3AYWA

Crystal structure of human nucleosome core particle containing h3k56q mutation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQQSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aywA00
4Z5TA 4WU9D 4Z66B 1P3KC 4G91B 3WTPD 1P3OA 5AV9B 5B40B 5AY8A 4J8XB 3WA9A 5GT0B 3RELD 1P3GB 5CPJA 1P3ID 4Z5TD 3AZGA 5B1MA 1JFIA 5B2IC 5B32B 4X23B 4XUJB 1EQZA 5B2JD 5GXQB 3AZGD 3LZ0B 4QLCC 5JA4B 4Z2MH 1EQZD 4XZQB 1P3KD 5B1LC 4R8PA 3C1BC 3AZJB 4KUDC 3MGPD 5F99B 5B2ID 1BH9A 2BYMB 1WWSA 4ZUXC 5B24C 5B1LA 3LELD 5BNXB 4QLCD 4KUDA 1B67A 3W96B 3AV2C 5B1LD 3REKA 2F8NH 4WZSB 4KHAA 1N1JB 2HUEC 3NQJB 3C1BD 4KUDD 5B31G 5B24A 5CP6B 3AYWA 4H9NB 1M19C 4ZUXD 5B24D 5DNNC 3A6NC 3VH6T 5AVBB 3X1VC 3KUYC 2HIOB 1KX5B 3AV2D 3W99C 4CSRA 1M19A 1ZLAC 4YM6C 5DNNA 3A6NA 1KX4D 3B6GC 5B32G 1M19D 4KGCA 5GSUC 5DNND 5JRGB 1ZLAA 4YM6A 3KUYD 3X1VD 3AZKC 3REHC 5B0YC 3W99D 1P3FC 3VH5T 3W97B 5GSUA 1M1AB 3KXBC 2AROC 4WU8C 3B6GD 3B6FB 4UUZA 3WKJD 3MGQB 3AZKA 4YS3A 1P34C 5C3IB 5B0ZC 4H9PA 4J8VC 3UTBC 4JJNC 3AZHD 2PYOB 3KXBA 3REHD 2AROA 4WU8A 5B0YD 1P34A 1P3FD 5AVCB 3REIC 3AZLB 1F1EA 3KXBD 3LZ1C 2AROD 4WU8D 4DRAA 4J8VA 3UTBA 4JJNA 4G92C 1P34D 3LJAB 2F8NA 1AOID 3UT9C 3B0CW 5B0ZD 3REIA 3W98C 2YFWB 3X1TC 3TU4B 5KDMB 4J8WC 5CPKC 3MGSA 2NZDB 1U35D 4NE3A 5AV8D 3X1UA 5AV5C 3LZ1D 1TZYC 4J8WA 1ULYA 3UT9D 3W98D 3X1TD 3O62C 4J8WD 5CPKD 3AZIB 1TZYA 3R45B 3AN2B 1P3AB 5BT1C 3AZFC 1P3IC 2BYKB 1KX3B 1KU5A 5E5AB 5AV5D 1HQ3B 4H9RA 4CAYB 3B0DC 1TZYD 2NQBC 3MGRD 5B2JC 3C1CC 4LD9C 5GT3B 3UTAD 1P3IA 1H3OA 3REJD 1P3LB 3KWQB 4Z66C 3O62D 1R4VA 5AV9C 1M18D 1TAFB 5BO0A 5BT1D 5B2JA 3MVDD 3MGPC 3C1CA 3AZFD 5B31D 3WTPB 4LD9A 4WNNA 3AZMB 5FUGA 5B32C 5BNVB 4X23C 2NQBD 4H9SC 1F66B 4J8UC 1P3KA 3C1CD 4LD9D 3LELC 2IO5B 1P3OB 4H9OB 1P3PB 5AY8B 3WA9B 3MGPA 5CPJB 4XZQC 3AZGB 4Z66D 5B1MB 5B2IA 5B32A 5AV9D 4H9SA 1EQZB 4J8UA 5GT0D 5G49A 1P3GD 3LELA 2FJ7B 4H9QA 4QLCA 4DRBA 5F99C 5B32D 4X23D 4J8UD 4XZQA 3MNNB 5GXQD 3C1BA 3LZ0D 4R8PB 3W96C 4XZQD 2BYMA 1BH9B 4ZUXA 1KX4C 3VH5A 5F99D 2CWEA 5CP6C 3W96A 1S32B 3AV2A 4NE5A 3WTPE 3REKB 3KSYA 4KHAB 3W96D 5B24B 1KX4A 1KX5C 3AYWB 4WV4B 5CP6D 3KUYA 3X1VA 3WKJC 2HUEB 1B6WA 1ID3B 3W99A 5JRGC 3AZHC 5AVBD 1KX5D 3B6GA 2LY8A 5DNNB 3A6NB 3WKJA 1BH8A 1WWIA 3W97C 5CHLB 3X1SC 4KGCB 1M1AC 5AV6C 1P3BC 3AZHA 1ZLAB 4YM6B 3REHA 1AOIC 5C3IC 5B0YA 1P3FA 5JRGD 3X1SA 2PYOC 3V9RB 1M1AA 5GSUB 5AV6A 3WAAB 1P3BA 4UUZB 1U35C 3AZKB 5AV8C 4YS3B 3W97D 1AOIA 3X1SD 5B0ZA 1M1AD 5AV6D 4NFTA 1P3BD 4H9PB 4ZBJC 3AFAC 3KXBB 3NQUA 2AROB 1P3MC 1U35A 3AZEC 5AV8A 1P34B 3B0CT 4AWLC 3TU4C 4HGAB 2CV5C 2PYOD 1BFMA 3LZ1A 5DNMB 3AFAA 2NZDC 4J8VB 3UTBB 4JJNB 5AVCD 3AZNC 2F8NB 3UT9A 1P3MA 3AZEA 3W98A 3REIB 3MGRC 3AFAD 3X1TA 2CV5A 3LJAD 5CPKA 3UTAC 3MGSB 2NZDA 5B33B 1P3MD 4G92B 3REJC 3AZNA 3AZED 4EO5C 3TU4D 2CV5D 5AV5A 3X1UB 1HTAA 1M18C 1P3AC 4E44A 2YFVA 3MGRA 3MVDC 5CPIB 2NZDD 5B31C 3AZND 3AV1B 4J8WB 1KX3C 3UTAA 4M6BA 5E5AC 1HQ3C 3REJA 3O62A 5GT3C 1P3AA 1M18A 1TZYB 3MVDA 3AZFA 5B31A 3KWQC 4G91C 5E5AA 1HQ3A 2NQBA 5B40C 1P3AD 3AN2D 4J8XC 5GT0C 1P3GC 4WU9B 3AZMC 1KX3D 5E5AD 3RELB 1HQ3D 4XUJC 1P3IB 1F66C 4Z5TB 4Z66A 1Q9CA 2IO5C 5GXQC 1P3OC 5GT3D 3B0BA 5B40A 5AV9A 3LZ0C 4J8XA 1P3PC 5GT0A 1P3GA 5BO0B 3WA9C 5B2JB 4LD9B 3VH6A 1P3LD 3KWQD 4WNNB 5B1MC 1JFIB 4X23A 4XUJA 5B40D 5FUGB 4J8XD 1F66A 3AZJC 2FJ7C 5GXQA 1P3KB 2F8NG 4H9OA 3LZ0A 3AZMD 1P3PA 5JA4A 4XUJD 3MGPB 1F66D 3MNNC 5B2IB 1P3OD 1P3PD 3AZJA 4R8PC 5AY8D 3WA9D 4J8UB 2FJ7A 5G49B 3LELB 5CPJD 4H9QB 5F99A 5B1MD 4QLCB 3AZJD 3MNNA 2FJ7D 5BNXA 5B1LB 3C1BB 4KUDB 1S32C 3MNND 3REKC 1N1JA 3NQJA 5AVBC 4R8PD 2HIOC 4ZUXB 5CP6A 4H9NA 3AYWC 1S32A 3AV2B 5BS7C 5AVBA 2HIOA 1KX5A 1S32D 1KX4B 1ID3C 4CSRB 3REKD 1M19B 3VH6W 2HIOD 5BS7A 3KUYB 3X1VB 3AYWD 1ID3A 4KGCC 5JRGA 3W99B 3B6FC 3MGQC 1ID3D 3B6GB 3WKJB 4E45A 3W97A 1BH8B 3WAAC 3B6FA 1A7WA 3A6ND 3MGQA 3AZHB 5AVCC 3AZLC 4YS3C 3REHB 4KGCD 3VH5W 5B0YB 1P3FB 3B6FD 2PYOA 3V9RA 1ZLAD 4YM6D 3X1SB 3LJAC 3MGQD 3WAAA 5AV6B 4WU8B 1P3BB 5AVCA 3AZLA 4HGAC 1AOIB 2JSSA 5GSUD 5DNMC 5B0ZB 3WAAD 3LJAA 3AZLD 4YS3D 3AZKD 2F8NK 3NQUB 2YFWA 1U35B 5AV8B 3TU4A 5KDMA 5DNMA 3LZ1B 3MGSC 5B33C 4ZBJB 3AFAB 3X1UC 5DNMD 3UT9B 3AZIC 3AN2C 1P3MB 3AZEB 3W98B 5CPIC 4J8VD 4AWLB 4JJND 3UTBD 3X1TB 2CV5B 3AV1C 2F8ND 5CPKB 5B33A 4NE6A 3REID 3AZNB 5AV5B 3AZIA 3R45A 3AN2A 3MGSD 5B33D 2YFVB 3MGRB 5CPIA 2BYKA 3AV1A 1P3LC 1KX3A 4Z2MG 3X1UD 3UTAB 4CAYA 3AZID 2RVQC 4H9RB 3REJB 4WU9C 5CPID 4EO5B 3O62B 5GT3A 3WTPC 3AV1D 1M18B 3RELC 3MVDB 3AZFB 5B31B 1H3OB 4Z5TC 3KWQA 1P3LA 1TAFA 2NQBB 3B0DB 5AY8C 4WU9A 3C1CB 3WTPA 3AZMA 5CPJC 3AZGC 2L5AA 3RELA 5BNVA 2RVQD 1EQZC
