC 2HUEC 5B40A 3AZMC 4J8WB 1M19B 4ZUXC 5AV6A 5CP6A 1AOIC 2Y2GA 2Y2NA 3AZJD 2G5IC 3UTBA 3W98D 1P3OA 1H3OA 1F66B 4J8WA 1S32D 1M19A 5B0YD 3X1SD 3MGRD 4H9NB 1KX3B 4WU8C 3KUYD 3W97D 5C3IB 3X1TB 1F66A 5GT3B 5CPIB 4XUJB 3LELD 3AV1C 4H9NA 3LZ1C 3P5JB 1KX3A 1WWIA 1P3AC 4XZQB 1F1EA 3AZIB 3X1TA 3EPKA 5B31G 5GT3A 3UTAD 5B2IB 5CPIA 4XUJA 1P3PB 5AV9C 4WU9D 1ULYA 3AZHB 4XZQA 1M18B 3AZIA 3B0DB 1P3LC 2HIOD 1KX5B 1P3FB 2F8ND 1EQZC 3AN2D 5B2IA 3A6NB 1P3PA 3MVDB 3LJAC 1P3IC 2XD1A 1KX4C 5AVCC 4J8UD 3AZHA 1TZYD 5B1LB 4HGAC 1P3KB 1M18A 1ZLAB 3W98C 3B0CT 4EO5C 5AV8D 4R8PB 1KX5A 1P3FA 2CV5C 5E5AD 3A6NA 3REHD 5B0YC 5AY8C 3MVDA 4J8VD 5CPJB 3MGRC 2NZDD 3H0LC 1ID3D 3C1BB 3WTPC 1ZLAA 5B2JD 5B1LA 1P3KA 3MGQC 2F8NH 5GXQD 1HQ3D 1P3MD 4R8PA 5DNMB 3KSYA 3AZND 5CPJA 4YS3D 3C1BA 5GT0B 1P3GD 5DNND 5DNMA 3TU4D 5B24B 4KGCC 3B6FB 3KWQC 3AZED 4KUDB 5GT0A 4G91C 1PZRA 3REJD 1M1AD 4J8XD 1Q9CA 3AN2C 5B24A 2F2AC 3EPHA 3B6FA 2BYMB 3RELD 4QLCD 4KUDA 5B33B 2RVQD 3AZGD 4NE6A 5B31D 1P3BB 3MGPD 2BYMA 2NZDC 1ID3C 2F8NK 5B2JC 2ZM5A 2YFVB 5B33A 1P3MC 5JRGD 2NQBD 1N1JB 3LZ0C 3AZNC 1P3BA 4WJ3C 4NE3A 3REIC 3AZMD 2DF4C 4G92B 1P3GC 2YFVA 1AOID 1F66C 4H9RB 3TU4C 3AV2C 4H9OB 3VH6T 1U35C 1N1JA 3O62C 1KX3C 2UWXA 5B0ZC 2Y2KA 4E45A 4WU8D 4H9SC 4H9RA 4H9OA 3X1SB 4AWLC 3KUYB 3RELC 4JJNC 3W97B 4KHAB 3AV1D 2RVQC 3AZGC 3LZ1D 5BNXB 5B2IC 1P3AD 3AL0C 1P3PC 5FUGB 3X1SA 5G49B 3MGPC 3KUYA 3W97A 5AVBB 3AFAC 4ZBJC 3W99B 4KHAA 5AV9D 1BH9B 3UTAB 3W96C 2IO5C 5BNXA 1P34B 2L5AA 5FUGA 4WU9B 5G49A 1P3LD 5AVBA 1EQZD 1BFMA 1ZLAC 3W99A 2HIOB 1BH9A 3LJAD 1P3ID 3X1UD 2F8NB 3UTAA 5B32C 1KX4D 1P34A 5AVCD 4Z5TB 5F99C 4UPKA 4WU9A 2CV5D 4J8UB 3WAAB 1TZYB 5AY8D 2HIOA 2F8NA 2W8SA 5E5AB 3REHB 3WTPD 5BO0B 4Z5TA 3MGQD 4Z66D 2Y2MA 3MGSB 3WAAA 4J8UA 1TZYA 4LD9B 5GXQB 3B6GB 1HQ3B 3X1VC 5E5AA 3REHA 5BO0A 2Y2PA 4YS3B 3MGSA 4KGCD 5DNNB 4LD9A 3WTPE 5GXQA 3VH6W 1HQ3A 3KWQD 3C1CB 3AZKD 3B6GA 5B1MC 3REKD 5AV5C 4H9QB 4YM6C 2LY8A 2AROC 2VQRA 2FFFB 3AZEB 4YS3A 3WKJB 2BG1A 3IP4C 4M6BA 4X23B 2PYOB 5DNNA 3REJB 3C1CA 5B33C 3UT9C 1M1AB 4J8XB 3X1UC 3FDDA 2FJ7B 4H9QA 3A1KA 5B32G 3H0RC 4QLCB 3AZEA 3WKJA 3KXBC 4UUZB 4X23A 2PYOA 3REJA 3AZFC 1M1AA 4J8XA 5GSUB 3WA9C 2FJ7A 5B31B 4H9PB 4QLCA 4Z66C 3NQJB 1R4VA 4NFTA 4UUZA 1M19D 3LZ0D 4CSRB 5GSUA 3REID 5JRGB 2NQBB 5B31A 3EPLA 4H9PA 3AZLB 2HUEB 1F66D 3AV2D 1U35D 3NQJA 4ZUXB 3O62D 1WWSA 2RIQA 4CSRA 1AOIB 3AZKC 1KX3D 3V9RB 3REKC 5CPKB 5JRGA 2YFWB 2NQBA 5B0ZD 3AZLA 3AYWC 5CPID 4XUJD 4ZUXA 1AOIA 5BS7C 4JJND 3V9RA 5CPKA 3KFUG 2YFWA 4XZQD 3VH5T 5AVBC 5B40C 5B2ID 3AV1B 3W99C 1P3PD 5AV6C 1T3UA 5CP6C 3MNNB 3AFAD 1P34C 3UTBC 1M18D 1P3OC 1P3FD 3W96D 1JFIB 4J8WC 3A6ND 5AV9B 3AV1A 1M19C 2ZY2A 1BH8B 3MNNA 2BYKB 1ZLAD 1P3KD 5B1LD 4Z5TC 1P3LB 1EQZB 5B32D 3WAAC 1JFIA 5AV9A 5F99D 5CPJD 3LJAB 4DQYB 3AZJB 1BH8A 2DQNC 3W98B 4HGAB 2BYKA 4EO5B 5C3IC 1P3LA 3X1TC 2CV5B 5DNMD 1EQZA 5GT3C 1S32B 5CPIC 3MGSC 5B0YB 5AY8B 4XUJC 4LD9C 3MGRB 3B6GC 3LJAA 3AZJA 3W98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZQ C;  3AZI C;  4DRB A;  3X1V D;  2CV5 A;  1S32 A;  3LEL B;  5B0Y A;  5AY8 A;  3MGR A;  3C1C C;  3AZH C;  1M18 C;  3B0D C;  1KX5 C;  5B1M D;  1P3F C;  4KGC B;  5AV5 D;  4YM6 D;  3LEL A;  4X23 C;  3A6N C;  3KWQ B;  2ARO D;  3MVD C;  2FJ7 C;  4G91 B;  1P3K C;  5B1L C;  5B33 D;  3UT9 D;  4R8P C;  3AN2 B;  4KGC A;  3KWQ A;  3B0B A;  5CPJ C;  1P3B D;  3VH5 W;  5CHL B;  5GSU C;  3KXB D;  3C1B C;  5AV8 B;  3AZF D;  3WA9 D;  5DNM C;  3AN2 A;  5BT1 D;  4J8V B;  2NZD B;  5JA4 B;  1ID3 B;  5B2J B;  5GT0 C;  1P3M B;  1A7W A;  5AV8 A;  4NE5 A;  4WZS B;  5B24 C;  3LZ0 B;  3AZN B;  4J8V A;  3B6F C;  2NZD A;  5JA4 A;  1ID3 A;  3REI B;  5CPK C;  4KUD C;  5B2J A;  1P3G B;  4CAY B;  1P3M A;  3TU4 B;  3NQU B;  3AV2 B;  1U35 B;  3O62 B;  3LZ0 A;  3AZN A;  3R45 B;  3AYW D;  3REI A;  5B0Z B;  1P3G A;  4Z2M G;  4CAY A;  3TU4 A;  3NQU A;  3AV2 A;  1U35 A;  3O62 A;  4AWL B;  3REL B;  4JJN B;  1P3B C;  3R45 A;  5AVB D;  5B40 D;  3MNN C;  5B0Z A;  3W99 D;  3AZG B;  5AV6 D;  5CP6 D;  4H9S A;  1P34 D;  5BT1 C;  4DRA A;  3UTB D;  3MGP B;  1P3O D;  3REL A;  4JJN A;  3AFA B;  4ZBJ B;  4J8W D;  1B67 A;  4G92 C;  3AZG A;  3W96 B;  2IO5 B;  4Z5T D;  3MGP A;  3AZJ C;  3AZM B;  3AFA A;  3WAA D;  4E44 A;  5B32 B;  3W96 A;  1S32 C;  5F99 B;  3X1S C;  3KUY C;  3X1T D;  3W97 C;  3AZM A;  5GT3 D;  1TAF B;  3MGS D;  5KDM B;  4LD9 D;  3B6G D;  4WU8 B;  5B32 A;  3LEL C;  5F99 A;  3AZI D;  1TAF A;  5KDM A;  3C1C D;  3LZ1 B;  3X1V B;  4WU8 A;  4WV4 B;  3UTA C;  1P3A B;  3AZH D;  4WU9 C;  1B6W A;  1KX5 D;  3WKJ D;  4X23 D;  2PYO D;  3MVD D;  2HIO C;  5B1M B;  3LZ1 A;  3X1V A;  5AV5 B;  4YM6 B;  1P3A A;  2FJ7 D;  5BNV B;  2ARO B;  1HTA A;  4R8P D;  4J8U C;  1TZY C;  3UT9 B;  1P3I B;  3X1U B;  5AV8 C;  5B1M A;  5AV5 A;  5GSU D;  5AVC B;  5E5A C;  4YM6 A;  3C1B D;  1KX4 B;  5BNV A;  2ARO A;  4J8V C;  3REH C;  4WNN B;  3KXB B;  1KU5 A;  4Z2M H;  3UT9 A;  5GXQ C;  3AZF B;  1HQ3 C;  3X1U A;  1P3I A;  3WA9 B;  1KX4 A;  3WTP B;  5AVC A;  3MGQ B;  5GT0 D;  3AZL D;  4Z66 B;  4WNN A;  4YS3 C;  3KXB A;  5B24 D;  4ZUX D;  5DNN C;  3B6F D;  3AZF A;  3WA9 A;  3VH5 A;  3WTP A;  5CPK D;  4KUD D;  3MGQ A;  4Z66 A;  3AZE C;  3WKJ C;  3B0C W;  2JSS A;  2PYO C;  3AZK B;  3REJ C;  3REK B;  1M1A C;  4J8X C;  2F8N G;  3AYW B;  4QLC C;  3AZK A;  3REK A;  3MNN D;  5B31 C;  3AYW A;  2CWE A;  5B40 B;  3VH6 A;  5AV6 B;  5CP6 B;  5BS7 A;  5JRG C;  3UTB B;  2NQB C;  1P3O B;  1H3O B;  3AZL C;  2HUE C;  5B40 A;  3AZM C;  4J8W B;  1M19 B;  4ZUX C;  5AV6 A;  5CP6 A;  1AOI C;  3AZJ D;  3UTB A;  3W98 D;  1P3O A;  1H3O A;  1F66 B;  4J8W A;  1S32 D;  1M19 A;  5B0Y D;  3X1S D;  3MGR D;  4H9N B;  1KX3 B;  4WU8 C;  3KUY D;  3W97 D;  5C3I B;  3X1T B;  1F66 A;  5GT3 B;  5CPI B;  4XUJ B;  3LEL D;  3AV1 C;  4H9N A;  3LZ1 C;  1KX3 A;  1WWI A;  1P3A C;  4XZQ B;  1F1E A;  3AZI B;  3X1T A;  5B31 G;  5GT3 A;  3UTA D;  5B2I B;  5CPI A;  4XUJ A;  1P3P B;  5AV9 C;  4WU9 D;  1ULY A;  3AZH