1M19D

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
total genus 34
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m19D00
3A6NA 4JJNB 5B31G 3AZIB 5BNXB 4J8WA 5B24B 2NQBC 3W99D 1P34A 4J8VB 3WAAB 4WU8D 2PYOD 1P3KD 4ZUXD 4J8XD 1KX4C 3C1CB 5AVCA 4G91B 4H9SA 5B32A 3UT9D 4H9QB 1S32D 3AZKB 1M19C 2RVQC 3LZ1B 3KUYA 3C1BB 1P3AB 3WKJD 3MGRD 3AZFC 3X1VD 5AV8C 5B31C 3NQJB 3UTAB 3WA9C 3TU4A 1AOIC 3RELD 4X23C 3LZ0D 3W97B 5BS7A 1P3OD 3AZND 5G49B 1KX3D 1H3OB 3W98D 5KDMA 1JFIB 1M19A 1P3BD 3KXBB 4WU9B 2CV5C 4LD9C 3VH6T 5AY8A 3AZEA 1TZYB 5AV8A 1ID3B 3AZJD 3MGSD 3KWQD 4H9NB 3AZHA 1AOIA 4NE6A 1ZLAA 3NQUA 4UUZB 1EQZC 1BH8B 4YS3D 3X1UC 2BYMA 5AV9A 4AWLC 3UTBA 2FJ7C 1KX5B 5CP6C 4LD9A 2CV5A 1P3MC 5B1MB 1U35C 3A6NB 3REHB 4Z2MH 1P3IB 3AN2C 5B40B 1P34D 5B1LC 4QLCC 3AFAC 5AVCD 3MNND 4J8WB 4KUDB 4Z5TB 5E5AC 5CPJB 1P3PC 3AZIA 1P3FA 1HTAA 5F99C 3X1TD 5BNXA 3KUYB 5GSUC 5B24A 1F66D 4J8VA 2AROA 2NZDC 4Z66D 3TU4D 1U35A 5GT0D 5B2JC 5AV6D 1N1JA 5B1LA 4H9QA 4QLCA 4WU8C 3AZKA 3AV2C 4ZUXC 3C1BA 3B0DC 1P3AA 3AZMD 2NQBB 5E5AA 2YFWA 5C3IC 5AV5D 3UT9C 1S32C 1P3PA 1KX4B 2L5AA 3MGRC 3W96C 5KDMB 1M19B 3X1VC 5B0ZC 3MVDA 1A7WA 3W97A 2NZDA 3V9RA 2F8NB 5DNNA 1M18D 5CPKD 3MGPC 5G49A 5AV8B 5JRGC 5B31B 4YM6D 3RELC 1ZLAD 1JFIA 3AV2A 3WA9B 3B6FD 5B0YD 5AV9D 1KX3C 1AOIB 5GXQD 3NQUB 4X23B 1P3GD 5BNVB 2BYMB 1TZYA 5CPIC 4WZSB 3UTBB 3REID 4H9NA 5B0ZA 3LELC 3B6GC 4LD9B 2CV5B 4XUJD 3AZJC 3MGSC 1BH8A 4XZQC 3AV1C 3VH5T 3MGPA 3REJD 5JRGA 2IO5C 4JJND 4YS3C 3AYWD 1P3LC 3B0BA 4ZBJC 3KSYA 1P3IA 3REHA 4R8PC 1M1AD 4M6BA 5BO0A 5B40A 1P3FB 3X1UB 3WAAD 5CPIA 4AWLB 3C1CD 2HIOD 4KUDA 4Z5TA 5B33C 2AROB 3B6GA 3LELA 5CPJA 4KGCC 5CP6B 3AZKD 3LZ1D 1P3MB 1U35B 3MNNC 3AN2B 4XZQA 3AV1A 3LJAC 1N1JB 5B1LB 4QLCB 3AFAB 3VH6W 5E5AB 2YFWB 1P3LA 3UTAD 3X1SC 5DNMC 1P3PB 1HQ3C 5F99B 5AVBC 5GSUB 3MVDB 2NQBA 5B33A 3REKD 5AV6C 5GT3C 3WTPC 4KGCA 2NZDB 3V9RB 1KX4A 5DNNB 4CAYA 3KXBD 4WU9D 5B2JB 4NFTA 3AZMC 3LJAA 2F8NH 4WU8B 5AV5C 3AV2B 5B2IC 4ZUXB 1TZYD 1R4VA 1ID3D 1TAFB 1B67A 3B0DB 3AZLD 3X1SA 5C3IB 3AZFA 5DNMA 3UT9B 1S32B 2F8NA 4DRAA 1HQ3A 5FUGB 5B31A 3O62D 3W96B 3WA9A 5AVBA 3MGQC 3X1VB 1WWIA 5B0ZB 4J8UD 5CPKC 4H9PA 4X23A 5JA4A 5GT3A 3WTPA 5BNVA 5B0YC 3MGPB 1KX5D 5JRGB 5B1MD 3A6ND 3RELB 1P3GC 1KX3B 4CSRA 4J8WD 5BO0B 4Z5TD 5CPIB 3AZGC 3MGQA 5B32D 3LELB 3B6GB 3KUYD 5BT1C 3MGSB 3AZJB 1EQZA 3X1UA 4XZQB 3AV1B 4WNNB 3AYWC 2IO5B 1M1AC 4YS3B 3WAAC 2FJ7A 1P3LB 3VH5A 5CP6A 1P3MA 1Q9CA 2HIOC 4R8PB 3AN2A 2NQBD 3W99C 3AFAA 3AZGA 2PYOC 1P3KC 4J8XC 3R45A 5B33B 4KGCB 1M19D 2RVQD 4CAYB 3MNNB 3WKJC 3LJAB 5AY8D 3UTAC 5F99A 3AZED 5GSUA 5CHLB 5AV8D 3X1SB 3AZFB 5DNMB 3VH5W 1HQ3B 5B2JA 3AZHD 1AOID 3W99A 3LZ0C 3REKC 4WU8A 2PYOA 1P3KA 4ZUXA 4J8XA 5AVBB 1P3OC 3AZNC 1TAFA 3UTBD 4WU9C 4H9PB 3W98C 2HUEC 3WTPB 5JA4B 5GT3B 5AV6B 3UT9A 1S32A 1P3BC 5FUGA 4LD9D 2CV5D 3WKJA 3AZMB 3MGRA 3AZLC 3W96A 5AV5B 5B2IB 3X1VA 3O62C 1BH9B 2BYKA 2JSSA 4CSRB 4HGAC 3KWQC 5B32G 4J8UC 3B0CT 3VH6A 3RELA 3LZ0A 3AZID 1P3FD 1P3OA 3MGQB 3AZNA 1KX3A 4G92C 3W98A 5B24D 1EQZB 4J8VD 2AROD 1P3BA 4WV4B 1U35D 3AN2D 1P34C 2FJ7B 5B1LD 4QLCD 4KHAB 3AZJA 3MGSA 5AVCC 3C1BD 3KWQA 1P3AD 4WNNA 5E5AD 5B32C 3AZGB 1P3PD 3R45B 4YS3A 3X1TC 4R8PA 5GSUD 3MVDD 1F66C 4EO5C 3AYWB 3W97D 2NZDD 4Z66C 5DNND 3TU4C 5GT0C 1M1AB 5B2JD 1F1EA 4E45A 3AV2D 5BS7C 2HIOB 3MNNA 3W99B 2PYOB 1P3KB 2YFVA 4J8XB 4H9RB 3W96D 5AY8C 3X1TA 3AZEC 5B0ZD 1F66A 3WKJB 3MGRB 4NE3A 4Z2MG 4Z66A 1M18C 3MGPD 5GT0A 5JRGD 3AZHC 4YM6C 2BYKB 1ZLAC 5AV6A 1B6WA 3B6FC 5AV9C 3UTBC 3AZMA 1P3ID 3REHD 5GXQC 3LZ0B 3REKB 5AV5A 5B40D 5B2IA 1P3OB 5CPID 3AZNB 1BH9A 4KUDD 3W98B 2HUEB 3REIC 1WWSA 3LELD 5CPJD 1P3BB 3B6GD 1ULYA 4XUJC 4H9OB 3AZLB 2LY8A 4DRBA 4XZQD 3AV1D 1M18A 5CPKA 3REJC 4YM6A 3O62B 4JJNC 4HGAB 3AZIC 3KWQB 1P3FC 1P3LD 3B6FA 5B0YA 4J8UB 5GXQA 4R8PD 5B24C 1P3GA 4J8VC 2AROC 4ZBJB 4KHAA 4G92B 3C1CC 4G91C 3REIA 5B33D 4KGCD 3AZKC 2F8NK 3LZ1C 1KX4D 4XUJA 3C1BC 1P3AC 3LJAD 1P34B 3REJA 3WTPE 5AVCB 4JJNA 1KU5A 3AYWA 3X1SD 5B32B 3AZFD 5DNMD 2F8ND 2YFVB 1HQ3D 1M1AA 3MVDC 5B31D 3WAAA 3W97C 3WA9D 5AVBD 3X1TB 3C1CA 2HIOA 5DNNC 3B0CW 1F66B 4X23D 4EO5B 5GT3D 3WTPD 3LZ1A 4Z66B 3TU4B 4H9RA 5GT0B 3KXBC 4NE5A 5B2ID 1TZYC 1ID3C 3NQJA 2CWEA 3UTAA 5AY8B 3MGQD 3AZEB 1H3OA 3REKA 1EQZD 3X1UD 1M18B 5CPKB 1KX5C 3KXBA 4WU9A 3AZHB 5B1MC 4YM6B 4E44A 3A6NC 3REHC 1P3IC 1ZLAB 5B40C 2FJ7D 3B6FB 5B0YB 5AV9B 5CP6D 1ID3A 1P3MD 4H9OA 3AZLA 4J8WC 5GXQB 4KUDC 1P3GB 4Z5TC 3AFAD 3AZGD 5CPJC 3O62A 4UUZA 3REIB 4H9SC 4J8UA 3KUYC 4XUJB 5BT1D 1BFMA 1KX5A 5F99D 3REJB 2F8NG 5B1MA
