1M19D

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 34
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m19D00
1P3GA 5AV6B 5B2IA 2NZDC 5AVBD 4M6BA 3LELD 5CPJD 4YM6B 4XZQC 5JRGD 3MGQA 5B1LB 4CAYB 4AWLB 4H9QA 5B33D 4H9PA 3AFAD 1P3BC 3KWQD 4NE5A 1P3BA 4J8XD 5B31D 3C1CC 3MGPB 1P3OD 5CPIB 3C1CA 4WU9B 4YS3A 5B0YB 3MNND 3C1BD 3AZGA 4LD9C 4Z2MG 5GT3A 4LD9A 4H9RB 1P3PA 3NQUA 5C3IC 5AY8C 3AN2D 4H9OA 4CSRA 3W96C 5BNVB 5AV8D 3O62A 5AY8A 3KXBC 3AZED 3KXBA 3W96A 1KX5D 1BH8A 3B6FD 5F99A 3REKB 2CV5A 2NQBD 4J8UB 5GSUD 5AVCC 4J8VA 3UTBA 2F8NH 4Z2MH 5AVCA 3KUYB 3B6GB 3V9RB 3LZ0B 5AV9B 4QLCC 5FUGA 1M1AB 2NQBB 5B24C 5B2JA 3AZFD 1EQZB 5B24A 5GT0D 2RVQC 3R45A 2PYOC 3W99D 3REJD 5B31G 3X1SB 1AOIC 2F8NA 1P3ID 5GT0B 3AYWD 1TZYC 3AZNC 1TZYA 1P3FB 5E5AD 3RELD 3UTAB 1ZLAB 5G49B 3AYWB 2FJ7D 3W97A 1N1JA 5DNMD 3MGRB 5B1MD 2HIOC 3X1VB 1ID3C 1P3LC 1TAFA 2HIOA 2IO5B 1ID3A 3TU4D 1P3KB 4Z5TC 5B32B 3W98D 3AZLD 4UUZB 4XUJC 1P3AC 3AZMD 4XUJA 3VH6A 3AZHC 1P3MD 3X1TC 3AZHA 2NZDD 3X1TA 4JJNB 3UT9B 3AV2D 3LZ1B 3WA9C 4ZBJB 3VH5A 1M18C 1S32D 3WA9A 5AV5C 1P3OA 1M18A 1P3GB 5AV5A 5B40D 1KX4C 3WTPC 4WNNB 2NZDB 4H9NA 3WTPA 4XZQB 4H9QB 4H9PB 1R4VA 1P3BB 3MGSC 1BH9A 3AV1D 3X1UA 3C1CB 3MGSA 3WKJD 1F1EA 1ULYA 1A7WA 4LD9B 5GSUA 1HQ3C 3AZJC 2YFVA 1HQ3A 3AZJA 3NQUB 4CSRB 5C3IB 5AY8B 3A6NC 3KXBB 3W96B 1BH8B 3A6NA 5BS7A 5B0ZD 5CP6D 5JA4B 3UTBB 1KU5A 5BNXA 5AVCB 1KX3C 1KX3A 5FUGB 5AV6D 1JFIA 4QLCB 4YM6D 2PYOD 5B1LD 5GXQC 5B2IC 5GXQA 5B24B 5E5AA 1M19C 4G91C 1M19A 3R45B 3MGQC 4G92C 2PYOB 3MGPD 2FJ7A 2F8NK 5CPID 4KUDA 4WU9D 2F8NB 5B0YD 1AOIB 4NE6A 4J8WC 4J8WA 4KGCA 1TZYB 3AZNB 4YS3C 3AZGC 4R8PC 4WU8A 5GT3C 4R8PA 1BFMA 1N1JB 3REKD 2HIOB 1TAFB 3LJAC 1P3PC 1P3LB 3O62C 1ID3B 3LJAA 4J8UD 3AV2A 1P3AD 5F99C 4Z5TB 3KUYD 1S32A 2CV5C 3B6GD 3LZ0D 5B40A 5AV9D 1M1AD 3REIC 4J8VC 4XUJB 3UTBC 3REIA 1F66C 1P3AB 2YFWB 1F66A 3AZHB 1EQZD 2LY8A 4ZUXA 3X1TB 3AZIC 3WAAC 3AZIA 3WA9B 5B2JC 3AV1A 1M18B 3WAAA 5AV5B 3X1SD 3MVDC 4X23C 4H9NB 1KX4B 3MVDA 4X23A 3WTPB 1U35C 1U35A 3AZKC 1P3FD 3UTAD 1ZLAD 4EO5C 3AZKA 2BYMA 2AROC 1BH9B 2AROA 5DNNC 3MGSB 1B6WA 5DNNA 3MGRD 3X1VD 5CP6A 1P3KD 3W97C 2YFVB 5B32D 1HQ3B 4Z66C 2CWEA 3REHA 3AZJB 1P34C 4Z66A 1P34A 5CPKC 5AV6A 5CPKA 4YM6A 3A6NB 4CAYA 4KHAB 4WV4B 5AVBC 3LELC 5CPJC 5AVBA 4JJND 3UT9D 5JRGC 3LELA 5CPJA 3LZ1D 5BNXB 5JRGA 3MGPA 1KX3B 1P3GD 5B33C 4WU9A 5B33A 3AFAC 3KWQC 3AFAA 3KWQA 5B31C 4J8XC 4XZQD 1P3OC 4J8XA 5B31A 5GXQB 3MNNC 5B2IB 3C1BC 2L5AA 3MNNA 1M19B 3C1BA 4G91B 1P3BD 3MGQB 4G92B 4KUDB 4E44A 4YS3D 3C1CD 4J8WB 5GT3D 1WWIA 3AN2C 4LD9D 4HGAC 3X1UC 4E45A 5AV8A 3AZEC 3AN2A 4YS3B 1KX5C 2HUEC 3AZEA 3B6FC 5B32G 4WU8B 1KX5A 3B6FA 3AZGB 3V9RA 4R8PB 3LZ0A 5GT3B 1M1AA 5GSUC 1H3OA 3O62D 2NQBA 5AY8D 3KXBD 3W96D 3VH6T 3LJAB 1P3PB 4H9OB 3O62B 3B0BA 3UTBD 5AVCD 5BS7C 3AZFC 5F99B 3VH5T 3AZFA 2CV5B 5GT0A 3NQJA 3B0DC 4QLCD 3REIB 4J8VB 1F66B 3W99A 3REJC 1HTAA 3REJA 5B24D 1P3IC 1P3FA 3UTAA 1P3IA 3AYWA 3AZIB 2RVQD 3WAAB 5B2JB 5E5AC 3RELC 2F8ND 2BYKA 3MGRA 3RELA 3MVDB 4X23B 1AOID 1U35B 1TZYD 2FJ7C 4KUDC 3AZND 1P3KA 5DNMC 5BT1C 5B32A 5B1MC 5DNMA 3AZKB 3B0CT 5B1MA 2BYMB 4EO5B 4KGCC 3TU4C 2AROB 3TU4A 3W98C 3W97D 5DNNB 4WU8C 3W98A 3AZLC 3AZLA 2HIOD 1ID3D 1P3LD 3AZMC 3AZMA 3W97B 4Z5TD 4Z66B 1P34B 1P3MC 1P3MA 5CPKB 3AV2C 4WNNA 2NZDA 4H9SC 4XUJD 1S32C 4H9SA 4XZQA 5B40C 3AZHD 3X1TD 5AVBB 3LELB 5CPJB 5JRGB 3WA9D 1M18D 4ZUXC 5AV5D 5B33B 2F8NG 1B67A 1KX4D 3AFAB 3WTPD 3KWQB 3AV1C 4J8XB 5B31B 1P3OB 3WKJC 3WKJA 3MNNB 3C1BB 3KSYA 3X1UD 3MGSD 5JA4A 5AV8B 3AN2B 4HGAB 3X1UB 5BO0A 4NE3A 3AZEB 1HQ3D 3AZJD 1KX5B 2HUEB 3B6FB 5B0ZC 5CP6C 1H3OB 5B0ZA 4QLCA 5GSUB 5CHLB 5KDMA 3REHC 3A6ND 5AV6C 4YM6C 5B1LC 4AWLC 2PYOA 5B1LA 1KX3D 3AZFB 3NQJB 1AOIA 3B0DB 3W99B 3MGPC 5CPIC 3AZNA 3REJB 5GXQD 4WU9C 5B0YC 4WZSB 5CPIA 5B2ID 1JFIB 1P3IB 5B0YA 1M19D 3MGQD 4KUDD 5BT1D 2BYKB 5E5AB 3RELB 4H9RA 4J8WD 1P3LA 4KGCD 5BNVA 2FJ7B 5DNMB 3REKC 4Z5TA 4WU8D 5B1MB 3REKA 4R8PD 3AZGD 4J8UC 4KGCB 5AV8C 3TU4B 4J8UA 1P3AA 2YFWA 3KUYC 3W98B 3B6GC 3KUYA 3LZ0C 5AV9C 3AZLB 3B6GA 1M1AC 2NQBC 5AV9A 3LJAD 1P3PD 3AZMB 4DRAA 4DRBA 5F99D 1EQZC 1P3MB 2CV5D 1EQZA 1KX4A 3REID 3AV2B 4J8VD 1F66D 1S32B 3X1SC 1WWSA 5B40B 5GT0C 4ZUXD 3X1SA 3VH6W 3AZID 3W99C 3WAAD 5B2JD 1P3FC 3UTAC 1ZLAC 4ZUXB 2JSSA 3MVDD 4X23D 3AYWC 1ZLAA 5G49A 3VH5W 1U35D 3AV1B 3MGRC 3WKJB 3X1VC 3AZKD 1Q9CA 3X1VA 2IO5C 3WTPE 2AROD 1P3KC 5B32C 5DNND 4KHAA 4UUZA 5BO0B 3REHD 4Z66D 1P34D 4NFTA 4JJNC 3UT9C 5CPKD 5B0ZB 5CP6B 3LZ1C 5KDMB 3B0CW 4ZBJC 4JJNA 3UT9A 3REHB 3LZ1A 1P3GC