B;  4XZQ A;  1M18 B;  3AZI A;  3B0D B;  1P3L C;  2HIO D;  1KX5 B;  1P3F B;  2F8N D;  1EQZ C;  3AN2 D;  5B2I A;  3A6N B;  1P3P A;  3MVD B;  3LJA C;  1P3I C;  1KX4 C;  5AVC C;  4J8U D;  3AZH A;  1TZY D;  5B1L B;  4HGA C;  1P3K B;  1M18 A;  1ZLA B;  3W98 C;  3B0C T;  4EO5 C;  5AV8 D;  4R8P B;  1KX5 A;  1P3F A;  2CV5 C;  5E5A D;  3A6N A;  3REH D;  5B0Y C;  5AY8 C;  3MVD A;  4J8V D;  5CPJ B;  3MGR C;  2NZD D;  1ID3 D;  3C1B B;  3WTP C;  1ZLA A;  5B2J D;  5B1L A;  1P3K A;  3MGQ C;  2F8N H;  5GXQ D;  1HQ3 D;  1P3M D;  4R8P A;  5DNM B;  3KSY A;  3AZN D;  5CPJ A;  4YS3 D;  3C1B A;  5GT0 B;  1P3G D;  5DNN D;  5DNM A;  3TU4 D;  5B24 B;  4KGC C;  3B6F B;  3KWQ C;  3AZE D;  4KUD B;  5GT0 A;  4G91 C;  3REJ D;  1M1A D;  4J8X D;  1Q9C A;  3AN2 C;  5B24 A;  3B6F A;  2BYM B;  3REL D;  4QLC D;  4KUD A;  5B33 B;  2RVQ D;  3AZG D;  4NE6 A;  5B31 D;  1P3B B;  3MGP D;  2BYM A;  2NZD C;  1ID3 C;  2F8N K;  5B2J C;  2YFV B;  5B33 A;  1P3M C;  5JRG D;  2NQB D;  1N1J B;  3LZ0 C;  3AZN C;  1P3B A;  4NE3 A;  3REI C;  3AZM D;  4G92 B;  1P3G C;  2YFV A;  1AOI D;  1F66 C;  4H9R B;  3TU4 C;  3AV2 C;  4H9O B;  3VH6 T;  1U35 C;  1N1J A;  3O62 C;  1KX3 C;  5B0Z C;  4E45 A;  4WU8 D;  4H9S C;  4H9R A;  4H9O A;  3X1S B;  4AWL C;  3KUY B;  3REL C;  4JJN C;  3W97 B;  4KHA B;  3AV1 D;  2RVQ C;  3AZG C;  3LZ1 D;  5BNX B;  5B2I C;  1P3A D;  1P3P C;  5FUG B;  3X1S A;  5G49 B;  3MGP C;  3KUY A;  3W97 A;  5AVB B;  3AFA C;  4ZBJ C;  3W99 B;  4KHA A;  5AV9 D;  1BH9 B;  3UTA B;  3W96 C;  2IO5 C;  5BNX A;  1P34 B;  2L5A A;  5FUG A;  4WU9 B;  5G49 A;  1P3L D;  5AVB A;  1EQZ D;  1BFM A;  1ZLA C;  3W99 A;  2HIO B;  1BH9 A;  3LJA D;  1P3I D;  3X1U D;  2F8N B;  3UTA A;  5B32 C;  1KX4 D;  1P34 A;  5AVC D;  4Z5T B;  5F99 C;  4WU9 A;  2CV5 D;  4J8U B;  3WAA B;  1TZY B;  5AY8 D;  2HIO A;  2F8N A;  5E5A B;  3REH B;  3WTP D;  5BO0 B;  4Z5T A;  3MGQ D;  4Z66 D;  3MGS B;  3WAA A;  4J8U A;  1TZY A;  4LD9 B;  5GXQ B;  3B6G B;  1HQ3 B;  3X1V C;  5E5A A;  3REH A;  5BO0 A;  4YS3 B;  3MGS A;  4KGC D;  5DNN B;  4LD9 A;  3WTP E;  5GXQ A;  3VH6 W;  1HQ3 A;  3KWQ D;  3C1C B;  3AZK D;  3B6G A;  5B1M C;  3REK D;  5AV5 C;  4H9Q B;  4YM6 C;  2LY8 A;  2ARO C;  3AZE B;  4YS3 A;  3WKJ B;  4M6B A;  4X23 B;  2PYO B;  5DNN A;  3REJ B;  3C1C A;  5B33 C;  3UT9 C;  1M1A B;  4J8X B;  3X1U C;  2FJ7 B;  4H9Q A;  5B32 G;  4QLC B;  3AZE A;  3WKJ A;  3KXB C;  4UUZ B;  4X23 A;  2PYO A;  3REJ A;  3AZF C;  1M1A A;  4J8X A;  5GSU B;  3WA9 C;  2FJ7 A;  5B31 B;  4H9P B;  4QLC A;  4Z66 C;  3NQJ B;  1R4V A;  4NFT A;  4UUZ A;  1M19 D;  3LZ0 D;  4CSR B;  5GSU A;  3REI D;  5JRG B;  2NQB B;  5B31 A;  4H9P A;  3AZL B;  2HUE B;  1F66 D;  3AV2 D;  1U35 D;  3NQJ A;  4ZUX B;  3O62 D;  1WWS A;  4CSR A;  1AOI B;  3AZK C;  1KX3 D;  3V9R B;  3REK C;  5CPK B;  5JRG A;  2YFW B;  2NQB A;  5B0Z D;  3AZL A;  3AYW C;  5CPI D;  4XUJ D;  4ZUX A;  1AOI A;  5BS7 C;  4JJN D;  3V9R A;  5CPK A;  2YFW A;  4XZQ D;  3VH5 