chains in the Genus database with same CATH superfamily
3A6NA 4JJNB 5B31G 3AZIB 5BNXB 4J8WA 5B24B 2NQBC 3W99D 1P34A 4J8VB 3WAAB 4WU8D 2PYOD 1P3KD 4ZUXD 4J8XD 1KX4C 3C1CB 5AVCA 4G91B 4H9SA 5B32A 3UT9D 4H9QB 1S32D 3AZKB 1M19C 2RVQC 3LZ1B 3KUYA 3C1BB 1P3AB 3WKJD 3MGRD 3AZFC 3X1VD 5AV8C 5B31C 3NQJB 3UTAB 3WA9C 3TU4A 2BG1A 1AOIC 3RELD 4X23C 3LZ0D 3W97B 5BS7A 1P3OD 3AZND 5G49B 1KX3D 1H3OB 2UWXA 3W98D 5KDMA 1JFIB 1M19A 1P3BD 3KXBB 4WU9B 2CV5C 4LD9C 3VH6T 5AY8A 3AZEA 1TZYB 5AV8A 1ID3B 2Y2QA 3AZJD 3MGSD 3KWQD 4H9NB 3H0RC 2Y2GA 3AZHA 1AOIA 4NE6A 1ZLAA 3NQUA 4UUZB 1EQZC 1BH8B 4YS3D 3X1UC 2BYMA 5AV9A 2Y2OA 4AWLC 3UTBA 2FJ7C 1KX5B 5CP6C 4LD9A 2CV5A 1P3MC 5B1MB 1U35C 3A6NB 3REHB 4Z2MH 1P3IB 3AN2C 5B40B 1P34D 5B1LC 4QLCC 3AFAC 5AVCD 3MNND 4J8WB 4KUDB 4Z5TB 5E5AC 5CPJB 1P3PC 3EPHA 3AZIA 1P3FA 1HTAA 3F6TA 2Y2HA 2Y2IA 5F99C 3X1TD 5BNXA 3KUYB 5GSUC 5B24A 1F66D 4J8VA 4DQYB 2AROA 2NZDC 4Z66D 3TU4D 1U35A 5GT0D 5B2JC 5AV6D 1N1JA 5B1LA 4H9QA 4QLCA 1PZRA 3AZKA 3AV2C 4WU8C 4ZUXC 3C1BA 3B0DC 1P3AA 3AZMD 2NQBB 5E5AA 2YFWA 5C3IC 5AV5D 3UT9C 1S32C 1P3PA 1KX4B 2L5AA 3MGRC 3W96C 1T3UA 5KDMB 1M19B 3X1VC 5B0ZC 3MVDA 1A7WA 3W97A 2NZDA 3V9RA 2F8NB 5DNNA 1M18D 5CPKD 3MGPC 5G49A 5AV8B 5JRGC 5B31B 4YM6D 3RELC 1ZLAD 1JFIA 3AV2A 3WA9B 3B6FD 5B0YD 5AV9D 1KX3C 1AOIB 5GXQD 3NQUB 4X23B 1P3GD 5BNVB 2BYMB 1TZYA 5CPIC 4WZSB 3UTBB 3REID 4H9NA 5B0ZA 3LELC 3B6GC 4LD9B 2CV5B 4XUJD 3AZJC 3MGSC 1BH8A 4XZQC 3AV1C 3VH5T 3MGPA 3REJD 5JRGA 2IO5C 4JJND 4YS3C 3AYWD 1P3LC 3B0BA 4ZBJC 3KSYA 1P3IA 3REHA 4R8PC 1M1AD 4M6BA 5BO0A 3A1IA 5B40A 3X1UB 1P3FB 3WAAD 5CPIA 4AWLB 3C1CD 2HIOD 4KUDA 4Z5TA 5B33C 2AROB 3B6GA 3LELA 5CPJA 4KGCC 5CP6B 3AZKD 3LZ1D 2W8SA 1P3MB 1U35B 3MNNC 3AN2B 4XZQA 3AV1A 3LJAC 1N1JB 5B1LB 4QLCB 3AFAB 2J8PA 3VH6W 2JCHA 2YFWB 5E5AB 3UTAD 3X1SC 1P3LA 5DNMC 1P3PB 1HQ3C 2VQRA 3EG5B 5F99B 5AVBC 5GSUB 3MVDB 2NQBA 5B33A 3REKD 5AV6C 5GT3C 3WTPC 4KGCA 2NZDB 3V9RB 1KX4A 5DNNB 4CAYA 3KXBD 4WU9D 5B2JB 4NFTA 3AZMC 3LJAA 2F8NH 2DQNC 4WU8B 5AV5C 3AV2B 5B2IC 4ZUXB 3IP4C 1TZYD 1R4VA 1ID3D 1TAFB 1B67A 3B0DB 3AZLD 3X1SA 5C3IB 3AZFA 5DNMA 3UT9B 1S32B 2F8NA 4DRAA 1HQ3A 5FUGB 5B31A 3O62D 3W96B 3WA9A 5AVBA 3MGQC 3X1VB 1WWIA 5B0ZB 4J8UD 5CPKC 4H9PA 4X23A 5JA4A 5GT3A 3WTPA 5BNVA 2DF4C 5B0YC 3MGPB 1KX5D 5JRGB 5B1MD 3A6ND 3RELB 1P3GC 2Y2NA 1KX3B 4CSRA 4J8WD 5BO0B 4Z5TD 5CPIB 3AZGC 3MGQA 5B32D 3LELB 3B6GB 3KUYD 5BT1C 3MGSB 2Y2JA 3AZJB 1EQZA 3X1UA 4XZQB 3AV1B 4WNNB 3AYWC 2IO5B 1M1AC 4YS3B 3WAAC 2FJ7A 1P3LB 3VH5A 5CP6A 1P3MA 1Q9CA 2HIOC 4R8PB 3AN2A 2NQBD 3W99C 3AFAA 3AZGA 2PYOC 1P3KC 4J8XC 3R45A 5B33B 4KGCB 1M19D 2RVQD 4CAYB 3MNNB 3WKJC 3LJAB 5AY8D 3UTAC 5F99A 3AZED 5GSUA 5CHLB 5AV8D 3X1SB 3AZFB 5DNMB 3VH5W 1HQ3B 1Z2CB 5B2JA 3AZHD 1AOID 3W99A 3LZ0C 3REKC 4WU8A 2PYOA 1P3KA 4ZUXA 4J8XA 5AVBB 1P3OC 3AZNC 1TAFA 3UTBD 4WU9C 4H9PB 3W98C 2HUEC 3WTPB 5JA4B 5GT3B 5AV6B 3UT9A 1S32A 1P3BC 5FUGA 4LD9D 2CV5D 3WKJA 3AZMB 3MGRA 3AZLC 3W96A 5AV5B 5B2IB 3X1VA 3KFUG 3O62C 1BH9B 2BYKA 2JSSA 4CSRB 4HGAC 3KWQC 5B32G 4J8UC 3B0CT 3VH6A 3RELA 3LZ0A 3AZID 1P3FD 3A1KA 1P3OA 3MGQB 3AZNA 1KX3A 4G92C 3H0LC 3W98A 5B24D 1EQZB 4J8VD 2AROD 3P5JB 1P3BA 3AL0C 4WV4B 4WJ3C 1U35D 3AN2D 1P34C 2FJ7B 5B1LD 4QLCD 2ZY5A 3EPJA 4KHAB 3AZJA 3MGSA 2ZY2A 5AVCC 3C1BD 3KWQA 1P3AD 4WNNA 5E5AD 5B32C 3AZGB 1P3PD 3R45B 4YS3A 3X1TC 4R8PA 5GSUD 3MVDD 1F66C 4EO5C 3AYWB 3W97D 2NZDD 4Z66C 5DNND 3TU4C 5GT0C 1M1AB 5B2JD 1F1EA 3FDDA 4E45A 3AV2D 5BS7C 2HIOB 3MNNA 2G5HC 3W99B 2PYOB 1P3KB 2YFVA 4J8XB 4H9RB 3W96D 5AY8C 1W2EA 3X1TA 3AZEC 5B0ZD 1F66A 3WKJB 3MGRB 4NE3A 4Z2MG 4Z66A 1M18C 3MGPD 5GT0A 5JRGD 3AZHC 4YM6C 2BYKB 3EPKA 5AV6A 1ZLAC 1B6WA 3B6FC 5AV9C 3UTBC 3AZMA 1P3ID 3REHD 5GXQC 3LZ0B 3REKB 3EPLA 5AV5A 5B40D 5B2IA 1P3OB 5CPID 3AZNB 1BH9A 4KUDD 3W98B 2HUEB 3REIC 1WWSA 3LELD 5CPJD 1P3BB 3B6GD 1ULYA 4XUJC 4H9OB 3AZLB 2LY8A 4UPKA 4DRBA 4XZQD 3AV1D 2F2AC 1M18A 5CPKA 3REJC 4YM6A 3O62B 4JJNC 4HGAB 3AZIC 3KWQB 3H0MC 1P3FC 1P3LD 3B6FA 5B0YA 4J8UB 5GXQA 4R8PD 5B24C 1P3GA 4J8VC 2AROC 2XD1A 4ZBJB 4KHAA 4G92B 3C1CC 2G5IC 4G91C 3REIA 5B33D 4KGCD 3AZKC 2F8NK 3LZ1C 1KX4D 4XUJA 2Y2PA 3C1BC 2ZM5A 2JE5A 1P3AC 3LJAD 1P34B 3REJA 3WTPE 2Y2KA 5AVCB 4JJNA 1KU5A 3AYWA 3X1SD 5B32B 3AZFD 5DNMD 2F8ND 2YFVB 1HQ3D 1M1AA 3MVDC 5B31D 3WAAA 3W97C 2XD5A 3WA9D 5AVBD 3X1TB 3C1CA 2HIOA 5DNNC 3B0CW 1F66B 4X23D 4EO5B 5GT3D 3WTPD 3LZ1A 4Z66B 3TU4B 4H9RA 5GT0B 3KXBC 4NE5A 5B2ID 1TZYC 1ID3C 3NQJA 2CWEA 2Y2LA 3UTAA 2ZY4A 5AY8B 3MGQD 3AZEB 2ZY3A 1H3OA 3REKA 1EQZD 3X1UD 1M18B 5CPKB 1KX5C 3KXBA 4WU9A 3AZHB 5B1MC 4YM6B 4E44A 3A6NC 3REHC 1P3IC 1ZLAB 5B40C 2FJ7D 3B6FB 5B0YB 5AV9B 5CP6D 1ID3A 1P3MD 4H9OA 3AZLA 4J8WC 5GXQB 4KUDC 1P3GB 4Z5TC 3AFAD 3AZGD 5CPJC 3O62A 4UUZA 3REIB 4H9SC 4J8UA 3KUYC 4XUJB 5BT1D 2RIQA 2Y2MA 1BFMA 1KX5A 5F99D 3REJB 2F8NG 2FFFB 5B1MA