chains in the Genus database with same CATH superfamily
4Z5TA 4WU9D 4Z66B 1P3KC 4G91B 3WTPD 1P3OA 5AV9B 5B40B 2Y2IA 5AY8A 4J8XB 3WA9A 5GT0B 3RELD 3EPLA 1P3GB 5CPJA 1P3ID 4Z5TD 3AZGA 5B1MA 2F2AC 1JFIA 5B2IC 5B32B 4X23B 4XUJB 1EQZA 5B2JD 5GXQB 3AZGD 3LZ0B 4QLCC 5JA4B 4Z2MH 2Y2PA 1EQZD 3F6TA 4XZQB 1P3KD 5B1LC 4R8PA 3C1BC 3AZJB 4KUDC 3MGPD 2Y2OA 5F99B 5B2ID 1BH9A 2BYMB 1WWSA 4ZUXC 5B24C 5B1LA 3LELD 5BNXB 4QLCD 4KUDA 1B67A 3W96B 3AV2C 5B1LD 3REKA 2F8NH 4WZSB 4KHAA 1N1JB 2HUEC 3NQJB 3C1BD 4KUDD 5B31G 5B24A 5CP6B 3AL0C 3AYWA 4H9NB 2Y2GA 1M19C 4ZUXD 5B24D 5DNNC 3A6NC 3VH6T 5AVBB 3X1VC 3KUYC 4DQYB 2HIOB 1KX5B 3AV2D 3W99C 4CSRA 1M19A 1ZLAC 4YM6C 5DNNA 3A6NA 1KX4D 3B6GC 5B32G 1M19D 4KGCA 5GSUC 5DNND 5JRGB 1ZLAA 4YM6A 3KUYD 3X1VD 3AZKC 3REHC 1PZRA 5B0YC 2J8PA 3W99D 1P3FC 3VH5T 3W97B 5GSUA 1M1AB 3KXBC 2AROC 4WU8C 3B6GD 3B6FB 4UUZA 3WKJD 3MGQB 3AZKA 4YS3A 1P34C 5C3IB 5B0ZC 4H9PA 4J8VC 3UTBC 4JJNC 3AZHD 2PYOB 3KXBA 3REHD 2AROA 4WU8A 2G5HC 5B0YD 1P34A 1P3FD 5AVCB 3REIC 3AZLB 3EPKA 1F1EA 3KXBD 3LZ1C 2AROD 4WU8D 4DRAA 4J8VA 3UTBA 4JJNA 4G92C 1P34D 3LJAB 2F8NA 2VQRA 1AOID 3UT9C 3B0CW 5B0ZD 3REIA 3W98C 2YFWB 3X1TC 3TU4B 5KDMB 4J8WC 5CPKC 3MGSA 2NZDB 1T3UA 1U35D 4NE3A 5AV8D 2ZY3A 3X1UA 5AV5C 3LZ1D 1TZYC 4J8WA 2W8SA 1ULYA 3UT9D 3IP4C 3W98D 2RIQA 3X1TD 3O62C 4J8WD 5CPKD 3AZIB 1TZYA 3R45B 3AN2B 1P3AB 5BT1C 3AZFC 1P3IC 2BYKB 2XD5A 1KX3B 1KU5A 2ZY4A 5E5AB 5AV5D 1HQ3B 4H9RA 4CAYB 3B0DC 1TZYD 2NQBC 3MGRD 5B2JC 3C1CC 4LD9C 5GT3B 3UTAD 1P3IA 1H3OA 3REJD 1P3LB 3KWQB 4Z66C 3O62D 1R4VA 5AV9C 1M18D 1TAFB 5BO0A 5BT1D 2Y2HA 5B2JA 3MVDD 3MGPC 3C1CA 5B31D 3WTPB 3AZFD 4LD9A 4WJ3C 4WNNA 3AZMB 5FUGA 5B32C 5BNVB 4X23C 2NQBD 4H9SC 1F66B 4J8UC 1P3KA 3C1CD 4LD9D 3LELC 2IO5B 1P3OB 4H9OB 1P3PB 5AY8B 3WA9B 3MGPA 5CPJB 4XZQC 3AZGB 4Z66D 5B1MB 5B2IA 5B32A 5AV9D 4H9SA 1EQZB 4J8UA 5GT0D 5G49A 1P3GD 3LELA 2FJ7B 4H9QA 2ZY2A 4QLCA 4DRBA 5F99C 5B32D 4X23D 4J8UD 4XZQA 3MNNB 5GXQD 3C1BA 3LZ0D 4R8PB 2Y2NA 3W96C 4XZQD 2BYMA 1BH9B 4ZUXA 1KX4C 3VH5A 5CP6C 2CWEA 5F99D 3W96A 1S32B 3AV2A 4NE5A 3WTPE 3REKB 3KSYA 4KHAB 3W96D 5B24B 1KX4A 1KX5C 2ZM5A 3AYWB 4WV4B 5CP6D 3KUYA 3X1VA 3WKJC 2HUEB 1B6WA 2ZY5A 1ID3B 3W99A 5JRGC 3AZHC 5AVBD 1KX5D 3B6GA 2LY8A 5DNNB 3A6NB 3WKJA 1BH8A 1WWIA 3W97C 5CHLB 3X1SC 4KGCB 1M1AC 5AV6C 1P3BC 3AZHA 1ZLAB 4YM6B 3REHA 1AOIC 5C3IC 5B0YA 1P3FA 5JRGD 2XD1A 3X1SA 3V9RB 2PYOC 1M1AA 5GSUB 5AV6A 3WAAB 1P3BA 4UUZB 1U35C 3AZKB 5AV8C 4YS3B 3W97D 1AOIA 3X1SD 2JE5A 5B0ZA 1M1AD 5AV6D 4NFTA 1P3BD 4H9PB 4ZBJC 3AFAC 3KXBB 3NQUA 2AROB 3H0RC 1P3MC 1U35A 3AZEC 5AV8A 4UPKA 1P34B 3B0CT 3H0LC 4AWLC 4HGAB 3TU4C 2CV5C 2PYOD 3LZ1A 5DNMB 1BFMA 2UWXA 3AFAA 2NZDC 4J8VB 3UTBB 4JJNB 5AVCD 3AZNC 2F8NB 3UT9A 1P3MA 3AZEA 3W98A 3REIB 3MGRC 3AFAD 3X1TA 2CV5A 3LJAD 5CPKA 2Y2MA 3UTAC 3MGSB 2NZDA 5B33B 1P3MD 4G92B 3REJC 3AZNA 3AZED 4EO5C 3TU4D 2CV5D 5AV5A 3X1UB 1HTAA 1M18C 1P3AC 2BG1A 4E44A 2YFVA 3MGRA 3MVDC 5CPIB 2NZDD 5B31C 3AZND 3AV1B 4J8WB 1KX3C 3UTAA 4M6BA 5E5AC 1HQ3C 3REJA 3EPJA 3O62A 5GT3C 1P3AA 1M18A 1TZYB 3MVDA 3AZFA 5B31A 3KWQC 4G91C 5E5AA 1HQ3A 2NQBA 2Y2KA 5B40C 3AN2D 1P3AD 4J8XC 5GT0C 1P3GC 4WU9B 3AZMC 1KX3D 3EPHA 5E5AD 3RELB 1HQ3D 4XUJC 1P3IB 1F66C 4Z5TB 4Z66A 1Q9CA 2IO5C 5GXQC 1P3OC 5GT3D 3B0BA 5B40A 5AV9A 3LZ0C 3A1KA 4J8XA 5GT0A 1P3PC 1P3GA 5BO0B 3WA9C 5B2JB 4LD9B 3VH6A 1P3LD 3KWQD 4WNNB 5B1MC 1JFIB 4X23A 4XUJA 5B40D 5FUGB 4J8XD 1F66A 3AZJC 2FJ7C 5GXQA 1P3KB 2F8NG 4H9OA 3LZ0A 3AZMD 1P3PA 5JA4A 4XUJD 3MGPB 1F66D 3MNNC 5B2IB 1P3OD 1P3PD 3AZJA 4R8PC 5AY8D 3WA9D 4J8UB 2FJ7A 5G49B 3LELB 5CPJD 4H9QB 5F99A 5B1MD 4QLCB 1W2EA 3AZJD 3MNNA 2FJ7D 5BNXA 5B1LB 3C1BB 3KFUG 4KUDB 1S32C 3MNND 3REKC 3H0MC 1N1JA 3NQJA 5AVBC 4R8PD 2HIOC 4ZUXB 5CP6A 4H9NA 3AYWC 1S32A 3AV2B 2JCHA 5BS7C 5AVBA 2DQNC 2HIOA 1KX5A 1S32D 1KX4B 1ID3C 4CSRB 3REKD 1M19B 2Y2JA 3VH6W 2HIOD 3P5JB 5BS7A 3KUYB 3X1VB 3AYWD 1ID3A 4KGCC 5JRGA 3W99B 3B6FC 2G5IC 3MGQC 1ID3D 3B6GB 3WKJB 4E45A 3W97A 1BH8B 3WAAC 3B6FA 1A7WA 3A6ND 3MGQA 3AZHB 5AVCC 3AZLC 4YS3C 3REHB 3A1IA 4KGCD 3VH5W 2DF4C 5B0YB 1P3FB 3B6FD 2PYOA 3V9RA 1ZLAD 4YM6D 3X1SB 3LJAC 3MGQD 3WAAA 5AV6B 4WU8B 1P3BB 5AVCA 3AZLA 4HGAC 1AOIB 2JSSA 5GSUD 5DNMC 5B0ZB 3WAAD 3LJAA 2FFFB 3AZLD 4YS3D 3AZKD 2Y2LA 2F8NK 3NQUB 2YFWA 1U35B 5AV8B 3TU4A 3FDDA 5KDMA 5DNMA 3LZ1B 3MGSC 5B33C 4ZBJB 3AFAB 3X1UC 2Y2QA 5DNMD 3UT9B 3AZIC 3AN2C 1P3MB 3AZEB 3W98B 5CPIC 4J8VD 4AWLB 4JJND 3UTBD 3X1TB 2CV5B 3AV1C 2F8ND 5CPKB 5B33A 4NE6A 3REID 3AZNB 5AV5B 3AZIA 3R45A 3AN2A 3MGSD 5B33D 2YFVB 3MGRB 1Z2CB 5CPIA 2BYKA 3EG5B 3AV1A 1P3LC 1KX3A 4Z2MG 3X1UD 3UTAB 4CAYA 3AZID 2RVQC 4H9RB 3REJB 4WU9C 5CPID 4EO5B 3O62B 5GT3A 3WTPC 3AV1D 1M18B 3RELC 3MVDB 3AZFB 5B31B 1H3OB 4Z5TC 3KWQA 1P3LA 1TAFA 2NQBB 3B0DB 5AY8C 4WU9A 3C1CB 3WTPA 3AZMA 5CPJC 3AZGC 2L5AA 3RELA 5BNVA 2RVQD 1EQZC