T;  5AVB C;  5B40 C;  5B2I D;  3AV1 B;  3W99 C;  1P3P D;  5AV6 C;  5CP6 C;  3MNN B;  3AFA D;  1P34 C;  3UTB C;  1M18 D;  1P3O C;  1P3F D;  3W96 D;  1JFI B;  4J8W C;  3A6N D;  5AV9 B;  3AV1 A;  1M19 C;  1BH8 B;  3MNN A;  2BYK B;  1ZLA D;  1P3K D;  5B1L D;  4Z5T C;  1P3L B;  1EQZ B;  5B32 D;  3WAA C;  1JFI A;  5AV9 A;  5F99 D;  5CPJ D;  3LJA B;  3AZJ B;  1BH8 A;  3W98 B;  4HGA B;  2BYK A;  4EO5 B;  5C3I C;  1P3L A;  3X1T C;  2CV5 B;  5DNM D;  1EQZ A;  5GT3 C;  1S32 B;  5CPI C;  3MGS C;  5B0Y B;  5AY8 B;  4XUJ C;  4LD9 C;  3MGR B;  3B6G C;  3LJA A;  3AZJ A;  3W98 A; 
#chains in the Genus database with same CATH topology
 4XZQ C;  3AZI C;  4DRB A;  3X1V D;  2CV5 A;  1S32 A;  3LEL B;  5B0Y A;  5AY8 A;  3MGR A;  3C1C C;  2Y2L A;  3AZH C;  3H0M C;  1M18 C;  3B0D C;  1KX5 C;  5B1M D;  1P3F C;  4KGC B;  5AV5 D;  4YM6 D;  3LEL A;  4X23 C;  3A6N C;  3KWQ B;  2ARO D;  3MVD C;  2FJ7 C;  4G91 B;  1P3K C;  5B1L C;  5B33 D;  3UT9 D;  4R8P C;  3AN2 B;  4KGC A;  3KWQ A;  3B0B A;  5CPJ C;  1P3B D;  3VH5 W;  5CHL B;  5GSU C;  3KXB D;  3C1B C;  2JE5 A;  5AV8 B;  3AZF D;  3WA9 D;  5DNM C;  3AN2 A;  2JCH A;  5BT1 D;  4J8V B;  2NZD B;  2ZY3 A;  5JA4 B;  1ID3 B;  5B2J B;  5GT0 C;  1P3M B;  1A7W A;  5AV8 A;  4NE5 A;  4WZS B;  5B24 C;  3LZ0 B;  3AZN B;  4J8V A;  3F6T A;  3B6F C;  2NZD A;  5JA4 A;  1ID3 A;  3REI B;  5CPK C;  4KUD C;  5B2J A;  1P3G B;  4CAY B;  1P3M A;  3TU4 B;  3NQU B;  3AV2 B;  1U35 B;  3O62 B;  3LZ0 A;  3AZN A;  3R45 B;  3AYW D;  3REI A;  2Y2O A;  5B0Z B;  1P3G A;  4Z2M G;  4CAY A;  3TU4 A;  2G5H C;  3NQU A;  3AV2 A;  1U35 A;  3O62 A;  4AWL B;  3REL B;  4JJN B;  1P3B C;  3R45 A;  5AVB D;  5B40 D;  3MNN C;  5B0Z A;  3W99 D;  3AZG B;  2XD5 A;  5AV6 D;  5CP6 D;  4H9S A;  1P34 D;  5BT1 C;  2Y2H A;  4DRA A;  3UTB D;  3MGP B;  1P3O D;  3REL A;  4JJN A;  3AFA B;  4ZBJ B;  4J8W D;  1B67 A;  4G92 C;  3AZG A;  3W96 B;  2IO5 B;  4Z5T D;  3MGP A;  3AZJ C;  3AZM B;  3AFA A;  3WAA D;  4E44 A;  5B32 B;  3W96 A;  1S32 C;  1W2E A;  5F99 B;  3X1S C;  3KUY C;  3X1T D;  3W97 C;  3AZM A;  5GT3 D;  1TAF B;  3MGS D;  5KDM B;  3A1I A;  4LD9 D;  3B6G D;  4WU8 B;  5B32 A;  3LEL C;  5F99 A;  3AZI D;  3EPJ A;  2Y2J A;  1TAF A;  5KDM A;  2Y2I A;  3C1C D;  3LZ1 B;  3X1V B;  4WU8 A;  4WV4 B;  3UTA C;  1P3A B;  3AZH D;  1Z2C B;  4WU9 C;  1B6W A;  1KX5 D;  3WKJ D;  4X23 D;  2PYO D;  3MVD D;  2HIO C;  5B1M B;  3LZ1 A;  3X1V A;  5AV5 B;  4YM6 B;  1P3A A;  2FJ7 D;  5BNV B;  2ARO B;  1HTA A;  4R8P D;  4J8U C;  1TZY C;  3UT9 B;  1P3I B;  3X1U B;  5AV8 C;  5B1M A;  5AV5 A;  2ZY5 A;  5AVC B;  5E5A C;  5GSU D;  4YM6 A;  3C1B D;  1KX4 B;  5BNV A;  2ARO A;  4J8V C;  3REH C;  3EG5 B;  4WNN B;  3KXB B;  1KU5 A;  4Z2M H;  3UT9 A;  5GXQ C;  3AZF B;  1HQ3 C;  3X1U A;  1P3I A;  3WA9 B;  1KX4 A;  3WTP B;  5AVC A;  3MGQ B;  5GT0 D;  3AZL D;  4Z66 B;  4WNN A;  4YS3 C;  3KXB A;  5B24 D;  4ZUX D;  5DNN C;  3B6F D;  3AZF A;  3WA9 A;  2J8P A;  3VH5 A;  3WTP A;  