1M19D

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
94
structure length
94
Chain Sequence
b'TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146 Base Pair DNA Fragment
molecule tags Structural protein/dna
source organism Xenopus laevis
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
total genus 34
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m19D00
4HGAC 4J8UB 5CPJB 1H3OA 4KGCA 2BYMB 4J8XC 3AZNA 5CP6B 1M18A 3C1BB 3VH6A 4CSRA 5B24A 3UTBD 2AROA 5B1MD 3AZHC 5C3IC 4ZUXC 3WKJB 4LD9B 1KX3A 5GT3C 5E5AB 1TAFB 5F99A 1EQZC 5BS7C 2HIOA 1P3FA 1BH9B 1P3KB 2FJ7A 1ID3A 2IO5C 4YS3D 3A6NC 1A7WA 1TZYC 5AVBD 4YM6A 3R45B 3WA9B 3KWQC 3TU4A 4Z66A 5F99C 5B2IB 5B2JB 4HGAB 3REHD 2YFVA 3V9RA 5AVBB 5GT0C 4XZQC 5AV6C 1P3AA 3AZID 3MVDA 1F66B 5B24C 1F1EA 1P3IC 1KX4D 3LELB 3VH6W 4XUJB 1ZLAC 5B0ZD 5B40C 3B6FC 3AFAC 4H9NA 3REIA 1P3LD 3AZHB 2JSSA 5B2IC 3B0CW 1EQZB 1P3OC 3WAAA 3X1UC 4Z2MH 5AV5A 5E5AC 4H9PB 4UUZA 2L5AA 3AV1D 4NE3A 1ZLAA 3LZ0C 4QLCA 1P3KC 3W97B 3KUYC 5B2ID 3AZKC 4J8VC 5B40D 4NFTA 3B6FD 5CPKA 2NQBD 5B0ZC 3AZEC 3WTPE 2NZDC 1KX4C 3X1UD 3NQUA 3AZED 3W99A 5JRGA 4Z5TA 1B67A 3MGRA 4G92B 3LZ0B 4YS3B 3WTPA 5B33A 3O62A 1P3ID 1JFIB 4R8PA 5GSUD 2F8NA 5GT0D 3AN2D 4WU8B 5G49A 3W98A 5JA4B 1P34D 3REKD 5CPJC 1P3IB 3AV2B 4KGCD 2NQBB 1M18D 5AV9D 3KUYB 3AZLD 5BNXB 5B1MC 2AROD 5B1MA 3AZHD 1KX5A 5GT3B 3X1SB 4DRBA 1EQZD 3VH5T 1P3BA 5AV6A 4KHAB 4WU9B 3MGPA 3MGPC 3AZFA 5AVCA 1P3AC 3WKJD 5AY8C 3UTAB 5DNNA 2YFWB 3MGSB 3AN2B 5B32D 3AYWC 4J8UC 5C3IB 5FUGA 4J8XD 3X1TA 1AOIC 1AOIA 2PYOC 3X1SC 4J8UA 5CPJA 1H3OB 4KGCB 2BYMA 3AZNB 4X23A 1S32A 1M18B 3KXBB 5B2JD 3LZ1A 3LZ1C 3C1BA 5BT1D 3C1BC 4CSRB 5B24B 3RELA 2CV5D 1KX3C 3UTBC 3WA9C 1Q9CA 3LJAD 3REKC 5GSUB 1TAFA 5F99B 3B6GD 4H9SA 4E44A 5JRGC 1P34B 2CV5B 1P3FB 1P3KA 2FJ7B 3B0DC 5DNNC 4JJND 3LJAB 3MGSC 3R45A 2F8NK 3WA9A 3LELC 1HQ3C 3REJD 5CP6D 5B2IA 3W97D 1ID3D 3V9RB 3B0CT 5CPKD 5AVBA 4WU9D 3AZKD 3MVDB 1F66A 5GXQD 3LELA 3REHA 5B33C 3AZMA 1P3OB 3WTPD 1M1AC 3AZJA 3KSYA 1P3PC 3AZMC 3MVDD 4R8PD 5AV5B 4KUDD 5GT0A 4H9PA 1BFMA 4NE5A 1ZLAB 5KDMA 1U35B 4WU8D 3REID 3AFAB 4J8VA 4AWLC 5B24D 3MNNA 3MGQC 1P3PA 2NZDA 4G92C 5F99D 3X1VC 2F8NH 5AV5C 2F8NG 3NQUB 1P3FC 3AZGD 5B1LC 5AV8D 3NQJB 3KWQD 2HIOD 5DNMA 5DNMC 3LZ0A 3UTBB 4YS3A 5B40A 3WTPB 3B6FA 3AZFD 3MVDC 5B33B 1HQ3A 1M19D 3X1UA 4R8PB 3UTAD 3W99D 3W98B 1B6WA 1P3BC 1U35D 3X1TD 4J8XA 5B32B 3O62D 1TZYA 4X23C 1P3IA 3AV2A 5BO0A 4CAYA 5B32G 5B0YC 3W96D 3W98D 3KUYA 5CPID 4XZQB 2LY8A 5GT3A 3WAAD 1P3BB 5AV6B 4ZUXA 3MGPB 3AZFB 5AY8A 3AZIB 1F66C 1S32C 4J8WC 3W96B 5B0YA 5B1LB 5DNNB 3B6GB 4XUJD 3AYWA 4QLCD 5BNVB 3MGSA 3REKB 5BS7A 5B31A 2FJ7D 5FUGB 3WA9D 3X1TB 3MGRC 3AZNC 1R4VA 4H9SC 4J8WD 3KXBC 5BT1C 4LD9D 3C1CD 3REJB 1U35C 1P3MD 4X23B 4Z66D 1S32B 4Z5TD 3KXBA 3LZ1B 3RELB 1BH8B 5CPIC 2PYOD 4YM6D 1KX5C 5B31C 4WV4B 3C1CB 1M1AB 5GSUA 3A6NA 3UT9C 3X1VA 4Z2MG 3AZJD 5B1LD 1P34A 2CV5A 3LJAA 3AZKB 5GXQB 3O62C 4KUDB 1KX4A 1ULYA 3MGQD 3AV1A 3X1TC 5B0ZA 4H9RA 3AZLC 5AVCC 3AZLA 1P3GC 4WU8C 4H9QB 3AV2C 4JJNA 1P3LB 2CWEA 1M19C 5AVCD 3MGQB 3AZGA 3TU4C 1M1AD 5AV9B 5DNMD 3REHB 3AZMB 1P3OA 5AV8B 3AZEA 1P3FD 3AZJB 5B31G 3VH5A 4WNNB 1P3GD 2BYKB 4WU9C 4J8WB 3UT9D 5GT0B 1M19B 3TU4D 1P3MB 3W97C 3AZMD 3KWQB 5KDMB 1U35A 3RELD 5CHLB 3AFAA 4J8VB 3WTPC 1WWSA 3MNNB 2PYOB 1P3GB 1P3PB 4Z5TC 4KUDC 2NZDB 3UT9B 4R8PC 4JJNC 2F8ND 4G91C 3AZND 3NQJA 4H9OB 5CPIB 5DNMB 3UTBA 1N1JA 5B40B 3B6FB 1HQ3B 4M6BA 3C1CC 3AZJC 1KX3D 3X1UB 2CV5C 3MGSD 1ZLAD 5CP6A 1ID3C 2FJ7C 1KX5D 4YM6C 4J8XB 4QLCC 4XUJC 5B32A 2AROB 1HQ3D 2RVQD 2RVQC 3B0DB 5AV6D 3REJC 3X1SD 3B6GC 3WKJA 4LD9A 1TZYB 1KX3B 1AOID 1F66D 5BO0B 1P3MC 5E5AA 4CAYB 4J8UD 1KU5A 3WAAC 4X23D 2HIOB 4XZQA 1BH9A 1HTAA 1ID3B 3W96C 4YM6B 4YS3C 4ZUXB 3A6ND 1P3AD 3WKJC 5AY8B 3UTAC 3AZIA 3VH5W 3TU4B 3W96A 5B0YB 5B1LA 4Z66B 1S32D 3B6GA 5B2JA 3LZ1D 3AYWB 4DRAA 5BNVA 2YFVB 3REKA 5B31B 3B0BA 2HIOC 4ZUXD 1P3AB 1WWIA 5AY8D 5AV5D 3W98C 5B0YD 3RELC 3REJA 4XUJA 5B32C 4ZBJC 3AYWD 4H9NB 3REIB 2AROC 3AZHA 1BH8A 3AZGC 1EQZA 3VH6T 3WAAB 4NE6A 1P3BD 5AV9C 3MGPD 3C1CA 3W99C 1M1AA 4UUZB 4KGCC 2IO5B 3A6NB 2HUEB 3X1VB 4QLCB 3W97A 3AZFC 1M18C 3AN2C 3AZKA 5CPKB 5B33D 3AV2D 5AV8C 5GSUC 5GXQA 4KUDA 1KX4B 3X1VD 5CPJD 4EO5C 3AV1B 5B0ZB 4H9RB 3KUYD 3AZLB 3W99B 5JRGB 1P34C 4Z5TB 4H9QA 3MGRB 4WZSB 4JJNB 1P3LA 4G91B 3REIC 5GXQC 3O62B 1JFIA 3MNNC 4ZBJB 3MGQA 3AZGB 2F8NB 2NQBC 4E45A 5AV9A 4WU8A 5G49B 4J8VD 5JA4A 5AV8A 3AZEB 3MNND 1P3PD 1P3KD 5B31D 2NZDD 4WNNA 2BYKA 4J8WA 2NQBA 1M19A 4Z66C 1P3MA 4AWLB 1P3OD 3REHC 5DNND 3KWQA 3KXBD 4LD9C 5BNXA 5B1MB 3LZ0D 1KX5B 5JRGD 3X1SA 2PYOA 5CPKC 3MGRD 4EO5B 3AV1C 1P3GA 4KHAA 4WU9A 5E5AD 5AVCB 1TZYD 2HUEC 5AVBC 3UT9A 5CP6C 3LJAC 3UTAA 3AZIC 3LELD 4XZQD 2YFWA 1P3LC 3AFAD 3AN2A 4H9OA 5CPIA 5B2JC 3C1BD 1N1JB 5GT3D 1AOIB