chains in the Genus database with same CATH superfamily
1P3GA 5AV6B 5B2IA 2NZDC 5AVBD 4M6BA 3LELD 5CPJD 4YM6B 4XZQC 5JRGD 3MGQA 5B1LB 4CAYB 4AWLB 4H9QA 5B33D 4H9PA 2ZM5A 3AFAD 1P3BC 3KWQD 3H0RC 4NE5A 1P3BA 4J8XD 5B31D 3C1CC 3MGPB 1P3OD 5CPIB 3C1CA 4WU9B 4YS3A 5B0YB 3MNND 3C1BD 3AZGA 2XD5A 4LD9C 4Z2MG 5GT3A 4LD9A 2BG1A 4H9RB 1P3PA 3NQUA 5C3IC 5AY8C 3AN2D 4H9OA 4CSRA 3W96C 5BNVB 5AV8D 3O62A 5AY8A 3KXBC 3AZED 3KXBA 3W96A 1KX5D 1BH8A 3B6FD 2Y2GA 5F99A 3REKB 2CV5A 2NQBD 4DQYB 4J8UB 5GSUD 5AVCC 4J8VA 3UTBA 2F8NH 4Z2MH 5AVCA 3KUYB 3B6GB 3V9RB 3LZ0B 5AV9B 4QLCC 2J8PA 5FUGA 1M1AB 2NQBB 3FDDA 5B24C 5B2JA 3AZFD 1EQZB 5B24A 5GT0D 2RVQC 3R45A 2PYOC 3W99D 3REJD 5B31G 2Y2OA 3X1SB 1AOIC 2F8NA 1P3ID 5GT0B 3AYWD 1TZYC 3AZNC 2XD1A 1TZYA 1P3FB 5E5AD 2VQRA 3RELD 3UTAB 1ZLAB 5G49B 3AYWB 2FJ7D 3W97A 1N1JA 5DNMD 3MGRB 5B1MD 2HIOC 3X1VB 1ID3C 1P3LC 1TAFA 2HIOA 2IO5B 1ID3A 2Y2QA 3EPKA 3TU4D 1P3KB 4Z5TC 5B32B 3W98D 3AZLD 4UUZB 4XUJC 1P3AC 3AZMD 4XUJA 3VH6A 3AZHC 1P3MD 3X1TC 3AZHA 2NZDD 3X1TA 4JJNB 3UT9B 3AV2D 3EPHA 3LZ1B 3WA9C 4ZBJB 3VH5A 1M18C 1S32D 3WA9A 3KFUG 5AV5C 1P3OA 1M18A 1P3GB 5AV5A 5B40D 1KX4C 3WTPC 4WNNB 2NZDB 4H9NA 3WTPA 4XZQB 4H9QB 4H9PB 1R4VA 1P3BB 3MGSC 1BH9A 3AV1D 3X1UA 3C1CB 3MGSA 3WKJD 2Y2MA 1F1EA 3IP4C 1ULYA 1A7WA 4LD9B 5GSUA 1HQ3C 3EPJA 3AZJC 1W2EA 2YFVA 1HQ3A 3AZJA 3NQUB 4CSRB 5C3IB 5AY8B 3A6NC 3KXBB 3W96B 1BH8B 3A6NA 5BS7A 5B0ZD 5CP6D 5JA4B 3UTBB 1KU5A 5BNXA 5AVCB 1KX3C 1KX3A 5FUGB 5AV6D 1JFIA 4QLCB 4YM6D 2PYOD 5B1LD 5GXQC 5B2IC 5GXQA 5B24B 3H0LC 5E5AA 1M19C 4G91C 1M19A 3R45B 3MGQC 4G92C 2PYOB 3MGPD 2FJ7A 2F8NK 5CPID 4KUDA 4WU9D 2F8NB 5B0YD 1AOIB 4NE6A 4J8WC 3P5JB 4J8WA 4KGCA 1TZYB 3AZNB 2G5HC 4YS3C 3AZGC 4R8PC 4WU8A 5GT3C 4R8PA 1BFMA 1N1JB 3EG5B 3REKD 2HIOB 1TAFB 3LJAC 1P3PC 1P3LB 3O62C 1ID3B 3LJAA 4J8UD 3AV2A 1P3AD 5F99C 4Z5TB 3KUYD 1S32A 2CV5C 3B6GD 3LZ0D 5B40A 5AV9D 1M1AD 3REIC 4J8VC 4XUJB 3UTBC 3REIA 1F66C 1P3AB 2YFWB 1F66A 3AZHB 1EQZD 2LY8A 4ZUXA 3X1TB 3AZIC 3WAAC 3AZIA 1PZRA 3WA9B 5B2JC 3AV1A 1M18B 3WAAA 5AV5B 3X1SD 3MVDC 4X23C 4H9NB 1KX4B 3MVDA 4X23A 3WTPB 1U35C 1U35A 1Z2CB 3AZKC 1P3FD 3UTAD 1ZLAD 4EO5C 3AZKA 2BYMA 2AROC 1BH9B 2AROA 2ZY5A 3H0MC 5DNNC 3MGSB 1B6WA 5DNNA 2Y2HA 3MGRD 3X1VD 5CP6A 1P3KD 3W97C 2YFVB 5B32D 1HQ3B 4Z66C 2CWEA 3REHA 3AZJB 1P34C 4Z66A 1P34A 5CPKC 5AV6A 5CPKA 4YM6A 3A6NB 4CAYA 4KHAB 4WV4B 5AVBC 3LELC 5CPJC 5AVBA 4JJND 3UT9D 5JRGC 3LELA 5CPJA 3LZ1D 2JCHA 5BNXB 5JRGA 3MGPA 1KX3B 1P3GD 5B33C 4WU9A 5B33A 3AFAC 3KWQC 3AFAA 3KWQA 5B31C 4J8XC 4XZQD 1P3OC 4J8XA 5B31A 5GXQB 3F6TA 3MNNC 5B2IB 3C1BC 2L5AA 3MNNA 1M19B 3C1BA 4G91B 1P3BD 3MGQB 4G92B 2ZY3A 4KUDB 4E44A 4YS3D 3C1CD 2Y2PA 3A1IA 4J8WB 5GT3D 1WWIA 3AN2C 4LD9D 4HGAC 3X1UC 4E45A 5AV8A 3AZEC 3AN2A 4YS3B 1KX5C 2HUEC 3AZEA 3B6FC 5B32G 4WU8B 1KX5A 3B6FA 3AZGB 3V9RA 4R8PB 3LZ0A 5GT3B 1M1AA 5GSUC 1H3OA 3O62D 2NQBA 5AY8D 3KXBD 3W96D 3VH6T 3LJAB 1P3PB 4H9OB 3O62B 3B0BA 3UTBD 5AVCD 5BS7C 3AZFC 5F99B 3VH5T 3AZFA 2CV5B 5GT0A 3NQJA 3B0DC 4QLCD 3REIB 2Y2IA 4J8VB 1F66B 3W99A 3REJC 1HTAA 3REJA 5B24D 1P3IC 1P3FA 3UTAA 1P3IA 3AYWA 3AZIB 2RVQD 3WAAB 2DQNC 5B2JB 5E5AC 3RELC 2F8ND 2BYKA 3MGRA 2W8SA 3MVDB 4X23B 3RELA 1AOID 3AL0C 1U35B 1TZYD 2FJ7C 4KUDC 3AZND 1P3KA 5DNMC 5BT1C 5B32A 5B1MC 5DNMA 3AZKB 3B0CT 5B1MA 2BYMB 4EO5B 4KGCC 3TU4C 2AROB 3TU4A 3W98C 3W97D 2ZY2A 5DNNB 4WU8C 3W98A 3AZLC 3AZLA 2HIOD 1ID3D 1P3LD 3AZMC 3AZMA 3W97B 4Z5TD 4Z66B 1P34B 1P3MC 1P3MA 5CPKB 3AV2C 4WNNA 2NZDA 4H9SC 4XUJD 1S32C 4H9SA 4XZQA 2Y2JA 5B40C 3AZHD 2RIQA 3X1TD 5AVBB 3LELB 5CPJB 5JRGB 3WA9D 1M18D 5AV5D 4ZUXC 2ZY4A 5B33B 2FFFB 2F8NG 1B67A 1KX4D 3AFAB 3WTPD 3KWQB 4UPKA 3AV1C 4J8XB 5B31B 1P3OB 3WKJC 3WKJA 3MNNB 3C1BB 1T3UA 3KSYA 3X1UD 3MGSD 5JA4A 5AV8B 3AN2B 3EPLA 4HGAB 3X1UB 5BO0A 4NE3A 3AZEB 1HQ3D 3AZJD 1KX5B 2HUEB 3B6FB 5B0ZC 5CP6C 1H3OB 3A1KA 5B0ZA 4QLCA 5GSUB 5CHLB 5KDMA 3REHC 3A6ND 5AV6C 4YM6C 5B1LC 4AWLC 2PYOA 5B1LA 1KX3D 3AZFB 3NQJB 1AOIA 3B0DB 3W99B 3MGPC 5CPIC 3AZNA 3REJB 5GXQD 4WU9C 2UWXA 5B0YC 4WZSB 5CPIA 5B2ID 1JFIB 1P3IB 5B0YA 1M19D 2G5IC 3MGQD 2Y2KA 4KUDD 5BT1D 2BYKB 5E5AB 3RELB 4H9RA 4J8WD 1P3LA 4KGCD 5BNVA 2FJ7B 5DNMB 3REKC 4Z5TA 4WU8D 5B1MB 3REKA 4R8PD 3AZGD 2DF4C 4J8UC 4KGCB 2Y2LA 5AV8C 3TU4B 4J8UA 1P3AA 2YFWA 3KUYC 3W98B 3B6GC 3KUYA 3LZ0C 5AV9C 3AZLB 3B6GA 1M1AC 2NQBC 5AV9A 3LJAD 1P3PD 3AZMB 2F2AC 4DRAA 4DRBA 2JE5A 5F99D 1EQZC 1P3MB 2CV5D 1EQZA 1KX4A 3REID 3AV2B 4J8VD 1F66D 1S32B 3X1SC 1WWSA 4ZUXD 5GT0C 5B40B 3X1SA 3VH6W 2Y2NA 3AZID 3W99C 3WAAD 4WJ3C 5B2JD 1P3FC 3UTAC 1ZLAC 4ZUXB 2JSSA 3MVDD 4X23D 3AYWC 1ZLAA 5G49A 3VH5W 1U35D 3AV1B 3MGRC 3WKJB 3X1VC 3AZKD 1Q9CA 3X1VA 2IO5C 3WTPE 2AROD 1P3KC 5B32C 5DNND 4KHAA 4UUZA 5BO0B 3REHD 4Z66D 1P34D 4NFTA 4JJNC 3UT9C 5CPKD 5B0ZB 5CP6B 3LZ1C 5KDMB 3B0CW 4ZBJC 4JJNA 3UT9A 3REHB 3LZ1A 1P3GC
