1M19D

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Palindromic 146 Base Pair DNA Fragment
total genus 34
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m19D00
4Z5TB 4CSRA 2FJ7D 3REJC 4H9PB 2F8NA 5AVCB 5CPJC 4H9OB 5BNXA 3MNNC 3AN2A 3TU4D 2CV5D 4KUDA 5GT3A 4LD9A 4KHAA 3WKJA 5GXQC 4H9QB 4WZSB 1F66D 5B2JB 3C1BC 3WA9B 1P3OB 4H9NA 4Z2MG 4XZQA 5B31A 3X1VD 1TZYD 3KUYB 4CSRB 3AZIC 1HQ3A 3MGPA 4J8VA 2FJ7B 1P3GD 1P3IC 3NQJB 3WTPA 3AZJB 4J8XA 1TZYC 1JFIB 3W96B 3AYWD 4ZUXB 5GT0C 1ZLAA 5GT3C 3LELD 1KX3D 1AOIB 3WAAB 3MGRC 1P3BA 1P3BC 5AV8D 5DNMC 3KWQD 3AFAC 1P34D 3NQJA 1S32C 3W99D 4J8WD 1P3KC 2F8NG 3LJAA 1N1JB 1ID3D 3AZLC 3LZ0D 1S32D 5E5AD 1ID3C 4QLCA 5JA4A 2CV5C 5B24B 3AZIA 3MVDD 3MGSB 5G49B 4H9RB 3WA9A 2BYKB 3A6NA 4ZUXA 3AZKC 3RELD 5B32G 2BYKA 5AV5A 4G92C 4LD9C 5CPID 5CPKC 4KUDC 5DNNB 2F8NB 5AVBA 5AY8C 3UTBB 1P3GC 2NZDD 2HIOB 5B1LB 4JJNB 3B6FB 2HIOA 3WKJD 3O62A 3REKA 5BT1D 5KDMA 3VH6T 5AY8D 1M19A 5AV5B 3X1UB 1P3KA 4J8UA 2NQBC 3X1VC 3X1TA 3WAAA 5B24A 3RELB 3REJD 1P3LB 2AROB 4M6BA 3LZ1D 5B0ZA 3MGSD 1P3AD 3X1SD 5E5AC 5DNNC 3R45B 3UT9C 4HGAB 1P3BD 1P3AC 3MGRD 5AV9D 3VH6W 3AZHC 1KX3B 4YS3D 4J8WB 3LELB 1TAFB 3AZKD 1P34C 5G49A 1H3OB 5B0ZC 5GXQA 3AV1D 5BS7A 3LZ0A 3REID 4WU9B 4H9OA 3AZJA 2NQBA 3UTAA 5CHLB 5AV9B 3MGQD 3V9RB 4Z66C 3B6FA 3V9RA 1BH8B 4H9NB 3AFAB 3X1SB 5B2IA 5DNNA 4LD9D 4WU9A 3B0DC 3W98C 4DRBA 3LZ1C 5JRGB 4WNNB 5JRGC 5F99D 1BH8A 3AZHA 3MGPD 1KX5C 3B0DB 4XZQD 3X1VA 2FJ7C 3VH6A 3WTPD 1HQ3D 4J8VD 3NQUA 3B0CW 4KGCC 4AWLC 5B33A 4J8XD 4NE5A 1HTAA 2NZDC 4H9RA 5B0ZD 1P3AB 3LJAC 1M18A 1H3OA 1F1EA 1P3AA 1ZLAD 3X1SA 1U35D 4Z2MH 3REJB 4UUZA 3W96A 3LJAD 1P34A 2LY8A 3MVDB 3REKC 5AV9A 3X1UD 1P34B 5CP6C 4XUJD 5B31B 5AV6C 2IO5B 1P3PD 3AV1B 3AZND 3AZID 3X1UC 5B0ZB 4J8UC 3REHD 3X1TB 3LELC 4J8WC 3RELA 3B6FC 3C1BA 5C3IB 4WU8B 2BYMA 2HIOC 3AYWC 1M18B 3AFAA 1P3GB 3WTPE 4KUDB 3AN2D 4QLCC 4QLCB 2CV5A 5CPKB 5GT3D 3X1VB 1M18C 3AZLD 3AZGB 2NZDA 3REKD 5AV5C 1P3KD 3RELC 1ID3B 1P3GA 5AY8A 1M19D 2RVQC 2NQBB 1U35C 5AVCA 5DNMA 5AY8B 3KXBD 3AYWA 5JA4B 5CP6B 4G92B 3MGSA 3REKB 4E44A 3WAAD 3MVDC 3LELA 4KGCB 5CPJA 3MGRB 5B24C 3WAAC 1M18D 3AV2C 5B0YA 3B0BA 3MGRA 3MGPC 1U35A 3KXBB 5CP6A 3AZKB 2CWEA 4CAYA 1WWSA 5B31C 5AV6B 4EO5C 1TZYB 4CAYB 1S32A 4H9SA 2YFWB 3X1UA 1P3KB 3WKJC 1S32B 1BFMA 1F66B 3AV1A 1KX5B 3REIA 3A6ND 3UTAD 5GT0A 3NQUB 5FUGA 3LJAB 1P3LD 5AV5D 4Z66B 4ZUXC 5FUGB 3C1BD 3W98A 3B6FD 4UUZB 1AOID 5AVBD 1EQZA 5GSUA 3MNNA 1KX5A 5GT3B 3AZIB 4KHAB 3WKJB 5KDMB 2JSSA 4JJND 3AZLA 5AV9C 5B1MA 5B2JC 3AZHD 1B6WA 4EO5B 1P3FA 4J8UD 4Z66D 3W98B 4WU9C 4HGAC 3AV2D 3MGPB 5B24D 3X1SC 5DNMD 5E5AB 5JRGA 3C1CA 2PYOA 1KX3C 5B33D 4NFTA 2L5AA 4YS3C 3AZEB 1P3MB 5B32D 4X23B 1HQ3C 4J8VC 1U35B 3AZKA 2AROC 4E45A 3C1CC 2PYOC 1ULYA 3AZHB 4XUJA 3AZJD 5B1LC 5AV8C 3LZ0C 3KWQC 3UT9B 5BNVB 3AZNA 4LD9B 3AYWB 5B33C 4JJNC 4X23D 3AFAD 5F99B 5C3IC 4WU8C 1M1AB 1P3LC 5B2ID 3X1TC 5BO0A 1P3PC 2FJ7A 5AVBC 3TU4B 1EQZD 4H9PA 5B1LA 1KX5D 3TU4A 4KUDD 2AROD 3AZGD 3AZLB 3MGSC 2CV5B 1BH9A 3B0CT 2BYMB 5CPIC 5AVCD 4R8PA 5CPKD 1P3IA 1P3OA 5B2IB 3REHC 5B40B 4R8PB 1P3BB 1M1AD 3AZEA 1P3MA 3KXBA 1AOIC 4YM6A 1KX4A 5BT1C 2NZDB 5GT0B 3C1CD 2PYOD 3UTBD 5CPJD 3AZMC 4AWLB 3AZJC 1P3PB 5B0YD 3W96D 5CP6D 2HUEC 4H9SC 5B32A 3W97B 3KUYC 3A6NB 1TAFA 4NE6A 4J8WA 1KX4B 5B1MC 5B2JA 1P3FC 4YM6C 1ID3A 5GXQB 3LZ1B 4G91B 5B0YB 4DRAA 3B6GA 3AZFD 5B40A 5DNMB 4NE3A 5E5AA 3MNNB 3REHA 5CPJB 5AV6A 5GSUC 1EQZC 5GT0D 3C1CB 1P3OC 2PYOB 4J8XB 4QLCD 3MVDA 1A7WA 3O62B 4Z5TD 3KUYA 3WTPC 1HQ3B 4J8VB 4X23C 5GSUD 3W96C 1B67A 4XZQB 3REIC 3W98D 1P3IB 1F66A 2F8ND 3B6GC 3MNND 1M19C 3AZFB 5B1MD 3O62C 1P3FD 4WU8A 1R4VA 3C1BB 5B31D 1JFIA 1TZYA 4J8XC 4JJNA 4XUJB 1EQZB 1BH9B 1M19B 2F8NK 5B0YC 5CPKA 3R45A 1P3OD 3AV2A 1KU5A 2YFVA 4XZQC 3REIB 4XUJC 5B1MB 1P3FB 3AZMA 3MGQB 3A6NC 3LZ1A 4YM6D 3B6GB 2HUEB 5BNXB 5B32C 3W99B 5GSUB 3VH5W 3W99A 3WTPB 4G91C 3W97A 1KX4C 3UT9D 5B2JD 3UTAC 4KGCA 5GXQD 1F66C 3AN2C 3VH5T 3UTBC 3B6GD 3AZFA 4YM6B 4ZBJC 1ZLAC 1P3LA 2NQBD 4X23A 3W97C 3VH5A 3WA9D 3KXBC 1AOIA 4Z5TA 3TU4C 4ZBJB 3AV2B 1ZLAB 3AZNC 2F8NH 1WWIA 3KSYA 4WV4B 5B1LD 5BNVA 4R8PC 5CPIA 5B40C 3AZMB 5DNND 4WU9D 5CPIB 3AZGA 4Z66A 2AROA 2HIOD 4R8PD 1N1JA 4WU8D 1P3ID 3O62D 5F99A 3AN2B 5B2IC 3X1TD 3REHB 1M1AA 1Q9CA 3REJA 5B31G 4H9QA 5JRGD 2RVQD 3AZNB 5BS7C 5B32B 3AZED 1P3MD 3AZMD 3AZGC 1KX3A 5B33B 1KX4D 3MGQC 5AVBB 3UTBA 5AV8A 3KWQA 3AZEC 1P3MC 5BO0B 3W99C 3LZ0B 5AV8B 3KWQB 1M1AC 4YS3A 5F99C 3UTAB 3W97D 3WA9C 4WNNA 4J8UB 2YFWA 3AZFC 3UT9A 3AV1C 2IO5C 4KGCD 1P3PA 5AVCC 5B40D 3MGQA 4YS3B 4ZUXD 5AV6D 4Z5TC 3KUYD 2YFVB