5CPK D;  4KUD D;  3MGQ A;  4Z66 A;  3AZE C;  3WKJ C;  3B0C W;  2JSS A;  2PYO C;  3AZK B;  2Y2Q A;  3REJ C;  3REK B;  1M1A C;  4J8X C;  2F8N G;  3AYW B;  4QLC C;  3AZK A;  3REK A;  3MNN D;  5B31 C;  3AYW A;  2CWE A;  5B40 B;  2ZY4 A;  3VH6 A;  5AV6 B;  5CP6 B;  5BS7 A;  5JRG C;  3UTB B;  2NQB C;  1P3O B;  1H3O B;  3AZL C;  2HUE C;  5B40 A;  3AZM C;  4J8W B;  1M19 B;  4ZUX C;  5AV6 A;  5CP6 A;  1AOI C;  2Y2G A;  2Y2N A;  3AZJ D;  2G5I C;  3UTB A;  3W98 D;  1P3O A;  1H3O A;  1F66 B;  4J8W A;  1S32 D;  1M19 A;  5B0Y D;  3X1S D;  3MGR D;  4H9N B;  1KX3 B;  4WU8 C;  3KUY D;  3W97 D;  5C3I B;  3X1T B;  1F66 A;  5GT3 B;  5CPI B;  4XUJ B;  3LEL D;  3AV1 C;  4H9N A;  3LZ1 C;  3P5J B;  1KX3 A;  1WWI A;  1P3A C;  4XZQ B;  1F1E A;  3AZI B;  3X1T A;  3EPK A;  5B31 G;  5GT3 A;  3UTA D;  5B2I B;  5CPI A;  4XUJ A;  1P3P B;  5AV9 C;  4WU9 D;  1ULY A;  3AZH B;  4XZQ A;  1M18 B;  3AZI A;  3B0D B;  1P3L C;  2HIO D;  1KX5 B;  1P3F B;  2F8N D;  1EQZ C;  3AN2 D;  5B2I A;  3A6N B;  1P3P A;  3MVD B;  3LJA C;  1P3I C;  2XD1 A;  1KX4 C;  5AVC C;  4J8U D;  3AZH A;  1TZY D;  5B1L B;  4HGA C;  1P3K B;  1M18 A;  1ZLA B;  3W98 C;  3B0C T;  4EO5 C;  5AV8 D;  4R8P B;  1KX5 A;  1P3F A;  2CV5 C;  5E5A D;  3A6N A;  3REH D;  5B0Y C;  5AY8 C;  3MVD A;  4J8V D;  5CPJ B;  3MGR C;  2NZD D;  3H0L C;  1ID3 D;  3C1B B;  3WTP C;  1ZLA A;  5B2J D;  5B1L A;  1P3K A;  3MGQ C;  2F8N H;  5GXQ D;  1HQ3 D;  1P3M D;  4R8P A;  5DNM B;  3KSY A;  3AZN D;  5CPJ A;  4YS3 D;  3C1B A;  5GT0 B;  1P3G D;  5DNN D;  5DNM A;  3TU4 D;  5B24 B;  4KGC C;  3B6F B;  3KWQ C;  3AZE D;  4KUD B;  5GT0 A;  4G91 C;  1PZR A;  3REJ D;  1M1A D;  4J8X D;  1Q9C A;  3AN2 C;  5B24 A;  2F2A C;  3EPH A;  3B6F A;  2BYM B;  3REL D;  4QLC D;  4KUD A;  5B33 B;  2RVQ D;  3AZG D;  4NE6 A;  5B31 D;  1P3B B;  3MGP D;  2BYM A;  2NZD C;  1ID3 C;  2F8N K;  5B2J C;  2ZM5 A;  2YFV B;  5B33 A;  1P3M C;  5JRG D;  2NQB D;  1N1J B;  3LZ0 C;  3AZN C;  1P3B A;  4WJ3 C;  4NE3 A;  3REI C;  3AZM D;  2DF4 C;  4G92 B;  1P3G C;  2YFV A;  1AOI D;  1F66 C;  4H9R B;  3TU4 C;  3AV2 C;  4H9O B;  3VH6 T;  1U35 C;  1N1J A;  3O62 C;  1KX3 C;  2UWX A;  5B0Z C;  2Y2K A;  4E45 A;  4WU8 D;  4H9S C;  4H9R A;  4H9O A;  3X1S B;  4AWL C;  3KUY B;  3REL C;  4JJN C;  3W97 B;  4KHA B;  3AV1 D;  2RVQ C;  3AZG C;  3LZ1 D;  5BNX B;  5B2I C;  1P3A D;  3AL0 C;  1P3P C;  5FUG B;  3X1S A;  5G49 B;  3MGP C;  3KUY A;  3W97 A;  5AVB B;  3AFA C;  4ZBJ C;  3W99 B;  4KHA A;  5AV9 D;  1BH9 B;  3UTA B;  3W96 C;  2IO5 C;  5BNX A;  1P34 B;  2L5A A;  5FUG A;  4WU9 B;  5G49 A;  1P3L D;  5AVB A;  1EQZ D;  1BFM A;  1ZLA C;  3W99 A;  2HIO B;  1BH9 A;  3LJA D;  1P3I D;  3X1U D;  2F8N B;  3UTA A;  5B32 C;  1KX4 D;  1P34 A;  5AVC D;  4Z5T B;  5F99 C;  4UPK A;  4WU9 A;  2CV5 D;  4J8U B;  3WAA B;  1TZY B;  5AY8 D;  2HIO A;  2F8N A;  2W8S A;  5E5A B;  3REH B;  3WTP D;  5BO0 B;  4Z5T A;  3MGQ D;  4Z66 D;  2Y2M A;  3MGS B;  3WAA A;  4J8U A;  1TZY A;  