chains in the Genus database with same CATH superfamily
4HGAC 4J8UB 5CPJB 1H3OA 4KGCA 2BYMB 4J8XC 3AZNA 5CP6B 1M18A 3C1BB 3VH6A 4CSRA 5B24A 3UTBD 2AROA 5B1MD 3AZHC 5C3IC 4ZUXC 3WKJB 4LD9B 1KX3A 5GT3C 5E5AB 1TAFB 5F99A 1EQZC 5BS7C 2HIOA 1P3FA 1BH9B 2UWXA 1P3KB 2FJ7A 1ID3A 2IO5C 4YS3D 3A6NC 1A7WA 1TZYC 5AVBD 4YM6A 3R45B 3WA9B 3KWQC 3TU4A 4Z66A 5F99C 5B2IB 5B2JB 4HGAB 3REHD 2YFVA 2Y2KA 2JCHA 3V9RA 5AVBB 2Y2PA 5GT0C 3P5JB 4XZQC 5AV6C 1P3AA 3AZID 3MVDA 1F66B 5B24C 1F1EA 1P3IC 2G5HC 1KX4D 3LELB 3VH6W 4XUJB 2Y2LA 1ZLAC 5B0ZD 5B40C 3B6FC 3AFAC 4H9NA 3REIA 1P3LD 3AZHB 2JSSA 5B2IC 3B0CW 1Z2CB 1P3OC 1EQZB 3WAAA 3X1UC 4Z2MH 5AV5A 5E5AC 2XD5A 4H9PB 4UUZA 2L5AA 3AV1D 4NE3A 1ZLAA 2Y2GA 3LZ0C 4QLCA 1P3KC 3W97B 3KUYC 5B2ID 2JE5A 3AZKC 4J8VC 5B40D 4NFTA 3B6FD 5CPKA 2NQBD 5B0ZC 3A1KA 3AZEC 3WTPE 2NZDC 1KX4C 3X1UD 3NQUA 3AZED 3W99A 5JRGA 4Z5TA 1B67A 3MGRA 4G92B 3LZ0B 2DF4C 4YS3B 3WTPA 5B33A 3EPKA 3O62A 1P3ID 2ZM5A 1JFIB 4R8PA 5GSUD 2Y2IA 2F8NA 5GT0D 3AN2D 4WU8B 5G49A 3W98A 5JA4B 1P34D 3REKD 5CPJC 3EG5B 1P3IB 3AV2B 4KGCD 2NQBB 1M18D 5AV9D 3KUYB 3AZLD 5BNXB 5B1MC 2AROD 5B1MA 3AZHD 1KX5A 5GT3B 3X1SB 4DRBA 1EQZD 3VH5T 1P3BA 5AV6A 4KHAB 4WU9B 3MGPA 3MGPC 3AZFA 5AVCA 1P3AC 3WKJD 5AY8C 3UTAB 5DNNA 2BG1A 2YFWB 3MGSB 3AN2B 5B32D 3AYWC 4J8UC 5C3IB 3H0MC 5FUGA 4J8XD 3X1TA 1AOIC 1AOIA 2PYOC 3X1SC 4J8UA 5CPJA 1H3OB 4KGCB 2BYMA 3AZNB 4X23A 1S32A 1M18B 3KXBB 5B2JD 3LZ1A 3LZ1C 3C1BA 5BT1D 3C1BC 4CSRB 5B24B 3RELA 2CV5D 1KX3C 3UTBC 3WA9C 1Q9CA 3LJAD 3REKC 5GSUB 1TAFA 5F99B 3B6GD 4H9SA 4E44A 5JRGC 1P34B 2CV5B 2VQRA 1P3FB 1P3KA 2FJ7B 3B0DC 5DNNC 4JJND 3LJAB 3MGSC 3R45A 2F8NK 3WA9A 3LELC 1HQ3C 3REJD 5CP6D 5B2IA 2Y2HA 3W97D 1ID3D 3V9RB 3B0CT 5CPKD 5AVBA 4WU9D 3AZKD 3MVDB 1F66A 2W8SA 5GXQD 3H0RC 3LELA 3REHA 5B33C 3AZMA 1P3OB 3WTPD 1M1AC 3AZJA 2RIQA 3KSYA 1P3PC 3AZMC 3MVDD 4R8PD 5AV5B 4KUDD 5GT0A 4H9PA 1BFMA 4NE5A 1ZLAB 5KDMA 1U35B 4WU8D 3REID 3AFAB 4J8VA 4AWLC 5B24D 3MNNA 3MGQC 1P3PA 3AL0C 2NZDA 4G92C 5F99D 3X1VC 2F8NH 5AV5C 2F8NG 3NQUB 1P3FC 3AZGD 5B1LC 5AV8D 3NQJB 3KWQD 2HIOD 5DNMA 5DNMC 3LZ0A 3UTBB 4YS3A 5B40A 3WTPB 3B6FA 3AZFD 1T3UA 2Y2NA 5B33B 3MVDC 1HQ3A 1M19D 3X1UA 4R8PB 2Y2MA 3UTAD 3W99D 3W98B 1B6WA 1P3BC 1U35D 2Y2OA 3X1TD 4J8XA 5B32B 3O62D 1TZYA 4X23C 1P3IA 3AV2A 2Y2JA 5BO0A 4CAYA 5B32G 4UPKA 5B0YC 3W96D 3W98D 3KUYA 5CPID 4XZQB 2LY8A 5GT3A 2ZY3A 3WAAD 1P3BB 5AV6B 4ZUXA 3MGPB 3AZFB 5AY8A 3AZIB 1F66C 1S32C 4J8WC 3W96B 5B0YA 5B1LB 5DNNB 3B6GB 4XUJD 3AYWA 4QLCD 5BNVB 3MGSA 3REKB 5BS7A 5B31A 2FJ7D 5FUGB 3WA9D 3X1TB 3MGRC 3AZNC 1R4VA 4H9SC 4J8WD 3KXBC 5BT1C 4LD9D 3C1CD 3REJB 1U35C 1P3MD 4X23B 4Z66D 1S32B 4Z5TD 3KXBA 3LZ1B 3RELB 2F2AC 1BH8B 5CPIC 2PYOD 4YM6D 1KX5C 5B31C 4WV4B 3C1CB 1M1AB 5GSUA 3A6NA 3UT9C 3X1VA 4Z2MG 3AZJD 5B1LD 1P34A 2CV5A 2J8PA 2ZY2A 3LJAA 3AZKB 5GXQB 3O62C 4KUDB 1KX4A 1ULYA 3MGQD 3AV1A 2XD1A 5B0ZA 4H9RA 3AZLC 5AVCC 3AZLA 3X1TC 1P3GC 4WU8C 4H9QB 3AV2C 4JJNA 1P3LB 2CWEA 1M19C 3A1IA 5AVCD 3MGQB 3AZGA 3TU4C 1M1AD 5AV9B 5DNMD 3REHB 3AZMB 1P3OA 5AV8B 3AZEA 1P3FD 3AZJB 5B31G 3VH5A 4WNNB 1P3GD 2BYKB 4WU9C 4J8WB 3UT9D 5GT0B 1M19B 3TU4D 3KFUG 1P3MB 3W97C 3AZMD 3KWQB 5KDMB 1U35A 3RELD 5CHLB 3AFAA 4J8VB 3WTPC 1WWSA 1PZRA 3MNNB 2PYOB 1P3GB 1P3PB 3EPLA 4Z5TC 4KUDC 2NZDB 3UT9B 4R8PC 4JJNC 2ZY5A 2F8ND 4G91C 3AZND 3NQJA 4H9OB 5CPIB 2Y2QA 5DNMB 3UTBA 1N1JA 5B40B 3B6FB 1HQ3B 4M6BA 3C1CC 3AZJC 1KX3D 3X1UB 2CV5C 3MGSD 1ZLAD 5CP6A 1ID3C 2FJ7C 1KX5D 4YM6C 4J8XB 4QLCC 4XUJC 5B32A 2AROB 1HQ3D 2RVQD 2RVQC 3B0DB 5AV6D 3REJC 2DQNC 3X1SD 3B6GC 3WKJA 1TZYB 4LD9A 1KX3B 1AOID 1F66D 5BO0B 1P3MC 3FDDA 5E5AA 4CAYB 4J8UD 4DQYB 1KU5A 2G5IC 3WAAC 4X23D 2HIOB 4XZQA 1BH9A 1HTAA 1ID3B 3W96C 4YM6B 4YS3C 4ZUXB 3A6ND 1P3AD 3WKJC 5AY8B 3UTAC 3IP4C 3VH5W 3AZIA 3TU4B 3W96A 5B0YB 5B1LA 4Z66B 1S32D 3B6GA 5B2JA 3LZ1D 3AYWB 4DRAA 5BNVA 2YFVB 3REKA 2FFFB 5B31B 3B0BA 2HIOC 4ZUXD 1P3AB 1WWIA 5AY8D 5AV5D 3W98C 5B0YD 3RELC 3REJA 4XUJA 5B32C 4ZBJC 3AYWD 4H9NB 3REIB 2AROC 3AZHA 1W2EA 1BH8A 3AZGC 1EQZA 3VH6T 3WAAB 4NE6A 1P3BD 5AV9C 3MGPD 3C1CA 3W99C 1M1AA 4UUZB 