chains in the Genus database with same CATH superfamily
4Z5TB 4CSRA 2XD1A 3REJC 2FJ7D 4H9PB 2F8NA 5AVCB 5CPJC 4H9OB 5BNXA 3MNNC 3AN2A 3TU4D 2CV5D 4KUDA 4DQYB 5GT3A 4LD9A 4KHAA 3WKJA 5GXQC 4H9QB 4WZSB 1F66D 5B2JB 3C1BC 3WA9B 1P3OB 4H9NA 4Z2MG 4XZQA 5B31A 3EPLA 1TZYD 3X1VD 3KUYB 4CSRB 3AZIC 2XD5A 1HQ3A 3MGPA 4J8VA 2FJ7B 1P3GD 1P3IC 2ZY2A 3NQJB 3WTPA 3AZJB 4J8XA 1TZYC 1JFIB 3W96B 3AYWD 4ZUXB 2W8SA 5GT0C 1ZLAA 5GT3C 3LELD 1KX3D 1AOIB 3WAAB 3MGRC 1P3BA 1P3BC 3A1IA 5AV8D 5DNMC 3KWQD 3AFAC 1P34D 3NQJA 1S32C 3W99D 4J8WD 1P3KC 2F8NG 3LJAA 1N1JB 1ID3D 3AZLC 2Y2PA 3LZ0D 1S32D 5E5AD 2Y2KA 1ID3C 4QLCA 5JA4A 2CV5C 5B24B 3AZIA 3MVDD 3MGSB 5G49B 4H9RB 3WA9A 2BYKB 3A6NA 4ZUXA 3AZKC 3RELD 5B32G 2BYKA 5AV5A 4G92C 4LD9C 5CPID 5CPKC 4KUDC 5DNNB 2F8NB 5AVBA 5AY8C 3UTBB 1P3GC 2NZDD 2HIOB 5B1LB 2JCHA 4JJNB 3B6FB 2HIOA 3WKJD 3O62A 3REKA 5BT1D 5KDMA 3VH6T 5AY8D 1M19A 5AV5B 3X1UB 1P3KA 4J8UA 2NQBC 3X1VC 3X1TA 2ZY4A 3WAAA 5B24A 3RELB 3REJD 1P3LB 2AROB 4M6BA 3LZ1D 5B0ZA 3MGSD 1P3AD 3X1SD 5E5AC 3P5JB 5DNNC 3R45B 3UT9C 1Z2CB 4HGAB 1P3BD 1P3AC 3MGRD 5AV9D 3VH6W 3AZHC 1KX3B 4YS3D 4J8WB 3LELB 1TAFB 3AZKD 1P34C 5G49A 1H3OB 5B0ZC 5GXQA 3AV1D 5BS7A 3LZ0A 3REID 4WU9B 4H9OA 3AZJA 2NQBA 3UTAA 5CHLB 5AV9B 3MGQD 3V9RB 4Z66C 3B6FA 3V9RA 1BH8B 4H9NB 3AFAB 2RIQA 3X1SB 5B2IA 5DNNA 4LD9D 4WU9A 2UWXA 3B0DC 3W98C 4DRBA 3LZ1C 5JRGB 4WNNB 5JRGC 5F99D 1BH8A 3AZHA 3MGPD 1KX5C 3B0DB 4XZQD 3X1VA 2FJ7C 3VH6A 3WTPD 1HQ3D 4J8VD 3NQUA 3B0CW 4KGCC 4AWLC 5B33A 4J8XD 4NE5A 1HTAA 2NZDC 4H9RA 5B0ZD 3F6TA 1P3AB 3LJAC 1M18A 1H3OA 1F1EA 1P3AA 1ZLAD 3X1SA 3H0MC 1U35D 4Z2MH 3REJB 4UUZA 2FFFB 3W96A 3H0RC 3LJAD 2G5IC 1P34A 2LY8A 3MVDB 3REKC 5AV9A 3X1UD 3A1KA 1P34B 5CP6C 4XUJD 5B31B 5AV6C 2IO5B 1P3PD 3AV1B 3AZND 3AZID 3X1UC 5B0ZB 4J8UC 3REHD 3X1TB 3LELC 4J8WC 3RELA 3B6FC 3C1BA 5C3IB 4WU8B 2BYMA 2HIOC 3AYWC 1M18B 3AFAA 1P3GB 3WTPE 4KUDB 3AN2D 4QLCC 4QLCB 2CV5A 5CPKB 5GT3D 3X1VB 1M18C 3AZLD 3AZGB 2NZDA 3REKD 2DQNC 5AV5C 1P3KD 3RELC 1ID3B 1P3GA 5AY8A 1M19D 2RVQC 2NQBB 1U35C 5AVCA 5DNMA 5AY8B 3KXBD 3AYWA 2Y2LA 5JA4B 5CP6B 4G92B 3MGSA 3REKB 4E44A 3WAAD 3MVDC 3EPKA 3LELA 4KGCB 5CPJA 3MGRB 5B24C 3WAAC 1M18D 2BG1A 3AV2C 2Y2IA 2Y2MA 5B0YA 3B0BA 3MGRA 3MGPC 1U35A 3KXBB 5CP6A 3AZKB 2CWEA 4CAYA 1WWSA 2Y2GA 5B31C 5AV6B 4EO5C 1TZYB 4CAYB 1S32A 2DF4C 4H9SA 2YFWB 3X1UA 1P3KB 3WKJC 1S32B 1BFMA 1F66B 3AV1A 1KX5B 3REIA 3A6ND 3UTAD 5GT0A 3NQUB 5FUGA 3LJAB 1P3LD 5AV5D 4Z66B 4ZUXC 5FUGB 3C1BD 3W98A 3B6FD 4UUZB 1AOID 5AVBD 1EQZA 5GSUA 3MNNA 1KX5A 2JE5A 5GT3B 2G5HC 3AZIB 4KHAB 3WKJB 5KDMB 2JSSA 4JJND 3AZLA 5AV9C 5B1MA 5B2JC 3AZHD 1B6WA 4EO5B 1P3FA 4J8UD 4Z66D 3W98B 4WU9C 4HGAC 3AV2D 3MGPB 5B24D 2ZY5A 3X1SC 5DNMD 5E5AB 5JRGA 3C1CA 2PYOA 1KX3C 5B33D 4NFTA 2L5AA 4YS3C 3AZEB 1P3MB 5B32D 4X23B 1HQ3C 4J8VC 1U35B 3AZKA 3EG5B 2AROC 4E45A 3C1CC 2PYOC 1ULYA 3AZHB 4XUJA 3AZJD 5B1LC 5AV8C 3LZ0C 3KWQC 3UT9B 2Y2NA 5BNVB 3AZNA 4LD9B 3AYWB 5B33C 4JJNC 2VQRA 4X23D 3AFAD 5F99B 5C3IC 4WU8C 1M1AB 1P3LC 5B2ID 3X1TC 5BO0A 1P3PC 2FJ7A 5AVBC 3TU4B 1EQZD 4H9PA 5B1LA 1KX5D 3TU4A 4KUDD 2AROD 3AZGD 3AZLB 3MGSC 2CV5B 1BH9A 3B0CT 2BYMB 5CPIC 5AVCD 4R8PA 5CPKD 1P3IA 1P3OA 5B2IB 3REHC 5B40B 4R8PB 1P3BB 1M1AD 3AZEA 1P3MA 2Y2JA 3KXBA 1AOIC 4YM6A 1KX4A 5BT1C 2NZDB 5GT0B 3C1CD 2PYOD 3UTBD 5CPJD 3AZMC 4AWLB 3AZJC 1P3PB 3AL0C 5B0YD 3W96D 5CP6D 2HUEC 4H9SC 5B32A 3W97B 3KUYC 2ZY3A 3A6NB 1TAFA 4NE6A 4J8WA 1KX4B 5B1MC 5B2JA 1P3FC 4YM6C 1ID3A 5GXQB 3LZ1B 4G91B 3FDDA 5B0YB 4DRAA 3B6GA 3AZFD 5B40A 5DNMB 4NE3A 5E5AA 3MNNB 3REHA 5CPJB 1W2EA 5GSUC 5AV6A 5GT0D 3C1CB 1P3OC 1EQZC 2PYOB 4J8XB 4QLCD 3MVDA 1A7WA 3O62B 4Z5TD 3KUYA 3WTPC 1HQ3B 4J8VB 4X23C 5GSUD 3W96C 1B67A 4XZQB 4UPKA 3REIC 3W98D 1P3IB 1F66A 2F8ND 3B6GC 3MNND 1M19C 3AZFB 5B1MD 3O62C 1P3FD 4WU8A 1R4VA 3C1BB 5B31D 1JFIA 1TZYA 4J8XC 4JJNA 2J8PA 4XUJB 1EQZB 1BH9B 1T3UA 1M19B 2F8NK 5B0YC 5CPKA 3R45A 1P3OD 3AV2A 3EPHA 1KU5A 2YFVA 4XZQC 3REIB 4XUJC 2F2AC 5B1MB 1P3FB 3AZMA 3MGQB 3A6NC 3LZ1A 4YM6D 3B6GB 2HUEB 2Y2OA 5BNXB 5B32C 3W99B 5GSUB 3VH5W 3W99A 3EPJA 3WTPB 4G91C 3W97A 1KX4C 3UT9D 5B2JD 3UTAC 4KGCA 1PZRA 5GXQD 1F66C 3AN2C 3VH5T 3UTBC 2Y2QA 3B6GD 2ZM5A 3AZFA 4YM6B 4ZBJC 1ZLAC 1P3LA 2Y2HA 2NQBD 4X23A 3W97C 3VH5A 3WA9D 3KXBC 1AOIA 4Z5TA 3TU4C 4ZBJB 3AV2B 1ZLAB 3AZNC 2F8NH 1WWIA 3KSYA 4WV4B 5B1LD 5BNVA 4R8PC 5CPIA 5B40C 4WJ3C 3AZMB 5DNND 4WU9D 5CPIB 3AZGA 4Z66A 2AROA 2HIOD 4R8PD 1N1JA 4WU8D 1P3ID 3O62D 5F99A 3IP4C 3AN2B 5B2IC 3X1TD 3REHB 1M1AA 3KFUG 1Q9CA 3REJA 5B31G 4H9QA 5JRGD 2RVQD 3AZNB 5BS7C 5B32B 3AZED 1P3MD 3AZMD 3AZGC 1KX3A 5B33B 1KX4D 3MGQC 5AVBB 3UTBA 5AV8A 3KWQA 3AZEC 1P3MC 5BO0B 3W99C 3LZ0B 5AV8B 3KWQB 1M1AC 4YS3A 5F99C 3UTAB 3W97D 3WA9C 4WNNA 4J8UB 2YFWA 3AZFC 3UT9A 3AV1C 2IO5C 4KGCD 1P3PA 5AVCC 5B40D 3MGQA 4YS3B 4ZUXD 5AV6D 4Z5TC 3KUYD 2YFVB 3H0LC