chains in the Genus database with same CATH topology
1P3GA 5AV6B 5B2IA 2NZDC 5AVBD 4M6BA 3LELD 5CPJD 4YM6B 4XZQC 5JRGD 3MGQA 5B1LB 4CAYB 4AWLB 4H9QA 5B33D 4H9PA 2ZM5A 3AFAD 1P3BC 3KWQD 3H0RC 4NE5A 1P3BA 4J8XD 5B31D 3C1CC 3MGPB 1P3OD 5CPIB 3C1CA 4WU9B 4YS3A 5B0YB 3MNND 3C1BD 3AZGA 2XD5A 4LD9C 4Z2MG 5GT3A 4LD9A 2BG1A 4H9RB 1P3PA 3NQUA 5C3IC 5AY8C 3AN2D 4H9OA 4CSRA 3W96C 5BNVB 5AV8D 3O62A 5AY8A 3KXBC 3AZED 3KXBA 3W96A 1KX5D 1BH8A 3B6FD 2Y2GA 5F99A 3REKB 2CV5A 2NQBD 4DQYB 4J8UB 5GSUD 5AVCC 4J8VA 3UTBA 2F8NH 4Z2MH 5AVCA 3KUYB 3B6GB 3V9RB 3LZ0B 5AV9B 4QLCC 2J8PA 5FUGA 1M1AB 2NQBB 3FDDA 5B24C 5B2JA 3AZFD 1EQZB 5B24A 5GT0D 2RVQC 3R45A 2PYOC 3W99D 3REJD 5B31G 2Y2OA 3X1SB 1AOIC 2F8NA 1P3ID 5GT0B 3AYWD 1TZYC 3AZNC 2XD1A 1TZYA 1P3FB 5E5AD 2VQRA 3RELD 3UTAB 1ZLAB 5G49B 3AYWB 2FJ7D 3W97A 1N1JA 5DNMD 3MGRB 5B1MD 2HIOC 3X1VB 1ID3C 1P3LC 1TAFA 2HIOA 2IO5B 1ID3A 2Y2QA 3EPKA 3TU4D 1P3KB 4Z5TC 5B32B 3W98D 3AZLD 4UUZB 4XUJC 1P3AC 3AZMD 4XUJA 3VH6A 3AZHC 1P3MD 3X1TC 3AZHA 2NZDD 3X1TA 4JJNB 3UT9B 3AV2D 3EPHA 3LZ1B 3WA9C 4ZBJB 3VH5A 1M18C 1S32D 3WA9A 3KFUG 5AV5C 1P3OA 1M18A 1P3GB 5AV5A 5B40D 1KX4C 3WTPC 4WNNB 2NZDB 4H9NA 3WTPA 4XZQB 4H9QB 4H9PB 1R4VA 1P3BB 3MGSC 1BH9A 3AV1D 3X1UA 3C1CB 3MGSA 3WKJD 2Y2MA 1F1EA 3IP4C 1ULYA 1A7WA 4LD9B 5GSUA 1HQ3C 3EPJA 3AZJC 1W2EA 2YFVA 1HQ3A 3AZJA 3NQUB 4CSRB 5C3IB 5AY8B 3A6NC 3KXBB 3W96B 1BH8B 3A6NA 5BS7A 5B0ZD 5CP6D 5JA4B 3UTBB 1KU5A 5BNXA 5AVCB 1KX3C 1KX3A 5FUGB 5AV6D 1JFIA 4QLCB 4YM6D 2PYOD 5B1LD 5GXQC 5B2IC 5GXQA 5B24B 3H0LC 5E5AA 1M19C 4G91C 1M19A 3R45B 3MGQC 4G92C 2PYOB 3MGPD 2FJ7A 2F8NK 5CPID 4KUDA 4WU9D 2F8NB 5B0YD 1AOIB 4NE6A 4J8WC 3P5JB 4J8WA 4KGCA 1TZYB 3AZNB 2G5HC 4YS3C 3AZGC 4R8PC 4WU8A 5GT3C 4R8PA 1BFMA 1N1JB 3EG5B 3REKD 2HIOB 1TAFB 3LJAC 1P3PC 1P3LB 3O62C 1ID3B 3LJAA 4J8UD 3AV2A 1P3AD 5F99C 4Z5TB 3KUYD 1S32A 2CV5C 3B6GD 3LZ0D 5B40A 5AV9D 1M1AD 3REIC 4J8VC 4XUJB 3UTBC 3REIA 1F66C 1P3AB 2YFWB 1F66A 3AZHB 1EQZD 2LY8A 4ZUXA 3X1TB 3AZIC 3WAAC 3AZIA 1PZRA 3WA9B 5B2JC 3AV1A 1M18B 3WAAA 5AV5B 3X1SD 3MVDC 4X23C 4H9NB 1KX4B 3MVDA 4X23A 3WTPB 1U35C 1U35A 1Z2CB 3AZKC 1P3FD 3UTAD 1ZLAD 4EO5C 3AZKA 2BYMA 2AROC 1BH9B 2AROA 2ZY5A 3H0MC 5DNNC 3MGSB 1B6WA 5DNNA 2Y2HA 3MGRD 3X1VD 5CP6A 1P3KD 3W97C 2YFVB 5B32D 1HQ3B 4Z66C 2CWEA 3REHA 3AZJB 1P34C 4Z66A 1P34A 5CPKC 5AV6A 5CPKA 4YM6A 3A6NB 4CAYA 4KHAB 4WV4B 5AVBC 3LELC 5CPJC 5AVBA 4JJND 3UT9D 5JRGC 3LELA 5CPJA 3LZ1D 2JCHA 5BNXB 5JRGA 3MGPA 1KX3B 1P3GD 5B33C 4WU9A 5B33A 3AFAC 3KWQC 3AFAA 3KWQA 5B31C 4J8XC 4XZQD 1P3OC 4J8XA 5B31A 5GXQB 3F6TA 3MNNC 5B2IB 3C1BC 2L5AA 3MNNA 1M19B 3C1BA 4G91B 1P3BD 3MGQB 4G92B 2ZY3A 4KUDB 4E44A 4YS3D 3C1CD 2Y2PA 3A1IA 4J8WB 5GT3D 1WWIA 3AN2C 4LD9D 4HGAC 3X1UC 4E45A 5AV8A 3AZEC 3AN2A 4YS3B 1KX5C 2HUEC 3AZEA 3B6FC 5B32G 4WU8B 1KX5A 3B6FA 3AZGB 3V9RA 4R8PB 3LZ0A 5GT3B 1M1AA 5GSUC 1H3OA 3O62D 2NQBA 5AY8D 3KXBD 3W96D 3VH6T 3LJAB 1P3PB 4H9OB 3O62B 3B0BA 3UTBD 5AVCD 5BS7C 3AZFC 5F99B 3VH5T 3AZFA 2CV5B 5GT0A 3NQJA 3B0DC 4QLCD 3REIB 2Y2IA 4J8VB 1F66B 3W99A 3REJC 1HTAA 3REJA 5B24D 1P3IC 1P3FA 3UTAA 1P3IA 3AYWA 3AZIB 2RVQD 3WAAB 2DQNC 5B2JB 5E5AC 3RELC 2F8ND 2BYKA 3MGRA 2W8SA 3MVDB 4X23B 3RELA 1AOID 3AL0C 1U35B 1TZYD 2FJ7C 4KUDC 3AZND 1P3KA 5DNMC 5BT1C 5B32A 5B1MC 5DNMA 3AZKB 3B0CT 5B1MA 2BYMB 4EO5B 4KGCC 3TU4C 2AROB 3TU4A 3W98C 3W97D 2ZY2A 5DNNB 4WU8C 3W98A 3AZLC 3AZLA 2HIOD 1ID3D 1P3LD 3AZMC 3AZMA 3W97B 4Z5TD 4Z66B 1P34B 1P3MC 1P3MA 5CPKB 3AV2C 4WNNA 2NZDA 4H9SC 4XUJD 1S32C 4H9SA 4XZQA 2Y2JA 5B40C 3AZHD 2RIQA 3X1TD 5AVBB 3LELB 5CPJB 5JRGB 3WA9D 1M18D 5AV5D 4ZUXC 2ZY4A 5B33B 2FFFB 2F8NG 1B67A 1KX4D 3AFAB 3WTPD 3KWQB 4UPKA 3AV1C 4J8XB 5B31B 1P3OB 3WKJC 3WKJA 3MNNB 3C1BB 1T3UA 3KSYA 3X1UD 3MGSD 5JA4A 5AV8B 3AN2B 3EPLA 4HGAB 3X1UB 5BO0A 4NE3A 3AZEB 1HQ3D 3AZJD 1KX5B 2HUEB 3B6FB 5B0ZC 5CP6C 1H3OB 3A1KA 5B0ZA 4QLCA 5GSUB 5CHLB 5KDMA 