chains in the Genus database with same CATH topology
3A6NA 4JJNB 5B31G 3AZIB 5BNXB 4J8WA 5B24B 2NQBC 3W99D 1P34A 4J8VB 3WAAB 4WU8D 2PYOD 1P3KD 4ZUXD 4J8XD 1KX4C 3C1CB 5AVCA 4G91B 4H9SA 5B32A 3UT9D 4H9QB 1S32D 3AZKB 1M19C 2RVQC 3LZ1B 3KUYA 3C1BB 1P3AB 3WKJD 3MGRD 3AZFC 3X1VD 5AV8C 5B31C 3NQJB 3UTAB 3WA9C 3TU4A 2BG1A 1AOIC 3RELD 4X23C 3LZ0D 3W97B 5BS7A 1P3OD 3AZND 5G49B 1KX3D 1H3OB 2UWXA 3W98D 5KDMA 1JFIB 1M19A 1P3BD 3KXBB 4WU9B 2CV5C 4LD9C 3VH6T 5AY8A 3AZEA 1TZYB 5AV8A 1ID3B 2Y2QA 3AZJD 3MGSD 3KWQD 4H9NB 3H0RC 2Y2GA 3AZHA 1AOIA 4NE6A 1ZLAA 3NQUA 4UUZB 1EQZC 1BH8B 4YS3D 3X1UC 2BYMA 5AV9A 2Y2OA 4AWLC 3UTBA 2FJ7C 1KX5B 5CP6C 4LD9A 2CV5A 1P3MC 5B1MB 1U35C 3A6NB 3REHB 4Z2MH 1P3IB 3AN2C 5B40B 1P34D 5B1LC 4QLCC 3AFAC 5AVCD 3MNND 4J8WB 4KUDB 4Z5TB 5E5AC 5CPJB 1P3PC 3EPHA 3AZIA 1P3FA 1HTAA 3F6TA 2Y2HA 2Y2IA 5F99C 3X1TD 5BNXA 3KUYB 5GSUC 5B24A 1F66D 4J8VA 4DQYB 2AROA 2NZDC 4Z66D 3TU4D 1U35A 5GT0D 5B2JC 5AV6D 1N1JA 5B1LA 4H9QA 4QLCA 1PZRA 3AZKA 3AV2C 4WU8C 4ZUXC 3C1BA 3B0DC 1P3AA 3AZMD 2NQBB 5E5AA 2YFWA 5C3IC 5AV5D 3UT9C 1S32C 1P3PA 1KX4B 2L5AA 3MGRC 3W96C 1T3UA 5KDMB 1M19B 3X1VC 5B0ZC 3MVDA 1A7WA 3W97A 2NZDA 3V9RA 2F8NB 5DNNA 1M18D 5CPKD 3MGPC 5G49A 5AV8B 5JRGC 5B31B 4YM6D 3RELC 1ZLAD 1JFIA 3AV2A 3WA9B 3B6FD 5B0YD 5AV9D 1KX3C 1AOIB 5GXQD 3NQUB 4X23B 1P3GD 5BNVB 2BYMB 1TZYA 5CPIC 4WZSB 3UTBB 3REID 4H9NA 5B0ZA 3LELC 3B6GC 4LD9B 2CV5B 4XUJD 3AZJC 3MGSC 1BH8A 4XZQC 3AV1C 3VH5T 3MGPA 3REJD 5JRGA 2IO5C 4JJND 4YS3C 3AYWD 1P3LC 3B0BA 4ZBJC 3KSYA 1P3IA 3REHA 4R8PC 1M1AD 4M6BA 5BO0A 3A1IA 5B40A 3X1UB 1P3FB 3WAAD 5CPIA 4AWLB 3C1CD 2HIOD 4KUDA 4Z5TA 5B33C 2AROB 3B6GA 3LELA 5CPJA 4KGCC 5CP6B 3AZKD 3LZ1D 2W8SA 1P3MB 1U35B 3MNNC 3AN2B 4XZQA 3AV1A 3LJAC 1N1JB 5B1LB 4QLCB 3AFAB 2J8PA 3VH6W 2JCHA 2YFWB 5E5AB 3UTAD 3X1SC 1P3LA 5DNMC 1P3PB 1HQ3C 2VQRA 3EG5B 5F99B 5AVBC 5GSUB 3MVDB 2NQBA 5B33A 3REKD 5AV6C 5GT3C 3WTPC 4KGCA 2NZDB 3V9RB 1KX4A 5DNNB 4CAYA 3KXBD 4WU9D 5B2JB 4NFTA 3AZMC 3LJAA 2F8NH 2DQNC 4WU8B 5AV5C 3AV2B 5B2IC 4ZUXB 3IP4C 1TZYD 1R4VA 1ID3D 1TAFB 1B67A 3B0DB 3AZLD 3X1SA 5C3IB 3AZFA 5DNMA 3UT9B 1S32B 2F8NA 4DRAA 1HQ3A 5FUGB 5B31A 3O62D 3W96B 3WA9A 5AVBA 3MGQC 3X1VB 1WWIA 5B0ZB 4J8UD 5CPKC 4H9PA 4X23A 5JA4A 5GT3A 3WTPA 5BNVA 2DF4C 5B0YC 3MGPB 1KX5D 5JRGB 5B1MD 3A6ND 3RELB 1P3GC 2Y2NA 1KX3B 4CSRA 4J8WD 5BO0B 4Z5TD 5CPIB 3AZGC 3MGQA 5B32D 3LELB 3B6GB 3KUYD 5BT1C 3MGSB 2Y2JA 3AZJB 1EQZA 3X1UA 4XZQB 3AV1B 4WNNB 3AYWC 2IO5B 1M1AC 4YS3B 3WAAC 2FJ7A 1P3LB 3VH5A 5CP6A 1P3MA 1Q9CA 2HIOC 4R8PB 3AN2A 2NQBD 3W99C 3AFAA 3AZGA 2PYOC 1P3KC 4J8XC 3R45A 5B33B 4KGCB 1M19D 2RVQD 4CAYB 3MNNB 3WKJC 3LJAB 5AY8D 3UTAC 5F99A 3AZED 5GSUA 5CHLB 5AV8D 3X1SB 3AZFB 5DNMB 3VH5W 1HQ3B 1Z2CB 5B2JA 3AZHD 1AOID 3W99A 3LZ0C 3REKC 4WU8A 2PYOA 1P3KA 4ZUXA 4J8XA 5AVBB 1P3OC 3AZNC 1TAFA 3UTBD 4WU9C 4H9PB 3W98C 2HUEC 3WTPB 5JA4B 5GT3B 5AV6B 3UT9A 1S32A 1P3BC 5FUGA 4LD9D 2CV5D 3WKJA 3AZMB 3MGRA 3AZLC 3W96A 5AV5B 5B2IB 3X1VA 3KFUG 3O62C 1BH9B 2BYKA 2JSSA 4CSRB 4HGAC 3KWQC 5B32G 4J8UC 3B0CT 3VH6A 3RELA 3LZ0A 3AZID 1P3FD 3A1KA 1P3OA 3MGQB 3AZNA 1KX3A 4G92C 3H0LC 3W98A 5B24D 1EQZB 4J8VD 2AROD 3P5JB 1P3BA 3AL0C 4WV4B 4WJ3C 1U35D 3AN2D 1P34C 2FJ7B 5B1LD 4QLCD 2ZY5A 3EPJA 4KHAB 3AZJA 3MGSA 2ZY2A 5AVCC 3C1BD 3KWQA 1P3AD 4WNNA 5E5AD 5B32C 3AZGB 1P3PD 3R45B 4YS3A 3X1TC 4R8PA 5GSUD 3MVDD 1F66C 4EO5C 3AYWB 3W97D 2NZDD 4Z66C 5DNND 3TU4C 5GT0C 1M1AB 5B2JD 1F1EA 3FDDA 4E45A 3AV2D 5BS7C 2HIOB 3MNNA 2G5HC 3W99B 2PYOB 1P3KB 2YFVA 4J8XB 4H9RB 3W96D 5AY8C 1W2EA 3X1TA 3AZEC 5B0ZD 1F66A 3WKJB 3MGRB 4NE3A 4Z2MG 4Z66A 1M18C 3MGPD 5GT0A 5JRGD 3AZHC 4YM6C 2BYKB 3EPKA 5AV6A 1ZLAC 1B6WA 3B6FC 5AV9C 3UTBC 3AZMA 1P3ID 3REHD 5GXQC 3LZ0B 3REKB 3EPLA 5AV5A 5B40D 5B2IA 1P3OB 5CPID 3AZNB 1BH9A 4KUDD 3W98B 2HUEB 3REIC 1WWSA 3LELD 5CPJD 1P3BB 3B6GD 1ULYA 4XUJC 4H9OB 3AZLB 2LY8A 4UPKA 