chains in the Genus database with same CATH topology
4Z5TB 4CSRA 2XD1A 3REJC 2FJ7D 4H9PB 2F8NA 5AVCB 5CPJC 4H9OB 5BNXA 3MNNC 3AN2A 3TU4D 2CV5D 4KUDA 4DQYB 5GT3A 4LD9A 4KHAA 3WKJA 5GXQC 4H9QB 4WZSB 1F66D 5B2JB 3C1BC 3WA9B 1P3OB 4H9NA 4Z2MG 4XZQA 5B31A 3EPLA 1TZYD 3X1VD 3KUYB 4CSRB 3AZIC 2XD5A 1HQ3A 3MGPA 4J8VA 2FJ7B 1P3GD 1P3IC 2ZY2A 3NQJB 3WTPA 3AZJB 4J8XA 1TZYC 1JFIB 3W96B 3AYWD 4ZUXB 2W8SA 5GT0C 1ZLAA 5GT3C 3LELD 1KX3D 1AOIB 3WAAB 3MGRC 1P3BA 1P3BC 3A1IA 5AV8D 5DNMC 3KWQD 3AFAC 1P34D 3NQJA 1S32C 3W99D 4J8WD 1P3KC 2F8NG 3LJAA 1N1JB 1ID3D 3AZLC 2Y2PA 3LZ0D 1S32D 5E5AD 2Y2KA 1ID3C 4QLCA 5JA4A 2CV5C 5B24B 3AZIA 3MVDD 3MGSB 5G49B 4H9RB 3WA9A 2BYKB 3A6NA 4ZUXA 3AZKC 3RELD 5B32G 2BYKA 5AV5A 4G92C 4LD9C 5CPID 5CPKC 4KUDC 5DNNB 2F8NB 5AVBA 5AY8C 3UTBB 1P3GC 2NZDD 2HIOB 5B1LB 2JCHA 4JJNB 3B6FB 2HIOA 3WKJD 3O62A 3REKA 5BT1D 5KDMA 3VH6T 5AY8D 1M19A 5AV5B 3X1UB 1P3KA 4J8UA 2NQBC 3X1VC 3X1TA 2ZY4A 3WAAA 5B24A 3RELB 3REJD 1P3LB 2AROB 4M6BA 3LZ1D 5B0ZA 3MGSD 1P3AD 3X1SD 5E5AC 3P5JB 5DNNC 3R45B 3UT9C 1Z2CB 4HGAB 1P3BD 1P3AC 3MGRD 5AV9D 3VH6W 3AZHC 1KX3B 4YS3D 4J8WB 3LELB 1TAFB 3AZKD 1P34C 5G49A 1H3OB 5B0ZC 5GXQA 3AV1D 5BS7A 3LZ0A 3REID 4WU9B 4H9OA 3AZJA 2NQBA 3UTAA 5CHLB 5AV9B 3MGQD 3V9RB 4Z66C 3B6FA 3V9RA 1BH8B 4H9NB 3AFAB 2RIQA 3X1SB 5B2IA 5DNNA 4LD9D 4WU9A 2UWXA 3B0DC 3W98C 4DRBA 3LZ1C 5JRGB 4WNNB 5JRGC 5F99D 1BH8A 3AZHA 3MGPD 1KX5C 3B0DB 4XZQD 3X1VA 2FJ7C 3VH6A 3WTPD 1HQ3D 4J8VD 3NQUA 3B0CW 4KGCC 4AWLC 5B33A 4J8XD 4NE5A 1HTAA 2NZDC 4H9RA 5B0ZD 3F6TA 1P3AB 3LJAC 1M18A 1H3OA 1F1EA 1P3AA 1ZLAD 3X1SA 3H0MC 1U35D 4Z2MH 3REJB 4UUZA 2FFFB 3W96A 3H0RC 3LJAD 2G5IC 1P34A 2LY8A 3MVDB 3REKC 5AV9A 3X1UD 3A1KA 1P34B 5CP6C 4XUJD 5B31B 5AV6C 2IO5B 1P3PD 3AV1B 3AZND 3AZID 3X1UC 5B0ZB 4J8UC 3REHD 3X1TB 3LELC 4J8WC 3RELA 3B6FC 3C1BA 5C3IB 4WU8B 2BYMA 2HIOC 3AYWC 1M18B 3AFAA 1P3GB 3WTPE 4KUDB 3AN2D 4QLCC 4QLCB 2CV5A 5CPKB 5GT3D 3X1VB 1M18C 3AZLD 3AZGB 2NZDA 3REKD 2DQNC 5AV5C 1P3KD 3RELC 1ID3B 1P3GA 5AY8A 1M19D 2RVQC 2NQBB 1U35C 5AVCA 5DNMA 5AY8B 3KXBD 3AYWA 2Y2LA 5JA4B 5CP6B 4G92B 3MGSA 3REKB 4E44A 3WAAD 3MVDC 3EPKA 3LELA 4KGCB 5CPJA 3MGRB 5B24C 3WAAC 1M18D 2BG1A 3AV2C 2Y2IA 2Y2MA 5B0YA 3B0BA 3MGRA 3MGPC 1U35A 3KXBB 5CP6A 3AZKB 2CWEA 4CAYA 1WWSA 2Y2GA 5B31C 5AV6B 4EO5C 1TZYB 4CAYB 1S32A 2DF4C 4H9SA 2YFWB 3X1UA 1P3KB 3WKJC 1S32B 1BFMA 1F66B 3AV1A 1KX5B 3REIA 3A6ND 3UTAD 5GT0A 3NQUB 5FUGA 3LJAB 1P3LD 5AV5D 4Z66B 4ZUXC 5FUGB 3C1BD 3W98A 3B6FD 4UUZB 1AOID 5AVBD 1EQZA 5GSUA 3MNNA 1KX5A 2JE5A 5GT3B 2G5HC 3AZIB 4KHAB 3WKJB 5KDMB 2JSSA 4JJND 3AZLA 5AV9C 5B1MA 5B2JC 3AZHD 1B6WA 4EO5B 1P3FA 4J8UD 4Z66D 3W98B 4WU9C 4HGAC 3AV2D 3MGPB 5B24D 2ZY5A 3X1SC 5DNMD 5E5AB 5JRGA 3C1CA 2PYOA 1KX3C 5B33D 4NFTA 2L5AA 4YS3C 3AZEB 1P3MB 5B32D 4X23B 1HQ3C 4J8VC 1U35B 3AZKA 3EG5B 2AROC 4E45A 3C1CC 2PYOC 1ULYA 3AZHB 4XUJA 3AZJD 5B1LC 5AV8C 3LZ0C 3KWQC 3UT9B 2Y2NA 5BNVB 3AZNA 4LD9B 3AYWB 5B33C 4JJNC 2VQRA 4X23D 3AFAD 5F99B 5C3IC 4WU8C 1M1AB 1P3LC 5B2ID 3X1TC 5BO0A 1P3PC 2FJ7A 5AVBC 3TU4B 1EQZD 4H9PA 5B1LA 1KX5D 3TU4A 4KUDD 2AROD 3AZGD 3AZLB 3MGSC 2CV5B 1BH9A 3B0CT 2BYMB 5CPIC 5AVCD 4R8PA 5CPKD 1P3IA 1P3OA 5B2IB 3REHC 5B40B 4R8PB 1P3BB 1M1AD 3AZEA 1P3MA 2Y2JA 3KXBA 1AOIC 4YM6A 1KX4A 5BT1C 2NZDB 5GT0B 3C1CD 2PYOD 3UTBD 5CPJD 3AZMC 4AWLB 3AZJC 1P3PB 3AL0C 5B0YD 3W96D 5CP6D 2HUEC 4H9SC 5B32A 3W97B 3KUYC 2ZY3A 3A6NB 1TAFA 4NE6A 4J8WA 1KX4B 5B1MC 5B2JA 1P3FC 4YM6C 1ID3A 5GXQB 3LZ1B 4G91B 3FDDA 5B0YB 4DRAA 3B6GA 3AZFD 5B40A 5DNMB 4NE3A 5E5AA 3MNNB 3REHA 5CPJB 1W2EA 5GSUC 5AV6A 5GT0D 3C1CB 1P3OC 1EQZC 2PYOB 4J8XB 4QLCD 3MVDA 1A7WA 3O62B 4Z5TD 3KUYA 3WTPC 1HQ3B 4J8VB 4X23C 5GSUD 3W96C 1B67A 4XZQB 4UPKA 3REIC 3W98D 1P3IB 1F66A 2F8ND 3B6GC 3MNND 1M19C 3AZFB 5B1MD 3O62C 1P3FD 4WU8A 1R4VA 3C1BB 5B31D 1JFIA 1TZYA 4J8XC 4JJNA 2J8PA 4XUJB 