4KGCC 2IO5B 3A6NB 2HUEB 3X1VB 2ZY4A 4QLCB 3W97A 3AZFC 1M18C 3AN2C 3AZKA 5CPKB 5B33D 3AV2D 5AV8C 5GSUC 4WJ3C 5GXQA 4KUDA 1KX4B 3X1VD 3F6TA 5CPJD 4EO5C 3H0LC 5B0ZB 4H9RB 3KUYD 3AZLB 3AV1B 5JRGB 1P34C 4Z5TB 3W99B 4H9QA 3MGRB 4WZSB 4JJNB 1P3LA 4G91B 3REIC 5GXQC 3O62B 1JFIA 3MNNC 4ZBJB 3MGQA 3AZGB 2F8NB 2NQBC 4E45A 5AV9A 4WU8A 5G49B 4J8VD 5JA4A 5AV8A 3AZEB 3MNND 1P3PD 1P3KD 5B31D 2NZDD 4WNNA 2BYKA 4J8WA 2NQBA 1M19A 4Z66C 1P3MA 4AWLB 1P3OD 3REHC 5DNND 3KWQA 3KXBD 4LD9C 5BNXA 5B1MB 3LZ0D 1KX5B 5JRGD 3X1SA 2PYOA 5CPKC 3MGRD 4EO5B 3AV1C 1P3GA 4KHAA 4WU9A 5E5AD 5AVCB 1TZYD 2HUEC 5AVBC 3UT9A 5CP6C 3LJAC 3UTAA 3AZIC 3LELD 4XZQD 2YFWA 1P3LC 3AFAD 3EPJA 3AN2A 4H9OA 5CPIA 5B2JC 3C1BD 1N1JB 5GT3D 1AOIB 3EPHA
chains in the Genus database with same CATH topology
4HGAC 4J8UB 5CPJB 1H3OA 4KGCA 2BYMB 4J8XC 3AZNA 5CP6B 1M18A 3C1BB 3VH6A 4CSRA 5B24A 3UTBD 2AROA 5B1MD 3AZHC 5C3IC 4ZUXC 3WKJB 4LD9B 1KX3A 5GT3C 5E5AB 1TAFB 5F99A 1EQZC 5BS7C 2HIOA 1P3FA 1BH9B 2UWXA 1P3KB 2FJ7A 1ID3A 2IO5C 4YS3D 3A6NC 1A7WA 1TZYC 5AVBD 4YM6A 3R45B 3WA9B 3KWQC 3TU4A 4Z66A 5F99C 5B2IB 5B2JB 4HGAB 3REHD 2YFVA 2Y2KA 2JCHA 3V9RA 5AVBB 2Y2PA 5GT0C 3P5JB 4XZQC 5AV6C 1P3AA 3AZID 3MVDA 1F66B 5B24C 1F1EA 1P3IC 2G5HC 1KX4D 3LELB 3VH6W 4XUJB 2Y2LA 1ZLAC 5B0ZD 5B40C 3B6FC 3AFAC 4H9NA 3REIA 1P3LD 3AZHB 2JSSA 5B2IC 3B0CW 1Z2CB 1P3OC 1EQZB 3WAAA 3X1UC 4Z2MH 5AV5A 5E5AC 2XD5A 4H9PB 4UUZA 2L5AA 3AV1D 4NE3A 1ZLAA 2Y2GA 3LZ0C 4QLCA 1P3KC 3W97B 3KUYC 5B2ID 2JE5A 3AZKC 4J8VC 5B40D 4NFTA 3B6FD 5CPKA 2NQBD 5B0ZC 3A1KA 3AZEC 3WTPE 2NZDC 1KX4C 3X1UD 3NQUA 3AZED 3W99A 5JRGA 4Z5TA 1B67A 3MGRA 4G92B 3LZ0B 2DF4C 4YS3B 3WTPA 5B33A 3EPKA 3O62A 1P3ID 2ZM5A 1JFIB 4R8PA 5GSUD 2Y2IA 2F8NA 5GT0D 3AN2D 4WU8B 5G49A 3W98A 5JA4B 1P34D 3REKD 5CPJC 3EG5B 1P3IB 3AV2B 4KGCD 2NQBB 1M18D 5AV9D 3KUYB 3AZLD 5BNXB 5B1MC 2AROD 5B1MA 3AZHD 1KX5A 5GT3B 3X1SB 4DRBA 1EQZD 3VH5T 1P3BA 5AV6A 4KHAB 4WU9B 3MGPA 3MGPC 3AZFA 5AVCA 1P3AC 3WKJD 5AY8C 3UTAB 5DNNA 2BG1A 2YFWB 3MGSB 3AN2B 5B32D 3AYWC 4J8UC 5C3IB 3H0MC 5FUGA 4J8XD 3X1TA 1AOIC 1AOIA 2PYOC 3X1SC 4J8UA 5CPJA 1H3OB 4KGCB 2BYMA 3AZNB 4X23A 1S32A 1M18B 3KXBB 5B2JD 3LZ1A 3LZ1C 3C1BA 5BT1D 3C1BC 4CSRB 5B24B 3RELA 2CV5D 1KX3C 3UTBC 3WA9C 1Q9CA 3LJAD 3REKC 5GSUB 1TAFA 5F99B 3B6GD 4H9SA 4E44A 5JRGC 1P34B 2CV5B 2VQRA 1P3FB 1P3KA 2FJ7B 3B0DC 5DNNC 4JJND 3LJAB 3MGSC 3R45A 2F8NK 3WA9A 3LELC 1HQ3C 3REJD 5CP6D 5B2IA 2Y2HA 3W97D 1ID3D 3V9RB 3B0CT 5CPKD 5AVBA 4WU9D 3AZKD 3MVDB 1F66A 2W8SA 5GXQD 3H0RC 3LELA 3REHA 5B33C 3AZMA 1P3OB 3WTPD 1M1AC 3AZJA 2RIQA 3KSYA 1P3PC 3AZMC 3MVDD 4R8PD 5AV5B 4KUDD 5GT0A 4H9PA 1BFMA 4NE5A 1ZLAB 5KDMA 1U35B 4WU8D 3REID 3AFAB 4J8VA 4AWLC 5B24D 3MNNA 3MGQC 1P3PA 3AL0C 2NZDA 4G92C 5F99D 3X1VC 2F8NH 5AV5C 2F8NG 3NQUB 1P3FC 3AZGD 5B1LC 5AV8D 3NQJB 3KWQD 2HIOD 5DNMA 5DNMC 3LZ0A 3UTBB 4YS3A 5B40A 3WTPB 3B6FA 3AZFD 1T3UA 2Y2NA 5B33B 3MVDC 1HQ3A 1M19D 3X1UA 4R8PB 2Y2MA 3UTAD 3W99D 3W98B 1B6WA 1P3BC 1U35D 2Y2OA 3X1TD 4J8XA 5B32B 3O62D 1TZYA 4X23C 1P3IA 3AV2A 2Y2JA 5BO0A 4CAYA 5B32G 4UPKA 5B0YC 3W96D 3W98D 3KUYA 5CPID 4XZQB 2LY8A 5GT3A 2ZY3A 3WAAD 1P3BB 5AV6B 4ZUXA 3MGPB 3AZFB 5AY8A 3AZIB 1F66C 1S32C 4J8WC 3W96B 5B0YA 5B1LB 5DNNB 3B6GB 4XUJD 3AYWA 4QLCD 5BNVB 3MGSA 3REKB 5BS7A 5B31A 2FJ7D 5FUGB 3WA9D 3X1TB 3MGRC 3AZNC 1R4VA 4H9SC 4J8WD 3KXBC 5BT1C 4LD9D 3C1CD 3REJB 1U35C 1P3MD 4X23B 4Z66D 1S32B 4Z5TD 3KXBA 3LZ1B 3RELB 2F2AC 1BH8B 5CPIC 2PYOD 4YM6D 1KX5C 5B31C 4WV4B 3C1CB 1M1AB 5GSUA 3A6NA 3UT9C 3X1VA 4Z2MG 3AZJD 5B1LD 1P34A 2CV5A 2J8PA 2ZY2A 3LJAA 3AZKB 5GXQB 3O62C 4KUDB 1KX4A 1ULYA 3MGQD 3AV1A 2XD1A 5B0ZA 4H9RA 3AZLC 5AVCC 3AZLA 3X1TC 1P3GC 4WU8C 4H9QB 3AV2C 4JJNA 1P3LB 2CWEA 1M19C 3A1IA 5AVCD 3MGQB 3AZGA 3TU4C 1M1AD 5AV9B 5DNMD 3REHB 3AZMB 1P3OA 5AV8B 3AZEA 1P3FD 3AZJB 5B31G 3VH5A 4WNNB 1P3GD 2BYKB 4WU9C 4J8WB 3UT9D 5GT0B 1M19B 3TU4D 3KFUG 1P3MB 3W97C 3AZMD 3KWQB 5KDMB 1U35A 3RELD 5CHLB 3AFAA 4J8VB 3WTPC 1WWSA 1PZRA 3MNNB 2PYOB 1P3GB 1P3PB 3EPLA 4Z5TC 4KUDC 2NZDB 3UT9B 4R8PC 4JJNC 2ZY5A 2F8ND 4G91C 3AZND 3NQJA 4H9OB 5CPIB 2Y2QA 5DNMB 3UTBA 1N1JA 5B40B 3B6FB 1HQ3B 4M6BA 3C1CC 3AZJC 1KX3D 3X1UB 2CV5C 3MGSD 1ZLAD 5CP6A 1ID3C 2FJ7C 1KX5D 4YM6C 4J8XB 4QLCC 4XUJC 5B32A 2AROB 1HQ3D 2RVQD 2RVQC 3B0DB 5AV6D 3REJC 2DQNC 3X1SD 3B6GC 3WKJA 1TZYB 4LD9A 1KX3B 1AOID 1F66D 5BO0B 1P3MC 3FDDA 5E5AA 4CAYB 4J8UD 4DQYB 1KU5A 2G5IC 3WAAC 4X23D 2HIOB 4XZQA 1BH9A 1HTAA 1ID3B 3W96C 4YM6B 4YS3C 