chains in the Genus database with same CATH topology
4Z5TA 4WU9D 4Z66B 1P3KC 4G91B 3WTPD 1P3OA 5AV9B 5B40B 2Y2IA 5AY8A 4J8XB 3WA9A 5GT0B 3RELD 3EPLA 1P3GB 5CPJA 1P3ID 4Z5TD 3AZGA 5B1MA 2F2AC 1JFIA 5B2IC 5B32B 4X23B 4XUJB 1EQZA 5B2JD 5GXQB 3AZGD 3LZ0B 4QLCC 5JA4B 4Z2MH 2Y2PA 1EQZD 3F6TA 4XZQB 1P3KD 5B1LC 4R8PA 3C1BC 3AZJB 4KUDC 3MGPD 2Y2OA 5F99B 5B2ID 1BH9A 2BYMB 1WWSA 4ZUXC 5B24C 5B1LA 3LELD 5BNXB 4QLCD 4KUDA 1B67A 3W96B 3AV2C 5B1LD 3REKA 2F8NH 4WZSB 4KHAA 1N1JB 2HUEC 3NQJB 3C1BD 4KUDD 5B31G 5B24A 5CP6B 3AL0C 3AYWA 4H9NB 2Y2GA 1M19C 4ZUXD 5B24D 5DNNC 3A6NC 3VH6T 5AVBB 3X1VC 3KUYC 4DQYB 2HIOB 1KX5B 3AV2D 3W99C 4CSRA 1M19A 1ZLAC 4YM6C 5DNNA 3A6NA 1KX4D 3B6GC 5B32G 1M19D 4KGCA 5GSUC 5DNND 5JRGB 1ZLAA 4YM6A 3KUYD 3X1VD 3AZKC 3REHC 1PZRA 5B0YC 2J8PA 3W99D 1P3FC 3VH5T 3W97B 5GSUA 1M1AB 3KXBC 2AROC 4WU8C 3B6GD 3B6FB 4UUZA 3WKJD 3MGQB 3AZKA 4YS3A 1P34C 5C3IB 5B0ZC 4H9PA 4J8VC 3UTBC 4JJNC 3AZHD 2PYOB 3KXBA 3REHD 2AROA 4WU8A 2G5HC 5B0YD 1P34A 1P3FD 5AVCB 3REIC 3AZLB 3EPKA 1F1EA 3KXBD 3LZ1C 2AROD 4WU8D 4DRAA 4J8VA 3UTBA 4JJNA 4G92C 1P34D 3LJAB 2F8NA 2VQRA 1AOID 3UT9C 3B0CW 5B0ZD 3REIA 3W98C 2YFWB 3X1TC 3TU4B 5KDMB 4J8WC 5CPKC 3MGSA 2NZDB 1T3UA 1U35D 4NE3A 5AV8D 2ZY3A 3X1UA 5AV5C 3LZ1D 1TZYC 4J8WA 2W8SA 1ULYA 3UT9D 3IP4C 3W98D 2RIQA 3X1TD 3O62C 4J8WD 5CPKD 3AZIB 1TZYA 3R45B 3AN2B 1P3AB 5BT1C 3AZFC 1P3IC 2BYKB 2XD5A 1KX3B 1KU5A 2ZY4A 5E5AB 5AV5D 1HQ3B 4H9RA 4CAYB 3B0DC 1TZYD 2NQBC 3MGRD 5B2JC 3C1CC 4LD9C 5GT3B 3UTAD 1P3IA 1H3OA 3REJD 1P3LB 3KWQB 4Z66C 3O62D 1R4VA 5AV9C 1M18D 1TAFB 5BO0A 5BT1D 2Y2HA 5B2JA 3MVDD 3MGPC 3C1CA 5B31D 3WTPB 3AZFD 4LD9A 4WJ3C 4WNNA 3AZMB 5FUGA 5B32C 5BNVB 4X23C 2NQBD 4H9SC 1F66B 4J8UC 1P3KA 3C1CD 4LD9D 3LELC 2IO5B 1P3OB 4H9OB 1P3PB 5AY8B 3WA9B 3MGPA 5CPJB 4XZQC 3AZGB 4Z66D 5B1MB 5B2IA 5B32A 5AV9D 4H9SA 1EQZB 4J8UA 5GT0D 5G49A 1P3GD 3LELA 2FJ7B 4H9QA 2ZY2A 4QLCA 4DRBA 5F99C 5B32D 4X23D 4J8UD 4XZQA 3MNNB 5GXQD 3C1BA 3LZ0D 4R8PB 2Y2NA 3W96C 4XZQD 2BYMA 1BH9B 4ZUXA 1KX4C 3VH5A 5CP6C 2CWEA 5F99D 3W96A 1S32B 3AV2A 4NE5A 3WTPE 3REKB 3KSYA 4KHAB 3W96D 5B24B 1KX4A 1KX5C 2ZM5A 3AYWB 4WV4B 5CP6D 3KUYA 3X1VA 3WKJC 2HUEB 1B6WA 2ZY5A 1ID3B 3W99A 5JRGC 3AZHC 5AVBD 1KX5D 3B6GA 2LY8A 5DNNB 3A6NB 3WKJA 1BH8A 1WWIA 3W97C 5CHLB 3X1SC 4KGCB 1M1AC 5AV6C 1P3BC 3AZHA 1ZLAB 4YM6B 3REHA 1AOIC 5C3IC 5B0YA 1P3FA 5JRGD 2XD1A 3X1SA 3V9RB 2PYOC 1M1AA 5GSUB 5AV6A 3WAAB 1P3BA 4UUZB 1U35C 3AZKB 5AV8C 4YS3B 3W97D 1AOIA 3X1SD 2JE5A 5B0ZA 1M1AD 5AV6D 4NFTA 1P3BD 4H9PB 4ZBJC 3AFAC 3KXBB 3NQUA 2AROB 3H0RC 1P3MC 1U35A 3AZEC 5AV8A 4UPKA 1P34B 3B0CT 3H0LC 4AWLC 4HGAB 3TU4C 2CV5C 2PYOD 3LZ1A 5DNMB 1BFMA 2UWXA 3AFAA 2NZDC 4J8VB 3UTBB 4JJNB 5AVCD 3AZNC 2F8NB 3UT9A 1P3MA 3AZEA 3W98A 3REIB 3MGRC 3AFAD 3X1TA 2CV5A 3LJAD 5CPKA 2Y2MA 3UTAC 3MGSB 2NZDA 5B33B 1P3MD 4G92B 3REJC 3AZNA 3AZED 4EO5C 3TU4D 2CV5D 5AV5A 3X1UB 1HTAA 1M18C 1P3AC 2BG1A 4E44A 2YFVA 3MGRA 3MVDC 5CPIB 2NZDD 5B31C 3AZND 3AV1B 4J8WB 1KX3C 3UTAA 4M6BA 5E5AC 1HQ3C 3REJA 3EPJA 3O62A 5GT3C 1P3AA 1M18A 1TZYB 3MVDA 3AZFA 5B31A 3KWQC 4G91C 5E5AA 1HQ3A 2NQBA 2Y2KA 5B40C 3AN2D 1P3AD 4J8XC 5GT0C 1P3GC 4WU9B 3AZMC 1KX3D 3EPHA 5E5AD 3RELB 1HQ3D 4XUJC 1P3IB 1F66C 4Z5TB 4Z66A 1Q9CA 2IO5C 5GXQC 1P3OC 5GT3D 3B0BA 5B40A 5AV9A 3LZ0C 3A1KA 4J8XA 5GT0A 1P3PC 1P3GA 5BO0B 3WA9C 5B2JB 4LD9B 3VH6A 1P3LD 3KWQD 4WNNB 5B1MC 1JFIB 4X23A 4XUJA 5B40D 5FUGB 4J8XD 1F66A 3AZJC 2FJ7C 5GXQA 1P3KB 2F8NG 4H9OA 3LZ0A 3AZMD 1P3PA 5JA4A 4XUJD 3MGPB 1F66D 3MNNC 5B2IB 1P3OD 1P3PD 3AZJA 4R8PC 5AY8D 3WA9D 4J8UB 2FJ7A 5G49B 3LELB 5CPJD 4H9QB 5F99A 5B1MD 4QLCB 1W2EA 3AZJD 3MNNA 2FJ7D 5BNXA 5B1LB 3C1BB 3KFUG 4KUDB 1S32C 3MNND 3REKC 3H0MC 1N1JA 3NQJA 5AVBC 4R8PD 2HIOC 4ZUXB 5CP6A 4H9NA 3AYWC 1S32A 3AV2B 2JCHA 5BS7C 5AVBA 2DQNC 2HIOA 1KX5A 1S32D 1KX4B 1ID3C 4CSRB 3REKD 