1EQZB 1BH9B 1T3UA 1M19B 2F8NK 5B0YC 5CPKA 3R45A 1P3OD 3AV2A 3EPHA 1KU5A 2YFVA 4XZQC 3REIB 4XUJC 2F2AC 5B1MB 1P3FB 3AZMA 3MGQB 3A6NC 3LZ1A 4YM6D 3B6GB 2HUEB 2Y2OA 5BNXB 5B32C 3W99B 5GSUB 3VH5W 3W99A 3EPJA 3WTPB 4G91C 3W97A 1KX4C 3UT9D 5B2JD 3UTAC 4KGCA 1PZRA 5GXQD 1F66C 3AN2C 3VH5T 3UTBC 2Y2QA 3B6GD 2ZM5A 3AZFA 4YM6B 4ZBJC 1ZLAC 1P3LA 2Y2HA 2NQBD 4X23A 3W97C 3VH5A 3WA9D 3KXBC 1AOIA 4Z5TA 3TU4C 4ZBJB 3AV2B 1ZLAB 3AZNC 2F8NH 1WWIA 3KSYA 4WV4B 5B1LD 5BNVA 4R8PC 5CPIA 5B40C 4WJ3C 3AZMB 5DNND 4WU9D 5CPIB 3AZGA 4Z66A 2AROA 2HIOD 4R8PD 1N1JA 4WU8D 1P3ID 3O62D 5F99A 3IP4C 3AN2B 5B2IC 3X1TD 3REHB 1M1AA 3KFUG 1Q9CA 3REJA 5B31G 4H9QA 5JRGD 2RVQD 3AZNB 5BS7C 5B32B 3AZED 1P3MD 3AZMD 3AZGC 1KX3A 5B33B 1KX4D 3MGQC 5AVBB 3UTBA 5AV8A 3KWQA 3AZEC 1P3MC 5BO0B 3W99C 3LZ0B 5AV8B 3KWQB 1M1AC 4YS3A 5F99C 3UTAB 3W97D 3WA9C 4WNNA 4J8UB 2YFWA 3AZFC 3UT9A 3AV1C 2IO5C 4KGCD 1P3PA 5AVCC 5B40D 3MGQA 4YS3B 4ZUXD 5AV6D 4Z5TC 3KUYD 2YFVB 3H0LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5T B;  4CSR A;  2FJ7 D;  3REJ C;  4H9P B;  2F8N A;  5AVC B;  5CPJ C;  4H9O B;  5BNX A;  3MNN C;  3AN2 A;  3TU4 D;  2CV5 D;  4KUD A;  5GT3 A;  4LD9 A;  4KHA A;  3WKJ A;  5GXQ C;  4H9Q B;  4WZS B;  1F66 D;  5B2J B;  3C1B C;  3WA9 B;  1P3O B;  4H9N A;  4Z2M G;  4XZQ A;  5B31 A;  3X1V D;  1TZY D;  3KUY B;  4CSR B;  3AZI C;  1HQ3 A;  3MGP A;  4J8V A;  2FJ7 B;  1P3G D;  1P3I C;  3NQJ B;  3WTP A;  3AZJ B;  4J8X A;  1TZY C;  1JFI B;  3W96 B;  3AYW D;  4ZUX B;  5GT0 C;  1ZLA A;  5GT3 C;  3LEL D;  1KX3 D;  1AOI B;  3WAA B;  3MGR C;  1P3B A;  1P3B C;  5AV8 D;  5DNM C;  3KWQ D;  3AFA C;  1P34 D;  3NQJ A;  1S32 C;  3W99 D;  4J8W D;  1P3K C;  2F8N G;  3LJA A;  1N1J B;  1ID3 D;  3AZL C;  3LZ0 D;  1S32 D;  5E5A D;  1ID3 C;  4QLC A;  5JA4 A;  2CV5 C;  5B24 B;  3AZI A;  3MVD D;  3MGS B;  5G49 B;  4H9R B;  3WA9 A;  2BYK B;  3A6N A;  4ZUX A;  3AZK C;  3REL D;  5B32 G;  2BYK A;  5AV5 A;  4G92 C;  4LD9 C;  5CPI D;  5CPK C;  4KUD C;  5DNN B;  2F8N B;  5AVB A;  5AY8 C;  3UTB B;  1P3G C;  2NZD D;  2HIO B;  5B1L B;  4JJN B;  3B6F B;  2HIO A;  3WKJ D;  3O62 A;  3REK A;  5BT1 D;  5KDM A;  3VH6 T;  5AY8 D;  1M19 A;  5AV5 B;  3X1U B;  1P3K A;  4J8U A;  2NQB C;  3X1V C;  3X1T A;  3WAA A;  5B24 A;  3REL B;  3REJ D;  1P3L B;  2ARO B;  4M6B A;  3LZ1 D;  5B0Z A;  3MGS D;  1P3A D;  3X1S D;  5E5A C;  5DNN C;  3R45 B;  3UT9 C;  4HGA B;  1P3B D;  1P3A C;  3MGR D;  5AV9 D;  3VH6 W;  3AZH C;  1KX3 B;  4YS3 D;  4J8W B;  3LEL B;  1TAF B;  3AZK D;  1P34 C;  5G49 A;  1H3O B;  5B0Z C;  5GXQ A;  3AV1 D;  5BS7 A;  3LZ0 A;  3REI D;  4WU9 B;  4H9O A;  3AZJ A;  2NQB A;  3UTA A;  5CHL B;  5AV9 B;  3MGQ D;  3V9R B;  4Z66 C;  3B6F A;  3V9R A;  1BH8 B;  4H9N B;  3AFA B;  3X1S B;  5B2I A;  5DNN A;  4LD9 D;  4WU9 A;  3B0D C;  3W98 C;  4DRB A;  3LZ1 C;  5JRG B;  4WNN B;  5JRG C;  5F99 D;  1BH8 A;  3AZH A;  3MGP D;  1KX5 C;  3B0D B;  4XZQ D;  3X1V A;  2FJ7 C;  3VH6 A;  3WTP D;  1HQ3 D;  4J8V D;  3NQU A;  3B0C W;  4KGC C;  4AWL C;  5B33 A;  4J8X D;  4NE5 A;  1HTA A;  2NZD C;  4H9R A;  5B0Z D;  1P3A B;  3LJA C;  1M18 A;  1H3O A;  1F1E A;  1P3A A;  1ZLA D;  3X1S A;  1U35 D;  4Z2M H;  3REJ B;  4UUZ A;  3W96 A;  3LJA D;  1P34 A;  2LY8 A;  3MVD B;  3REK C;  5AV9 A;  3X1U D;  1P34 B;  5CP6 C;  4XUJ D;  5B31 B;  5AV6 C;  2IO5 B;  1P3P D;  3AV1 B;  3AZN D;  3AZI D;  3X1U C;  5B0Z B;  4J8U C;  3REH D;  3X1T B;  3LEL C;  4J8W C;  3REL A;  3B6F C;  3C1B A;  5C3I B;  4WU8 B;  2BYM A;  2HIO C;  3AYW C;  1M18 B;  3AFA A;  1P3G B;  3WTP E;  4KUD B;  3AN2 D;  4QLC C;  4QLC B;  2CV5 A;  5CPK B;  5GT3 D;  3X1V B;  1M18 C;  3AZL D;  3AZG B;  2NZD A;  3REK D;  5AV5 C;  1P3K D;  3REL C;  1ID3 B;  1P3G A;  5AY8 A;  1M19 D;  2RVQ C;  2NQB B;  1U35 C;  5AVC A;  5DNM A;  5AY8 B;  3KXB D;  3AYW A;  5JA4 B;  5CP6 B;  4G92 B;  3MGS A;  3REK B;  4E44 A;  3WAA D;  3MVD C;  3LEL A;  4KGC B;  5CPJ A;  3MGR B;  5B24 C;  3WAA C;  1M18 D;  3AV2 C;  5B0Y A;  3B0B A;  3MGR A;  3MGP C;  1U35 A;  3KXB B;  5CP6 A;  3AZK B;  2CWE A;  4CAY A;  1WWS A;  5B31 C;  5AV6 B;  4EO5 C;  1TZY B;  4CAY B;  1S32 A;  4H9S A;  2YFW B;  3X1U A;  1P3K B;  3WKJ C;  1S32 B;  1BFM A;  1F66 B;  3AV1 A;  1KX5 B;  3REI A;  3A6N D;  3UTA D;  5GT0 A;  3NQU B;  5FUG A;  3LJA B;  1P3L D;  5AV5 D;  4Z66 B;  4ZUX C;  5FUG B;  3C1B D;  3W98 A;  3B6F D;  4UUZ B;  1AOI D;  5AVB