3REHC 3A6ND 5AV6C 4YM6C 5B1LC 4AWLC 2PYOA 5B1LA 1KX3D 3AZFB 3NQJB 1AOIA 3B0DB 3W99B 3MGPC 5CPIC 3AZNA 3REJB 5GXQD 4WU9C 2UWXA 5B0YC 4WZSB 5CPIA 5B2ID 1JFIB 1P3IB 5B0YA 1M19D 2G5IC 3MGQD 2Y2KA 4KUDD 5BT1D 2BYKB 5E5AB 3RELB 4H9RA 4J8WD 1P3LA 4KGCD 5BNVA 2FJ7B 5DNMB 3REKC 4Z5TA 4WU8D 5B1MB 3REKA 4R8PD 3AZGD 2DF4C 4J8UC 4KGCB 2Y2LA 5AV8C 3TU4B 4J8UA 1P3AA 2YFWA 3KUYC 3W98B 3B6GC 3KUYA 3LZ0C 5AV9C 3AZLB 3B6GA 1M1AC 2NQBC 5AV9A 3LJAD 1P3PD 3AZMB 2F2AC 4DRAA 4DRBA 2JE5A 5F99D 1EQZC 1P3MB 2CV5D 1EQZA 1KX4A 3REID 3AV2B 4J8VD 1F66D 1S32B 3X1SC 1WWSA 4ZUXD 5GT0C 5B40B 3X1SA 3VH6W 2Y2NA 3AZID 3W99C 3WAAD 4WJ3C 5B2JD 1P3FC 3UTAC 1ZLAC 4ZUXB 2JSSA 3MVDD 4X23D 3AYWC 1ZLAA 5G49A 3VH5W 1U35D 3AV1B 3MGRC 3WKJB 3X1VC 3AZKD 1Q9CA 3X1VA 2IO5C 3WTPE 2AROD 1P3KC 5B32C 5DNND 4KHAA 4UUZA 5BO0B 3REHD 4Z66D 1P34D 4NFTA 4JJNC 3UT9C 5CPKD 5B0ZB 5CP6B 3LZ1C 5KDMB 3B0CW 4ZBJC 4JJNA 3UT9A 3REHB 3LZ1A 1P3GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3G A;  5AV6 B;  5B2I A;  2NZD C;  5AVB D;  4M6B A;  3LEL D;  5CPJ D;  4YM6 B;  4XZQ C;  5JRG D;  3MGQ A;  5B1L B;  4CAY B;  4AWL B;  4H9Q A;  5B33 D;  4H9P A;  3AFA D;  1P3B C;  3KWQ D;  4NE5 A;  1P3B A;  4J8X D;  5B31 D;  3C1C C;  3MGP B;  1P3O D;  5CPI B;  3C1C A;  4WU9 B;  4YS3 A;  5B0Y B;  3MNN D;  3C1B D;  3AZG A;  4LD9 C;  4Z2M G;  5GT3 A;  4LD9 A;  4H9R B;  1P3P A;  3NQU A;  5C3I C;  5AY8 C;  3AN2 D;  4H9O A;  4CSR A;  3W96 C;  5BNV B;  5AV8 D;  3O62 A;  5AY8 A;  3KXB C;  3AZE D;  3KXB A;  3W96 A;  1KX5 D;  1BH8 A;  3B6F D;  5F99 A;  3REK B;  2CV5 A;  2NQB D;  4J8U B;  5GSU D;  5AVC C;  4J8V A;  3UTB A;  2F8N H;  4Z2M H;  5AVC A;  3KUY B;  3B6G B;  3V9R B;  3LZ0 B;  5AV9 B;  4QLC C;  5FUG A;  1M1A B;  2NQB B;  5B24 C;  5B2J A;  3AZF D;  1EQZ B;  5B24 A;  5GT0 D;  2RVQ C;  3R45 A;  2PYO C;  3W99 D;  3REJ D;  5B31 G;  3X1S B;  1AOI C;  2F8N A;  1P3I D;  5GT0 B;  3AYW D;  1TZY C;  3AZN C;  1TZY A;  1P3F B;  5E5A D;  3REL D;  3UTA B;  1ZLA B;  5G49 B;  3AYW B;  2FJ7 D;  3W97 A;  1N1J A;  5DNM D;  3MGR B;  5B1M D;  2HIO C;  3X1V B;  1ID3 C;  1P3L C;  1TAF A;  2HIO A;  2IO5 B;  1ID3 A;  3TU4 D;  1P3K B;  4Z5T C;  5B32 B;  3W98 D;  3AZL D;  4UUZ B;  4XUJ C;  1P3A C;  3AZM D;  4XUJ A;  3VH6 A;  3AZH C;  1P3M D;  3X1T C;  3AZH A;  2NZD D;  3X1T A;  4JJN B;  3UT9 B;  3AV2 D;  3LZ1 B;  3WA9 C;  4ZBJ B;  3VH5 A;  1M18 C;  1S32 D;  3WA9 A;  5AV5 C;  1P3O A;  1M18 A;  1P3G B;  5AV5 A;  5B40 D;  1KX4 C;  3WTP C;  4WNN B;  2NZD B;  4H9N A;  3WTP A;  4XZQ B;  4H9Q B;  4H9P B;  1R4V A;  1P3B B;  3MGS C;  1BH9 A;  3AV1 D;  3X1U A;  3C1C B;  3MGS A;  3WKJ D;  1F1E A;  1ULY A;  1A7W A;  4LD9 B;  5GSU A;  1HQ3 C;  3AZJ C;  2YFV A;  1HQ3 A;  3AZJ A;  3NQU B;  4CSR B;  5C3I B;  5AY8 B;  3A6N C;  3KXB B;  3W96 B;  1BH8 B;  3A6N A;  5BS7 A;  5B0Z D;  5CP6 D;  5JA4 B;  3UTB B;  1KU5 A;  5BNX A;  5AVC B;  1KX3 C;  1KX3 A;  5FUG B;  5AV6 D;  1JFI A;  4QLC B;  4YM6 D;  2PYO D;  5B1L D;  5GXQ C;  5B2I C;  5GXQ A;  5B24 B;  5E5A A;  1M19 C;  4G91 C;  1M19 A;  3R45 B;  3MGQ C;  4G92 C;  2PYO B;  3MGP D;  2FJ7 A;  2F8N K;  5CPI D;  4KUD A;  4WU9 D;  2F8N B;  5B0Y D;  1AOI B;  4NE6 A;  4J8W C;  4J8W A;  4KGC A;  1TZY B;  3AZN B;  4YS3 C;  3AZG C;  4R8P C;  4WU8 A;  5GT3 C;  4R8P A;  1BFM A;  1N1J B;  3REK D;  2HIO B;  1TAF B;  3LJA C;  1P3P C;  1P3L B;  3O62 C;  1ID3 B;  3LJA A;  4J8U D;  3AV2 A;  1P3A D;  5F99 C;  4Z5T B;  3KUY D;  1S32 A;  2CV5 C;  3B6G D;  3LZ0 D;  5B40 A;  5AV9 D;  1M1A D;  3REI C;  4J8V C;  4XUJ B;  3UTB C;  3REI A;  1F66 C;  1P3A B;  2YFW B;  1F66 A;  3AZH B;  1EQZ D;  2LY8 A;  4ZUX A;  3X1T B;  3AZI C;  3WAA C;  3AZI A;  3WA9 B;  5B2J C;  3AV1 A;  1M18 B;  3WAA A;  5AV5 B;  3X1S D;  3MVD C;  4X23 C;  4H9N B;  1KX4 B;  3MVD A;  4X23 A;  3WTP B;  1U35 C;  1U35 A;  3AZK C;  1P3F D;  3UTA D;  1ZLA D;  4EO5 C;  3AZK A;  2BYM A;  2ARO C;  1BH9 B;  2ARO A;  5DNN C;  3MGS B;  1B6W A;  5DNN A;  3MGR D;  3X1V D;  5CP6 A;  1P3K D;  3W97 C;  2YFV B;  5B32 D;  1HQ3 B;  4Z66 C;  2CWE A;  3REH A;  3AZJ B;  1P34 C;  4Z66 A;  1P34 A;  5CPK C;  5AV6 A;  5CPK A;  4YM6 A;  3A6N B;  4CAY A;  4KHA B;  4WV4 B;  5AVB C;  3LEL C;  5CPJ C;  5AVB A;  4JJN D;  3UT9 D;  5JRG C;  3LEL A;  5CPJ A;  3LZ1 D;  5BNX B;  5JRG A;  3MGP A;  1KX3 B;  1P3G D;  5B33 C;  4WU9 A;  5B33 A;  3AFA C;  3KWQ C;  3AFA A;  