4DRBA 4XZQD 3AV1D 2F2AC 1M18A 5CPKA 3REJC 4YM6A 3O62B 4JJNC 4HGAB 3AZIC 3KWQB 3H0MC 1P3FC 1P3LD 3B6FA 5B0YA 4J8UB 5GXQA 4R8PD 5B24C 1P3GA 4J8VC 2AROC 2XD1A 4ZBJB 4KHAA 4G92B 3C1CC 2G5IC 4G91C 3REIA 5B33D 4KGCD 3AZKC 2F8NK 3LZ1C 1KX4D 4XUJA 2Y2PA 3C1BC 2ZM5A 2JE5A 1P3AC 3LJAD 1P34B 3REJA 3WTPE 2Y2KA 5AVCB 4JJNA 1KU5A 3AYWA 3X1SD 5B32B 3AZFD 5DNMD 2F8ND 2YFVB 1HQ3D 1M1AA 3MVDC 5B31D 3WAAA 3W97C 2XD5A 3WA9D 5AVBD 3X1TB 3C1CA 2HIOA 5DNNC 3B0CW 1F66B 4X23D 4EO5B 5GT3D 3WTPD 3LZ1A 4Z66B 3TU4B 4H9RA 5GT0B 3KXBC 4NE5A 5B2ID 1TZYC 1ID3C 3NQJA 2CWEA 2Y2LA 3UTAA 2ZY4A 5AY8B 3MGQD 3AZEB 2ZY3A 1H3OA 3REKA 1EQZD 3X1UD 1M18B 5CPKB 1KX5C 3KXBA 4WU9A 3AZHB 5B1MC 4YM6B 4E44A 3A6NC 3REHC 1P3IC 1ZLAB 5B40C 2FJ7D 3B6FB 5B0YB 5AV9B 5CP6D 1ID3A 1P3MD 4H9OA 3AZLA 4J8WC 5GXQB 4KUDC 1P3GB 4Z5TC 3AFAD 3AZGD 5CPJC 3O62A 4UUZA 3REIB 4H9SC 4J8UA 3KUYC 4XUJB 5BT1D 2RIQA 2Y2MA 1BFMA 1KX5A 5F99D 3REJB 2F8NG 2FFFB 5B1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A6N A;  4JJN B;  5B31 G;  3AZI B;  5BNX B;  4J8W A;  5B24 B;  2NQB C;  3W99 D;  1P34 A;  4J8V B;  3WAA B;  4WU8 D;  2PYO D;  1P3K D;  4ZUX D;  4J8X D;  1KX4 C;  3C1C B;  5AVC A;  4G91 B;  4H9S A;  5B32 A;  3UT9 D;  4H9Q B;  1S32 D;  3AZK B;  1M19 C;  2RVQ C;  3LZ1 B;  3KUY A;  3C1B B;  1P3A B;  3WKJ D;  3MGR D;  3AZF C;  3X1V D;  5AV8 C;  5B31 C;  3NQJ B;  3UTA B;  3WA9 C;  3TU4 A;  1AOI C;  3REL D;  4X23 C;  3LZ0 D;  3W97 B;  5BS7 A;  1P3O D;  3AZN D;  5G49 B;  1KX3 D;  1H3O B;  3W98 D;  5KDM A;  1JFI B;  1M19 A;  1P3B D;  3KXB B;  4WU9 B;  2CV5 C;  4LD9 C;  3VH6 T;  5AY8 A;  3AZE A;  1TZY B;  5AV8 A;  1ID3 B;  3AZJ D;  3MGS D;  3KWQ D;  4H9N B;  3AZH A;  1AOI A;  4NE6 A;  1ZLA A;  3NQU A;  4UUZ B;  1EQZ C;  1BH8 B;  4YS3 D;  3X1U C;  2BYM A;  5AV9 A;  4AWL C;  3UTB A;  2FJ7 C;  1KX5 B;  5CP6 C;  4LD9 A;  2CV5 A;  1P3M C;  5B1M B;  1U35 C;  3A6N B;  3REH B;  4Z2M H;  1P3I B;  3AN2 C;  5B40 B;  1P34 D;  5B1L C;  4QLC C;  3AFA C;  5AVC D;  3MNN D;  4J8W B;  4KUD B;  4Z5T B;  5E5A C;  5CPJ B;  1P3P C;  3AZI A;  1P3F A;  1HTA A;  5F99 C;  3X1T D;  5BNX A;  3KUY B;  5GSU C;  5B24 A;  1F66 D;  4J8V A;  2ARO A;  2NZD C;  4Z66 D;  3TU4 D;  1U35 A;  5GT0 D;  5B2J C;  5AV6 D;  1N1J A;  5B1L A;  4H9Q A;  4QLC A;  4WU8 C;  3AZK A;  3AV2 C;  4ZUX C;  3C1B A;  3B0D C;  1P3A A;  3AZM D;  2NQB B;  5E5A A;  2YFW A;  5C3I C;  5AV5 D;  3UT9 C;  1S32 C;  1P3P A;  1KX4 B;  2L5A A;  3MGR C;  3W96 C;  5KDM B;  1M19 B;  3X1V C;  5B0Z C;  3MVD A;  1A7W A;  3W97 A;  2NZD A;  3V9R A;  2F8N B;  5DNN A;  1M18 D;  5CPK D;  3MGP C;  5G49 A;  5AV8 B;  5JRG C;  5B31 B;  4YM6 D;  3REL C;  1ZLA D;  1JFI A;  3AV2 A;  3WA9 B;  3B6F D;  5B0Y D;  5AV9 D;  1KX3 C;  1AOI B;  5GXQ D;  3NQU B;  4X23 B;  1P3G D;  5BNV B;  2BYM B;  1TZY A;  5CPI C;  4WZS B;  3UTB B;  3REI D;  4H9N A;  5B0Z A;  3LEL C;  3B6G C;  4LD9 B;  2CV5 B;  4XUJ D;  3AZJ C;  3MGS C;  1BH8 A;  4XZQ C;  3AV1 C;  3VH5 T;  3MGP A;  3REJ D;  5JRG A;  2IO5 C;  4JJN D;  4YS3 C;  3AYW D;  1P3L C;  3B0B A;  4ZBJ C;  3KSY A;  1P3I A;  3REH A;  4R8P C;  1M1A D;  4M6B A;  5BO0 A;  5B40 A;  1P3F B;  3X1U B;  3WAA D;  5CPI A;  4AWL B;  3C1C D;  2HIO D;  4KUD A;  4Z5T A;  5B33 C;  2ARO B;  3B6G A;  3LEL A;  5CPJ A;  4KGC C;  5CP6 B;  3AZK D;  3LZ1 D;  1P3M B;  1U35 B;  3MNN C;  3AN2 B;  4XZQ A;  3AV1 A;  3LJA C;  1N1J B;  5B1L B;  4QLC B;  3AFA B;  3VH6 W;  5E5A B;  2YFW B;  1P3L A;  3UTA D;  3X1S C;  5DNM C;  1P3P B;  1HQ3 C;  5F99 B;  5AVB C;  5GSU B;  3MVD B;  2NQB A;  5B33 A;  3REK D;  5AV6 C;  5GT3 C;  3WTP C;  4KGC A;  2NZD B;  3V9R B;  1KX4 A;  5DNN B;  4CAY A;  3KXB D;  4WU9 D;  5B2J B;  4NFT A;  3AZM C;  3LJA A;  2F8N H;  4WU8 B;  5AV5 C;  3AV2 B;  5B2I C;  4ZUX B;  1TZY D;  1R4V A;  1ID3 D;  1TAF B;  1B67 A;  3B0D B;  3AZL D;  3X1S A;  5C3I B;  3AZF A;  5DNM A;  3UT9 B;  1S32 B;  2F8N A;  4DRA A;  1HQ3 A;  5FUG B;  5B31 A;  3O62 D;  3W96 B;  3WA9 A;  5AVB A;  3MGQ C;  3X1V B;  1WWI A;  5B0Z B;  4J8U D;  5CPK C;  4H9P A;  4X23 A;  5JA4 A;  5GT3 A;  3WTP A;  5BNV A;  5B0Y C;  3MGP B;  1KX5 D;  5JRG B;  5B1M D;  3A6N D;  3REL B;  1P3G C;  1KX3 B;  4CSR A;  4J8W D;  5BO0 B;  4Z5T D;  5CPI B;  3AZG C;  3MGQ A;  5B32 D;  3LEL B;  3B6G B;  3KUY D;  5BT1 C;  3MGS B;  3AZJ B;  1EQZ A;  3X1U A;  4XZQ B;  3AV1 B;  4WNN B;  3AYW C;  2IO5 B;  1M1A C;  4YS3 