4ZUXB 3A6ND 1P3AD 3WKJC 5AY8B 3UTAC 3IP4C 3VH5W 3AZIA 3TU4B 3W96A 5B0YB 5B1LA 4Z66B 1S32D 3B6GA 5B2JA 3LZ1D 3AYWB 4DRAA 5BNVA 2YFVB 3REKA 2FFFB 5B31B 3B0BA 2HIOC 4ZUXD 1P3AB 1WWIA 5AY8D 5AV5D 3W98C 5B0YD 3RELC 3REJA 4XUJA 5B32C 4ZBJC 3AYWD 4H9NB 3REIB 2AROC 3AZHA 1W2EA 1BH8A 3AZGC 1EQZA 3VH6T 3WAAB 4NE6A 1P3BD 5AV9C 3MGPD 3C1CA 3W99C 1M1AA 4UUZB 4KGCC 2IO5B 3A6NB 2HUEB 3X1VB 2ZY4A 4QLCB 3W97A 3AZFC 1M18C 3AN2C 3AZKA 5CPKB 5B33D 3AV2D 5AV8C 5GSUC 4WJ3C 5GXQA 4KUDA 1KX4B 3X1VD 3F6TA 5CPJD 4EO5C 3H0LC 5B0ZB 4H9RB 3KUYD 3AZLB 3AV1B 5JRGB 1P34C 4Z5TB 3W99B 4H9QA 3MGRB 4WZSB 4JJNB 1P3LA 4G91B 3REIC 5GXQC 3O62B 1JFIA 3MNNC 4ZBJB 3MGQA 3AZGB 2F8NB 2NQBC 4E45A 5AV9A 4WU8A 5G49B 4J8VD 5JA4A 5AV8A 3AZEB 3MNND 1P3PD 1P3KD 5B31D 2NZDD 4WNNA 2BYKA 4J8WA 2NQBA 1M19A 4Z66C 1P3MA 4AWLB 1P3OD 3REHC 5DNND 3KWQA 3KXBD 4LD9C 5BNXA 5B1MB 3LZ0D 1KX5B 5JRGD 3X1SA 2PYOA 5CPKC 3MGRD 4EO5B 3AV1C 1P3GA 4KHAA 4WU9A 5E5AD 5AVCB 1TZYD 2HUEC 5AVBC 3UT9A 5CP6C 3LJAC 3UTAA 3AZIC 3LELD 4XZQD 2YFWA 1P3LC 3AFAD 3EPJA 3AN2A 4H9OA 5CPIA 5B2JC 3C1BD 1N1JB 5GT3D 1AOIB 3EPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HGA C;  4J8U B;  5CPJ B;  1H3O A;  4KGC A;  2BYM B;  4J8X C;  3AZN A;  5CP6 B;  1M18 A;  3C1B B;  3VH6 A;  4CSR A;  5B24 A;  3UTB D;  2ARO A;  5B1M D;  3AZH C;  5C3I C;  4ZUX C;  3WKJ B;  4LD9 B;  1KX3 A;  5GT3 C;  5E5A B;  1TAF B;  5F99 A;  1EQZ C;  5BS7 C;  2HIO A;  1P3F A;  1BH9 B;  1P3K B;  2FJ7 A;  1ID3 A;  2IO5 C;  4YS3 D;  3A6N C;  1A7W A;  1TZY C;  5AVB D;  4YM6 A;  3R45 B;  3WA9 B;  3KWQ C;  3TU4 A;  4Z66 A;  5F99 C;  5B2I B;  5B2J B;  4HGA B;  3REH D;  2YFV A;  3V9R A;  5AVB B;  5GT0 C;  4XZQ C;  5AV6 C;  1P3A A;  3AZI D;  3MVD A;  1F66 B;  5B24 C;  1F1E A;  1P3I C;  1KX4 D;  3LEL B;  3VH6 W;  4XUJ B;  1ZLA C;  5B0Z D;  5B40 C;  3B6F C;  3AFA C;  4H9N A;  3REI A;  1P3L D;  3AZH B;  2JSS A;  5B2I C;  3B0C W;  1EQZ B;  1P3O C;  3WAA A;  3X1U C;  4Z2M H;  5AV5 A;  5E5A C;  4H9P B;  4UUZ A;  2L5A A;  3AV1 D;  4NE3 A;  1ZLA A;  3LZ0 C;  4QLC A;  1P3K C;  3W97 B;  3KUY C;  5B2I D;  3AZK C;  4J8V C;  5B40 D;  4NFT A;  3B6F D;  5CPK A;  2NQB D;  5B0Z C;  3AZE C;  3WTP E;  2NZD C;  1KX4 C;  3X1U D;  3NQU A;  3AZE D;  3W99 A;  5JRG A;  4Z5T A;  1B67 A;  3MGR A;  4G92 B;  3LZ0 B;  4YS3 B;  3WTP A;  5B33 A;  3O62 A;  1P3I D;  1JFI B;  4R8P A;  5GSU D;  2F8N A;  5GT0 D;  3AN2 D;  4WU8 B;  5G49 A;  3W98 A;  5JA4 B;  1P34 D;  3REK D;  5CPJ C;  1P3I B;  3AV2 B;  4KGC D;  2NQB B;  1M18 D;  5AV9 D;  3KUY B;  3AZL D;  5BNX B;  5B1M C;  2ARO D;  5B1M A;  3AZH D;  1KX5 A;  5GT3 B;  3X1S B;  4DRB A;  1EQZ D;  3VH5 T;  1P3B A;  5AV6 A;  4KHA B;  4WU9 B;  3MGP A;  3MGP C;  3AZF A;  5AVC A;  1P3A C;  3WKJ D;  5AY8 C;  3UTA B;  5DNN A;  2YFW B;  3MGS B;  3AN2 B;  5B32 D;  3AYW C;  4J8U C;  5C3I B;  5FUG A;  4J8X D;  3X1T A;  1AOI C;  1AOI A;  2PYO C;  3X1S C;  4J8U A;  5CPJ A;  1H3O B;  4KGC B;  2BYM A;  3AZN B;  4X23 A;  1S32 A;  1M18 B;  3KXB B;  5B2J D;  3LZ1 A;  3LZ1 C;  3C1B A;  5BT1 D;  3C1B C;  4CSR B;  5B24 B;  3REL A;  2CV5 D;  1KX3 C;  3UTB C;  3WA9 C;  1Q9C A;  3LJA D;  3REK C;  5GSU B;  1TAF A;  5F99 B;  3B6G D;  4H9S A;  4E44 A;  5JRG C;  1P34 B;  2CV5 B;  1P3F B;  1P3K A;  2FJ7 B;  3B0D C;  5DNN C;  4JJN D;  3LJA B;  3MGS C;  3R45 A;  2F8N K;  3WA9 A;  3LEL C;  1HQ3 C;  3REJ D;  5CP6 D;  5B2I A;  3W97 D;  1ID3 D;  3V9R B;  3B0C T;  5CPK D;  5AVB A;  4WU9 D;  3AZK D;  3MVD B;  1F66 A;  5GXQ D;  3LEL A;  3REH A;  5B33 C;  3AZM A;  1P3O B;  3WTP D;  1M1A C;  3AZJ A;  3KSY A;  1P3P C;  3AZM C;  3MVD D;  4R8P D;  5AV5 B;  4KUD D;  5GT0 A;  4H9P A;  1BFM A;  4NE5 A;  1ZLA B;  5KDM A;  1U35 B;  4WU8 D;  3REI D;  3AFA B;  4J8V A;  4AWL C;  5B24 D;  3MNN A;  3MGQ C;  1P3P A;  2NZD A;  4G92 C;  5F99 D;  3X1V C;  2F8N H;  5AV5 C;  2F8N G;  3NQU B;  1P3F C;  3AZG D;  5B1L C;  5AV8 D;  3NQJ B;  3KWQ D;  2HIO D;  5DNM A;  5DNM C;  3LZ0 A;  3UTB B;  4YS3 A;  5B40 A;  3WTP B;  3B6F A;  3AZF D;  3MVD C;  5B33 B;  1HQ3 A;  1M19 D;  3X1U A;  4R8P B;  3UTA D;  3W99 D;  3W98 B;  1B6W A;  1P3B C;  1U35 D;  3X1T D;  4J8X A;  5B32 B;  3O62 D;  1TZY A;  4X23 C;  1P3I A;  3AV2 A;  5BO0 A;  4CAY A;  5B32 G;  5B0Y C;  3W96 D;  3W98 D;  3KUY A;  5CPI D;  4XZQ B;  2LY8 A;  5GT3 A;  3WAA D;  1P3B B;  5AV6 B;  4ZUX A;  3MGP B;  3AZF B;  5AY8 A;  3AZI B;  1F66 C;  1S32 C;  4J8W C;  