1M19B 2Y2JA 3VH6W 2HIOD 3P5JB 5BS7A 3KUYB 3X1VB 3AYWD 1ID3A 4KGCC 5JRGA 3W99B 3B6FC 2G5IC 3MGQC 1ID3D 3B6GB 3WKJB 4E45A 3W97A 1BH8B 3WAAC 3B6FA 1A7WA 3A6ND 3MGQA 3AZHB 5AVCC 3AZLC 4YS3C 3REHB 3A1IA 4KGCD 3VH5W 2DF4C 5B0YB 1P3FB 3B6FD 2PYOA 3V9RA 1ZLAD 4YM6D 3X1SB 3LJAC 3MGQD 3WAAA 5AV6B 4WU8B 1P3BB 5AVCA 3AZLA 4HGAC 1AOIB 2JSSA 5GSUD 5DNMC 5B0ZB 3WAAD 3LJAA 2FFFB 3AZLD 4YS3D 3AZKD 2Y2LA 2F8NK 3NQUB 2YFWA 1U35B 5AV8B 3TU4A 3FDDA 5KDMA 5DNMA 3LZ1B 3MGSC 5B33C 4ZBJB 3AFAB 3X1UC 2Y2QA 5DNMD 3UT9B 3AZIC 3AN2C 1P3MB 3AZEB 3W98B 5CPIC 4J8VD 4AWLB 4JJND 3UTBD 3X1TB 2CV5B 3AV1C 2F8ND 5CPKB 5B33A 4NE6A 3REID 3AZNB 5AV5B 3AZIA 3R45A 3AN2A 3MGSD 5B33D 2YFVB 3MGRB 1Z2CB 5CPIA 2BYKA 3EG5B 3AV1A 1P3LC 1KX3A 4Z2MG 3X1UD 3UTAB 4CAYA 3AZID 2RVQC 4H9RB 3REJB 4WU9C 5CPID 4EO5B 3O62B 5GT3A 3WTPC 3AV1D 1M18B 3RELC 3MVDB 3AZFB 5B31B 1H3OB 4Z5TC 3KWQA 1P3LA 1TAFA 2NQBB 3B0DB 5AY8C 4WU9A 3C1CB 3WTPA 3AZMA 5CPJC 3AZGC 2L5AA 3RELA 5BNVA 2RVQD 1EQZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5T A;  4WU9 D;  4Z66 B;  1P3K C;  4G91 B;  3WTP D;  1P3O A;  5AV9 B;  5B40 B;  5AY8 A;  4J8X B;  3WA9 A;  5GT0 B;  3REL D;  1P3G B;  5CPJ A;  1P3I D;  4Z5T D;  3AZG A;  5B1M A;  1JFI A;  5B2I C;  5B32 B;  4X23 B;  4XUJ B;  1EQZ A;  5B2J D;  5GXQ B;  3AZG D;  3LZ0 B;  4QLC C;  5JA4 B;  4Z2M H;  1EQZ D;  4XZQ B;  1P3K D;  5B1L C;  4R8P A;  3C1B C;  3AZJ B;  4KUD C;  3MGP D;  5F99 B;  5B2I D;  1BH9 A;  2BYM B;  1WWS A;  4ZUX C;  5B24 C;  5B1L A;  3LEL D;  5BNX B;  4QLC D;  4KUD A;  1B67 A;  3W96 B;  3AV2 C;  5B1L D;  3REK A;  2F8N H;  4WZS B;  4KHA A;  1N1J B;  2HUE C;  3NQJ B;  3C1B D;  4KUD D;  5B31 G;  5B24 A;  5CP6 B;  3AYW A;  4H9N B;  1M19 C;  4ZUX D;  5B24 D;  5DNN C;  3A6N C;  3VH6 T;  5AVB B;  3X1V C;  3KUY C;  2HIO B;  1KX5 B;  3AV2 D;  3W99 C;  4CSR A;  1M19 A;  1ZLA C;  4YM6 C;  5DNN A;  3A6N A;  1KX4 D;  3B6G C;  5B32 G;  1M19 D;  4KGC A;  5GSU C;  5DNN D;  5JRG B;  1ZLA A;  4YM6 A;  3KUY D;  3X1V D;  3AZK C;  3REH C;  5B0Y C;  3W99 D;  1P3F C;  3VH5 T;  3W97 B;  5GSU A;  1M1A B;  3KXB C;  2ARO C;  4WU8 C;  3B6G D;  3B6F B;  4UUZ A;  3WKJ D;  3MGQ B;  3AZK A;  4YS3 A;  1P34 C;  5C3I B;  5B0Z C;  4H9P A;  4J8V C;  3UTB C;  4JJN C;  3AZH D;  2PYO B;  3KXB A;  3REH D;  2ARO A;  4WU8 A;  5B0Y D;  1P34 A;  1P3F D;  5AVC B;  3REI C;  3AZL B;  1F1E A;  3KXB D;  3LZ1 C;  2ARO D;  4WU8 D;  4DRA A;  4J8V A;  3UTB A;  4JJN A;  4G92 C;  1P34 D;  3LJA B;  2F8N A;  1AOI D;  3UT9 C;  3B0C W;  5B0Z D;  3REI A;  3W98 C;  2YFW B;  3X1T C;  3TU4 B;  5KDM B;  4J8W C;  5CPK C;  3MGS A;  2NZD B;  1U35 D;  4NE3 A;  5AV8 D;  3X1U A;  5AV5 C;  3LZ1 D;  1TZY C;  4J8W A;  1ULY A;  3UT9 D;  3W98 D;  3X1T D;  3O62 C;  4J8W D;  5CPK D;  3AZI B;  1TZY A;  3R45 B;  3AN2 B;  1P3A B;  5BT1 C;  3AZF C;  1P3I C;  2BYK B;  1KX3 B;  1KU5 A;  5E5A B;  5AV5 D;  1HQ3 B;  4H9R A;  4CAY B;  3B0D C;  1TZY D;  2NQB C;  3MGR D;  5B2J C;  3C1C C;  4LD9 C;  5GT3 B;  3UTA D;  1P3I A;  1H3O A;  3REJ D;  1P3L B;  3KWQ B;  4Z66 C;  3O62 D;  1R4V A;  5AV9 C;  1M18 D;  1TAF B;  5BO0 A;  5BT1 D;  5B2J A;  3MVD D;  3MGP C;  3C1C A;  3AZF D;  5B31 D;  3WTP B;  4LD9 A;  4WNN A;  3AZM B;  5FUG A;  5B32 C;  5BNV B;  4X23 C;  2NQB D;  4H9S C;  1F66 B;  4J8U C;  1P3K A;  3C1C D;  4LD9 D;  3LEL C;  2IO5 B;  1P3O B;  4H9O B;  1P3P B;  5AY8 B;  3WA9 B;  3MGP A;  5CPJ B;  4XZQ C;  3AZG B;  4Z66 D;  5B1M B;  5B2I A;  5B32 A;  5AV9 D;  4H9S A;  1EQZ B;  4J8U A;  5GT0 D;  5G49 A;  1P3G D;  3LEL A;  2FJ7 B;  4H9Q A;  4QLC A;  4DRB A;  5F99 C;  5B32 D;  4X23 D;  4J8U D;  4XZQ A;  3MNN B;  5GXQ D;  3C1B A;  3LZ0 D;  4R8P B;  3W96 C;  4XZQ D;  2BYM A;  1BH9 B;  4ZUX A;  1KX4 C;  3VH5 A;  5F99 D;  2CWE A;  5CP6 C;  3W96 A;  1S32 B;  3AV2 A;  4NE5 A;  3WTP E;  3REK B;  3KSY A;  4KHA B;  3W96 D;  5B24 B;  1KX4 A;  1KX5 C;  3AYW B;  4WV4 B;  5CP6 D;  3KUY A;  3X1V A;  3WKJ C;  2HUE B;  1B6W A;  1ID3 B;  3W99 A;  5JRG C;  3AZH C;  5AVB D;  1KX5 D;  3B6G A;  2LY8 A;  5DNN B;  3A6N B;  3WKJ A;  1BH8 A;  1WWI A;  3W97 C;  5CHL B;  3X1S C;  4KGC B;  1M1A C;  5AV6 C;  1P3B C;  3AZH A;  1ZLA B;  4YM6 B;  3REH A;  1AOI C;  5C3I C;  5B0Y A;  1P3F A;  5JRG D;  3X1S A;  2PYO C;  3V9R B;  1M1A A;  5GSU B;  5AV6 A;  3WAA B;  1P3B A;  4UUZ B;  1U35 C;  3AZK B;  5AV8 C;  4YS3 B;  3W97 D;  1AOI A;  3X1S D;  5B0Z A;  