4LD9 B;  5GXQ B;  3B6G B;  1HQ3 B;  3X1V C;  5E5A A;  3REH A;  5BO0 A;  2Y2P A;  4YS3 B;  3MGS A;  4KGC D;  5DNN B;  4LD9 A;  3WTP E;  5GXQ A;  3VH6 W;  1HQ3 A;  3KWQ D;  3C1C B;  3AZK D;  3B6G A;  5B1M C;  3REK D;  5AV5 C;  4H9Q B;  4YM6 C;  2LY8 A;  2ARO C;  2VQR A;  2FFF B;  3AZE B;  4YS3 A;  3WKJ B;  2BG1 A;  3IP4 C;  4M6B A;  4X23 B;  2PYO B;  5DNN A;  3REJ B;  3C1C A;  5B33 C;  3UT9 C;  1M1A B;  4J8X B;  3X1U C;  3FDD A;  2FJ7 B;  4H9Q A;  3A1K A;  5B32 G;  3H0R C;  4QLC B;  3AZE A;  3WKJ A;  3KXB C;  4UUZ B;  4X23 A;  2PYO A;  3REJ A;  3AZF C;  1M1A A;  4J8X A;  5GSU B;  3WA9 C;  2FJ7 A;  5B31 B;  4H9P B;  4QLC A;  4Z66 C;  3NQJ B;  1R4V A;  4NFT A;  4UUZ A;  1M19 D;  3LZ0 D;  4CSR B;  5GSU A;  3REI D;  5JRG B;  2NQB B;  5B31 A;  3EPL A;  4H9P A;  3AZL B;  2HUE B;  1F66 D;  3AV2 D;  1U35 D;  3NQJ A;  4ZUX B;  3O62 D;  1WWS A;  2RIQ A;  4CSR A;  1AOI B;  3AZK C;  1KX3 D;  3V9R B;  3REK C;  5CPK B;  5JRG A;  2YFW B;  2NQB A;  5B0Z D;  3AZL A;  3AYW C;  5CPI D;  4XUJ D;  4ZUX A;  1AOI A;  5BS7 C;  4JJN D;  3V9R A;  5CPK A;  3KFU G;  2YFW A;  4XZQ D;  3VH5 T;  5AVB C;  5B40 C;  5B2I D;  3AV1 B;  3W99 C;  1P3P D;  5AV6 C;  1T3U A;  5CP6 C;  3MNN B;  3AFA D;  1P34 C;  3UTB C;  1M18 D;  1P3O C;  1P3F D;  3W96 D;  1JFI B;  4J8W C;  3A6N D;  5AV9 B;  3AV1 A;  1M19 C;  2ZY2 A;  1BH8 B;  3MNN A;  2BYK B;  1ZLA D;  1P3K D;  5B1L D;  4Z5T C;  1P3L B;  1EQZ B;  5B32 D;  3WAA C;  1JFI A;  5AV9 A;  5F99 D;  5CPJ D;  3LJA B;  4DQY B;  3AZJ B;  1BH8 A;  2DQN C;  3W98 B;  4HGA B;  2BYK A;  4EO5 B;  5C3I C;  1P3L A;  3X1T C;  2CV5 B;  5DNM D;  1EQZ A;  5GT3 C;  1S32 B;  5CPI C;  3MGS C;  5B0Y B;  5AY8 B;  4XUJ C;  4LD9 C;  3MGR B;  3B6G C;  3LJA A;  3AZJ A;  3W98 A; 
#chains in the Genus database with same CATH homology
 4XZQ C;  3AZI C;  4DRB A;  3X1V D;  2CV5 A;  1S32 A;  3LEL B;  5B0Y A;  5AY8 A;  3MGR A;  3C1C C;  2Y2L A;  3AZH C;  3H0M C;  1M18 C;  3B0D C;  1KX5 C;  5B1M D;  1P3F C;  4KGC B;  5AV5 D;  4YM6 D;  3LEL A;  4X23 C;  3A6N C;  3KWQ B;  2ARO D;  3MVD C;  2FJ7 C;  4G91 B;  1P3K C;  5B1L C;  5B33 D;  3UT9 D;  4R8P C;  3AN2 B;  4KGC A;  3KWQ A;  3B0B A;  5CPJ C;  1P3B D;  3VH5 W;  5CHL B;  5GSU C;  3KXB D;  3C1B C;  2JE5 A;  5AV8 B;  3AZF D;  3WA9 D;  5DNM C;  3AN2 A;  2JCH A;  5BT1 D;  4J8V B;  2NZD B;  2ZY3 A;  5JA4 B;  1ID3 B;  5B2J B;  5GT0 C;  1P3M B;  1A7W A;  5AV8 A;  4NE5 A;  4WZS B;  5B24 C;  3LZ0 B;  3AZN B;  4J8V A;  3F6T A;  3B6F C;  2NZD A;  5JA4 A;  1ID3 A;  3REI B;  5CPK C;  4KUD C;  5B2J A;  1P3G B;  4CAY B;  1P3M A;  3TU4 B;  3NQU B;  3AV2 B;  1U35 B;  3O62 B;  3LZ0 A;  3AZN A;  3R45 B;  3AYW D;  3REI A;  2Y2O A;  5B0Z B;  1P3G A;  4Z2M G;  4CAY A;  3TU4 A;  2G5H C;  3NQU A;  3AV2 A;  1U35 A;  3O62 A;  4AWL B;  3REL B;  4JJN B;  1P3B C;  3R45 A;  5AVB D;  5B40 D;  3MNN C;  5B0Z A;  3W99 D;  3AZG B;  2XD5 A;  5AV6 D;  5CP6 D;  4H9S A;  1P34 D;  5BT1 C;  2Y2H A;  4DRA A;  3UTB D;  