3KWQ A;  5B31 C;  4J8X C;  4XZQ D;  1P3O C;  4J8X A;  5B31 A;  5GXQ B;  3MNN C;  5B2I B;  3C1B C;  2L5A A;  3MNN A;  1M19 B;  3C1B A;  4G91 B;  1P3B D;  3MGQ B;  4G92 B;  4KUD B;  4E44 A;  4YS3 D;  3C1C D;  4J8W B;  5GT3 D;  1WWI A;  3AN2 C;  4LD9 D;  4HGA C;  3X1U C;  4E45 A;  5AV8 A;  3AZE C;  3AN2 A;  4YS3 B;  1KX5 C;  2HUE C;  3AZE A;  3B6F C;  5B32 G;  4WU8 B;  1KX5 A;  3B6F A;  3AZG B;  3V9R A;  4R8P B;  3LZ0 A;  5GT3 B;  1M1A A;  5GSU C;  1H3O A;  3O62 D;  2NQB A;  5AY8 D;  3KXB D;  3W96 D;  3VH6 T;  3LJA B;  1P3P B;  4H9O B;  3O62 B;  3B0B A;  3UTB D;  5AVC D;  5BS7 C;  3AZF C;  5F99 B;  3VH5 T;  3AZF A;  2CV5 B;  5GT0 A;  3NQJ A;  3B0D C;  4QLC D;  3REI B;  4J8V B;  1F66 B;  3W99 A;  3REJ C;  1HTA A;  3REJ A;  5B24 D;  1P3I C;  1P3F A;  3UTA A;  1P3I A;  3AYW A;  3AZI B;  2RVQ D;  3WAA B;  5B2J B;  5E5A C;  3REL C;  2F8N D;  2BYK A;  3MGR A;  3REL A;  3MVD B;  4X23 B;  1AOI D;  1U35 B;  1TZY D;  2FJ7 C;  4KUD C;  3AZN D;  1P3K A;  5DNM C;  5BT1 C;  5B32 A;  5B1M C;  5DNM A;  3AZK B;  3B0C T;  5B1M A;  2BYM B;  4EO5 B;  4KGC C;  3TU4 C;  2ARO B;  3TU4 A;  3W98 C;  3W97 D;  5DNN B;  4WU8 C;  3W98 A;  3AZL C;  3AZL A;  2HIO D;  1ID3 D;  1P3L D;  3AZM C;  3AZM A;  3W97 B;  4Z5T D;  4Z66 B;  1P34 B;  1P3M C;  1P3M A;  5CPK B;  3AV2 C;  4WNN A;  2NZD A;  4H9S C;  4XUJ D;  1S32 C;  4H9S A;  4XZQ A;  5B40 C;  3AZH D;  3X1T D;  5AVB B;  3LEL B;  5CPJ B;  5JRG B;  3WA9 D;  1M18 D;  4ZUX C;  5AV5 D;  5B33 B;  2F8N G;  1B67 A;  1KX4 D;  3AFA B;  3WTP D;  3KWQ B;  3AV1 C;  4J8X B;  5B31 B;  1P3O B;  3WKJ C;  3WKJ A;  3MNN B;  3C1B B;  3KSY A;  3X1U D;  3MGS D;  5JA4 A;  5AV8 B;  3AN2 B;  4HGA B;  3X1U B;  5BO0 A;  4NE3 A;  3AZE B;  1HQ3 D;  3AZJ D;  1KX5 B;  2HUE B;  3B6F B;  5B0Z C;  5CP6 C;  1H3O B;  5B0Z A;  4QLC A;  5GSU B;  5CHL B;  5KDM A;  3REH C;  3A6N D;  5AV6 C;  4YM6 C;  5B1L C;  4AWL C;  2PYO A;  5B1L A;  1KX3 D;  3AZF B;  3NQJ B;  1AOI A;  3B0D B;  3W99 B;  3MGP C;  5CPI C;  3AZN A;  3REJ B;  5GXQ D;  4WU9 C;  5B0Y C;  4WZS B;  5CPI A;  5B2I D;  1JFI B;  1P3I B;  5B0Y A;  1M19 D;  3MGQ D;  4KUD D;  5BT1 D;  2BYK B;  5E5A B;  3REL B;  4H9R A;  4J8W D;  1P3L A;  4KGC D;  5BNV A;  2FJ7 B;  5DNM B;  3REK C;  4Z5T A;  4WU8 D;  5B1M B;  3REK A;  4R8P D;  3AZG D;  4J8U C;  4KGC B;  5AV8 C;  3TU4 B;  4J8U A;  1P3A A;  2YFW A;  3KUY C;  3W98 B;  3B6G C;  3KUY A;  3LZ0 C;  5AV9 C;  3AZL B;  3B6G A;  1M1A C;  2NQB C;  5AV9 A;  3LJA D;  1P3P D;  3AZM B;  4DRA A;  4DRB A;  5F99 D;  1EQZ C;  1P3M B;  2CV5 D;  1EQZ A;  1KX4 A;  3REI D;  3AV2 B;  4J8V D;  1F66 D;  1S32 B;  3X1S C;  1WWS A;  5B40 B;  5GT0 C;  4ZUX D;  3X1S A;  3VH6 W;  3AZI D;  3W99 C;  3WAA D;  5B2J D;  1P3F C;  3UTA C;  1ZLA C;  4ZUX B;  2JSS A;  3MVD D;  4X23 D;  3AYW C;  1ZLA A;  5G49 A;  3VH5 W;  1U35 D;  3AV1 B;  3MGR C;  3WKJ B;  3X1V C;  3AZK D;  1Q9C A;  3X1V A;  2IO5 C;  3WTP E;  2ARO D;  1P3K C;  5B32 C;  5DNN D;  4KHA A;  4UUZ A;  5BO0 B;  3REH D;  4Z66 D;  1P34 D;  4NFT A;  4JJN C;  3UT9 C;  5CPK D;  5B0Z B;  5CP6 B;  3LZ1 C;  5KDM B;  3B0C W;  4ZBJ C;  4JJN A;  3UT9 A;  3REH B;  3LZ1 A;  1P3G C; 
#chains in the Genus database with same CATH topology
 1P3G A;  5AV6 B;  5B2I A;  2NZD C;  5AVB D;  4M6B A;  3LEL D;  5CPJ D;  4YM6 B;  4XZQ C;  5JRG D;  3MGQ A;  5B1L B;  4CAY B;  4AWL B;  4H9Q A;  5B33 D;  4H9P A;  2ZM5 A;  3AFA D;  1P3B C;  3KWQ D;  3H0R C;  4NE5 A;  1P3B A;  4J8X D;  5B31 D;  3C1C C;  3MGP B;  1P3O D;  5CPI B;  3C1C A;  4WU9 B;  4YS3 A;  5B0Y B;  3MNN D;  3C1B D;  3AZG A;  2XD5 A;  4LD9 C;  4Z2M G;  5GT3 A;  4LD9 A;  2BG1 A;  4H9R B;  1P3P A;  3NQU A;  5C3I C;  5AY8 C;  3AN2 D;  4H9O A;  4CSR A;  3W96 C;  5BNV B;  5AV8 D;  3O62 A;  5AY8 A;  3KXB C;  3AZE D;  3KXB A;  3W96 A;  1KX5 D;  1BH8 A;  3B6F D;  2Y2G A;  5F99 A;  3REK B;  2CV5 A;  2NQB D;  4DQY B;  4J8U B;  5GSU D;  5AVC C;  4J8V A;  3UTB A;  2F8N H;  4Z2M H;  5AVC A;  3KUY B;  3B6G B;  3V9R B;  3LZ0 B;  5AV9 B;  4QLC C;  2J8P A;  5FUG A;  1M1A B;  2NQB B;  3FDD A;  5B24 C;  5B2J A;  3AZF D;  1EQZ B;  5B24 A;  5GT0 D;  2RVQ C;  3R45 A;  2PYO C;  3W99 D;  3REJ D;  5B31 G;  2Y2O A;  3X1S B;  1AOI C;  2F8N A;  1P3I D;  5GT0 B;  3AYW D;  1TZY C;  3AZN C;  2XD1 A;  1TZY A;  1P3F B;  5E5A D;  2VQR A;  3REL D;  3UTA B;  1ZLA B;  5G49 B;  3AYW B;  2FJ7 D;  3W97 