3W96 B;  5B0Y A;  5B1L B;  5DNN B;  3B6G B;  4XUJ D;  3AYW A;  4QLC D;  5BNV B;  3MGS A;  3REK B;  5BS7 A;  5B31 A;  2FJ7 D;  5FUG B;  3WA9 D;  3X1T B;  3MGR C;  3AZN C;  1R4V A;  4H9S C;  4J8W D;  3KXB C;  5BT1 C;  4LD9 D;  3C1C D;  3REJ B;  1U35 C;  1P3M D;  4X23 B;  4Z66 D;  1S32 B;  4Z5T D;  3KXB A;  3LZ1 B;  3REL B;  1BH8 B;  5CPI C;  2PYO D;  4YM6 D;  1KX5 C;  5B31 C;  4WV4 B;  3C1C B;  1M1A B;  5GSU A;  3A6N A;  3UT9 C;  3X1V A;  4Z2M G;  3AZJ D;  5B1L D;  1P34 A;  2CV5 A;  3LJA A;  3AZK B;  5GXQ B;  3O62 C;  4KUD B;  1KX4 A;  1ULY A;  3MGQ D;  3AV1 A;  3X1T C;  5B0Z A;  4H9R A;  3AZL C;  5AVC C;  3AZL A;  1P3G C;  4WU8 C;  4H9Q B;  3AV2 C;  4JJN A;  1P3L B;  2CWE A;  1M19 C;  5AVC D;  3MGQ B;  3AZG A;  3TU4 C;  1M1A D;  5AV9 B;  5DNM D;  3REH B;  3AZM B;  1P3O A;  5AV8 B;  3AZE A;  1P3F D;  3AZJ B;  5B31 G;  3VH5 A;  4WNN B;  1P3G D;  2BYK B;  4WU9 C;  4J8W B;  3UT9 D;  5GT0 B;  1M19 B;  3TU4 D;  1P3M B;  3W97 C;  3AZM D;  3KWQ B;  5KDM B;  1U35 A;  3REL D;  5CHL B;  3AFA A;  4J8V B;  3WTP C;  1WWS A;  3MNN B;  2PYO B;  1P3G B;  1P3P B;  4Z5T C;  4KUD C;  2NZD B;  3UT9 B;  4R8P C;  4JJN C;  2F8N D;  4G91 C;  3AZN D;  3NQJ A;  4H9O B;  5CPI B;  5DNM B;  3UTB A;  1N1J A;  5B40 B;  3B6F B;  1HQ3 B;  4M6B A;  3C1C C;  3AZJ C;  1KX3 D;  3X1U B;  2CV5 C;  3MGS D;  1ZLA D;  5CP6 A;  1ID3 C;  2FJ7 C;  1KX5 D;  4YM6 C;  4J8X B;  4QLC C;  4XUJ C;  5B32 A;  2ARO B;  1HQ3 D;  2RVQ D;  2RVQ C;  3B0D B;  5AV6 D;  3REJ C;  3X1S D;  3B6G C;  3WKJ A;  4LD9 A;  1TZY B;  1KX3 B;  1AOI D;  1F66 D;  5BO0 B;  1P3M C;  5E5A A;  4CAY B;  4J8U D;  1KU5 A;  3WAA C;  4X23 D;  2HIO B;  4XZQ A;  1BH9 A;  1HTA A;  1ID3 B;  3W96 C;  4YM6 B;  4YS3 C;  4ZUX B;  3A6N D;  1P3A D;  3WKJ C;  5AY8 B;  3UTA C;  3AZI A;  3VH5 W;  3TU4 B;  3W96 A;  5B0Y B;  5B1L A;  4Z66 B;  1S32 D;  3B6G A;  5B2J A;  3LZ1 D;  3AYW B;  4DRA A;  5BNV A;  2YFV B;  3REK A;  5B31 B;  3B0B A;  2HIO C;  4ZUX D;  1P3A B;  1WWI A;  5AY8 D;  5AV5 D;  3W98 C;  5B0Y D;  3REL C;  3REJ A;  4XUJ A;  5B32 C;  4ZBJ C;  3AYW D;  4H9N B;  3REI B;  2ARO C;  3AZH A;  1BH8 A;  3AZG C;  1EQZ A;  3VH6 T;  3WAA B;  4NE6 A;  1P3B D;  5AV9 C;  3MGP D;  3C1C A;  3W99 C;  1M1A A;  4UUZ B;  4KGC C;  2IO5 B;  3A6N B;  2HUE B;  3X1V B;  4QLC B;  3W97 A;  3AZF C;  1M18 C;  3AN2 C;  3AZK A;  5CPK B;  5B33 D;  3AV2 D;  5AV8 C;  5GSU C;  5GXQ A;  4KUD A;  1KX4 B;  3X1V D;  5CPJ D;  4EO5 C;  3AV1 B;  5B0Z B;  4H9R B;  3KUY D;  3AZL B;  3W99 B;  5JRG B;  1P34 C;  4Z5T B;  4H9Q A;  3MGR B;  4WZS B;  4JJN B;  1P3L A;  4G91 B;  3REI C;  5GXQ C;  3O62 B;  1JFI A;  3MNN C;  4ZBJ B;  3MGQ A;  3AZG B;  2F8N B;  2NQB C;  4E45 A;  5AV9 A;  4WU8 A;  5G49 B;  4J8V D;  5JA4 A;  5AV8 A;  3AZE B;  3MNN D;  1P3P D;  1P3K D;  5B31 D;  2NZD D;  4WNN A;  2BYK A;  4J8W A;  2NQB A;  1M19 A;  4Z66 C;  1P3M A;  4AWL B;  1P3O D;  3REH C;  5DNN D;  3KWQ A;  3KXB D;  4LD9 C;  5BNX A;  5B1M B;  3LZ0 D;  1KX5 B;  5JRG D;  3X1S A;  2PYO A;  5CPK C;  3MGR D;  4EO5 B;  3AV1 C;  1P3G A;  4KHA A;  4WU9 A;  5E5A D;  5AVC B;  1TZY D;  2HUE C;  5AVB C;  3UT9 A;  5CP6 C;  3LJA C;  3UTA A;  3AZI C;  3LEL D;  4XZQ D;  2YFW A;  1P3L C;  3AFA D;  3AN2 A;  4H9O A;  5CPI A;  5B2J C;  3C1B D;  1N1J B;  5GT3 D;  1AOI B; 
#chains in the Genus database with same CATH topology
 4HGA C;  4J8U B;  5CPJ B;  1H3O A;  4KGC A;  2BYM B;  4J8X C;  3AZN A;  5CP6 B;  1M18 A;  3C1B B;  3VH6 A;  4CSR A;  5B24 A;  3UTB D;  2ARO A;  5B1M D;  3AZH C;  5C3I C;  4ZUX C;  3WKJ B;  4LD9 B;  1KX3 A;  5GT3 C;  5E5A B;  1TAF B;  5F99 A;  1EQZ C;  5BS7 C;  2HIO A;  1P3F A;  1BH9 B;  2UWX A;  1P3K B;  2FJ7 A;  1ID3 A;  2IO5 C;  4YS3 D;  3A6N C;  1A7W A;  1TZY C;  5AVB D;  4YM6 A;  3R45 B;  3WA9 B;  3KWQ C;  3TU4 A;  4Z66 A;  5F99 C;  5B2I B;  5B2J B;  4HGA B;  3REH D;  2YFV A;  2Y2K A;  2JCH A;  3V9R A;  5AVB B;  2Y2P A;  5GT0 C;  3P5J B;  4XZQ C;  5AV6 C;  1P3A A;  3AZI D;  3MVD A;  1F66 B;  5B24 C;  1F1E A;  1P3I C;  2G5H C;  1KX4 D;  3LEL B;  3VH6 W;  4XUJ B;  2Y2L A;  1ZLA C;  5B0Z D;  5B40 C;  3B6F C;  3AFA C;  4H9N A;  3REI A;  1P3L D;  3AZH B;  2JSS A;  5B2I C;  3B0C W;  1Z2C B;  1P3O C;  1EQZ B;  3WAA A;  3X1U C;  4Z2M H;  5AV5 A;  5E5A C;  2XD5 A;  4H9P B;  4UUZ A;  2L5A A;  3AV1 D;  4NE3 A;  1ZLA A;  2Y2G A;  3LZ0 C;  4QLC A;  1P3K C;  3W97 B;  3KUY C;  5B2I D;  2JE5 