B;  3WAA C;  2FJ7 A;  1P3L B;  3VH5 A;  5CP6 A;  1P3M A;  1Q9C A;  2HIO C;  4R8P B;  3AN2 A;  2NQB D;  3W99 C;  3AFA A;  3AZG A;  2PYO C;  1P3K C;  4J8X C;  3R45 A;  5B33 B;  4KGC B;  1M19 D;  2RVQ D;  4CAY B;  3MNN B;  3WKJ C;  3LJA B;  5AY8 D;  3UTA C;  5F99 A;  3AZE D;  5GSU A;  5CHL B;  5AV8 D;  3X1S B;  3AZF B;  5DNM B;  3VH5 W;  1HQ3 B;  5B2J A;  3AZH D;  1AOI D;  3W99 A;  3LZ0 C;  3REK C;  4WU8 A;  2PYO A;  1P3K A;  4ZUX A;  4J8X A;  5AVB B;  1P3O C;  3AZN C;  1TAF A;  3UTB D;  4WU9 C;  4H9P B;  3W98 C;  2HUE C;  3WTP B;  5JA4 B;  5GT3 B;  5AV6 B;  3UT9 A;  1S32 A;  1P3B C;  5FUG A;  4LD9 D;  2CV5 D;  3WKJ A;  3AZM B;  3MGR A;  3AZL C;  3W96 A;  5AV5 B;  5B2I B;  3X1V A;  3O62 C;  1BH9 B;  2BYK A;  2JSS A;  4CSR B;  4HGA C;  3KWQ C;  5B32 G;  4J8U C;  3B0C T;  3VH6 A;  3REL A;  3LZ0 A;  3AZI D;  1P3F D;  1P3O A;  3MGQ B;  3AZN A;  1KX3 A;  4G92 C;  3W98 A;  5B24 D;  1EQZ B;  4J8V D;  2ARO D;  1P3B A;  4WV4 B;  1U35 D;  3AN2 D;  1P34 C;  2FJ7 B;  5B1L D;  4QLC D;  4KHA B;  3AZJ A;  3MGS A;  5AVC C;  3C1B D;  3KWQ A;  1P3A D;  4WNN A;  5E5A D;  5B32 C;  3AZG B;  1P3P D;  3R45 B;  4YS3 A;  3X1T C;  4R8P A;  5GSU D;  3MVD D;  1F66 C;  4EO5 C;  3AYW B;  3W97 D;  2NZD D;  4Z66 C;  5DNN D;  3TU4 C;  5GT0 C;  1M1A B;  5B2J D;  1F1E A;  4E45 A;  3AV2 D;  5BS7 C;  2HIO B;  3MNN A;  3W99 B;  2PYO B;  1P3K B;  2YFV A;  4J8X B;  4H9R B;  3W96 D;  5AY8 C;  3X1T A;  3AZE C;  5B0Z D;  1F66 A;  3WKJ B;  3MGR B;  4NE3 A;  4Z2M G;  4Z66 A;  1M18 C;  3MGP D;  5GT0 A;  5JRG D;  3AZH C;  4YM6 C;  2BYK B;  1ZLA C;  5AV6 A;  1B6W A;  3B6F C;  5AV9 C;  3UTB C;  3AZM A;  1P3I D;  3REH D;  5GXQ C;  3LZ0 B;  3REK B;  5AV5 A;  5B40 D;  5B2I A;  1P3O B;  5CPI D;  3AZN B;  1BH9 A;  4KUD D;  3W98 B;  2HUE B;  3REI C;  1WWS A;  3LEL D;  5CPJ D;  1P3B B;  3B6G D;  1ULY A;  4XUJ C;  4H9O B;  3AZL B;  2LY8 A;  4DRB A;  4XZQ D;  3AV1 D;  1M18 A;  5CPK A;  3REJ C;  4YM6 A;  3O62 B;  4JJN C;  4HGA B;  3AZI C;  3KWQ B;  1P3F C;  1P3L D;  3B6F A;  5B0Y A;  4J8U B;  5GXQ A;  4R8P D;  5B24 C;  1P3G A;  4J8V C;  2ARO C;  4ZBJ B;  4KHA A;  4G92 B;  3C1C C;  4G91 C;  3REI A;  5B33 D;  4KGC D;  3AZK C;  2F8N K;  3LZ1 C;  1KX4 D;  4XUJ A;  3C1B C;  1P3A C;  3LJA D;  1P34 B;  3REJ A;  3WTP E;  5AVC B;  4JJN A;  1KU5 A;  3AYW A;  3X1S D;  5B32 B;  3AZF D;  5DNM D;  2F8N D;  2YFV B;  1HQ3 D;  1M1A A;  3MVD C;  5B31 D;  3WAA A;  3W97 C;  3WA9 D;  5AVB D;  3X1T B;  3C1C A;  2HIO A;  5DNN C;  3B0C W;  1F66 B;  4X23 D;  4EO5 B;  5GT3 D;  3WTP D;  3LZ1 A;  4Z66 B;  3TU4 B;  4H9R A;  5GT0 B;  3KXB C;  4NE5 A;  5B2I D;  1TZY C;  1ID3 C;  3NQJ A;  2CWE A;  3UTA A;  5AY8 B;  3MGQ D;  3AZE B;  1H3O A;  3REK A;  1EQZ D;  3X1U D;  1M18 B;  5CPK B;  1KX5 C;  3KXB A;  4WU9 A;  3AZH B;  5B1M C;  4YM6 B;  4E44 A;  3A6N C;  3REH C;  1P3I C;  1ZLA B;  5B40 C;  2FJ7 D;  3B6F B;  5B0Y B;  5AV9 B;  5CP6 D;  1ID3 A;  1P3M D;  4H9O A;  3AZL A;  4J8W C;  5GXQ B;  4KUD C;  1P3G B;  4Z5T C;  3AFA D;  3AZG D;  5CPJ C;  3O62 A;  4UUZ A;  3REI B;  4H9S C;  4J8U A;  3KUY C;  4XUJ B;  5BT1 D;  1BFM A;  1KX5 A;  5F99 D;  3REJ B;  2F8N G;  5B1M A; 
#chains in the Genus database with same CATH topology
 3A6N A;  4JJN B;  5B31 G;  3AZI B;  5BNX B;  4J8W A;  5B24 B;  2NQB C;  3W99 D;  1P34 A;  4J8V B;  3WAA B;  4WU8 D;  2PYO D;  1P3K D;  4ZUX D;  4J8X D;  1KX4 C;  3C1C B;  5AVC A;  4G91 B;  4H9S A;  5B32 A;  3UT9 D;  4H9Q B;  1S32 D;  3AZK B;  1M19 C;  2RVQ C;  3LZ1 B;  3KUY A;  3C1B B;  1P3A B;  3WKJ D;  3MGR D;  3AZF C;  3X1V D;  5AV8 C;  5B31 C;  3NQJ B;  3UTA B;  3WA9 C;  3TU4 A;  2BG1 A;  1AOI C;  3REL D;  4X23 C;  3LZ0 D;  3W97 B;  5BS7 A;  1P3O D;  3AZN D;  5G49 B;  1KX3 D;  1H3O B;  2UWX A;  3W98 D;  5KDM A;  1JFI B;  1M19 A;  1P3B D;  3KXB B;  4WU9 B;  2CV5 C;  4LD9 C;  3VH6 T;  5AY8 A;  3AZE A;  1TZY B;  5AV8 A;  1ID3 B;  2Y2Q A;  3AZJ D;  3MGS D;  3KWQ D;  4H9N B;  3H0R C;  2Y2G A;  3AZH A;  1AOI A;  4NE6 A;  1ZLA A;  3NQU A;  4UUZ B;  1EQZ C;  1BH8 B;  4YS3 D;  3X1U C;  2BYM A;  5AV9 A;  2Y2O A;  4AWL C;  3UTB A;  2FJ7 C;  1KX5 B;  5CP6 C;  4LD9 A;  2CV5 A;  1P3M C;  5B1M B;  1U35 C;  3A6N B;  3REH B;  4Z2M H;  1P3I B;  3AN2 C;  5B40 B;  1P34 D;  5B1L C;  4QLC C;  3AFA C;  5AVC D;  3MNN D;  4J8W B;  4KUD B;  4Z5T B;  5E5A C;  5CPJ B;  1P3P C;  3EPH A;  3AZI A;  