A;  1N1J A;  5DNM D;  3MGR B;  5B1M D;  2HIO C;  3X1V B;  1ID3 C;  1P3L C;  1TAF A;  2HIO A;  2IO5 B;  1ID3 A;  2Y2Q A;  3EPK A;  3TU4 D;  1P3K B;  4Z5T C;  5B32 B;  3W98 D;  3AZL D;  4UUZ B;  4XUJ C;  1P3A C;  3AZM D;  4XUJ A;  3VH6 A;  3AZH C;  1P3M D;  3X1T C;  3AZH A;  2NZD D;  3X1T A;  4JJN B;  3UT9 B;  3AV2 D;  3EPH A;  3LZ1 B;  3WA9 C;  4ZBJ B;  3VH5 A;  1M18 C;  1S32 D;  3WA9 A;  3KFU G;  5AV5 C;  1P3O A;  1M18 A;  1P3G B;  5AV5 A;  5B40 D;  1KX4 C;  3WTP C;  4WNN B;  2NZD B;  4H9N A;  3WTP A;  4XZQ B;  4H9Q B;  4H9P B;  1R4V A;  1P3B B;  3MGS C;  1BH9 A;  3AV1 D;  3X1U A;  3C1C B;  3MGS A;  3WKJ D;  2Y2M A;  1F1E A;  3IP4 C;  1ULY A;  1A7W A;  4LD9 B;  5GSU A;  1HQ3 C;  3EPJ A;  3AZJ C;  1W2E A;  2YFV A;  1HQ3 A;  3AZJ A;  3NQU B;  4CSR B;  5C3I B;  5AY8 B;  3A6N C;  3KXB B;  3W96 B;  1BH8 B;  3A6N A;  5BS7 A;  5B0Z D;  5CP6 D;  5JA4 B;  3UTB B;  1KU5 A;  5BNX A;  5AVC B;  1KX3 C;  1KX3 A;  5FUG B;  5AV6 D;  1JFI A;  4QLC B;  4YM6 D;  2PYO D;  5B1L D;  5GXQ C;  5B2I C;  5GXQ A;  5B24 B;  3H0L C;  5E5A A;  1M19 C;  4G91 C;  1M19 A;  3R45 B;  3MGQ C;  4G92 C;  2PYO B;  3MGP D;  2FJ7 A;  2F8N K;  5CPI D;  4KUD A;  4WU9 D;  2F8N B;  5B0Y D;  1AOI B;  4NE6 A;  4J8W C;  3P5J B;  4J8W A;  4KGC A;  1TZY B;  3AZN B;  2G5H C;  4YS3 C;  3AZG C;  4R8P C;  4WU8 A;  5GT3 C;  4R8P A;  1BFM A;  1N1J B;  3EG5 B;  3REK D;  2HIO B;  1TAF B;  3LJA C;  1P3P C;  1P3L B;  3O62 C;  1ID3 B;  3LJA A;  4J8U D;  3AV2 A;  1P3A D;  5F99 C;  4Z5T B;  3KUY D;  1S32 A;  2CV5 C;  3B6G D;  3LZ0 D;  5B40 A;  5AV9 D;  1M1A D;  3REI C;  4J8V C;  4XUJ B;  3UTB C;  3REI A;  1F66 C;  1P3A B;  2YFW B;  1F66 A;  3AZH B;  1EQZ D;  2LY8 A;  4ZUX A;  3X1T B;  3AZI C;  3WAA C;  3AZI A;  1PZR A;  3WA9 B;  5B2J C;  3AV1 A;  1M18 B;  3WAA A;  5AV5 B;  3X1S D;  3MVD C;  4X23 C;  4H9N B;  1KX4 B;  3MVD A;  4X23 A;  3WTP B;  1U35 C;  1U35 A;  1Z2C B;  3AZK C;  1P3F D;  3UTA D;  1ZLA D;  4EO5 C;  3AZK A;  2BYM A;  2ARO C;  1BH9 B;  2ARO A;  2ZY5 A;  3H0M C;  5DNN C;  3MGS B;  1B6W A;  5DNN A;  2Y2H A;  3MGR D;  3X1V D;  5CP6 A;  1P3K D;  3W97 C;  2YFV B;  5B32 D;  1HQ3 B;  4Z66 C;  2CWE A;  3REH A;  3AZJ B;  1P34 C;  4Z66 A;  1P34 A;  5CPK C;  5AV6 A;  5CPK A;  4YM6 A;  3A6N B;  4CAY A;  4KHA B;  4WV4 B;  5AVB C;  3LEL C;  5CPJ C;  5AVB A;  4JJN D;  3UT9 D;  5JRG C;  3LEL A;  5CPJ A;  3LZ1 D;  2JCH A;  5BNX B;  5JRG A;  3MGP A;  1KX3 B;  1P3G D;  5B33 C;  4WU9 A;  5B33 A;  3AFA C;  3KWQ C;  3AFA A;  3KWQ A;  5B31 C;  4J8X C;  4XZQ D;  1P3O C;  4J8X A;  5B31 A;  5GXQ B;  3F6T A;  3MNN C;  5B2I B;  3C1B C;  2L5A A;  3MNN A;  1M19 B;  3C1B A;  4G91 B;  1P3B D;  3MGQ B;  4G92 B;  2ZY3 A;  4KUD B;  4E44 A;  4YS3 D;  3C1C D;  2Y2P A;  3A1I A;  4J8W B;  5GT3 D;  1WWI A;  3AN2 C;  4LD9 D;  4HGA C;  3X1U C;  4E45 A;  5AV8 A;  3AZE C;  3AN2 A;  4YS3 B;  1KX5 C;  2HUE C;  3AZE A;  3B6F C;  5B32 G;  4WU8 B;  1KX5 A;  3B6F A;  3AZG B;  3V9R A;  4R8P B;  3LZ0 A;  5GT3 B;  1M1A A;  5GSU C;  1H3O A;  3O62 D;  2NQB A;  5AY8 D;  3KXB D;  3W96 D;  3VH6 T;  3LJA B;  1P3P B;  4H9O B;  3O62 B;  3B0B A;  3UTB D;  5AVC D;  5BS7 C;  3AZF C;  5F99 B;  3VH5 T;  3AZF A;  2CV5 B;  5GT0 A;  3NQJ A;  3B0D C;  4QLC D;  3REI B;  2Y2I A;  4J8V B;  1F66 B;  3W99 A;  3REJ C;  1HTA A;  3REJ A;  5B24 D;  1P3I C;  1P3F A;  3UTA A;  1P3I A;  3AYW A;  3AZI B;  2RVQ D;  3WAA B;  2DQN C;  5B2J B;  5E5A C;  3REL C;  2F8N D;  2BYK A;  3MGR A;  2W8S A;  3MVD B;  4X23 B;  3REL A;  1AOI D;  3AL0 C;  1U35 B;  1TZY D;  2FJ7 C;  4KUD C;  3AZN D;  1P3K A;  5DNM C;  5BT1 C;  5B32 A;  5B1M C;  5DNM A;  3AZK B;  3B0C T;  5B1M A;  2BYM B;  4EO5 B;  4KGC C;  3TU4 C;  2ARO B;  3TU4 A;  3W98 C;  3W97 D;  2ZY2 A;  5DNN B;  4WU8 C;  3W98 A;  3AZL C;  3AZL A;  2HIO D;  1ID3 D;  1P3L D;  3AZM C;  3AZM A;  3W97 B;  4Z5T D;  4Z66 B;  1P34 B;  1P3M C;  1P3M A;  5CPK B;  3AV2 C;  4WNN A;  2NZD A;  4H9S C;  4XUJ D;  1S32 C;  4H9S A;  4XZQ A;  2Y2J A;  5B40 C;  3AZH D;  2RIQ A;  3X1T D;  5AVB B;  3LEL B;  5CPJ B;  5JRG B;  3WA9 D;  1M18 D;  5AV5 D;  4ZUX C;  2ZY4 A;  5B33 B;  2FFF B;  2F8N G;  1B67 A;  1KX4 D;  3AFA B;  3WTP D;  3KWQ B;  4UPK A;  3AV1 C;  4J8X B;  5B31 B;  1P3O B;  3WKJ C;  3WKJ A;  3MNN B;  3C1B B;  1T3U A;  3KSY A;  3X1U D;  3MGS D;  5JA4 A;  5AV8 B;  3AN2 B;  3EPL A;  4HGA B;  3X1U B;  