3MGP B;  1P3O D;  3REL A;  4JJN A;  3AFA B;  4ZBJ B;  4J8W D;  1B67 A;  4G92 C;  3AZG A;  3W96 B;  2IO5 B;  4Z5T D;  3MGP A;  3AZJ C;  3AZM B;  3AFA A;  3WAA D;  4E44 A;  5B32 B;  3W96 A;  1S32 C;  1W2E A;  5F99 B;  3X1S C;  3KUY C;  3X1T D;  3W97 C;  3AZM A;  5GT3 D;  1TAF B;  3MGS D;  5KDM B;  3A1I A;  4LD9 D;  3B6G D;  4WU8 B;  5B32 A;  3LEL C;  5F99 A;  3AZI D;  3EPJ A;  2Y2J A;  1TAF A;  5KDM A;  2Y2I A;  3C1C D;  3LZ1 B;  3X1V B;  4WU8 A;  4WV4 B;  3UTA C;  1P3A B;  3AZH D;  1Z2C B;  4WU9 C;  1B6W A;  1KX5 D;  3WKJ D;  4X23 D;  2PYO D;  3MVD D;  2HIO C;  5B1M B;  3LZ1 A;  3X1V A;  5AV5 B;  4YM6 B;  1P3A A;  2FJ7 D;  5BNV B;  2ARO B;  1HTA A;  4R8P D;  4J8U C;  1TZY C;  3UT9 B;  1P3I B;  3X1U B;  5AV8 C;  5B1M A;  5AV5 A;  2ZY5 A;  5AVC B;  5E5A C;  5GSU D;  4YM6 A;  3C1B D;  1KX4 B;  5BNV A;  2ARO A;  4J8V C;  3REH C;  3EG5 B;  4WNN B;  3KXB B;  1KU5 A;  4Z2M H;  3UT9 A;  5GXQ C;  3AZF B;  1HQ3 C;  3X1U A;  1P3I A;  3WA9 B;  1KX4 A;  3WTP B;  5AVC A;  3MGQ B;  5GT0 D;  3AZL D;  4Z66 B;  4WNN A;  4YS3 C;  3KXB A;  5B24 D;  4ZUX D;  5DNN C;  3B6F D;  3AZF A;  3WA9 A;  2J8P A;  3VH5 A;  3WTP A;  5CPK D;  4KUD D;  3MGQ A;  4Z66 A;  3AZE C;  3WKJ C;  3B0C W;  2JSS A;  2PYO C;  3AZK B;  2Y2Q A;  3REJ C;  3REK B;  1M1A C;  4J8X C;  2F8N G;  3AYW B;  4QLC C;  3AZK A;  3REK A;  3MNN D;  5B31 C;  3AYW A;  2CWE A;  5B40 B;  2ZY4 A;  3VH6 A;  5AV6 B;  5CP6 B;  5BS7 A;  5JRG C;  3UTB B;  2NQB C;  1P3O B;  1H3O B;  3AZL C;  2HUE C;  5B40 A;  3AZM C;  4J8W B;  1M19 B;  4ZUX C;  5AV6 A;  5CP6 A;  1AOI C;  2Y2G A;  2Y2N A;  3AZJ D;  2G5I C;  3UTB A;  3W98 D;  1P3O A;  1H3O A;  1F66 B;  4J8W A;  1S32 D;  1M19 A;  5B0Y D;  3X1S D;  3MGR D;  4H9N B;  1KX3 B;  4WU8 C;  3KUY D;  3W97 D;  5C3I B;  3X1T B;  1F66 A;  5GT3 B;  5CPI B;  4XUJ B;  3LEL D;  3AV1 C;  4H9N A;  3LZ1 C;  3P5J B;  1KX3 A;  1WWI A;  1P3A C;  4XZQ B;  1F1E A;  3AZI B;  3X1T A;  3EPK A;  5B31 G;  5GT3 A;  3UTA D;  5B2I B;  5CPI A;  4XUJ A;  1P3P B;  5AV9 C;  4WU9 D;  1ULY A;  3AZH B;  4XZQ A;  1M18 B;  3AZI A;  3B0D B;  1P3L C;  2HIO D;  1KX5 B;  1P3F B;  2F8N D;  1EQZ C;  3AN2 D;  5B2I A;  3A6N B;  1P3P A;  3MVD B;  3LJA C;  1P3I C;  2XD1 A;  1KX4 C;  5AVC C;  4J8U D;  3AZH A;  1TZY D;  5B1L B;  4HGA C;  1P3K B;  1M18 A;  1ZLA B;  3W98 C;  3B0C T;  4EO5 C;  5AV8 D;  4R8P B;  1KX5 A;  1P3F A;  2CV5 C;  5E5A D;  3A6N A;  3REH D;  5B0Y C;  5AY8 C;  3MVD A;  4J8V D;  5CPJ B;  3MGR C;  2NZD D;  3H0L C;  1ID3 D;  3C1B B;  3WTP C;  1ZLA A;  5B2J D;  5B1L A;  1P3K A;  3MGQ C;  2F8N H;  5GXQ D;  1HQ3 D;  1P3M D;  4R8P A;  5DNM B;  3KSY A;  3AZN D;  5CPJ A;  4YS3 D;  3C1B A;  5GT0 B;  1P3G D;  5DNN D;  5DNM A;  3TU4 D;  5B24 B;  4KGC C;  3B6F B;  3KWQ C;  3AZE D;  4KUD B;  5GT0 A;  4G91 C;  1PZR A;  3REJ D;  1M1A D;  4J8X D;  1Q9C A;  3AN2 C;  5B24 A;  2F2A C;  3EPH A;  3B6F A;  2BYM B;  3REL D;  4QLC D;  4KUD A;  5B33 B;  2RVQ D;  3AZG D;  4NE6 A;  5B31 