D;  1EQZ A;  5GSU A;  3MNN A;  1KX5 A;  5GT3 B;  3AZI B;  4KHA B;  3WKJ B;  5KDM B;  2JSS A;  4JJN D;  3AZL A;  5AV9 C;  5B1M A;  5B2J C;  3AZH D;  1B6W A;  4EO5 B;  1P3F A;  4J8U D;  4Z66 D;  3W98 B;  4WU9 C;  4HGA C;  3AV2 D;  3MGP B;  5B24 D;  3X1S C;  5DNM D;  5E5A B;  5JRG A;  3C1C A;  2PYO A;  1KX3 C;  5B33 D;  4NFT A;  2L5A A;  4YS3 C;  3AZE B;  1P3M B;  5B32 D;  4X23 B;  1HQ3 C;  4J8V C;  1U35 B;  3AZK A;  2ARO C;  4E45 A;  3C1C C;  2PYO C;  1ULY A;  3AZH B;  4XUJ A;  3AZJ D;  5B1L C;  5AV8 C;  3LZ0 C;  3KWQ C;  3UT9 B;  5BNV B;  3AZN A;  4LD9 B;  3AYW B;  5B33 C;  4JJN C;  4X23 D;  3AFA D;  5F99 B;  5C3I C;  4WU8 C;  1M1A B;  1P3L C;  5B2I D;  3X1T C;  5BO0 A;  1P3P C;  2FJ7 A;  5AVB C;  3TU4 B;  1EQZ D;  4H9P A;  5B1L A;  1KX5 D;  3TU4 A;  4KUD D;  2ARO D;  3AZG D;  3AZL B;  3MGS C;  2CV5 B;  1BH9 A;  3B0C T;  2BYM B;  5CPI C;  5AVC D;  4R8P A;  5CPK D;  1P3I A;  1P3O A;  5B2I B;  3REH C;  5B40 B;  4R8P B;  1P3B B;  1M1A D;  3AZE A;  1P3M A;  3KXB A;  1AOI C;  4YM6 A;  1KX4 A;  5BT1 C;  2NZD B;  5GT0 B;  3C1C D;  2PYO D;  3UTB D;  5CPJ D;  3AZM C;  4AWL B;  3AZJ C;  1P3P B;  5B0Y D;  3W96 D;  5CP6 D;  2HUE C;  4H9S C;  5B32 A;  3W97 B;  3KUY C;  3A6N B;  1TAF A;  4NE6 A;  4J8W A;  1KX4 B;  5B1M C;  5B2J A;  1P3F C;  4YM6 C;  1ID3 A;  5GXQ B;  3LZ1 B;  4G91 B;  5B0Y B;  4DRA A;  3B6G A;  3AZF D;  5B40 A;  5DNM B;  4NE3 A;  5E5A A;  3MNN B;  3REH A;  5CPJ B;  5AV6 A;  5GSU C;  1EQZ C;  5GT0 D;  3C1C B;  1P3O C;  2PYO B;  4J8X B;  4QLC D;  3MVD A;  1A7W A;  3O62 B;  4Z5T D;  3KUY A;  3WTP C;  1HQ3 B;  4J8V B;  4X23 C;  5GSU D;  3W96 C;  1B67 A;  4XZQ B;  3REI C;  3W98 D;  1P3I B;  1F66 A;  2F8N D;  3B6G C;  3MNN D;  1M19 C;  3AZF B;  5B1M D;  3O62 C;  1P3F D;  4WU8 A;  1R4V A;  3C1B B;  5B31 D;  1JFI A;  1TZY A;  4J8X C;  4JJN A;  4XUJ B;  1EQZ B;  1BH9 B;  1M19 B;  2F8N K;  5B0Y C;  5CPK A;  3R45 A;  1P3O D;  3AV2 A;  1KU5 A;  2YFV A;  4XZQ C;  3REI B;  4XUJ C;  5B1M B;  1P3F B;  3AZM A;  3MGQ B;  3A6N C;  3LZ1 A;  4YM6 D;  3B6G B;  2HUE B;  5BNX B;  5B32 C;  3W99 B;  5GSU B;  3VH5 W;  3W99 A;  3WTP B;  4G91 C;  3W97 A;  1KX4 C;  3UT9 D;  5B2J D;  3UTA C;  4KGC A;  5GXQ D;  1F66 C;  3AN2 C;  3VH5 T;  3UTB C;  3B6G D;  3AZF A;  4YM6 B;  4ZBJ C;  1ZLA C;  1P3L A;  2NQB D;  4X23 A;  3W97 C;  3VH5 A;  3WA9 D;  3KXB C;  1AOI A;  4Z5T A;  3TU4 C;  4ZBJ B;  3AV2 B;  1ZLA B;  3AZN C;  2F8N H;  1WWI A;  3KSY A;  4WV4 B;  5B1L D;  5BNV A;  4R8P C;  5CPI A;  5B40 C;  3AZM B;  5DNN D;  4WU9 D;  5CPI B;  3AZG A;  4Z66 A;  2ARO A;  2HIO D;  4R8P D;  1N1J A;  4WU8 D;  1P3I D;  3O62 D;  5F99 A;  3AN2 B;  5B2I C;  3X1T D;  3REH B;  1M1A A;  1Q9C A;  3REJ A;  5B31 G;  4H9Q A;  5JRG D;  2RVQ D;  3AZN B;  5BS7 C;  5B32 B;  3AZE D;  1P3M D;  3AZM D;  3AZG C;  1KX3 A;  5B33 B;  1KX4 D;  3MGQ C;  5AVB B;  3UTB A;  5AV8 A;  3KWQ A;  3AZE C;  1P3M C;  5BO0 B;  3W99 C;  3LZ0 B;  5AV8 B;  3KWQ B;  1M1A C;  4YS3 A;  5F99 C;  3UTA B;  3W97 D;  3WA9 C;  4WNN A;  4J8U B;  2YFW A;  3AZF C;  3UT9 A;  3AV1 C;  2IO5 C;  4KGC D;  1P3P A;  5AVC C;  5B40 D;  3MGQ A;  4YS3 B;  4ZUX D;  5AV6 D;  4Z5T C;  3KUY D;  2YFV B; 
#chains in the Genus database with same CATH topology
 4Z5T B;  4CSR A;  2XD1 A;  3REJ C;  2FJ7 D;  4H9P B;  2F8N A;  5AVC B;  5CPJ C;  4H9O B;  5BNX A;  3MNN C;  3AN2 A;  3TU4 D;  2CV5 D;  4KUD A;  4DQY B;  5GT3 A;  4LD9 A;  4KHA A;  3WKJ A;  5GXQ C;  4H9Q B;  4WZS B;  1F66 D;  5B2J B;  3C1B C;  3WA9 B;  1P3O B;  4H9N A;  4Z2M G;  4XZQ A;  5B31 A;  3EPL A;  1TZY D;  3X1V D;  3KUY B;  4CSR B;  3AZI C;  2XD5 A;  1HQ3 A;  3MGP A;  4J8V A;  2FJ7 B;  1P3G D;  1P3I C;  2ZY2 A;  3NQJ B;  3WTP A;  3AZJ B;  4J8X A;  1TZY C;  1JFI B;  3W96 B;  3AYW D;  4ZUX B;  2W8S A;  5GT0 C;  1ZLA A;  5GT3 C;  3LEL D;  1KX3 D;  1AOI B;  3WAA B;  3MGR C;  1P3B A;  1P3B C;  3A1I A;  5AV8 D;  5DNM C;  3KWQ D;  3AFA C;  1P34 D;  3NQJ A;  1S32 C;  3W99 D;  4J8W D;  1P3K C;  2F8N G;  3LJA A;  1N1J B;  1ID3 D;  3AZL C;  2Y2P A;  3LZ0 D;  1S32 D;  5E5A D;  2Y2K A;  1ID3 C;  4QLC A;  5JA4 A;  2CV5 C;  5B24 B;  3AZI A;  3MVD D;  3MGS B;  5G49 B;  4H9R B;  3WA9 A;  2BYK B;  3A6N A;  4ZUX A;  3AZK C;  3REL D;  5B32 G;  2BYK A;  5AV5 A;  4G92 C;  4LD9 C;  5CPI D;  5CPK C;  4KUD C;  5DNN B;  2F8N B;  5AVB A;  5AY8 C;  3UTB B;  1P3G C;  2NZD D;  2HIO