1P3F A;  1HTA A;  3F6T A;  2Y2H A;  2Y2I A;  5F99 C;  3X1T D;  5BNX A;  3KUY B;  5GSU C;  5B24 A;  1F66 D;  4J8V A;  4DQY B;  2ARO A;  2NZD C;  4Z66 D;  3TU4 D;  1U35 A;  5GT0 D;  5B2J C;  5AV6 D;  1N1J A;  5B1L A;  4H9Q A;  4QLC A;  1PZR A;  3AZK A;  3AV2 C;  4WU8 C;  4ZUX C;  3C1B A;  3B0D C;  1P3A A;  3AZM D;  2NQB B;  5E5A A;  2YFW A;  5C3I C;  5AV5 D;  3UT9 C;  1S32 C;  1P3P A;  1KX4 B;  2L5A A;  3MGR C;  3W96 C;  1T3U A;  5KDM B;  1M19 B;  3X1V C;  5B0Z C;  3MVD A;  1A7W A;  3W97 A;  2NZD A;  3V9R A;  2F8N B;  5DNN A;  1M18 D;  5CPK D;  3MGP C;  5G49 A;  5AV8 B;  5JRG C;  5B31 B;  4YM6 D;  3REL C;  1ZLA D;  1JFI A;  3AV2 A;  3WA9 B;  3B6F D;  5B0Y D;  5AV9 D;  1KX3 C;  1AOI B;  5GXQ D;  3NQU B;  4X23 B;  1P3G D;  5BNV B;  2BYM B;  1TZY A;  5CPI C;  4WZS B;  3UTB B;  3REI D;  4H9N A;  5B0Z A;  3LEL C;  3B6G C;  4LD9 B;  2CV5 B;  4XUJ D;  3AZJ C;  3MGS C;  1BH8 A;  4XZQ C;  3AV1 C;  3VH5 T;  3MGP A;  3REJ D;  5JRG A;  2IO5 C;  4JJN D;  4YS3 C;  3AYW D;  1P3L C;  3B0B A;  4ZBJ C;  3KSY A;  1P3I A;  3REH A;  4R8P C;  1M1A D;  4M6B A;  5BO0 A;  3A1I A;  5B40 A;  3X1U B;  1P3F B;  3WAA D;  5CPI A;  4AWL B;  3C1C D;  2HIO D;  4KUD A;  4Z5T A;  5B33 C;  2ARO B;  3B6G A;  3LEL A;  5CPJ A;  4KGC C;  5CP6 B;  3AZK D;  3LZ1 D;  2W8S A;  1P3M B;  1U35 B;  3MNN C;  3AN2 B;  4XZQ A;  3AV1 A;  3LJA C;  1N1J B;  5B1L B;  4QLC B;  3AFA B;  2J8P A;  3VH6 W;  2JCH A;  2YFW B;  5E5A B;  3UTA D;  3X1S C;  1P3L A;  5DNM C;  1P3P B;  1HQ3 C;  2VQR A;  3EG5 B;  5F99 B;  5AVB C;  5GSU B;  3MVD B;  2NQB A;  5B33 A;  3REK D;  5AV6 C;  5GT3 C;  3WTP C;  4KGC A;  2NZD B;  3V9R B;  1KX4 A;  5DNN B;  4CAY A;  3KXB D;  4WU9 D;  5B2J B;  4NFT A;  3AZM C;  3LJA A;  2F8N H;  2DQN C;  4WU8 B;  5AV5 C;  3AV2 B;  5B2I C;  4ZUX B;  3IP4 C;  1TZY D;  1R4V A;  1ID3 D;  1TAF B;  1B67 A;  3B0D B;  3AZL D;  3X1S A;  5C3I B;  3AZF A;  5DNM A;  3UT9 B;  1S32 B;  2F8N A;  4DRA A;  1HQ3 A;  5FUG B;  5B31 A;  3O62 D;  3W96 B;  3WA9 A;  5AVB A;  3MGQ C;  3X1V B;  1WWI A;  5B0Z B;  4J8U D;  5CPK C;  4H9P A;  4X23 A;  5JA4 A;  5GT3 A;  3WTP A;  5BNV A;  2DF4 C;  5B0Y C;  3MGP B;  1KX5 D;  5JRG B;  5B1M D;  3A6N D;  3REL B;  1P3G C;  2Y2N A;  1KX3 B;  4CSR A;  4J8W D;  5BO0 B;  4Z5T D;  5CPI B;  3AZG C;  3MGQ A;  5B32 D;  3LEL B;  3B6G B;  3KUY D;  5BT1 C;  3MGS B;  2Y2J A;  3AZJ B;  1EQZ A;  3X1U A;  4XZQ B;  3AV1 B;  4WNN B;  3AYW C;  2IO5 B;  1M1A C;  4YS3 B;  3WAA C;  2FJ7 A;  1P3L B;  3VH5 A;  5CP6 A;  1P3M A;  1Q9C A;  2HIO C;  4R8P B;  3AN2 A;  2NQB D;  3W99 C;  3AFA A;  3AZG A;  2PYO C;  1P3K C;  4J8X C;  3R45 A;  5B33 B;  4KGC B;  1M19 D;  2RVQ D;  4CAY B;  3MNN B;  3WKJ C;  3LJA B;  5AY8 D;  3UTA C;  5F99 A;  3AZE D;  5GSU A;  5CHL B;  5AV8 D;  3X1S B;  3AZF B;  5DNM B;  3VH5 W;  1HQ3 B;  1Z2C B;  5B2J A;  3AZH D;  1AOI D;  3W99 A;  3LZ0 C;  3REK C;  4WU8 A;  2PYO A;  1P3K A;  4ZUX A;  4J8X A;  5AVB B;  1P3O C;  3AZN C;  1TAF A;  3UTB D;  4WU9 C;  4H9P B;  3W98 C;  2HUE C;  3WTP B;  5JA4 B;  5GT3 B;  5AV6 B;  3UT9 A;  1S32 A;  1P3B C;  5FUG A;  4LD9 D;  2CV5 D;  3WKJ A;  3AZM B;  3MGR A;  3AZL C;  3W96 A;  5AV5 B;  5B2I B;  3X1V A;  3KFU G;  3O62 C;  1BH9 B;  2BYK A;  2JSS A;  4CSR B;  4HGA C;  3KWQ C;  5B32 G;  4J8U C;  3B0C T;  3VH6 A;  3REL A;  3LZ0 A;  3AZI D;  1P3F D;  3A1K A;  1P3O A;  3MGQ B;  3AZN A;  1KX3 A;  4G92 C;  3H0L C;  3W98 A;  5B24 D;  1EQZ B;  4J8V D;  2ARO D;  3P5J B;  1P3B A;  3AL0 C;  4WV4 B;  4WJ3 C;  1U35 D;  3AN2 D;  1P34 C;  2FJ7 B;  5B1L D;  4QLC D;  2ZY5 A;  3EPJ A;  4KHA B;  3AZJ A;  3MGS A;  2ZY2 A;  5AVC C;  3C1B D;  3KWQ A;  1P3A D;  4WNN A;  5E5A D;  5B32 C;  3AZG B;  1P3P D;  3R45 B;  4YS3 A;  3X1T C;  4R8P A;  5GSU D;  3MVD D;  1F66 C;  4EO5 C;  3AYW B;  3W97 D;  2NZD D;  4Z66 C;  5DNN D;  3TU4 C;  5GT0 C;  1M1A B;  5B2J D;  1F1E A;  3FDD A;  4E45 A;  3AV2 D;  5BS7 C;  2HIO B;  3MNN A;  2G5H C;  3W99 B;  2PYO B;  1P3K B;  2YFV A;  4J8X B;  4H9R B;  3W96 D;  5AY8 C;  1W2E A;  3X1T A;  3AZE C;  5B0Z D;  1F66 A;  3WKJ B;  3MGR B;  4NE3 A;  4Z2M G;  4Z66 A;  1M18 C;  3MGP D;  5GT0 A;  5JRG D;  3AZH C;  4YM6 C;  2BYK B;  3EPK A;  5AV6 A;  1ZLA C;  1B6W A;  3B6F C;  5AV9 C;  3UTB C;  3AZM A;  1P3I D;  3REH D;  5GXQ C;  3LZ0 B;  3REK B;  3EPL A;  5AV5 A;  5B40 D;  5B2I A;  1P3O B;  5CPI D;  3AZN B;  1BH9 