A;  3AZK C;  4J8V C;  5B40 D;  4NFT A;  3B6F D;  5CPK A;  2NQB D;  5B0Z C;  3A1K A;  3AZE C;  3WTP E;  2NZD C;  1KX4 C;  3X1U D;  3NQU A;  3AZE D;  3W99 A;  5JRG A;  4Z5T A;  1B67 A;  3MGR A;  4G92 B;  3LZ0 B;  2DF4 C;  4YS3 B;  3WTP A;  5B33 A;  3EPK A;  3O62 A;  1P3I D;  2ZM5 A;  1JFI B;  4R8P A;  5GSU D;  2Y2I A;  2F8N A;  5GT0 D;  3AN2 D;  4WU8 B;  5G49 A;  3W98 A;  5JA4 B;  1P34 D;  3REK D;  5CPJ C;  3EG5 B;  1P3I B;  3AV2 B;  4KGC D;  2NQB B;  1M18 D;  5AV9 D;  3KUY B;  3AZL D;  5BNX B;  5B1M C;  2ARO D;  5B1M A;  3AZH D;  1KX5 A;  5GT3 B;  3X1S B;  4DRB A;  1EQZ D;  3VH5 T;  1P3B A;  5AV6 A;  4KHA B;  4WU9 B;  3MGP A;  3MGP C;  3AZF A;  5AVC A;  1P3A C;  3WKJ D;  5AY8 C;  3UTA B;  5DNN A;  2BG1 A;  2YFW B;  3MGS B;  3AN2 B;  5B32 D;  3AYW C;  4J8U C;  5C3I B;  3H0M C;  5FUG A;  4J8X D;  3X1T A;  1AOI C;  1AOI A;  2PYO C;  3X1S C;  4J8U A;  5CPJ A;  1H3O B;  4KGC B;  2BYM A;  3AZN B;  4X23 A;  1S32 A;  1M18 B;  3KXB B;  5B2J D;  3LZ1 A;  3LZ1 C;  3C1B A;  5BT1 D;  3C1B C;  4CSR B;  5B24 B;  3REL A;  2CV5 D;  1KX3 C;  3UTB C;  3WA9 C;  1Q9C A;  3LJA D;  3REK C;  5GSU B;  1TAF A;  5F99 B;  3B6G D;  4H9S A;  4E44 A;  5JRG C;  1P34 B;  2CV5 B;  2VQR A;  1P3F B;  1P3K A;  2FJ7 B;  3B0D C;  5DNN C;  4JJN D;  3LJA B;  3MGS C;  3R45 A;  2F8N K;  3WA9 A;  3LEL C;  1HQ3 C;  3REJ D;  5CP6 D;  5B2I A;  2Y2H A;  3W97 D;  1ID3 D;  3V9R B;  3B0C T;  5CPK D;  5AVB A;  4WU9 D;  3AZK D;  3MVD B;  1F66 A;  2W8S A;  5GXQ D;  3H0R C;  3LEL A;  3REH A;  5B33 C;  3AZM A;  1P3O B;  3WTP D;  1M1A C;  3AZJ A;  2RIQ A;  3KSY A;  1P3P C;  3AZM C;  3MVD D;  4R8P D;  5AV5 B;  4KUD D;  5GT0 A;  4H9P A;  1BFM A;  4NE5 A;  1ZLA B;  5KDM A;  1U35 B;  4WU8 D;  3REI D;  3AFA B;  4J8V A;  4AWL C;  5B24 D;  3MNN A;  3MGQ C;  1P3P A;  3AL0 C;  2NZD A;  4G92 C;  5F99 D;  3X1V C;  2F8N H;  5AV5 C;  2F8N G;  3NQU B;  1P3F C;  3AZG D;  5B1L C;  5AV8 D;  3NQJ B;  3KWQ D;  2HIO D;  5DNM A;  5DNM C;  3LZ0 A;  3UTB B;  4YS3 A;  5B40 A;  3WTP B;  3B6F A;  3AZF D;  1T3U A;  2Y2N A;  5B33 B;  3MVD C;  1HQ3 A;  1M19 D;  3X1U A;  4R8P B;  2Y2M A;  3UTA D;  3W99 D;  3W98 B;  1B6W A;  1P3B C;  1U35 D;  2Y2O A;  3X1T D;  4J8X A;  5B32 B;  3O62 D;  1TZY A;  4X23 C;  1P3I A;  3AV2 A;  2Y2J A;  5BO0 A;  4CAY A;  5B32 G;  4UPK A;  5B0Y C;  3W96 D;  3W98 D;  3KUY A;  5CPI D;  4XZQ B;  2LY8 A;  5GT3 A;  2ZY3 A;  3WAA D;  1P3B B;  5AV6 B;  4ZUX A;  3MGP B;  3AZF B;  5AY8 A;  3AZI B;  1F66 C;  1S32 C;  4J8W C;  3W96 B;  5B0Y A;  5B1L B;  5DNN B;  3B6G B;  4XUJ D;  3AYW A;  4QLC D;  5BNV B;  3MGS A;  3REK B;  5BS7 A;  5B31 A;  2FJ7 D;  5FUG B;  3WA9 D;  3X1T B;  3MGR C;  3AZN C;  1R4V A;  4H9S C;  4J8W D;  3KXB C;  5BT1 C;  4LD9 D;  3C1C D;  3REJ B;  1U35 C;  1P3M D;  4X23 B;  4Z66 D;  1S32 B;  4Z5T D;  3KXB A;  3LZ1 B;  3REL B;  2F2A C;  1BH8 B;  5CPI C;  2PYO D;  4YM6 D;  1KX5 C;  5B31 C;  4WV4 B;  3C1C B;  1M1A B;  5GSU A;  3A6N A;  3UT9 C;  3X1V A;  4Z2M G;  3AZJ D;  5B1L D;  1P34 A;  2CV5 A;  2J8P A;  2ZY2 A;  3LJA A;  3AZK B;  5GXQ B;  3O62 C;  4KUD B;  1KX4 A;  1ULY A;  3MGQ D;  3AV1 A;  2XD1 A;  5B0Z A;  4H9R A;  3AZL C;  5AVC C;  3AZL A;  3X1T C;  1P3G C;  4WU8 C;  4H9Q B;  3AV2 C;  4JJN A;  1P3L B;  2CWE A;  1M19 C;  3A1I A;  5AVC D;  3MGQ B;  3AZG A;  3TU4 C;  1M1A D;  5AV9 B;  5DNM D;  3REH B;  3AZM B;  1P3O A;  5AV8 B;  3AZE A;  1P3F D;  3AZJ B;  5B31 G;  3VH5 A;  4WNN B;  1P3G D;  2BYK B;  4WU9 C;  4J8W B;  3UT9 D;  5GT0 B;  1M19 B;  3TU4 D;  3KFU G;  1P3M B;  3W97 C;  3AZM D;  3KWQ B;  5KDM B;  1U35 A;  3REL D;  5CHL B;  3AFA A;  4J8V B;  3WTP C;  1WWS A;  1PZR A;  3MNN B;  2PYO B;  1P3G B;  1P3P B;  3EPL A;  4Z5T C;  4KUD C;  2NZD B;  3UT9 B;  4R8P C;  4JJN C;  2ZY5 A;  2F8N D;  4G91 C;  3AZN D;  3NQJ A;  4H9O B;  5CPI B;  2Y2Q A;  5DNM B;  3UTB A;  1N1J A;  5B40 B;  3B6F B;  1HQ3 B;  4M6B A;  3C1C C;  3AZJ C;  1KX3 D;  3X1U B;  2CV5 C;  3MGS D;  1ZLA D;  5CP6 A;  1ID3 C;  2FJ7 C;  1KX5 D;  4YM6 C;  4J8X B;  4QLC C;  4XUJ C;  5B32 A;  2ARO B;  1HQ3 D;  2RVQ D;  2RVQ C;  3B0D B;  5AV6 D;  3REJ C;  2DQN C;  3X1S D;  3B6G C;  3WKJ A;  1TZY B;  4LD9 A;  1KX3 B;  1AOI D;  1F66 D;  5BO0 B;  1P3M C;  3FDD A;  5E5A A;  4CAY B;  4J8U D;  4DQY B;  1KU5 A;  2G5I C;  3WAA C;  4X23 D;  2HIO B;  4XZQ A;  1BH9 A;  1HTA A;  1ID3 B;  3W96 C;  4YM6 B;  4YS3 C;  4ZUX B;  3A6N D;  1P3A