B;  5B1L B;  2JCH A;  4JJN B;  3B6F B;  2HIO A;  3WKJ D;  3O62 A;  3REK A;  5BT1 D;  5KDM A;  3VH6 T;  5AY8 D;  1M19 A;  5AV5 B;  3X1U B;  1P3K A;  4J8U A;  2NQB C;  3X1V C;  3X1T A;  2ZY4 A;  3WAA A;  5B24 A;  3REL B;  3REJ D;  1P3L B;  2ARO B;  4M6B A;  3LZ1 D;  5B0Z A;  3MGS D;  1P3A D;  3X1S D;  5E5A C;  3P5J B;  5DNN C;  3R45 B;  3UT9 C;  1Z2C B;  4HGA B;  1P3B D;  1P3A C;  3MGR D;  5AV9 D;  3VH6 W;  3AZH C;  1KX3 B;  4YS3 D;  4J8W B;  3LEL B;  1TAF B;  3AZK D;  1P34 C;  5G49 A;  1H3O B;  5B0Z C;  5GXQ A;  3AV1 D;  5BS7 A;  3LZ0 A;  3REI D;  4WU9 B;  4H9O A;  3AZJ A;  2NQB A;  3UTA A;  5CHL B;  5AV9 B;  3MGQ D;  3V9R B;  4Z66 C;  3B6F A;  3V9R A;  1BH8 B;  4H9N B;  3AFA B;  2RIQ A;  3X1S B;  5B2I A;  5DNN A;  4LD9 D;  4WU9 A;  2UWX A;  3B0D C;  3W98 C;  4DRB A;  3LZ1 C;  5JRG B;  4WNN B;  5JRG C;  5F99 D;  1BH8 A;  3AZH A;  3MGP D;  1KX5 C;  3B0D B;  4XZQ D;  3X1V A;  2FJ7 C;  3VH6 A;  3WTP D;  1HQ3 D;  4J8V D;  3NQU A;  3B0C W;  4KGC C;  4AWL C;  5B33 A;  4J8X D;  4NE5 A;  1HTA A;  2NZD C;  4H9R A;  5B0Z D;  3F6T A;  1P3A B;  3LJA C;  1M18 A;  1H3O A;  1F1E A;  1P3A A;  1ZLA D;  3X1S A;  3H0M C;  1U35 D;  4Z2M H;  3REJ B;  4UUZ A;  2FFF B;  3W96 A;  3H0R C;  3LJA D;  2G5I C;  1P34 A;  2LY8 A;  3MVD B;  3REK C;  5AV9 A;  3X1U D;  3A1K A;  1P34 B;  5CP6 C;  4XUJ D;  5B31 B;  5AV6 C;  2IO5 B;  1P3P D;  3AV1 B;  3AZN D;  3AZI D;  3X1U C;  5B0Z B;  4J8U C;  3REH D;  3X1T B;  3LEL C;  4J8W C;  3REL A;  3B6F C;  3C1B A;  5C3I B;  4WU8 B;  2BYM A;  2HIO C;  3AYW C;  1M18 B;  3AFA A;  1P3G B;  3WTP E;  4KUD B;  3AN2 D;  4QLC C;  4QLC B;  2CV5 A;  5CPK B;  5GT3 D;  3X1V B;  1M18 C;  3AZL D;  3AZG B;  2NZD A;  3REK D;  2DQN C;  5AV5 C;  1P3K D;  3REL C;  1ID3 B;  1P3G A;  5AY8 A;  1M19 D;  2RVQ C;  2NQB B;  1U35 C;  5AVC A;  5DNM A;  5AY8 B;  3KXB D;  3AYW A;  2Y2L A;  5JA4 B;  5CP6 B;  4G92 B;  3MGS A;  3REK B;  4E44 A;  3WAA D;  3MVD C;  3EPK A;  3LEL A;  4KGC B;  5CPJ A;  3MGR B;  5B24 C;  3WAA C;  1M18 D;  2BG1 A;  3AV2 C;  2Y2I A;  2Y2M A;  5B0Y A;  3B0B A;  3MGR A;  3MGP C;  1U35 A;  3KXB B;  5CP6 A;  3AZK B;  2CWE A;  4CAY A;  1WWS A;  2Y2G A;  5B31 C;  5AV6 B;  4EO5 C;  1TZY B;  4CAY B;  1S32 A;  2DF4 C;  4H9S A;  2YFW B;  3X1U A;  1P3K B;  3WKJ C;  1S32 B;  1BFM A;  1F66 B;  3AV1 A;  1KX5 B;  3REI A;  3A6N D;  3UTA D;  5GT0 A;  3NQU B;  5FUG A;  3LJA B;  1P3L D;  5AV5 D;  4Z66 B;  4ZUX C;  5FUG B;  3C1B D;  3W98 A;  3B6F D;  4UUZ B;  1AOI D;  5AVB D;  1EQZ A;  5GSU A;  3MNN A;  1KX5 A;  2JE5 A;  5GT3 B;  2G5H C;  3AZI B;  4KHA B;  3WKJ B;  5KDM B;  2JSS A;  4JJN D;  3AZL A;  5AV9 C;  5B1M A;  5B2J C;  3AZH D;  1B6W A;  4EO5 B;  1P3F A;  4J8U D;  4Z66 D;  3W98 B;  4WU9 C;  4HGA C;  3AV2 D;  3MGP B;  5B24 D;  2ZY5 A;  3X1S C;  5DNM D;  5E5A B;  5JRG A;  3C1C A;  2PYO A;  1KX3 C;  5B33 D;  4NFT A;  2L5A A;  4YS3 C;  3AZE B;  1P3M B;  5B32 D;  4X23 B;  1HQ3 C;  4J8V C;  1U35 B;  3AZK A;  3EG5 B;  2ARO C;  4E45 A;  3C1C C;  2PYO C;  1ULY A;  3AZH B;  4XUJ A;  3AZJ D;  5B1L C;  5AV8 C;  3LZ0 C;  3KWQ C;  3UT9 B;  2Y2N A;  5BNV B;  3AZN A;  4LD9 B;  3AYW B;  5B33 C;  4JJN C;  2VQR A;  4X23 D;  3AFA D;  5F99 B;  5C3I C;  4WU8 C;  1M1A B;  1P3L C;  5B2I D;  3X1T C;  5BO0 A;  1P3P C;  2FJ7 A;  5AVB C;  3TU4 B;  1EQZ D;  4H9P A;  5B1L A;  1KX5 D;  3TU4 A;  4KUD D;  2ARO D;  3AZG D;  3AZL B;  3MGS C;  2CV5 B;  1BH9 A;  3B0C T;  2BYM B;  5CPI C;  5AVC D;  4R8P A;  5CPK D;  1P3I A;  1P3O A;  5B2I B;  3REH C;  5B40 B;  4R8P B;  1P3B B;  1M1A D;  3AZE A;  1P3M A;  2Y2J A;  3KXB A;  1AOI C;  4YM6 A;  1KX4 A;  5BT1 C;  2NZD B;  5GT0 B;  3C1C D;  2PYO D;  3UTB D;  5CPJ D;  3AZM C;  4AWL B;  3AZJ C;  1P3P B;  3AL0 C;  5B0Y D;  3W96 D;  5CP6 D;  2HUE C;  4H9S C;  5B32 A;  3W97 B;  3KUY C;  2ZY3 A;  3A6N B;  1TAF A;  4NE6 A;  4J8W A;  1KX4 B;  5B1M C;  5B2J A;  1P3F C;  4YM6 C;  1ID3 A;  5GXQ B;  3LZ1 B;  4G91 B;  3FDD A;  5B0Y B;  4DRA A;  3B6G A;  3AZF D;  5B40 A;  5DNM B;  4NE3 A;  5E5A A;  3MNN B;  3REH A;  5CPJ B;  1W2E A;  5GSU C;  5AV6 A;  5GT0 D;  3C1C B;  1P3O C;  1EQZ C;  2PYO B;  4J8X B;  4QLC D;  3MVD A;  1A7W A;  3O62 B;  4Z5T D;  3KUY A;  3WTP C;  1HQ3 B;  4J8V B;  4X23 C;  5GSU D;  3W96 C;  1B67 A;  4XZQ B;  4UPK A;  3REI C;  3W98 D;  1P3I B;  1F66 A;  2F8N D;  3B6G C;  3MNN D;  1M19 C;  3AZF B;  5B1M