A;  4KUD D;  3W98 B;  2HUE B;  3REI C;  1WWS A;  3LEL D;  5CPJ D;  1P3B B;  3B6G D;  1ULY A;  4XUJ C;  4H9O B;  3AZL B;  2LY8 A;  4UPK A;  4DRB A;  4XZQ D;  3AV1 D;  2F2A C;  1M18 A;  5CPK A;  3REJ C;  4YM6 A;  3O62 B;  4JJN C;  4HGA B;  3AZI C;  3KWQ B;  3H0M C;  1P3F C;  1P3L D;  3B6F A;  5B0Y A;  4J8U B;  5GXQ A;  4R8P D;  5B24 C;  1P3G A;  4J8V C;  2ARO C;  2XD1 A;  4ZBJ B;  4KHA A;  4G92 B;  3C1C C;  2G5I C;  4G91 C;  3REI A;  5B33 D;  4KGC D;  3AZK C;  2F8N K;  3LZ1 C;  1KX4 D;  4XUJ A;  2Y2P A;  3C1B C;  2ZM5 A;  2JE5 A;  1P3A C;  3LJA D;  1P34 B;  3REJ A;  3WTP E;  2Y2K A;  5AVC B;  4JJN A;  1KU5 A;  3AYW A;  3X1S D;  5B32 B;  3AZF D;  5DNM D;  2F8N D;  2YFV B;  1HQ3 D;  1M1A A;  3MVD C;  5B31 D;  3WAA A;  3W97 C;  2XD5 A;  3WA9 D;  5AVB D;  3X1T B;  3C1C A;  2HIO A;  5DNN C;  3B0C W;  1F66 B;  4X23 D;  4EO5 B;  5GT3 D;  3WTP D;  3LZ1 A;  4Z66 B;  3TU4 B;  4H9R A;  5GT0 B;  3KXB C;  4NE5 A;  5B2I D;  1TZY C;  1ID3 C;  3NQJ A;  2CWE A;  2Y2L A;  3UTA A;  2ZY4 A;  5AY8 B;  3MGQ D;  3AZE B;  2ZY3 A;  1H3O A;  3REK A;  1EQZ D;  3X1U D;  1M18 B;  5CPK B;  1KX5 C;  3KXB A;  4WU9 A;  3AZH B;  5B1M C;  4YM6 B;  4E44 A;  3A6N C;  3REH C;  1P3I C;  1ZLA B;  5B40 C;  2FJ7 D;  3B6F B;  5B0Y B;  5AV9 B;  5CP6 D;  1ID3 A;  1P3M D;  4H9O A;  3AZL A;  4J8W C;  5GXQ B;  4KUD C;  1P3G B;  4Z5T C;  3AFA D;  3AZG D;  5CPJ C;  3O62 A;  4UUZ A;  3REI B;  4H9S C;  4J8U A;  3KUY C;  4XUJ B;  5BT1 D;  2RIQ A;  2Y2M A;  1BFM A;  1KX5 A;  5F99 D;  3REJ B;  2F8N G;  2FFF B;  5B1M A; 
#chains in the Genus database with same CATH homology
 3A6N A;  4JJN B;  5B31 G;  3AZI B;  5BNX B;  4J8W A;  5B24 B;  2NQB C;  3W99 D;  1P34 A;  4J8V B;  3WAA B;  4WU8 D;  2PYO D;  1P3K D;  4ZUX D;  4J8X D;  1KX4 C;  3C1C B;  5AVC A;  4G91 B;  4H9S A;  5B32 A;  3UT9 D;  4H9Q B;  1S32 D;  3AZK B;  1M19 C;  2RVQ C;  3LZ1 B;  3KUY A;  3C1B B;  1P3A B;  3WKJ D;  3MGR D;  3AZF C;  3X1V D;  5AV8 C;  5B31 C;  3NQJ B;  3UTA B;  3WA9 C;  3TU4 A;  2BG1 A;  1AOI C;  3REL D;  4X23 C;  3LZ0 D;  3W97 B;  5BS7 A;  1P3O D;  3AZN D;  5G49 B;  1KX3 D;  1H3O B;  2UWX A;  3W98 D;  5KDM A;  1JFI B;  1M19 A;  1P3B D;  3KXB B;  4WU9 B;  2CV5 C;  4LD9 C;  3VH6 T;  5AY8 A;  3AZE A;  1TZY B;  5AV8 A;  1ID3 B;  2Y2Q A;  3AZJ D;  3MGS D;  3KWQ D;  4H9N B;  3H0R C;  2Y2G A;  3AZH A;  1AOI A;  4NE6 A;  1ZLA A;  3NQU A;  4UUZ B;  1EQZ C;  1BH8 B;  4YS3 D;  3X1U C;  2BYM A;  5AV9 A;  2Y2O A;  4AWL C;  3UTB A;  2FJ7 C;  1KX5 B;  5CP6 C;  4LD9 A;  2CV5 A;  1P3M C;  5B1M B;  1U35 C;  3A6N B;  3REH B;  4Z2M H;  1P3I B;  3AN2 C;  5B40 B;  1P34 D;  5B1L C;  4QLC C;  3AFA C;  5AVC D;  3MNN D;  4J8W B;  4KUD B;  4Z5T B;  5E5A C;  5CPJ B;  1P3P C;  3EPH A;  3AZI A;  1P3F A;  1HTA A;  3F6T A;  2Y2H A;  2Y2I A;  5F99 C;  3X1T D;  5BNX A;  3KUY B;  5GSU C;  5B24 A;  1F66 D;  4J8V A;  4DQY B;  2ARO A;  2NZD C;  4Z66 D;  3TU4 D;  1U35 A;  5GT0 D;  5B2J C;  5AV6 D;  1N1J A;  5B1L A;  4H9Q A;  4QLC A;  1PZR A;  3AZK A;  3AV2 C;  4WU8 C;  4ZUX C;  3C1B A;  3B0D C;  1P3A A;  3AZM D;  2NQB B;  5E5A A;  2YFW A;  5C3I C;  5AV5 D;  3UT9 C;  1S32 C;  1P3P A;  1KX4 B;  2L5A A;  3MGR C;  3W96 C;  1T3U A;  5KDM B;  1M19 B;  3X1V C;  5B0Z C;  3MVD A;  1A7W A;  3W97 A;  2NZD A;  3V9R A;  2F8N B;  5DNN A;  1M18 D;  5CPK D;  3MGP C;  5G49 A;  5AV8 B;  5JRG C;  5B31 B;  4YM6 D;  3REL C;  1ZLA D;  1JFI A;  3AV2 A;  3WA9 B;  3B6F D;  5B0Y D;  5AV9 D;  1KX3 C;  1AOI B;  5GXQ D;  3NQU B;  4X23 B;  1P3G D;  5BNV B;  2BYM B;  1TZY A;  5CPI C;  4WZS B;  3UTB B;  3REI D;  4H9N A;  5B0Z A;  3LEL C;  3B6G C;  4LD9 B;  2CV5 B;  4XUJ D;  3AZJ C;  3MGS C;  1BH8 A;  4XZQ C;  3AV1 C;  3VH5 T;  3MGP A;  3REJ D;  5JRG A;  2IO5 C;  4JJN D;  4YS3 C;  3AYW D;  1P3L C;  3B0B A;  4ZBJ C;  3KSY A;  1P3I A;  3REH A;  4R8P C;  1M1A D;  4M6B A;  5BO0 A;  3A1I A;  5B40 A;  3X1U B;  1P3F B;  3WAA D;  5CPI A;  4AWL B;  3C1C D;  2HIO D;  4KUD A;  4Z5T A;  5B33 C;  2ARO B;  3B6G A;  3LEL A;  5CPJ A;  4KGC C;  5CP6 B;  3AZK D;  3LZ1 D;  2W8S A;  1P3M B;  1U35 B;  3MNN C;  3AN2 B;  4XZQ A;  3AV1 A;  3LJA C;  1N1J B;  5B1L B;  4QLC B;  3AFA B;  2J8P A;  3VH6 W;  2JCH A;  2YFW B;  5E5A B;  3UTA D;  3X1S C;  1P3L A;  5DNM C;  1P3P B;  1HQ3 C;  2VQR A;  3EG5 B;  5F99 B;  5AVB C;  5GSU B;  3MVD B;  2NQB A;  5B33 A;  3REK D;  5AV6 C;  