1M1A D;  5AV6 D;  4NFT A;  1P3B D;  4H9P B;  4ZBJ C;  3AFA C;  3KXB B;  3NQU A;  2ARO B;  1P3M C;  1U35 A;  3AZE C;  5AV8 A;  1P34 B;  3B0C T;  4AWL C;  3TU4 C;  4HGA B;  2CV5 C;  2PYO D;  1BFM A;  3LZ1 A;  5DNM B;  3AFA A;  2NZD C;  4J8V B;  3UTB B;  4JJN B;  5AVC D;  3AZN C;  2F8N B;  3UT9 A;  1P3M A;  3AZE A;  3W98 A;  3REI B;  3MGR C;  3AFA D;  3X1T A;  2CV5 A;  3LJA D;  5CPK A;  3UTA C;  3MGS B;  2NZD A;  5B33 B;  1P3M D;  4G92 B;  3REJ C;  3AZN A;  3AZE D;  4EO5 C;  3TU4 D;  2CV5 D;  5AV5 A;  3X1U B;  1HTA A;  1M18 C;  1P3A C;  4E44 A;  2YFV A;  3MGR A;  3MVD C;  5CPI B;  2NZD D;  5B31 C;  3AZN D;  3AV1 B;  4J8W B;  1KX3 C;  3UTA A;  4M6B A;  5E5A C;  1HQ3 C;  3REJ A;  3O62 A;  5GT3 C;  1P3A A;  1M18 A;  1TZY B;  3MVD A;  3AZF A;  5B31 A;  3KWQ C;  4G91 C;  5E5A A;  1HQ3 A;  2NQB A;  5B40 C;  1P3A D;  3AN2 D;  4J8X C;  5GT0 C;  1P3G C;  4WU9 B;  3AZM C;  1KX3 D;  5E5A D;  3REL B;  1HQ3 D;  4XUJ C;  1P3I B;  1F66 C;  4Z5T B;  4Z66 A;  1Q9C A;  2IO5 C;  5GXQ C;  1P3O C;  5GT3 D;  3B0B A;  5B40 A;  5AV9 A;  3LZ0 C;  4J8X A;  1P3P C;  5GT0 A;  1P3G A;  5BO0 B;  3WA9 C;  5B2J B;  4LD9 B;  3VH6 A;  1P3L D;  3KWQ D;  4WNN B;  5B1M C;  1JFI B;  4X23 A;  4XUJ A;  5B40 D;  5FUG B;  4J8X D;  1F66 A;  3AZJ C;  2FJ7 C;  5GXQ A;  1P3K B;  2F8N G;  4H9O A;  3LZ0 A;  3AZM D;  1P3P A;  5JA4 A;  4XUJ D;  3MGP B;  1F66 D;  3MNN C;  5B2I B;  1P3O D;  1P3P D;  3AZJ A;  4R8P C;  5AY8 D;  3WA9 D;  4J8U B;  2FJ7 A;  5G49 B;  3LEL B;  5CPJ D;  4H9Q B;  5F99 A;  5B1M D;  4QLC B;  3AZJ D;  3MNN A;  2FJ7 D;  5BNX A;  5B1L B;  3C1B B;  4KUD B;  1S32 C;  3MNN D;  3REK C;  1N1J A;  3NQJ A;  5AVB C;  4R8P D;  2HIO C;  4ZUX B;  5CP6 A;  4H9N A;  3AYW C;  1S32 A;  3AV2 B;  5BS7 C;  5AVB A;  2HIO A;  1KX5 A;  1S32 D;  1KX4 B;  1ID3 C;  4CSR B;  3REK D;  1M19 B;  3VH6 W;  2HIO D;  5BS7 A;  3KUY B;  3X1V B;  3AYW D;  1ID3 A;  4KGC C;  5JRG A;  3W99 B;  3B6F C;  3MGQ C;  1ID3 D;  3B6G B;  3WKJ B;  4E45 A;  3W97 A;  1BH8 B;  3WAA C;  3B6F A;  1A7W A;  3A6N D;  3MGQ A;  3AZH B;  5AVC C;  3AZL C;  4YS3 C;  3REH B;  4KGC D;  3VH5 W;  5B0Y B;  1P3F B;  3B6F D;  2PYO A;  3V9R A;  1ZLA D;  4YM6 D;  3X1S B;  3LJA C;  3MGQ D;  3WAA A;  5AV6 B;  4WU8 B;  1P3B B;  5AVC A;  3AZL A;  4HGA C;  1AOI B;  2JSS A;  5GSU D;  5DNM C;  5B0Z B;  3WAA D;  3LJA A;  3AZL D;  4YS3 D;  3AZK D;  2F8N K;  3NQU B;  2YFW A;  1U35 B;  5AV8 B;  3TU4 A;  5KDM A;  5DNM A;  3LZ1 B;  3MGS C;  5B33 C;  4ZBJ B;  3AFA B;  3X1U C;  5DNM D;  3UT9 B;  3AZI C;  3AN2 C;  1P3M B;  3AZE B;  3W98 B;  5CPI C;  4J8V D;  4AWL B;  4JJN D;  3UTB D;  3X1T B;  2CV5 B;  3AV1 C;  2F8N D;  5CPK B;  5B33 A;  4NE6 A;  3REI D;  3AZN B;  5AV5 B;  3AZI A;  3R45 A;  3AN2 A;  3MGS D;  5B33 D;  2YFV B;  3MGR B;  5CPI A;  2BYK A;  3AV1 A;  1P3L C;  1KX3 A;  4Z2M G;  3X1U D;  3UTA B;  4CAY A;  3AZI D;  2RVQ C;  4H9R B;  3REJ B;  4WU9 C;  5CPI D;  4EO5 B;  3O62 B;  5GT3 A;  3WTP C;  3AV1 D;  1M18 B;  3REL C;  3MVD B;  3AZF B;  5B31 B;  1H3O B;  4Z5T C;  3KWQ A;  1P3L A;  1TAF A;  2NQB B;  3B0D B;  5AY8 C;  4WU9 A;  3C1C B;  3WTP A;  3AZM A;  5CPJ C;  3AZG C;  2L5A A;  3REL A;  5BNV A;  2RVQ D;  1EQZ C; 
#chains in the Genus database with same CATH topology
 4Z5T A;  4WU9 D;  4Z66 B;  1P3K C;  4G91 B;  3WTP D;  1P3O A;  5AV9 B;  5B40 B;  2Y2I A;  5AY8 A;  4J8X B;  3WA9 A;  5GT0 B;  3REL D;  3EPL A;  1P3G B;  5CPJ A;  1P3I D;  4Z5T D;  3AZG A;  5B1M A;  2F2A C;  1JFI A;  5B2I C;  5B32 B;  4X23 B;  4XUJ B;  1EQZ A;  5B2J D;  5GXQ B;  3AZG D;  3LZ0 B;  4QLC C;  5JA4 B;  4Z2M H;  2Y2P A;  1EQZ D;  3F6T A;  4XZQ B;  1P3K D;  5B1L C;  4R8P A;  3C1B C;  3AZJ B;  4KUD C;  3MGP D;  2Y2O A;  5F99 B;  5B2I D;  1BH9 A;  2BYM B;  1WWS A;  4ZUX C;  5B24 C;  5B1L A;  3LEL D;  5BNX B;  4QLC D;  4KUD A;  1B67 A;  3W96 B;  3AV2 C;  5B1L D;  3REK A;  2F8N H;  4WZS B;  4KHA A;  1N1J B;  2HUE C;  3NQJ B;  3C1B D;  4KUD D;  5B31 G;  5B24 A;  5CP6 B;  3AL0 C;  3AYW A;  4H9N B;  2Y2G A;  1M19 C;  4ZUX D;  5B24 D;  5DNN C;  3A6N C;  3VH6 T;  5AVB B;  3X1V C;  3KUY C;  4DQY B;  2HIO B;  1KX5 B;  3AV2 D;  3W99 C;  4CSR A;  1M19 A;  1ZLA C;  4YM6 C;  5DNN A;  3A6N A;  1KX4 D;  3B6G C;  5B32 G;  1M19 D;  4KGC A;  5GSU C;  5DNN D;  5JRG B;  1ZLA A;  4YM6 A;  3KUY D;  3X1V D;  3AZK C;  3REH C;  1PZR A;  5B0Y C;  2J8P A;  3W99 D;  