1H3OA

Crystal structure of the human taf4-taf12 (tafii135-tafii20) complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
49
structure length
49
Chain Sequence
b'MFLLQAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID 135 KDA SUBUNIT
publication title Crystal Structure of a Subcomplex of Human Transcription Factor TFIID Formed by TATA Binding Protein-Associated Factors Htaf4 (Htaf(II)135) and Htaf12 (Htaf(II)20).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/tbp-associated factors
total genus 18
structure length 49
sequence length 49
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1h3oA00
1AOIB 3AZLC 3C1CB 3W97C 1P3BA 5DNMA 4LD9A 3KXBB 5CP6C 3VH5T 3UTBA 1TAFB 2FJ7D 3MVDB 5BS7A 5AVCB 4QLCB 1KX3A 2NQBD 2YFVB 4ZUXD 5CPJD 1B67A 4EO5B 5B40B 2IO5C 3X1TD 1M19D 3LELD 5AV5B 2F8NB 2FJ7C 4HGAC 4G91C 5GSUB 5B0YB 3AZIA 2NQBC 4ZUXC 3AV2A 3REIB 1P3FA 2NZDA 1N1JB 3MGSD 5CPJC 5B32D 5DNND 5B2IA 1M19C 3X1TC 4H9QB 3LELC 3UTAB 2F8NG 4J8VA 5B2JB 4KHAB 1TZYB 2HUEB 3AZJD 3MGSC 4H9RA 5B32C 5CPID 5B31D 5DNNC 3W96B 3X1UD 5CPKD 3WAAB 3W99D 4Z5TD 5GT0B 3AZJC 5BNVB 4KUDD 3AN2A 1P3LA 1M18D 5CPIC 3REHB 4Z66B 5B31C 3REKA 3WKJA 3B0DB 3RELD 3AZMA 1P3BD 3X1UC 3VH5W 5CPKC 3W99C 4LD9D 3AZGB 4Z5TC 3UTBD 3C1BA 4KUDC 4J8UD 1KX3D 1M18C 3AZFA 3KWQD 5GXQA 3MGPD 3B6FD 5FUGA 3B6GB 3RELC 1P3PD 1P3BC 4LD9C 5C3IB 1AOIA 3UTBC 3C1CA 5JRGB 5BS7C 4WU9D 4J8UC 1KX3C 3KWQC 3AV2D 3MGPC 5B1MB 1P3FD 3B6FC 3KXBA 1P3PC 1M1AB 1TAFA 4NE5A 3MVDA 5B2ID 3UT9B 5AVCA 2AROA 4QLCA 2YFVA 4WU9C 3AV2C 3AZNA 1P3FC 2F8NA 3TU4A 2CV5B 5AV5A 5BO0B 5B2IC 5GSUA 5B0YA 3R45B 4H9OB 3NQJB 2HIOA 3REIA 1N1JA 3AN2D 5BT1D 4E45A 4XUJB 3REKD 3UTAA 5B2JA 4KHAA 4ZBJC 5JA4B 5AV8D 3REJB 3C1BD 1P3MB 3AN2C 5BT1C 3AFAD 3AZFD 3LJAB 3REKC 3W96A 3WAAA 3WTPB 1A7WA 5GT0A 5BNVA 5AV8C 3C1BC 4Z66A 1KU5A 4R8PB 5E5AB 1HQ3A 3AFAC 3AZFC 5AV9D 3KXBD 3MVDD 3WA9D 3MGQB 4J8XB 2AROD 4QLCD 1F1EA 1P3IB 4CAYB 3B6GA 3AZND 5CHLB 5AV9C 3KXBC 3AYWB 5GT3B 3TU4D 3MVDC 5JRGA 3AZEB 3WA9C 5GSUD 2AROC 4QLCC 2HIOD 3AZHB 3AZNC 1M1AA 3KUYB 3TU4C 4YS3D 3LZ1B 5GSUC 5B2JD 3X1SB 2HIOC 3X1VB 2CV5A 5BO0A 2PYOA 1KX5B 3O62B 3R45A 4YS3C 3A6NB 1F66D 3NQJA 5B2JC 1ZLAB 5GT0D 4DRBA 1JFIB 4XUJA 1HQ3D 1H3OB 1F66C 5AVBB 3REJA 5GT0C 5AV6B 3LJAA 4Z2MH 1KX4B 1P3OB 1HQ3C 4J8WB 3B6GD 3WTPA 3LZ0B 1P3KB 4R8PA 3AZLB 4NFTA 5G49B 5E5AA 1P34D 4X23D 3B6GC 3W97B 