D;  3O62 C;  1P3F D;  4WU8 A;  1R4V A;  3C1B B;  5B31 D;  1JFI A;  1TZY A;  4J8X C;  4JJN A;  2J8P A;  4XUJ B;  1EQZ B;  1BH9 B;  1T3U A;  1M19 B;  2F8N K;  5B0Y C;  5CPK A;  3R45 A;  1P3O D;  3AV2 A;  3EPH A;  1KU5 A;  2YFV A;  4XZQ C;  3REI B;  4XUJ C;  2F2A C;  5B1M B;  1P3F B;  3AZM A;  3MGQ B;  3A6N C;  3LZ1 A;  4YM6 D;  3B6G B;  2HUE B;  2Y2O A;  5BNX B;  5B32 C;  3W99 B;  5GSU B;  3VH5 W;  3W99 A;  3EPJ A;  3WTP B;  4G91 C;  3W97 A;  1KX4 C;  3UT9 D;  5B2J D;  3UTA C;  4KGC A;  1PZR A;  5GXQ D;  1F66 C;  3AN2 C;  3VH5 T;  3UTB C;  2Y2Q A;  3B6G D;  2ZM5 A;  3AZF A;  4YM6 B;  4ZBJ C;  1ZLA C;  1P3L A;  2Y2H A;  2NQB D;  4X23 A;  3W97 C;  3VH5 A;  3WA9 D;  3KXB C;  1AOI A;  4Z5T A;  3TU4 C;  4ZBJ B;  3AV2 B;  1ZLA B;  3AZN C;  2F8N H;  1WWI A;  3KSY A;  4WV4 B;  5B1L D;  5BNV A;  4R8P C;  5CPI A;  5B40 C;  4WJ3 C;  3AZM B;  5DNN D;  4WU9 D;  5CPI B;  3AZG A;  4Z66 A;  2ARO A;  2HIO D;  4R8P D;  1N1J A;  4WU8 D;  1P3I D;  3O62 D;  5F99 A;  3IP4 C;  3AN2 B;  5B2I C;  3X1T D;  3REH B;  1M1A A;  3KFU G;  1Q9C A;  3REJ A;  5B31 G;  4H9Q A;  5JRG D;  2RVQ D;  3AZN B;  5BS7 C;  5B32 B;  3AZE D;  1P3M D;  3AZM D;  3AZG C;  1KX3 A;  5B33 B;  1KX4 D;  3MGQ C;  5AVB B;  3UTB A;  5AV8 A;  3KWQ A;  3AZE C;  1P3M C;  5BO0 B;  3W99 C;  3LZ0 B;  5AV8 B;  3KWQ B;  1M1A C;  4YS3 A;  5F99 C;  3UTA B;  3W97 D;  3WA9 C;  4WNN A;  4J8U B;  2YFW A;  3AZF C;  3UT9 A;  3AV1 C;  2IO5 C;  4KGC D;  1P3P A;  5AVC C;  5B40 D;  3MGQ A;  4YS3 B;  4ZUX D;  5AV6 D;  4Z5T C;  3KUY D;  2YFV B;  3H0L C; 
#chains in the Genus database with same CATH homology
 4Z5T B;  4CSR A;  2XD1 A;  3REJ C;  2FJ7 D;  4H9P B;  2F8N A;  5AVC B;  5CPJ C;  4H9O B;  5BNX A;  3MNN C;  3AN2 A;  3TU4 D;  2CV5 D;  4KUD A;  4DQY B;  5GT3 A;  4LD9 A;  4KHA A;  3WKJ A;  5GXQ C;  4H9Q B;  4WZS B;  1F66 D;  5B2J B;  3C1B C;  3WA9 B;  1P3O B;  4H9N A;  4Z2M G;  4XZQ A;  5B31 A;  3EPL A;  1TZY D;  3X1V D;  3KUY B;  4CSR B;  3AZI C;  2XD5 A;  1HQ3 A;  3MGP A;  4J8V A;  2FJ7 B;  1P3G D;  1P3I C;  2ZY2 A;  3NQJ B;  3WTP A;  3AZJ B;  4J8X A;  1TZY C;  1JFI B;  3W96 B;  3AYW D;  4ZUX B;  2W8S A;  5GT0 C;  1ZLA A;  5GT3 C;  3LEL D;  1KX3 D;  1AOI B;  3WAA B;  3MGR C;  1P3B A;  1P3B C;  3A1I A;  5AV8 D;  5DNM C;  3KWQ D;  3AFA C;  1P34 D;  3NQJ A;  1S32 C;  3W99 D;  4J8W D;  1P3K C;  2F8N G;  3LJA A;  1N1J B;  1ID3 D;  3AZL C;  2Y2P A;  3LZ0 D;  1S32 D;  5E5A D;  2Y2K A;  1ID3 C;  4QLC A;  5JA4 A;  2CV5 C;  5B24 B;  3AZI A;  3MVD D;  3MGS B;  5G49 B;  4H9R B;  3WA9 A;  2BYK B;  3A6N A;  4ZUX A;  3AZK C;  3REL D;  5B32 G;  2BYK A;  5AV5 A;  4G92 C;  4LD9 C;  5CPI D;  5CPK C;  4KUD C;  5DNN B;  2F8N B;  5AVB A;  5AY8 C;  3UTB B;  1P3G C;  2NZD D;  2HIO B;  5B1L B;  2JCH A;  4JJN B;  3B6F B;  2HIO A;  3WKJ D;  3O62 A;  3REK A;  5BT1 D;  5KDM A;  3VH6 T;  5AY8 D;  1M19 A;  5AV5 B;  3X1U B;  1P3K A;  4J8U A;  2NQB C;  3X1V C;  3X1T A;  2ZY4 A;  3WAA A;  5B24 A;  3REL B;  3REJ D;  1P3L B;  2ARO B;  4M6B A;  3LZ1 D;  5B0Z A;  3MGS D;  1P3A D;  3X1S D;  5E5A C;  3P5J B;  5DNN C;  3R45 B;  3UT9 C;  1Z2C B;  4HGA B;  1P3B D;  1P3A C;  3MGR D;  5AV9 D;  3VH6 W;  3AZH C;  1KX3 B;  4YS3 D;  4J8W B;  3LEL B;  1TAF B;  3AZK D;  1P34 C;  5G49 A;  1H3O B;  5B0Z C;  5GXQ A;  3AV1 D;  5BS7 A;  3LZ0 A;  3REI D;  4WU9 B;  4H9O A;  3AZJ A;  2NQB A;  3UTA A;  5CHL B;  5AV9 B;  3MGQ D;  3V9R B;  4Z66 C;  3B6F A;  3V9R A;  1BH8 B;  4H9N B;  3AFA B;  2RIQ A;  3X1S B;  5B2I A;  5DNN A;  4LD9 D;  4WU9 A;  2UWX A;  3B0D C;  3W98 C;  4DRB A;  3LZ1 C;  5JRG B;  4WNN B;  5JRG C;  5F99 D;  1BH8 A;  3AZH A;  3MGP D;  1KX5 C;  3B0D B;  4XZQ D;  3X1V A;  2FJ7 C;  3VH6 A;  3WTP D;  1HQ3 D;  4J8V D;  3NQU A;  3B0C W;  4KGC C;  4AWL C;  5B33 A;  4J8X D;  4NE5 A;  1HTA A;  2NZD C;  4H9R A;  5B0Z D;  3F6T A;  1P3A B;  3LJA C;  1M18 A;  1H3O A;  1F1E A;  1P3A A;  1ZLA D;  3X1S A;  3H0M C;  1U35 D;  4Z2M H;  3REJ B;  4UUZ A;  2FFF B;  3W96 A;  3H0R C;  3LJA D;  2G5I C;  1P34 A;  2LY8 A;  3MVD B;  3REK C;  5AV9 A;  3X1U D;  3A1K A;  1P34 B;  5CP6 C;  4XUJ D;  5B31 B;  5AV6 C;  2IO5 B;  1P3P D;  3AV1 B;  3AZN D;  3AZI D;  3X1U C;  5B0Z B;  4J8U C;  3REH D;  3X1T B;  3LEL C;  4J8W C;  3REL A;  3B6F C;  3C1B A;  5C3I B;  4WU8 B;  2BYM A;  2HIO C;  3AYW C;  1M18 B;  3AFA A;  1P3G B;  3WTP E;  4KUD B;  3AN2 D;  4QLC