5BO0 A;  4NE3 A;  3AZE B;  1HQ3 D;  3AZJ D;  1KX5 B;  2HUE B;  3B6F B;  5B0Z C;  5CP6 C;  1H3O B;  3A1K A;  5B0Z A;  4QLC A;  5GSU B;  5CHL B;  5KDM A;  3REH C;  3A6N D;  5AV6 C;  4YM6 C;  5B1L C;  4AWL C;  2PYO A;  5B1L A;  1KX3 D;  3AZF B;  3NQJ B;  1AOI A;  3B0D B;  3W99 B;  3MGP C;  5CPI C;  3AZN A;  3REJ B;  5GXQ D;  4WU9 C;  2UWX A;  5B0Y C;  4WZS B;  5CPI A;  5B2I D;  1JFI B;  1P3I B;  5B0Y A;  1M19 D;  2G5I C;  3MGQ D;  2Y2K A;  4KUD D;  5BT1 D;  2BYK B;  5E5A B;  3REL B;  4H9R A;  4J8W D;  1P3L A;  4KGC D;  5BNV A;  2FJ7 B;  5DNM B;  3REK C;  4Z5T A;  4WU8 D;  5B1M B;  3REK A;  4R8P D;  3AZG D;  2DF4 C;  4J8U C;  4KGC B;  2Y2L A;  5AV8 C;  3TU4 B;  4J8U A;  1P3A A;  2YFW A;  3KUY C;  3W98 B;  3B6G C;  3KUY A;  3LZ0 C;  5AV9 C;  3AZL B;  3B6G A;  1M1A C;  2NQB C;  5AV9 A;  3LJA D;  1P3P D;  3AZM B;  2F2A C;  4DRA A;  4DRB A;  2JE5 A;  5F99 D;  1EQZ C;  1P3M B;  2CV5 D;  1EQZ A;  1KX4 A;  3REI D;  3AV2 B;  4J8V D;  1F66 D;  1S32 B;  3X1S C;  1WWS A;  4ZUX D;  5GT0 C;  5B40 B;  3X1S A;  3VH6 W;  2Y2N A;  3AZI D;  3W99 C;  3WAA D;  4WJ3 C;  5B2J D;  1P3F C;  3UTA C;  1ZLA C;  4ZUX B;  2JSS A;  3MVD D;  4X23 D;  3AYW C;  1ZLA A;  5G49 A;  3VH5 W;  1U35 D;  3AV1 B;  3MGR C;  3WKJ B;  3X1V C;  3AZK D;  1Q9C A;  3X1V A;  2IO5 C;  3WTP E;  2ARO D;  1P3K C;  5B32 C;  5DNN D;  4KHA A;  4UUZ A;  5BO0 B;  3REH D;  4Z66 D;  1P34 D;  4NFT A;  4JJN C;  3UT9 C;  5CPK D;  5B0Z B;  5CP6 B;  3LZ1 C;  5KDM B;  3B0C W;  4ZBJ C;  4JJN A;  3UT9 A;  3REH B;  3LZ1 A;  1P3G C; 
#chains in the Genus database with same CATH homology
 1P3G A;  5AV6 B;  5B2I A;  2NZD C;  5AVB D;  4M6B A;  3LEL D;  5CPJ D;  4YM6 B;  4XZQ C;  5JRG D;  3MGQ A;  5B1L B;  4CAY B;  4AWL B;  4H9Q A;  5B33 D;  4H9P A;  2ZM5 A;  3AFA D;  1P3B C;  3KWQ D;  3H0R C;  4NE5 A;  1P3B A;  4J8X D;  5B31 D;  3C1C C;  3MGP B;  1P3O D;  5CPI B;  3C1C A;  4WU9 B;  4YS3 A;  5B0Y B;  3MNN D;  3C1B D;  3AZG A;  2XD5 A;  4LD9 C;  4Z2M G;  5GT3 A;  4LD9 A;  2BG1 A;  4H9R B;  1P3P A;  3NQU A;  5C3I C;  5AY8 C;  3AN2 D;  4H9O A;  4CSR A;  3W96 C;  5BNV B;  5AV8 D;  3O62 A;  5AY8 A;  3KXB C;  3AZE D;  3KXB A;  3W96 A;  1KX5 D;  1BH8 A;  3B6F D;  2Y2G A;  5F99 A;  3REK B;  2CV5 A;  2NQB D;  4DQY B;  4J8U B;  5GSU D;  5AVC C;  4J8V A;  3UTB A;  2F8N H;  4Z2M H;  5AVC A;  3KUY B;  3B6G B;  3V9R B;  3LZ0 B;  5AV9 B;  4QLC C;  2J8P A;  5FUG A;  1M1A B;  2NQB B;  3FDD A;  5B24 C;  5B2J A;  3AZF D;  1EQZ B;  5B24 A;  5GT0 D;  2RVQ C;  3R45 A;  2PYO C;  3W99 D;  3REJ D;  5B31 G;  2Y2O A;  3X1S B;  1AOI C;  2F8N A;  1P3I D;  5GT0 B;  3AYW D;  1TZY C;  3AZN C;  2XD1 A;  1TZY A;  1P3F B;  5E5A D;  2VQR A;  3REL D;  3UTA B;  1ZLA B;  5G49 B;  3AYW B;  2FJ7 D;  3W97 A;  1N1J A;  5DNM D;  3MGR B;  5B1M D;  2HIO C;  3X1V B;  1ID3 C;  1P3L C;  1TAF A;  2HIO A;  2IO5 B;  1ID3 A;  2Y2Q A;  3EPK A;  3TU4 D;  1P3K B;  4Z5T C;  5B32 B;  3W98 D;  3AZL D;  4UUZ B;  4XUJ C;  1P3A C;  3AZM D;  4XUJ A;  3VH6 A;  3AZH C;  1P3M D;  3X1T C;  3AZH A;  2NZD D;  3X1T A;  4JJN B;  3UT9 B;  3AV2 D;  3EPH A;  3LZ1 B;  3WA9 C;  4ZBJ B;  3VH5 A;  1M18 C;  1S32 D;  3WA9 A;  3KFU G;  5AV5 C;  1P3O A;  1M18 A;  1P3G B;  5AV5 A;  5B40 D;  1KX4 C;  3WTP C;  4WNN B;  2NZD B;  4H9N A;  3WTP A;  4XZQ B;  4H9Q B;  4H9P B;  1R4V A;  1P3B B;  3MGS C;  1BH9 A;  3AV1 D;  3X1U A;  3C1C B;  3MGS A;  3WKJ D;  2Y2M A;  1F1E A;  3IP4 C;  1ULY A;  1A7W A;  4LD9 B;  5GSU A;  1HQ3 C;  3EPJ A;  3AZJ C;  1W2E A;  2YFV A;  1HQ3 A;  3AZJ A;  3NQU B;  4CSR B;  5C3I B;  5AY8 B;  3A6N C;  3KXB B;  3W96 B;  1BH8 B;  3A6N A;  5BS7 A;  5B0Z D;  5CP6 D;  5JA4 B;  3UTB B;  1KU5 A;  5BNX A;  5AVC B;  1KX3 C;  1KX3 A;  5FUG B;  5AV6 D;  1JFI A;  4QLC B;  4YM6 D;  2PYO D;  5B1L D;  5GXQ C;  5B2I C;  5GXQ A;  5B24 B;  3H0L C;  5E5A A;  1M19 C;  4G91 C;  1M19 A;  3R45 B;  3MGQ C;  4G92 C;  2PYO B;  3MGP D;  2FJ7 A;  2F8N K;  5CPI D;  4KUD A;  4WU9 D;  2F8N B;  5B0Y D;  1AOI B;  4NE6 A;  4J8W C;  3P5J B;  4J8W A;  4KGC A;  1TZY B;  3AZN B;  2G5H C;  4YS3 C;  3AZG C;  4R8P C;  4WU8 A;  5GT3 C;  4R8P A;  1BFM A;  1N1J B;  3EG5 B;  3REK D;  2HIO B;  1TAF B;  3LJA C;  1P3P C;  1P3L B;  3O62 C;  1ID3 B;  3LJA A;  4J8U D;  3AV2 A;  1P3A D;  5F99 C;  4Z5T B;  3KUY D;  1S32 A;  2CV5 C;  3B6G D;  3LZ0 D;  5B40 A;  5AV9 D;  1M1A D;  3REI C;  