D;  1P3B B;  3MGP D;  2BYM A;  2NZD C;  1ID3 C;  2F8N K;  5B2J C;  2ZM5 A;  2YFV B;  5B33 A;  1P3M C;  5JRG D;  2NQB D;  1N1J B;  3LZ0 C;  3AZN C;  1P3B A;  4WJ3 C;  4NE3 A;  3REI C;  3AZM D;  2DF4 C;  4G92 B;  1P3G C;  2YFV A;  1AOI D;  1F66 C;  4H9R B;  3TU4 C;  3AV2 C;  4H9O B;  3VH6 T;  1U35 C;  1N1J A;  3O62 C;  1KX3 C;  2UWX A;  5B0Z C;  2Y2K A;  4E45 A;  4WU8 D;  4H9S C;  4H9R A;  4H9O A;  3X1S B;  4AWL C;  3KUY B;  3REL C;  4JJN C;  3W97 B;  4KHA B;  3AV1 D;  2RVQ C;  3AZG C;  3LZ1 D;  5BNX B;  5B2I C;  1P3A D;  3AL0 C;  1P3P C;  5FUG B;  3X1S A;  5G49 B;  3MGP C;  3KUY A;  3W97 A;  5AVB B;  3AFA C;  4ZBJ C;  3W99 B;  4KHA A;  5AV9 D;  1BH9 B;  3UTA B;  3W96 C;  2IO5 C;  5BNX A;  1P34 B;  2L5A A;  5FUG A;  4WU9 B;  5G49 A;  1P3L D;  5AVB A;  1EQZ D;  1BFM A;  1ZLA C;  3W99 A;  2HIO B;  1BH9 A;  3LJA D;  1P3I D;  3X1U D;  2F8N B;  3UTA A;  5B32 C;  1KX4 D;  1P34 A;  5AVC D;  4Z5T B;  5F99 C;  4UPK A;  4WU9 A;  2CV5 D;  4J8U B;  3WAA B;  1TZY B;  5AY8 D;  2HIO A;  2F8N A;  2W8S A;  5E5A B;  3REH B;  3WTP D;  5BO0 B;  4Z5T A;  3MGQ D;  4Z66 D;  2Y2M A;  3MGS B;  3WAA A;  4J8U A;  1TZY A;  4LD9 B;  5GXQ B;  3B6G B;  1HQ3 B;  3X1V C;  5E5A A;  3REH A;  5BO0 A;  2Y2P A;  4YS3 B;  3MGS A;  4KGC D;  5DNN B;  4LD9 A;  3WTP E;  5GXQ A;  3VH6 W;  1HQ3 A;  3KWQ D;  3C1C B;  3AZK D;  3B6G A;  5B1M C;  3REK D;  5AV5 C;  4H9Q B;  4YM6 C;  2LY8 A;  2ARO C;  2VQR A;  2FFF B;  3AZE B;  4YS3 A;  3WKJ B;  2BG1 A;  3IP4 C;  4M6B A;  4X23 B;  2PYO B;  5DNN A;  3REJ B;  3C1C A;  5B33 C;  3UT9 C;  1M1A B;  4J8X B;  3X1U C;  3FDD A;  2FJ7 B;  4H9Q A;  3A1K A;  5B32 G;  3H0R C;  4QLC B;  3AZE A;  3WKJ A;  3KXB C;  4UUZ B;  4X23 A;  2PYO A;  3REJ A;  3AZF C;  1M1A A;  4J8X A;  5GSU B;  3WA9 C;  2FJ7 A;  5B31 B;  4H9P B;  4QLC A;  4Z66 C;  3NQJ B;  1R4V A;  4NFT A;  4UUZ A;  1M19 D;  3LZ0 D;  4CSR B;  5GSU A;  3REI D;  5JRG B;  2NQB B;  5B31 A;  3EPL A;  4H9P A;  3AZL B;  2HUE B;  1F66 D;  3AV2 D;  1U35 D;  3NQJ A;  4ZUX B;  3O62 D;  1WWS A;  2RIQ A;  4CSR A;  1AOI B;  3AZK C;  1KX3 D;  3V9R B;  3REK C;  5CPK B;  5JRG A;  2YFW B;  2NQB A;  5B0Z D;  3AZL A;  3AYW C;  5CPI D;  4XUJ D;  4ZUX A;  1AOI A;  5BS7 C;  4JJN D;  3V9R A;  5CPK A;  3KFU G;  2YFW A;  4XZQ D;  3VH5 T;  5AVB C;  5B40 C;  5B2I D;  3AV1 B;  3W99 C;  1P3P D;  5AV6 C;  1T3U A;  5CP6 C;  3MNN B;  3AFA D;  1P34 C;  3UTB C;  1M18 D;  1P3O C;  1P3F D;  3W96 D;  1JFI B;  4J8W C;  3A6N D;  5AV9 B;  3AV1 A;  1M19 C;  2ZY2 A;  1BH8 B;  3MNN A;  2BYK B;  1ZLA D;  1P3K D;  5B1L D;  4Z5T C;  1P3L B;  1EQZ B;  5B32 D;  3WAA C;  1JFI A;  5AV9 A;  5F99 D;  5CPJ D;  3LJA B;  4DQY B;  3AZJ B;  1BH8 A;  2DQN C;  3W98 B;  4HGA B;  2BYK A;  4EO5 B;  5C3I C;  1P3L A;  3X1T C;  2CV5 B;  5DNM D;  1EQZ A;  5GT3 C;  1S32 B;  5CPI C;  3MGS C;  5B0Y B;  5AY8 B;  4XUJ C;  4LD9 C;  3MGR B;  3B6G C;  3LJA A;  3AZJ A;  3W98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...