D;  3WKJ C;  5AY8 B;  3UTA C;  3IP4 C;  3VH5 W;  3AZI A;  3TU4 B;  3W96 A;  5B0Y B;  5B1L A;  4Z66 B;  1S32 D;  3B6G A;  5B2J A;  3LZ1 D;  3AYW B;  4DRA A;  5BNV A;  2YFV B;  3REK A;  2FFF B;  5B31 B;  3B0B A;  2HIO C;  4ZUX D;  1P3A B;  1WWI A;  5AY8 D;  5AV5 D;  3W98 C;  5B0Y D;  3REL C;  3REJ A;  4XUJ A;  5B32 C;  4ZBJ C;  3AYW D;  4H9N B;  3REI B;  2ARO C;  3AZH A;  1W2E A;  1BH8 A;  3AZG C;  1EQZ A;  3VH6 T;  3WAA B;  4NE6 A;  1P3B D;  5AV9 C;  3MGP D;  3C1C A;  3W99 C;  1M1A A;  4UUZ B;  4KGC C;  2IO5 B;  3A6N B;  2HUE B;  3X1V B;  2ZY4 A;  4QLC B;  3W97 A;  3AZF C;  1M18 C;  3AN2 C;  3AZK A;  5CPK B;  5B33 D;  3AV2 D;  5AV8 C;  5GSU C;  4WJ3 C;  5GXQ A;  4KUD A;  1KX4 B;  3X1V D;  3F6T A;  5CPJ D;  4EO5 C;  3H0L C;  5B0Z B;  4H9R B;  3KUY D;  3AZL B;  3AV1 B;  5JRG B;  1P34 C;  4Z5T B;  3W99 B;  4H9Q A;  3MGR B;  4WZS B;  4JJN B;  1P3L A;  4G91 B;  3REI C;  5GXQ C;  3O62 B;  1JFI A;  3MNN C;  4ZBJ B;  3MGQ A;  3AZG B;  2F8N B;  2NQB C;  4E45 A;  5AV9 A;  4WU8 A;  5G49 B;  4J8V D;  5JA4 A;  5AV8 A;  3AZE B;  3MNN D;  1P3P D;  1P3K D;  5B31 D;  2NZD D;  4WNN A;  2BYK A;  4J8W A;  2NQB A;  1M19 A;  4Z66 C;  1P3M A;  4AWL B;  1P3O D;  3REH C;  5DNN D;  3KWQ A;  3KXB D;  4LD9 C;  5BNX A;  5B1M B;  3LZ0 D;  1KX5 B;  5JRG D;  3X1S A;  2PYO A;  5CPK C;  3MGR D;  4EO5 B;  3AV1 C;  1P3G A;  4KHA A;  4WU9 A;  5E5A D;  5AVC B;  1TZY D;  2HUE C;  5AVB C;  3UT9 A;  5CP6 C;  3LJA C;  3UTA A;  3AZI C;  3LEL D;  4XZQ D;  2YFW A;  1P3L C;  3AFA D;  3EPJ A;  3AN2 A;  4H9O A;  5CPI A;  5B2J C;  3C1B D;  1N1J B;  5GT3 D;  1AOI B;  3EPH A; 
#chains in the Genus database with same CATH homology
 4HGA C;  4J8U B;  5CPJ B;  1H3O A;  4KGC A;  2BYM B;  4J8X C;  3AZN A;  5CP6 B;  1M18 A;  3C1B B;  3VH6 A;  4CSR A;  5B24 A;  3UTB D;  2ARO A;  5B1M D;  3AZH C;  5C3I C;  4ZUX C;  3WKJ B;  4LD9 B;  1KX3 A;  5GT3 C;  5E5A B;  1TAF B;  5F99 A;  1EQZ C;  5BS7 C;  2HIO A;  1P3F A;  1BH9 B;  2UWX A;  1P3K B;  2FJ7 A;  1ID3 A;  2IO5 C;  4YS3 D;  3A6N C;  1A7W A;  1TZY C;  5AVB D;  4YM6 A;  3R45 B;  3WA9 B;  3KWQ C;  3TU4 A;  4Z66 A;  5F99 C;  5B2I B;  5B2J B;  4HGA B;  3REH D;  2YFV A;  2Y2K A;  2JCH A;  3V9R A;  5AVB B;  2Y2P A;  5GT0 C;  3P5J B;  4XZQ C;  5AV6 C;  1P3A A;  3AZI D;  3MVD A;  1F66 B;  5B24 C;  1F1E A;  1P3I C;  2G5H C;  1KX4 D;  3LEL B;  3VH6 W;  4XUJ B;  2Y2L A;  1ZLA C;  5B0Z D;  5B40 C;  3B6F C;  3AFA C;  4H9N A;  3REI A;  1P3L D;  3AZH B;  2JSS A;  5B2I C;  3B0C W;  1Z2C B;  1P3O C;  1EQZ B;  3WAA A;  3X1U C;  4Z2M H;  5AV5 A;  5E5A C;  2XD5 A;  4H9P B;  4UUZ A;  2L5A A;  3AV1 D;  4NE3 A;  1ZLA A;  2Y2G A;  3LZ0 C;  4QLC A;  1P3K C;  3W97 B;  3KUY C;  5B2I D;  2JE5 A;  3AZK C;  4J8V C;  5B40 D;  4NFT A;  3B6F D;  5CPK A;  2NQB D;  5B0Z C;  3A1K A;  3AZE C;  3WTP E;  2NZD C;  1KX4 C;  3X1U D;  3NQU A;  3AZE D;  3W99 A;  5JRG A;  4Z5T A;  1B67 A;  3MGR A;  4G92 B;  3LZ0 B;  2DF4 C;  4YS3 B;  3WTP A;  5B33 A;  3EPK A;  3O62 A;  1P3I D;  2ZM5 A;  1JFI B;  4R8P A;  5GSU D;  2Y2I A;  2F8N A;  5GT0 D;  3AN2 D;  4WU8 B;  5G49 A;  3W98 A;  5JA4 B;  1P34 D;  3REK D;  5CPJ C;  3EG5 B;  1P3I B;  3AV2 B;  4KGC D;  2NQB B;  1M18 D;  5AV9 D;  3KUY B;  3AZL D;  5BNX B;  5B1M C;  2ARO D;  5B1M A;  3AZH D;  1KX5 A;  5GT3 B;  3X1S B;  4DRB A;  1EQZ D;  3VH5 T;  1P3B A;  5AV6 A;  4KHA B;  4WU9 B;  3MGP A;  3MGP C;  3AZF A;  5AVC A;  1P3A C;  3WKJ D;  5AY8 C;  3UTA B;  5DNN A;  2BG1 A;  2YFW B;  3MGS B;  3AN2 B;  5B32 D;  3AYW C;  4J8U C;  5C3I B;  3H0M C;  5FUG A;  4J8X D;  3X1T A;  1AOI C;  1AOI A;  2PYO C;  3X1S C;  4J8U A;  5CPJ A;  1H3O B;  4KGC B;  2BYM A;  3AZN B;  4X23 A;  1S32 A;  1M18 B;  3KXB B;  5B2J D;  3LZ1 A;  3LZ1 C;  3C1B A;  5BT1 D;  3C1B C;  4CSR B;  5B24 B;  3REL A;  2CV5 D;  1KX3 C;  3UTB C;  3WA9 C;  1Q9C A;  3LJA D;  3REK C;  5GSU B;  1TAF A;  5F99 B;  3B6G D;  4H9S A;  4E44 A;  5JRG C;  1P34 B;  2CV5 B;  2VQR A;  1P3F B;  1P3K A;  2FJ7 B;  3B0D C;  5DNN C;  4JJN D;  3LJA B;  3MGS C;  3R45 A;  2F8N K;  3WA9 A;  3LEL C;  1HQ3 C;  3REJ D;  5CP6 D;  5B2I A;  2Y2H A;  3W97 D;  1ID3 D;  3V9R B;  3B0C T;  5CPK D;  5AVB A;  4WU9 D;  3AZK D;  3MVD B;  1F66 A;  2W8S A;  5GXQ D;  3H0R C;  3LEL A;  3REH A;  5B33 C;  3AZM A;  1P3O B;  3WTP D;  1M1A C;  3AZJ A;  2RIQ A;  3KSY A;  1P3P C;  3AZM C;  3MVD D;  4R8P D;  5AV5 B;  4KUD D;  5GT0 A;  4H9P