5GT3 C;  3WTP C;  4KGC A;  2NZD B;  3V9R B;  1KX4 A;  5DNN B;  4CAY A;  3KXB D;  4WU9 D;  5B2J B;  4NFT A;  3AZM C;  3LJA A;  2F8N H;  2DQN C;  4WU8 B;  5AV5 C;  3AV2 B;  5B2I C;  4ZUX B;  3IP4 C;  1TZY D;  1R4V A;  1ID3 D;  1TAF B;  1B67 A;  3B0D B;  3AZL D;  3X1S A;  5C3I B;  3AZF A;  5DNM A;  3UT9 B;  1S32 B;  2F8N A;  4DRA A;  1HQ3 A;  5FUG B;  5B31 A;  3O62 D;  3W96 B;  3WA9 A;  5AVB A;  3MGQ C;  3X1V B;  1WWI A;  5B0Z B;  4J8U D;  5CPK C;  4H9P A;  4X23 A;  5JA4 A;  5GT3 A;  3WTP A;  5BNV A;  2DF4 C;  5B0Y C;  3MGP B;  1KX5 D;  5JRG B;  5B1M D;  3A6N D;  3REL B;  1P3G C;  2Y2N A;  1KX3 B;  4CSR A;  4J8W D;  5BO0 B;  4Z5T D;  5CPI B;  3AZG C;  3MGQ A;  5B32 D;  3LEL B;  3B6G B;  3KUY D;  5BT1 C;  3MGS B;  2Y2J A;  3AZJ B;  1EQZ A;  3X1U A;  4XZQ B;  3AV1 B;  4WNN B;  3AYW C;  2IO5 B;  1M1A C;  4YS3 B;  3WAA C;  2FJ7 A;  1P3L B;  3VH5 A;  5CP6 A;  1P3M A;  1Q9C A;  2HIO C;  4R8P B;  3AN2 A;  2NQB D;  3W99 C;  3AFA A;  3AZG A;  2PYO C;  1P3K C;  4J8X C;  3R45 A;  5B33 B;  4KGC B;  1M19 D;  2RVQ D;  4CAY B;  3MNN B;  3WKJ C;  3LJA B;  5AY8 D;  3UTA C;  5F99 A;  3AZE D;  5GSU A;  5CHL B;  5AV8 D;  3X1S B;  3AZF B;  5DNM B;  3VH5 W;  1HQ3 B;  1Z2C B;  5B2J A;  3AZH D;  1AOI D;  3W99 A;  3LZ0 C;  3REK C;  4WU8 A;  2PYO A;  1P3K A;  4ZUX A;  4J8X A;  5AVB B;  1P3O C;  3AZN C;  1TAF A;  3UTB D;  4WU9 C;  4H9P B;  3W98 C;  2HUE C;  3WTP B;  5JA4 B;  5GT3 B;  5AV6 B;  3UT9 A;  1S32 A;  1P3B C;  5FUG A;  4LD9 D;  2CV5 D;  3WKJ A;  3AZM B;  3MGR A;  3AZL C;  3W96 A;  5AV5 B;  5B2I B;  3X1V A;  3KFU G;  3O62 C;  1BH9 B;  2BYK A;  2JSS A;  4CSR B;  4HGA C;  3KWQ C;  5B32 G;  4J8U C;  3B0C T;  3VH6 A;  3REL A;  3LZ0 A;  3AZI D;  1P3F D;  3A1K A;  1P3O A;  3MGQ B;  3AZN A;  1KX3 A;  4G92 C;  3H0L C;  3W98 A;  5B24 D;  1EQZ B;  4J8V D;  2ARO D;  3P5J B;  1P3B A;  3AL0 C;  4WV4 B;  4WJ3 C;  1U35 D;  3AN2 D;  1P34 C;  2FJ7 B;  5B1L D;  4QLC D;  2ZY5 A;  3EPJ A;  4KHA B;  3AZJ A;  3MGS A;  2ZY2 A;  5AVC C;  3C1B D;  3KWQ A;  1P3A D;  4WNN A;  5E5A D;  5B32 C;  3AZG B;  1P3P D;  3R45 B;  4YS3 A;  3X1T C;  4R8P A;  5GSU D;  3MVD D;  1F66 C;  4EO5 C;  3AYW B;  3W97 D;  2NZD D;  4Z66 C;  5DNN D;  3TU4 C;  5GT0 C;  1M1A B;  5B2J D;  1F1E A;  3FDD A;  4E45 A;  3AV2 D;  5BS7 C;  2HIO B;  3MNN A;  2G5H C;  3W99 B;  2PYO B;  1P3K B;  2YFV A;  4J8X B;  4H9R B;  3W96 D;  5AY8 C;  1W2E A;  3X1T A;  3AZE C;  5B0Z D;  1F66 A;  3WKJ B;  3MGR B;  4NE3 A;  4Z2M G;  4Z66 A;  1M18 C;  3MGP D;  5GT0 A;  5JRG D;  3AZH C;  4YM6 C;  2BYK B;  3EPK A;  5AV6 A;  1ZLA C;  1B6W A;  3B6F C;  5AV9 C;  3UTB C;  3AZM A;  1P3I D;  3REH D;  5GXQ C;  3LZ0 B;  3REK B;  3EPL A;  5AV5 A;  5B40 D;  5B2I A;  1P3O B;  5CPI D;  3AZN B;  1BH9 A;  4KUD D;  3W98 B;  2HUE B;  3REI C;  1WWS A;  3LEL D;  5CPJ D;  1P3B B;  3B6G D;  1ULY A;  4XUJ C;  4H9O B;  3AZL B;  2LY8 A;  4UPK A;  4DRB A;  4XZQ D;  3AV1 D;  2F2A C;  1M18 A;  5CPK A;  3REJ C;  4YM6 A;  3O62 B;  4JJN C;  4HGA B;  3AZI C;  3KWQ B;  3H0M C;  1P3F C;  1P3L D;  3B6F A;  5B0Y A;  4J8U B;  5GXQ A;  4R8P D;  5B24 C;  1P3G A;  4J8V C;  2ARO C;  2XD1 A;  4ZBJ B;  4KHA A;  4G92 B;  3C1C C;  2G5I C;  4G91 C;  3REI A;  5B33 D;  4KGC D;  3AZK C;  2F8N K;  3LZ1 C;  1KX4 D;  4XUJ A;  2Y2P A;  3C1B C;  2ZM5 A;  2JE5 A;  1P3A C;  3LJA D;  1P34 B;  3REJ A;  3WTP E;  2Y2K A;  5AVC B;  4JJN A;  1KU5 A;  3AYW A;  3X1S D;  5B32 B;  3AZF D;  5DNM D;  2F8N D;  2YFV B;  1HQ3 D;  1M1A A;  3MVD C;  5B31 D;  3WAA A;  3W97 C;  2XD5 A;  3WA9 D;  5AVB D;  3X1T B;  3C1C A;  2HIO A;  5DNN C;  3B0C W;  1F66 B;  4X23 D;  4EO5 B;  5GT3 D;  3WTP D;  3LZ1 A;  4Z66 B;  3TU4 B;  4H9R A;  5GT0 B;  3KXB C;  4NE5 A;  5B2I D;  1TZY C;  1ID3 C;  3NQJ A;  2CWE A;  2Y2L A;  3UTA A;  2ZY4 A;  5AY8 B;  3MGQ D;  3AZE B;  2ZY3 A;  1H3O A;  3REK A;  1EQZ D;  3X1U D;  1M18 B;  5CPK B;  1KX5 C;  3KXB A;  4WU9 A;  3AZH B;  5B1M C;  4YM6 B;  4E44 A;  3A6N C;  3REH C;  1P3I C;  1ZLA B;  5B40 C;  2FJ7 D;  3B6F B;  5B0Y B;  5AV9 B;  5CP6 D;  1ID3 A;  1P3M D;  4H9O A;  3AZL A;  4J8W C;  5GXQ B;  4KUD C;  1P3G B;  4Z5T C;  3AFA D;  3AZG D;  5CPJ C;  3O62 A;  4UUZ A;  3REI B;  4H9S C;  4J8U A;  3KUY C;  4XUJ B;  5BT1 D;  2RIQ A;  2Y2M A;  1BFM A;  1KX5 A;  5F99 D;  3REJ B;  2F8N G;  2FFF B;  5B1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...