4J8V C;  4XUJ B;  3UTB C;  3REI A;  1F66 C;  1P3A B;  2YFW B;  1F66 A;  3AZH B;  1EQZ D;  2LY8 A;  4ZUX A;  3X1T B;  3AZI C;  3WAA C;  3AZI A;  1PZR A;  3WA9 B;  5B2J C;  3AV1 A;  1M18 B;  3WAA A;  5AV5 B;  3X1S D;  3MVD C;  4X23 C;  4H9N B;  1KX4 B;  3MVD A;  4X23 A;  3WTP B;  1U35 C;  1U35 A;  1Z2C B;  3AZK C;  1P3F D;  3UTA D;  1ZLA D;  4EO5 C;  3AZK A;  2BYM A;  2ARO C;  1BH9 B;  2ARO A;  2ZY5 A;  3H0M C;  5DNN C;  3MGS B;  1B6W A;  5DNN A;  2Y2H A;  3MGR D;  3X1V D;  5CP6 A;  1P3K D;  3W97 C;  2YFV B;  5B32 D;  1HQ3 B;  4Z66 C;  2CWE A;  3REH A;  3AZJ B;  1P34 C;  4Z66 A;  1P34 A;  5CPK C;  5AV6 A;  5CPK A;  4YM6 A;  3A6N B;  4CAY A;  4KHA B;  4WV4 B;  5AVB C;  3LEL C;  5CPJ C;  5AVB A;  4JJN D;  3UT9 D;  5JRG C;  3LEL A;  5CPJ A;  3LZ1 D;  2JCH A;  5BNX B;  5JRG A;  3MGP A;  1KX3 B;  1P3G D;  5B33 C;  4WU9 A;  5B33 A;  3AFA C;  3KWQ C;  3AFA A;  3KWQ A;  5B31 C;  4J8X C;  4XZQ D;  1P3O C;  4J8X A;  5B31 A;  5GXQ B;  3F6T A;  3MNN C;  5B2I B;  3C1B C;  2L5A A;  3MNN A;  1M19 B;  3C1B A;  4G91 B;  1P3B D;  3MGQ B;  4G92 B;  2ZY3 A;  4KUD B;  4E44 A;  4YS3 D;  3C1C D;  2Y2P A;  3A1I A;  4J8W B;  5GT3 D;  1WWI A;  3AN2 C;  4LD9 D;  4HGA C;  3X1U C;  4E45 A;  5AV8 A;  3AZE C;  3AN2 A;  4YS3 B;  1KX5 C;  2HUE C;  3AZE A;  3B6F C;  5B32 G;  4WU8 B;  1KX5 A;  3B6F A;  3AZG B;  3V9R A;  4R8P B;  3LZ0 A;  5GT3 B;  1M1A A;  5GSU C;  1H3O A;  3O62 D;  2NQB A;  5AY8 D;  3KXB D;  3W96 D;  3VH6 T;  3LJA B;  1P3P B;  4H9O B;  3O62 B;  3B0B A;  3UTB D;  5AVC D;  5BS7 C;  3AZF C;  5F99 B;  3VH5 T;  3AZF A;  2CV5 B;  5GT0 A;  3NQJ A;  3B0D C;  4QLC D;  3REI B;  2Y2I A;  4J8V B;  1F66 B;  3W99 A;  3REJ C;  1HTA A;  3REJ A;  5B24 D;  1P3I C;  1P3F A;  3UTA A;  1P3I A;  3AYW A;  3AZI B;  2RVQ D;  3WAA B;  2DQN C;  5B2J B;  5E5A C;  3REL C;  2F8N D;  2BYK A;  3MGR A;  2W8S A;  3MVD B;  4X23 B;  3REL A;  1AOI D;  3AL0 C;  1U35 B;  1TZY D;  2FJ7 C;  4KUD C;  3AZN D;  1P3K A;  5DNM C;  5BT1 C;  5B32 A;  5B1M C;  5DNM A;  3AZK B;  3B0C T;  5B1M A;  2BYM B;  4EO5 B;  4KGC C;  3TU4 C;  2ARO B;  3TU4 A;  3W98 C;  3W97 D;  2ZY2 A;  5DNN B;  4WU8 C;  3W98 A;  3AZL C;  3AZL A;  2HIO D;  1ID3 D;  1P3L D;  3AZM C;  3AZM A;  3W97 B;  4Z5T D;  4Z66 B;  1P34 B;  1P3M C;  1P3M A;  5CPK B;  3AV2 C;  4WNN A;  2NZD A;  4H9S C;  4XUJ D;  1S32 C;  4H9S A;  4XZQ A;  2Y2J A;  5B40 C;  3AZH D;  2RIQ A;  3X1T D;  5AVB B;  3LEL B;  5CPJ B;  5JRG B;  3WA9 D;  1M18 D;  5AV5 D;  4ZUX C;  2ZY4 A;  5B33 B;  2FFF B;  2F8N G;  1B67 A;  1KX4 D;  3AFA B;  3WTP D;  3KWQ B;  4UPK A;  3AV1 C;  4J8X B;  5B31 B;  1P3O B;  3WKJ C;  3WKJ A;  3MNN B;  3C1B B;  1T3U A;  3KSY A;  3X1U D;  3MGS D;  5JA4 A;  5AV8 B;  3AN2 B;  3EPL A;  4HGA B;  3X1U B;  5BO0 A;  4NE3 A;  3AZE B;  1HQ3 D;  3AZJ D;  1KX5 B;  2HUE B;  3B6F B;  5B0Z C;  5CP6 C;  1H3O B;  3A1K A;  5B0Z A;  4QLC A;  5GSU B;  5CHL B;  5KDM A;  3REH C;  3A6N D;  5AV6 C;  4YM6 C;  5B1L C;  4AWL C;  2PYO A;  5B1L A;  1KX3 D;  3AZF B;  3NQJ B;  1AOI A;  3B0D B;  3W99 B;  3MGP C;  5CPI C;  3AZN A;  3REJ B;  5GXQ D;  4WU9 C;  2UWX A;  5B0Y C;  4WZS B;  5CPI A;  5B2I D;  1JFI B;  1P3I B;  5B0Y A;  1M19 D;  2G5I C;  3MGQ D;  2Y2K A;  4KUD D;  5BT1 D;  2BYK B;  5E5A B;  3REL B;  4H9R A;  4J8W D;  1P3L A;  4KGC D;  5BNV A;  2FJ7 B;  5DNM B;  3REK C;  4Z5T A;  4WU8 D;  5B1M B;  3REK A;  4R8P D;  3AZG D;  2DF4 C;  4J8U C;  4KGC B;  2Y2L A;  5AV8 C;  3TU4 B;  4J8U A;  1P3A A;  2YFW A;  3KUY C;  3W98 B;  3B6G C;  3KUY A;  3LZ0 C;  5AV9 C;  3AZL B;  3B6G A;  1M1A C;  2NQB C;  5AV9 A;  3LJA D;  1P3P D;  3AZM B;  2F2A C;  4DRA A;  4DRB A;  2JE5 A;  5F99 D;  1EQZ C;  1P3M B;  2CV5 D;  1EQZ A;  1KX4 A;  3REI D;  3AV2 B;  4J8V D;  1F66 D;  1S32 B;  3X1S C;  1WWS A;  4ZUX D;  5GT0 C;  5B40 B;  3X1S A;  3VH6 W;  2Y2N A;  3AZI D;  3W99 C;  3WAA D;  4WJ3 C;  5B2J D;  1P3F C;  3UTA C;  1ZLA C;  4ZUX B;  2JSS A;  3MVD D;  4X23 D;  3AYW C;  1ZLA A;  5G49 A;  3VH5 W;  1U35 D;  3AV1 B;  3MGR C;  3WKJ B;  3X1V C;  3AZK D;  1Q9C A;  3X1V A;  2IO5 C;  3WTP E;  2ARO D;  1P3K C;  5B32 C;  5DNN D;  4KHA A;  4UUZ A;  5BO0 B;  3REH D;  4Z66 D;  1P34 D;  4NFT A;  4JJN C;  3UT9 C;  5CPK D;  5B0Z B;  5CP6 B;  3LZ1 C;  5KDM B;  3B0C W;  4ZBJ C;  4JJN A;  3UT9 A;  3REH B;  3LZ1 A;  1P3G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...