A;  1BFM A;  4NE5 A;  1ZLA B;  5KDM A;  1U35 B;  4WU8 D;  3REI D;  3AFA B;  4J8V A;  4AWL C;  5B24 D;  3MNN A;  3MGQ C;  1P3P A;  3AL0 C;  2NZD A;  4G92 C;  5F99 D;  3X1V C;  2F8N H;  5AV5 C;  2F8N G;  3NQU B;  1P3F C;  3AZG D;  5B1L C;  5AV8 D;  3NQJ B;  3KWQ D;  2HIO D;  5DNM A;  5DNM C;  3LZ0 A;  3UTB B;  4YS3 A;  5B40 A;  3WTP B;  3B6F A;  3AZF D;  1T3U A;  2Y2N A;  5B33 B;  3MVD C;  1HQ3 A;  1M19 D;  3X1U A;  4R8P B;  2Y2M A;  3UTA D;  3W99 D;  3W98 B;  1B6W A;  1P3B C;  1U35 D;  2Y2O A;  3X1T D;  4J8X A;  5B32 B;  3O62 D;  1TZY A;  4X23 C;  1P3I A;  3AV2 A;  2Y2J A;  5BO0 A;  4CAY A;  5B32 G;  4UPK A;  5B0Y C;  3W96 D;  3W98 D;  3KUY A;  5CPI D;  4XZQ B;  2LY8 A;  5GT3 A;  2ZY3 A;  3WAA D;  1P3B B;  5AV6 B;  4ZUX A;  3MGP B;  3AZF B;  5AY8 A;  3AZI B;  1F66 C;  1S32 C;  4J8W C;  3W96 B;  5B0Y A;  5B1L B;  5DNN B;  3B6G B;  4XUJ D;  3AYW A;  4QLC D;  5BNV B;  3MGS A;  3REK B;  5BS7 A;  5B31 A;  2FJ7 D;  5FUG B;  3WA9 D;  3X1T B;  3MGR C;  3AZN C;  1R4V A;  4H9S C;  4J8W D;  3KXB C;  5BT1 C;  4LD9 D;  3C1C D;  3REJ B;  1U35 C;  1P3M D;  4X23 B;  4Z66 D;  1S32 B;  4Z5T D;  3KXB A;  3LZ1 B;  3REL B;  2F2A C;  1BH8 B;  5CPI C;  2PYO D;  4YM6 D;  1KX5 C;  5B31 C;  4WV4 B;  3C1C B;  1M1A B;  5GSU A;  3A6N A;  3UT9 C;  3X1V A;  4Z2M G;  3AZJ D;  5B1L D;  1P34 A;  2CV5 A;  2J8P A;  2ZY2 A;  3LJA A;  3AZK B;  5GXQ B;  3O62 C;  4KUD B;  1KX4 A;  1ULY A;  3MGQ D;  3AV1 A;  2XD1 A;  5B0Z A;  4H9R A;  3AZL C;  5AVC C;  3AZL A;  3X1T C;  1P3G C;  4WU8 C;  4H9Q B;  3AV2 C;  4JJN A;  1P3L B;  2CWE A;  1M19 C;  3A1I A;  5AVC D;  3MGQ B;  3AZG A;  3TU4 C;  1M1A D;  5AV9 B;  5DNM D;  3REH B;  3AZM B;  1P3O A;  5AV8 B;  3AZE A;  1P3F D;  3AZJ B;  5B31 G;  3VH5 A;  4WNN B;  1P3G D;  2BYK B;  4WU9 C;  4J8W B;  3UT9 D;  5GT0 B;  1M19 B;  3TU4 D;  3KFU G;  1P3M B;  3W97 C;  3AZM D;  3KWQ B;  5KDM B;  1U35 A;  3REL D;  5CHL B;  3AFA A;  4J8V B;  3WTP C;  1WWS A;  1PZR A;  3MNN B;  2PYO B;  1P3G B;  1P3P B;  3EPL A;  4Z5T C;  4KUD C;  2NZD B;  3UT9 B;  4R8P C;  4JJN C;  2ZY5 A;  2F8N D;  4G91 C;  3AZN D;  3NQJ A;  4H9O B;  5CPI B;  2Y2Q A;  5DNM B;  3UTB A;  1N1J A;  5B40 B;  3B6F B;  1HQ3 B;  4M6B A;  3C1C C;  3AZJ C;  1KX3 D;  3X1U B;  2CV5 C;  3MGS D;  1ZLA D;  5CP6 A;  1ID3 C;  2FJ7 C;  1KX5 D;  4YM6 C;  4J8X B;  4QLC C;  4XUJ C;  5B32 A;  2ARO B;  1HQ3 D;  2RVQ D;  2RVQ C;  3B0D B;  5AV6 D;  3REJ C;  2DQN C;  3X1S D;  3B6G C;  3WKJ A;  1TZY B;  4LD9 A;  1KX3 B;  1AOI D;  1F66 D;  5BO0 B;  1P3M C;  3FDD A;  5E5A A;  4CAY B;  4J8U D;  4DQY B;  1KU5 A;  2G5I C;  3WAA C;  4X23 D;  2HIO B;  4XZQ A;  1BH9 A;  1HTA A;  1ID3 B;  3W96 C;  4YM6 B;  4YS3 C;  4ZUX B;  3A6N D;  1P3A D;  3WKJ C;  5AY8 B;  3UTA C;  3IP4 C;  3VH5 W;  3AZI A;  3TU4 B;  3W96 A;  5B0Y B;  5B1L A;  4Z66 B;  1S32 D;  3B6G A;  5B2J A;  3LZ1 D;  3AYW B;  4DRA A;  5BNV A;  2YFV B;  3REK A;  2FFF B;  5B31 B;  3B0B A;  2HIO C;  4ZUX D;  1P3A B;  1WWI A;  5AY8 D;  5AV5 D;  3W98 C;  5B0Y D;  3REL C;  3REJ A;  4XUJ A;  5B32 C;  4ZBJ C;  3AYW D;  4H9N B;  3REI B;  2ARO C;  3AZH A;  1W2E A;  1BH8 A;  3AZG C;  1EQZ A;  3VH6 T;  3WAA B;  4NE6 A;  1P3B D;  5AV9 C;  3MGP D;  3C1C A;  3W99 C;  1M1A A;  4UUZ B;  4KGC C;  2IO5 B;  3A6N B;  2HUE B;  3X1V B;  2ZY4 A;  4QLC B;  3W97 A;  3AZF C;  1M18 C;  3AN2 C;  3AZK A;  5CPK B;  5B33 D;  3AV2 D;  5AV8 C;  5GSU C;  4WJ3 C;  5GXQ A;  4KUD A;  1KX4 B;  3X1V D;  3F6T A;  5CPJ D;  4EO5 C;  3H0L C;  5B0Z B;  4H9R B;  3KUY D;  3AZL B;  3AV1 B;  5JRG B;  1P34 C;  4Z5T B;  3W99 B;  4H9Q A;  3MGR B;  4WZS B;  4JJN B;  1P3L A;  4G91 B;  3REI C;  5GXQ C;  3O62 B;  1JFI A;  3MNN C;  4ZBJ B;  3MGQ A;  3AZG B;  2F8N B;  2NQB C;  4E45 A;  5AV9 A;  4WU8 A;  5G49 B;  4J8V D;  5JA4 A;  5AV8 A;  3AZE B;  3MNN D;  1P3P D;  1P3K D;  5B31 D;  2NZD D;  4WNN A;  2BYK A;  4J8W A;  2NQB A;  1M19 A;  4Z66 C;  1P3M A;  4AWL B;  1P3O D;  3REH C;  5DNN D;  3KWQ A;  3KXB D;  4LD9 C;  5BNX A;  5B1M B;  3LZ0 D;  1KX5 B;  5JRG D;  3X1S A;  2PYO A;  5CPK C;  3MGR D;  4EO5 B;  3AV1 C;  1P3G A;  4KHA A;  4WU9 A;  5E5A D;  5AVC B;  1TZY D;  2HUE C;  5AVB C;  3UT9 A;  5CP6 C;  3LJA C;  3UTA A;  3AZI C;  3LEL D;  4XZQ D;  2YFW A;  1P3L C;  3AFA D;  3EPJ A;  3AN2 A;  4H9O A;  5CPI A;  5B2J C;  3C1B D;  1N1J B;  5GT3 D;  1AOI B;  3EPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...