1P3F C;  3VH5 T;  3W97 B;  5GSU A;  1M1A B;  3KXB C;  2ARO C;  4WU8 C;  3B6G D;  3B6F B;  4UUZ A;  3WKJ D;  3MGQ B;  3AZK A;  4YS3 A;  1P34 C;  5C3I B;  5B0Z C;  4H9P A;  4J8V C;  3UTB C;  4JJN C;  3AZH D;  2PYO B;  3KXB A;  3REH D;  2ARO A;  4WU8 A;  2G5H C;  5B0Y D;  1P34 A;  1P3F D;  5AVC B;  3REI C;  3AZL B;  3EPK A;  1F1E A;  3KXB D;  3LZ1 C;  2ARO D;  4WU8 D;  4DRA A;  4J8V A;  3UTB A;  4JJN A;  4G92 C;  1P34 D;  3LJA B;  2F8N A;  2VQR A;  1AOI D;  3UT9 C;  3B0C W;  5B0Z D;  3REI A;  3W98 C;  2YFW B;  3X1T C;  3TU4 B;  5KDM B;  4J8W C;  5CPK C;  3MGS A;  2NZD B;  1T3U A;  1U35 D;  4NE3 A;  5AV8 D;  2ZY3 A;  3X1U A;  5AV5 C;  3LZ1 D;  1TZY C;  4J8W A;  2W8S A;  1ULY A;  3UT9 D;  3IP4 C;  3W98 D;  2RIQ A;  3X1T D;  3O62 C;  4J8W D;  5CPK D;  3AZI B;  1TZY A;  3R45 B;  3AN2 B;  1P3A B;  5BT1 C;  3AZF C;  1P3I C;  2BYK B;  2XD5 A;  1KX3 B;  1KU5 A;  2ZY4 A;  5E5A B;  5AV5 D;  1HQ3 B;  4H9R A;  4CAY B;  3B0D C;  1TZY D;  2NQB C;  3MGR D;  5B2J C;  3C1C C;  4LD9 C;  5GT3 B;  3UTA D;  1P3I A;  1H3O A;  3REJ D;  1P3L B;  3KWQ B;  4Z66 C;  3O62 D;  1R4V A;  5AV9 C;  1M18 D;  1TAF B;  5BO0 A;  5BT1 D;  2Y2H A;  5B2J A;  3MVD D;  3MGP C;  3C1C A;  5B31 D;  3WTP B;  3AZF D;  4LD9 A;  4WJ3 C;  4WNN A;  3AZM B;  5FUG A;  5B32 C;  5BNV B;  4X23 C;  2NQB D;  4H9S C;  1F66 B;  4J8U C;  1P3K A;  3C1C D;  4LD9 D;  3LEL C;  2IO5 B;  1P3O B;  4H9O B;  1P3P B;  5AY8 B;  3WA9 B;  3MGP A;  5CPJ B;  4XZQ C;  3AZG B;  4Z66 D;  5B1M B;  5B2I A;  5B32 A;  5AV9 D;  4H9S A;  1EQZ B;  4J8U A;  5GT0 D;  5G49 A;  1P3G D;  3LEL A;  2FJ7 B;  4H9Q A;  2ZY2 A;  4QLC A;  4DRB A;  5F99 C;  5B32 D;  4X23 D;  4J8U D;  4XZQ A;  3MNN B;  5GXQ D;  3C1B A;  3LZ0 D;  4R8P B;  2Y2N A;  3W96 C;  4XZQ D;  2BYM A;  1BH9 B;  4ZUX A;  1KX4 C;  3VH5 A;  5CP6 C;  2CWE A;  5F99 D;  3W96 A;  1S32 B;  3AV2 A;  4NE5 A;  3WTP E;  3REK B;  3KSY A;  4KHA B;  3W96 D;  5B24 B;  1KX4 A;  1KX5 C;  2ZM5 A;  3AYW B;  4WV4 B;  5CP6 D;  3KUY A;  3X1V A;  3WKJ C;  2HUE B;  1B6W A;  2ZY5 A;  1ID3 B;  3W99 A;  5JRG C;  3AZH C;  5AVB D;  1KX5 D;  3B6G A;  2LY8 A;  5DNN B;  3A6N B;  3WKJ A;  1BH8 A;  1WWI A;  3W97 C;  5CHL B;  3X1S C;  4KGC B;  1M1A C;  5AV6 C;  1P3B C;  3AZH A;  1ZLA B;  4YM6 B;  3REH A;  1AOI C;  5C3I C;  5B0Y A;  1P3F A;  5JRG D;  2XD1 A;  3X1S A;  3V9R B;  2PYO C;  1M1A A;  5GSU B;  5AV6 A;  3WAA B;  1P3B A;  4UUZ B;  1U35 C;  3AZK B;  5AV8 C;  4YS3 B;  3W97 D;  1AOI A;  3X1S D;  2JE5 A;  5B0Z A;  1M1A D;  5AV6 D;  4NFT A;  1P3B D;  4H9P B;  4ZBJ C;  3AFA C;  3KXB B;  3NQU A;  2ARO B;  3H0R C;  1P3M C;  1U35 A;  3AZE C;  5AV8 A;  4UPK A;  1P34 B;  3B0C T;  3H0L C;  4AWL C;  4HGA B;  3TU4 C;  2CV5 C;  2PYO D;  3LZ1 A;  5DNM B;  1BFM A;  2UWX A;  3AFA A;  2NZD C;  4J8V B;  3UTB B;  4JJN B;  5AVC D;  3AZN C;  2F8N B;  3UT9 A;  1P3M A;  3AZE A;  3W98 A;  3REI B;  3MGR C;  3AFA D;  3X1T A;  2CV5 A;  3LJA D;  5CPK A;  2Y2M A;  3UTA C;  3MGS B;  2NZD A;  5B33 B;  1P3M D;  4G92 B;  3REJ C;  3AZN A;  3AZE D;  4EO5 C;  3TU4 D;  2CV5 D;  5AV5 A;  3X1U B;  1HTA A;  1M18 C;  1P3A C;  2BG1 A;  4E44 A;  2YFV A;  3MGR A;  3MVD C;  5CPI B;  2NZD D;  5B31 C;  3AZN D;  3AV1 B;  4J8W B;  1KX3 C;  3UTA A;  4M6B A;  5E5A C;  1HQ3 C;  3REJ A;  3EPJ A;  3O62 A;  5GT3 C;  1P3A A;  1M18 A;  1TZY B;  3MVD A;  3AZF A;  5B31 A;  3KWQ C;  4G91 C;  5E5A A;  1HQ3 A;  2NQB A;  2Y2K A;  5B40 C;  3AN2 D;  1P3A D;  4J8X C;  5GT0 C;  1P3G C;  4WU9 B;  3AZM C;  1KX3 D;  3EPH A;  5E5A D;  3REL B;  1HQ3 D;  4XUJ C;  1P3I B;  1F66 C;  4Z5T B;  4Z66 A;  1Q9C A;  2IO5 C;  5GXQ C;  1P3O C;  5GT3 D;  3B0B A;  5B40 A;  5AV9 A;  3LZ0 C;  3A1K A;  4J8X A;  5GT0 A;  1P3P C;  1P3G A;  5BO0 B;  3WA9 C;  5B2J B;  4LD9 B;  3VH6 A;  1P3L D;  3KWQ D;  4WNN B;  5B1M C;  1JFI B;  4X23 A;  4XUJ A;  5B40 D;  5FUG B;  4J8X D;  1F66 A;  3AZJ C;  2FJ7 C;  5GXQ A;  1P3K B;  2F8N G;  4H9O A;  3LZ0 A;  3AZM D;  1P3P A;  5JA4 A;  4XUJ D;  3MGP B;  1F66 D;  3MNN C;  5B2I B;  1P3O D;  1P3P D;  3AZJ A;  4R8P C;  5AY8 D;  3WA9 D;  4J8U B;  2FJ7 A;  5G49 B;  3LEL B;  5CPJ D;  4H9Q B;  5F99 A;  5B1M D;  4QLC B;  1W2E A;  3AZJ D;  3MNN A;  2FJ7 D;  5BNX A;  5B1L B;  3C1B B;  3KFU G;  4KUD B;  1S32 C;  3MNN D;  3REK C;  3H0M C;  1N1J A;  3NQJ A;  5AVB C;  4R8P D;  2HIO C;  4ZUX B;  5CP6 A;  4H9N A;  3AYW C;  1S32 A;  3AV2 