C;  4QLC B;  2CV5 A;  5CPK B;  5GT3 D;  3X1V B;  1M18 C;  3AZL D;  3AZG B;  2NZD A;  3REK D;  2DQN C;  5AV5 C;  1P3K D;  3REL C;  1ID3 B;  1P3G A;  5AY8 A;  1M19 D;  2RVQ C;  2NQB B;  1U35 C;  5AVC A;  5DNM A;  5AY8 B;  3KXB D;  3AYW A;  2Y2L A;  5JA4 B;  5CP6 B;  4G92 B;  3MGS A;  3REK B;  4E44 A;  3WAA D;  3MVD C;  3EPK A;  3LEL A;  4KGC B;  5CPJ A;  3MGR B;  5B24 C;  3WAA C;  1M18 D;  2BG1 A;  3AV2 C;  2Y2I A;  2Y2M A;  5B0Y A;  3B0B A;  3MGR A;  3MGP C;  1U35 A;  3KXB B;  5CP6 A;  3AZK B;  2CWE A;  4CAY A;  1WWS A;  2Y2G A;  5B31 C;  5AV6 B;  4EO5 C;  1TZY B;  4CAY B;  1S32 A;  2DF4 C;  4H9S A;  2YFW B;  3X1U A;  1P3K B;  3WKJ C;  1S32 B;  1BFM A;  1F66 B;  3AV1 A;  1KX5 B;  3REI A;  3A6N D;  3UTA D;  5GT0 A;  3NQU B;  5FUG A;  3LJA B;  1P3L D;  5AV5 D;  4Z66 B;  4ZUX C;  5FUG B;  3C1B D;  3W98 A;  3B6F D;  4UUZ B;  1AOI D;  5AVB D;  1EQZ A;  5GSU A;  3MNN A;  1KX5 A;  2JE5 A;  5GT3 B;  2G5H C;  3AZI B;  4KHA B;  3WKJ B;  5KDM B;  2JSS A;  4JJN D;  3AZL A;  5AV9 C;  5B1M A;  5B2J C;  3AZH D;  1B6W A;  4EO5 B;  1P3F A;  4J8U D;  4Z66 D;  3W98 B;  4WU9 C;  4HGA C;  3AV2 D;  3MGP B;  5B24 D;  2ZY5 A;  3X1S C;  5DNM D;  5E5A B;  5JRG A;  3C1C A;  2PYO A;  1KX3 C;  5B33 D;  4NFT A;  2L5A A;  4YS3 C;  3AZE B;  1P3M B;  5B32 D;  4X23 B;  1HQ3 C;  4J8V C;  1U35 B;  3AZK A;  3EG5 B;  2ARO C;  4E45 A;  3C1C C;  2PYO C;  1ULY A;  3AZH B;  4XUJ A;  3AZJ D;  5B1L C;  5AV8 C;  3LZ0 C;  3KWQ C;  3UT9 B;  2Y2N A;  5BNV B;  3AZN A;  4LD9 B;  3AYW B;  5B33 C;  4JJN C;  2VQR A;  4X23 D;  3AFA D;  5F99 B;  5C3I C;  4WU8 C;  1M1A B;  1P3L C;  5B2I D;  3X1T C;  5BO0 A;  1P3P C;  2FJ7 A;  5AVB C;  3TU4 B;  1EQZ D;  4H9P A;  5B1L A;  1KX5 D;  3TU4 A;  4KUD D;  2ARO D;  3AZG D;  3AZL B;  3MGS C;  2CV5 B;  1BH9 A;  3B0C T;  2BYM B;  5CPI C;  5AVC D;  4R8P A;  5CPK D;  1P3I A;  1P3O A;  5B2I B;  3REH C;  5B40 B;  4R8P B;  1P3B B;  1M1A D;  3AZE A;  1P3M A;  2Y2J A;  3KXB A;  1AOI C;  4YM6 A;  1KX4 A;  5BT1 C;  2NZD B;  5GT0 B;  3C1C D;  2PYO D;  3UTB D;  5CPJ D;  3AZM C;  4AWL B;  3AZJ C;  1P3P B;  3AL0 C;  5B0Y D;  3W96 D;  5CP6 D;  2HUE C;  4H9S C;  5B32 A;  3W97 B;  3KUY C;  2ZY3 A;  3A6N B;  1TAF A;  4NE6 A;  4J8W A;  1KX4 B;  5B1M C;  5B2J A;  1P3F C;  4YM6 C;  1ID3 A;  5GXQ B;  3LZ1 B;  4G91 B;  3FDD A;  5B0Y B;  4DRA A;  3B6G A;  3AZF D;  5B40 A;  5DNM B;  4NE3 A;  5E5A A;  3MNN B;  3REH A;  5CPJ B;  1W2E A;  5GSU C;  5AV6 A;  5GT0 D;  3C1C B;  1P3O C;  1EQZ C;  2PYO B;  4J8X B;  4QLC D;  3MVD A;  1A7W A;  3O62 B;  4Z5T D;  3KUY A;  3WTP C;  1HQ3 B;  4J8V B;  4X23 C;  5GSU D;  3W96 C;  1B67 A;  4XZQ B;  4UPK A;  3REI C;  3W98 D;  1P3I B;  1F66 A;  2F8N D;  3B6G C;  3MNN D;  1M19 C;  3AZF B;  5B1M D;  3O62 C;  1P3F D;  4WU8 A;  1R4V A;  3C1B B;  5B31 D;  1JFI A;  1TZY A;  4J8X C;  4JJN A;  2J8P A;  4XUJ B;  1EQZ B;  1BH9 B;  1T3U A;  1M19 B;  2F8N K;  5B0Y C;  5CPK A;  3R45 A;  1P3O D;  3AV2 A;  3EPH A;  1KU5 A;  2YFV A;  4XZQ C;  3REI B;  4XUJ C;  2F2A C;  5B1M B;  1P3F B;  3AZM A;  3MGQ B;  3A6N C;  3LZ1 A;  4YM6 D;  3B6G B;  2HUE B;  2Y2O A;  5BNX B;  5B32 C;  3W99 B;  5GSU B;  3VH5 W;  3W99 A;  3EPJ A;  3WTP B;  4G91 C;  3W97 A;  1KX4 C;  3UT9 D;  5B2J D;  3UTA C;  4KGC A;  1PZR A;  5GXQ D;  1F66 C;  3AN2 C;  3VH5 T;  3UTB C;  2Y2Q A;  3B6G D;  2ZM5 A;  3AZF A;  4YM6 B;  4ZBJ C;  1ZLA C;  1P3L A;  2Y2H A;  2NQB D;  4X23 A;  3W97 C;  3VH5 A;  3WA9 D;  3KXB C;  1AOI A;  4Z5T A;  3TU4 C;  4ZBJ B;  3AV2 B;  1ZLA B;  3AZN C;  2F8N H;  1WWI A;  3KSY A;  4WV4 B;  5B1L D;  5BNV A;  4R8P C;  5CPI A;  5B40 C;  4WJ3 C;  3AZM B;  5DNN D;  4WU9 D;  5CPI B;  3AZG A;  4Z66 A;  2ARO A;  2HIO D;  4R8P D;  1N1J A;  4WU8 D;  1P3I D;  3O62 D;  5F99 A;  3IP4 C;  3AN2 B;  5B2I C;  3X1T D;  3REH B;  1M1A A;  3KFU G;  1Q9C A;  3REJ A;  5B31 G;  4H9Q A;  5JRG D;  2RVQ D;  3AZN B;  5BS7 C;  5B32 B;  3AZE D;  1P3M D;  3AZM D;  3AZG C;  1KX3 A;  5B33 B;  1KX4 D;  3MGQ C;  5AVB B;  3UTB A;  5AV8 A;  3KWQ A;  3AZE C;  1P3M C;  5BO0 B;  3W99 C;  3LZ0 B;  5AV8 B;  3KWQ B;  1M1A C;  4YS3 A;  5F99 C;  3UTA B;  3W97 D;  3WA9 C;  4WNN A;  4J8U B;  2YFW A;  3AZF C;  3UT9 A;  3AV1 C;  2IO5 C;  4KGC D;  1P3P A;  5AVC C;  5B40 D;  3MGQ A;  4YS3 B;  4ZUX D;  5AV6 D;  4Z5T C;  3KUY D;  2YFV B;  3H0L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...