B;  2JCH A;  5BS7 C;  5AVB A;  2DQN C;  2HIO A;  1KX5 A;  1S32 D;  1KX4 B;  1ID3 C;  4CSR B;  3REK D;  1M19 B;  2Y2J A;  3VH6 W;  2HIO D;  3P5J B;  5BS7 A;  3KUY B;  3X1V B;  3AYW D;  1ID3 A;  4KGC C;  5JRG A;  3W99 B;  3B6F C;  2G5I C;  3MGQ C;  1ID3 D;  3B6G B;  3WKJ B;  4E45 A;  3W97 A;  1BH8 B;  3WAA C;  3B6F A;  1A7W A;  3A6N D;  3MGQ A;  3AZH B;  5AVC C;  3AZL C;  4YS3 C;  3REH B;  3A1I A;  4KGC D;  3VH5 W;  2DF4 C;  5B0Y B;  1P3F B;  3B6F D;  2PYO A;  3V9R A;  1ZLA D;  4YM6 D;  3X1S B;  3LJA C;  3MGQ D;  3WAA A;  5AV6 B;  4WU8 B;  1P3B B;  5AVC A;  3AZL A;  4HGA C;  1AOI B;  2JSS A;  5GSU D;  5DNM C;  5B0Z B;  3WAA D;  3LJA A;  2FFF B;  3AZL D;  4YS3 D;  3AZK D;  2Y2L A;  2F8N K;  3NQU B;  2YFW A;  1U35 B;  5AV8 B;  3TU4 A;  3FDD A;  5KDM A;  5DNM A;  3LZ1 B;  3MGS C;  5B33 C;  4ZBJ B;  3AFA B;  3X1U C;  2Y2Q A;  5DNM D;  3UT9 B;  3AZI C;  3AN2 C;  1P3M B;  3AZE B;  3W98 B;  5CPI C;  4J8V D;  4AWL B;  4JJN D;  3UTB D;  3X1T B;  2CV5 B;  3AV1 C;  2F8N D;  5CPK B;  5B33 A;  4NE6 A;  3REI D;  3AZN B;  5AV5 B;  3AZI A;  3R45 A;  3AN2 A;  3MGS D;  5B33 D;  2YFV B;  3MGR B;  1Z2C B;  5CPI A;  2BYK A;  3EG5 B;  3AV1 A;  1P3L C;  1KX3 A;  4Z2M G;  3X1U D;  3UTA B;  4CAY A;  3AZI D;  2RVQ C;  4H9R B;  3REJ B;  4WU9 C;  5CPI D;  4EO5 B;  3O62 B;  5GT3 A;  3WTP C;  3AV1 D;  1M18 B;  3REL C;  3MVD B;  3AZF B;  5B31 B;  1H3O B;  4Z5T C;  3KWQ A;  1P3L A;  1TAF A;  2NQB B;  3B0D B;  5AY8 C;  4WU9 A;  3C1C B;  3WTP A;  3AZM A;  5CPJ C;  3AZG C;  2L5A A;  3REL A;  5BNV A;  2RVQ D;  1EQZ C; 
#chains in the Genus database with same CATH homology
 4Z5T A;  4WU9 D;  4Z66 B;  1P3K C;  4G91 B;  3WTP D;  1P3O A;  5AV9 B;  5B40 B;  2Y2I A;  5AY8 A;  4J8X B;  3WA9 A;  5GT0 B;  3REL D;  3EPL A;  1P3G B;  5CPJ A;  1P3I D;  4Z5T D;  3AZG A;  5B1M A;  2F2A C;  1JFI A;  5B2I C;  5B32 B;  4X23 B;  4XUJ B;  1EQZ A;  5B2J D;  5GXQ B;  3AZG D;  3LZ0 B;  4QLC C;  5JA4 B;  4Z2M H;  2Y2P A;  1EQZ D;  3F6T A;  4XZQ B;  1P3K D;  5B1L C;  4R8P A;  3C1B C;  3AZJ B;  4KUD C;  3MGP D;  2Y2O A;  5F99 B;  5B2I D;  1BH9 A;  2BYM B;  1WWS A;  4ZUX C;  5B24 C;  5B1L A;  3LEL D;  5BNX B;  4QLC D;  4KUD A;  1B67 A;  3W96 B;  3AV2 C;  5B1L D;  3REK A;  2F8N H;  4WZS B;  4KHA A;  1N1J B;  2HUE C;  3NQJ B;  3C1B D;  4KUD D;  5B31 G;  5B24 A;  5CP6 B;  3AL0 C;  3AYW A;  4H9N B;  2Y2G A;  1M19 C;  4ZUX D;  5B24 D;  5DNN C;  3A6N C;  3VH6 T;  5AVB B;  3X1V C;  3KUY C;  4DQY B;  2HIO B;  1KX5 B;  3AV2 D;  3W99 C;  4CSR A;  1M19 A;  1ZLA C;  4YM6 C;  5DNN A;  3A6N A;  1KX4 D;  3B6G C;  5B32 G;  1M19 D;  4KGC A;  5GSU C;  5DNN D;  5JRG B;  1ZLA A;  4YM6 A;  3KUY D;  3X1V D;  3AZK C;  3REH C;  1PZR A;  5B0Y C;  2J8P A;  3W99 D;  1P3F C;  3VH5 T;  3W97 B;  5GSU A;  1M1A B;  3KXB C;  2ARO C;  4WU8 C;  3B6G D;  3B6F B;  4UUZ A;  3WKJ D;  3MGQ B;  3AZK A;  4YS3 A;  1P34 C;  5C3I B;  5B0Z C;  4H9P A;  4J8V C;  3UTB C;  4JJN C;  3AZH D;  2PYO B;  3KXB A;  3REH D;  2ARO A;  4WU8 A;  2G5H C;  5B0Y D;  1P34 A;  1P3F D;  5AVC B;  3REI C;  3AZL B;  3EPK A;  1F1E A;  3KXB D;  3LZ1 C;  2ARO D;  4WU8 D;  4DRA A;  4J8V A;  3UTB A;  4JJN A;  4G92 C;  1P34 D;  3LJA B;  2F8N A;  2VQR A;  1AOI D;  3UT9 C;  3B0C W;  5B0Z D;  3REI A;  3W98 C;  2YFW B;  3X1T C;  3TU4 B;  5KDM B;  4J8W C;  5CPK C;  3MGS A;  2NZD B;  1T3U A;  1U35 D;  4NE3 A;  5AV8 D;  2ZY3 A;  3X1U A;  5AV5 C;  3LZ1 D;  1TZY C;  4J8W A;  2W8S A;  1ULY A;  3UT9 D;  3IP4 C;  3W98 D;  2RIQ A;  3X1T D;  3O62 C;  4J8W D;  5CPK D;  3AZI B;  1TZY A;  3R45 B;  3AN2 B;  1P3A B;  5BT1 C;  3AZF C;  1P3I C;  2BYK B;  2XD5 A;  1KX3 B;  1KU5 A;  2ZY4 A;  5E5A B;  5AV5 D;  1HQ3 B;  4H9R A;  4CAY B;  3B0D C;  1TZY D;  2NQB C;  3MGR D;  5B2J C;  3C1C C;  4LD9 C;  5GT3 B;  3UTA D;  1P3I A;  1H3O A;  3REJ D;  1P3L B;  3KWQ B;  4Z66 C;  3O62 D;  1R4V A;  5AV9 C;  1M18 D;  1TAF B;  5BO0 A;  5BT1 D;  2Y2H A;  5B2J A;  3MVD D;  3MGP C;  3C1C A;  5B31 D;  3WTP B;  3AZF D;  4LD9 A;  4WJ3 C;  4WNN A;  3AZM B;  5FUG A;  5B32 C;  5BNV B;  4X23 C;  2NQB D;  4H9S C;  1F66 B;  4J8U C;  1P3K A;  3C1C D;  4LD9 D;  3LEL C;  2IO5 B;  1P3O B;  4H9O B;  1P3P B;  5AY8 B;  3WA9 B;  3MGP A;  5CPJ B;  4XZQ C;  3AZG B;  4Z66 D;  5B1M B;  5B2I A;  5B32 A;  5AV9 D;  4H9S A;  1EQZ B;  4J8U A;  5GT0 D;  5G49 A;  1P3G D;  3LEL A;  2FJ7 B;  4H9Q A;  2ZY2 A;  4QLC A;  4DRB A;  5F99 C;  5B32 D;  4X23 D;  4J8U D;  4XZQ A;  3MNN B;  5GXQ D;  3C1B A;  3LZ0 D;  4R8P B;  2Y2N A;  3W96 C;  4XZQ D;  2BYM A;  1BH9 B;  4ZUX A;  1KX4 C;  3VH5 A;  5CP6 C;  2CWE A;  5F99 D;  3W96 A;  1S32 B;  3AV2 A;  4NE5 A;  3WTP E;  3REK B;  3KSY A;  4KHA B;  3W96 D;  5B24 B;  1KX4 A;  1KX5 C;  2ZM5 A;  3AYW B;  4WV4 B;  5CP6 D;  3KUY A;  3X1V A;  3WKJ C;  2HUE B;  1B6W A;  2ZY5 A;  1ID3 B;  3W99 A;  5JRG C;  3AZH C;  5AVB D;  1KX5 D;  3B6G A;  2LY8 A;  5DNN B;  3A6N B;  3WKJ A;  1BH8 A;  1WWI A;  3W97 C;  5CHL B;  3X1S C;  4KGC B;  1M1A C;  5AV6 C;  1P3B C;  3AZH A;  1ZLA B;  4YM6 B;  3REH A;  1AOI C;  5C3I C;  5B0Y A;  1P3F A;  5JRG D;  2XD1 A;  3X1S A;  3V9R B;  2PYO C;  1M1A A;  5GSU B;  5AV6 A;  3WAA B;  1P3B A;  4UUZ B;  1U35 C;  3AZK B;  5AV8 C;  4YS3 B;  3W97 D;  1AOI A;  3X1S D;  2JE5 A;  5B0Z A;  1M1A D;  5AV6 D;  4NFT A;  1P3B D;  4H9P B;  4ZBJ C;  3AFA C;  3KXB B;  3NQU A;  2ARO B;  3H0R C;  1P3M C;  1U35 A;  3AZE C;  5AV8 A;  4UPK A;  1P34 B;  3B0C T;  3H0L C;  4AWL C;  4HGA B;  3TU4 C;  2CV5 C;  2PYO D;  3LZ1 A;  5DNM B;  1BFM A;  2UWX A;  3AFA A;  2NZD C;  4J8V B;  3UTB B;  4JJN B;  5AVC D;  3AZN C;  2F8N B;  3UT9 A;  1P3M A;  3AZE A;  3W98 A;  3REI B;  3MGR C;  3AFA D;  3X1T A;  2CV5 A;  3LJA D;  5CPK A;  2Y2M A;  3UTA C;  3MGS B;  2NZD A;  5B33 B;  1P3M D;  4G92 B;  3REJ C;  3AZN A;  3AZE D;  4EO5 C;  3TU4 D;  2CV5 D;  5AV5 A;  3X1U B;  1HTA A;  1M18 C;  1P3A C;  2BG1 A;  4E44 A;  2YFV A;  3MGR A;  3MVD C;  5CPI B;  2NZD D;  5B31 C;  3AZN D;  3AV1 B;  4J8W B;  1KX3 C;  3UTA A;  4M6B A;  5E5A C;  1HQ3 C;  3REJ A;  3EPJ A;  3O62 A;  5GT3 C;  1P3A A;  1M18 A;  1TZY B;  3MVD A;  3AZF A;  5B31 A;  3KWQ C;  4G91 C;  5E5A A;  1HQ3 A;  2NQB A;  2Y2K A;  5B40 C;  3AN2 D;  1P3A D;  4J8X C;  5GT0 C;  1P3G C;  4WU9 B;  3AZM C;  1KX3 D;  3EPH A;  5E5A D;  3REL B;  1HQ3 D;  4XUJ C;  1P3I B;  1F66 C;  4Z5T B;  4Z66 A;  1Q9C A;  2IO5 C;  5GXQ C;  1P3O C;  5GT3 D;  3B0B A;  5B40 A;  5AV9 A;  3LZ0 C;  3A1K A;  4J8X A;  5GT0 A;  1P3P C;  1P3G A;  5BO0 B;  3WA9 C;  5B2J B;  4LD9 B;  3VH6 A;  1P3L D;  3KWQ D;  4WNN B;  5B1M C;  1JFI B;  4X23 A;  4XUJ A;  5B40 D;  5FUG B;  4J8X D;  1F66 A;  3AZJ C;  2FJ7 C;  5GXQ A;  1P3K B;  2F8N G;  4H9O A;  3LZ0 A;  3AZM D;  1P3P A;  5JA4 A;  4XUJ D;  3MGP B;  1F66 D;  3MNN C;  5B2I B;  1P3O D;  1P3P D;  3AZJ A;  4R8P C;  5AY8 D;  3WA9 D;  4J8U B;  2FJ7 A;  5G49 B;  3LEL B;  5CPJ D;  4H9Q B;  5F99 A;  5B1M D;  4QLC B;  1W2E A;  3AZJ D;  3MNN A;  2FJ7 D;  5BNX A;  5B1L B;  3C1B B;  3KFU G;  4KUD B;  1S32 C;  3MNN D;  3REK C;  3H0M C;  1N1J A;  3NQJ A;  5AVB C;  4R8P D;  2HIO C;  4ZUX B;  5CP6 A;  4H9N A;  3AYW C;  1S32 A;  3AV2 B;  2JCH A;  5BS7 C;  5AVB A;  2DQN C;  2HIO A;  1KX5 A;  1S32 D;  1KX4 B;  1ID3 C;  4CSR B;  3REK D;  1M19 B;  2Y2J A;  3VH6 W;  2HIO D;  3P5J B;  5BS7 A;  3KUY B;  3X1V B;  3AYW D;  1ID3 A;  4KGC C;  5JRG A;  3W99 B;  3B6F C;  2G5I C;  3MGQ C;  1ID3 D;  3B6G B;  3WKJ B;  4E45 A;  3W97 A;  1BH8 B;  3WAA C;  3B6F A;  1A7W A;  3A6N D;  3MGQ A;  3AZH B;  5AVC C;  3AZL C;  4YS3 C;  3REH B;  3A1I A;  4KGC D;  3VH5 W;  2DF4 C;  5B0Y B;  1P3F B;  3B6F D;  2PYO A;  3V9R A;  1ZLA D;  4YM6 D;  3X1S B;  3LJA C;  3MGQ D;  3WAA A;  5AV6 B;  4WU8 B;  1P3B B;  5AVC A;  3AZL A;  4HGA C;  1AOI B;  2JSS A;  5GSU D;  5DNM C;  5B0Z B;  3WAA D;  3LJA A;  2FFF B;  3AZL D;  4YS3 D;  3AZK D;  2Y2L A;  2F8N K;  3NQU B;  2YFW A;  1U35 B;  5AV8 B;  3TU4 A;  3FDD A;  5KDM A;  5DNM A;  3LZ1 B;  3MGS C;  5B33 C;  4ZBJ B;  3AFA B;  3X1U C;  2Y2Q A;  5DNM D;  3UT9 B;  3AZI C;  3AN2 C;  1P3M B;  3AZE B;  3W98 B;  5CPI C;  4J8V D;  4AWL B;  4JJN D;  3UTB D;  3X1T B;  2CV5 B;  3AV1 C;  2F8N D;  5CPK B;  5B33 A;  4NE6 A;  3REI D;  3AZN B;  5AV5 B;  3AZI A;  3R45 A;  3AN2 A;  3MGS D;  5B33 D;  2YFV B;  3MGR B;  1Z2C B;  5CPI A;  2BYK A;  3EG5 B;  3AV1 A;  1P3L C;  1KX3 A;  4Z2M G;  3X1U D;  3UTA B;  4CAY A;  3AZI D;  2RVQ C;  4H9R B;  3REJ B;  4WU9 C;  5CPI D;  4EO5 B;  3O62 B;  5GT3 A;  3WTP C;  3AV1 D;  1M18 B;  3REL C;  3MVD B;  3AZF B;  5B31 B;  1H3O B;  4Z5T C;  3KWQ A;  1P3L A;  1TAF A;  2NQB B;  3B0D B;  5AY8 C;  4WU9 A;  3C1C B;  3WTP A;  3AZM A;  5CPJ C;  3AZG C;  2L5A A;  3REL A;  5BNV A;  2RVQ D;  1EQZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...