1M1AD 4H9PB 1BH8A 5C3IC 4J8XA 3AV1A 5B1LA 1BFMA 2RVQD 4CAYA 5DNMD 1P34C 4X23C 3AYWA 1S32B 1M1AC 5GT3A 3AZEA 4UUZB 2PYOD 2IO5B 1P3GA 2FJ7B 5F99B 4JJNB 4G91B 2BYMB 4YM6A 2RVQC 2NQBB 3AZHA 4ZUXB 5DNMC 5CPJB 3KUYA 4KGCB 3LZ1A 3AZID 2PYOC 4XZQB 2NZDD 3X1SA 4WNNB 3X1VA 5B24B 3MGSB 3O62A 4J8VD 3AZIC 2NZDC 2LY8A 1ZLAA 5B40A 4G92C 1JFIA 2YFWB 5B33B 4R8PD 2CWEA 3AZJB 3W98B 5CPIB 5B31B 4J8VC 1H3OA 3X1UB 5CPKB 3W99B 1P3LD 4Z5TB 5AV6A 4H9QA 3AV1D 5B1LD 3MNNB 1B6WA 4R8PC 3WKJD 4KUDB 1M18B 1KX4A 1TZYA 4NE3A 3AZMD 1P3OA 4J8WA 1EQZB 5B31G 3LZ0A 4H9NB 3RELB 1P3KA 3AZED 1P3LC 2JSSA 3UTBB 3AZLA 1P3GD 1WWIA 3AV1C 5GXQD 5B1LC 1P3AB 3WKJC 4YM6D 4J8UB 1KX3B 3AZMC 3KWQB 3W97A 3V9RB 3MGPB 1ID3B 1AOID 4H9PA 3B6FB 3MGRB 3C1CD 3REHA 1P3PB 3AZEC 1P3GC 5GXQC 4WU9B 4YM6C 3AZGA 3X1VD 4CSRB 5KDMB 1S32A 1P3FB 4AWLB 1AOIC 5AVCD 3C1CC 4UUZA 3NQUB 2FJ7A 5F99A 4JJNA 2BYMA 2NQBA 4ZUXA 1U35B 3X1VC 5B40D 5CPJA 2F8ND 5AV5D 5BNXB 5B0YD 4KGCA 5AVCC 4XZQA 3REID 5B1MA 3B0CT 4EO5C 4WNNA 5B24A 5AY8B 5AV6D 3MGSA 3UT9A 5B40C 5AV5C 3UTAD 5B0YC 4WU8B 1KX4D 1TZYD 1P3OD 3B0BA 3REIC 3REKB 2YFWA 5B33A 5AV8B 5AV6C 3AZJA 3C1BB 3W98A 3UTAC 5CPIA 3W96D 4Z2MG 4H9OA 5B31A 3WAAD 1KX4C 1TZYC 3AFAB 3AZKB 1ULYA 3AZFB 1P3OC 2HUEC 3X1UA 5CPKA 3W99A 3VH6A 4Z5TA 3REHD 4Z66D 3MNNA 4KUDA 1M18A 3W96C 3WAAC 5JA4A 4DRAA 1EQZA 2BYKB 3AZGD 4H9NA 5B0ZB 3RELA 1P3MA 1S32D 5AV9B 3REHC 4Z66C 1P3AA 5F99D 3WA9B 4JJND 4M6BA 4J8UA 2AROB 3B0DC 3KWQA 3V9RA 3MGPA 3AZGC 1ID3A 3B6FA 3MGRA 3AZNB 5JRGD 1S32C 1P3PA 4KGCD 3TU4B 3B0CW 5F99C 4XZQD 5B1MD 4JJNC 4WU9A 4CSRA 2HIOB 5KDMA 5CP6B 5B24D 3MGQA 3UT9D 5JRGC 4WZSB 3NQUA 4KGCC 1P3IA 4XZQC 1R4VA 5B1MC 4YS3B 1U35A 1WWSA 2CV5D 5BNXA 5B24C 5B33D 3UT9C 3W98D 4HGAB 1F66B 4WV4B 5AY8A 3VH6T 2CV5C 4XUJD 3MNND 5B33C 1M19B 3X1TB 3LELB 4WU8A 3W98C 1EQZD 2F8NH 1HQ3B 3REJD 4H9SA 1P3MD 5B32B 5AV8A 1KX5A 3LJAD 4XUJC 3A6NA 5DNNB 1P3AD 3MNNC 3WTPD 1BH9B 3AFAA 3AZKA 1EQZC 1ID3D 3MGRD 3REJC 1P3MC 4NE6A 2L5AA 5E5AD 5B32G 3LJAC 1P3AC 2BYKA 3WTPC 5AVBA 5B0ZA 1P34B 1ID3C 3MGQD 4X23B 5AV9A 3MGRC 4J8XD 3WA9A 5E5AC 1P3ID 1U35D 3AYWD 1P3BB 5GT3D 5DNMB 4LD9B 3MGQC 4AWLC 4J8XC 5G49A 2PYOB 3AZHD 1P3IC 1U35C 3VH6W 5CP6A 3AYWC 3KUYD 5AY8D 3KSYA 5GT3C 3LZ1D 4WU8D 4E44A 3X1SD 4YS3A 3AZIB 3AZHC 3AV2B 2NZDB 3VH5A 3KUYC 5AY8C 4G92B 1KX5D 3O62D 3A6ND 5B2IB 3LZ1C 4WU8C 3AZKD 3X1SC 1ZLAD 1HTAA 4J8VB 1F66A 4H9SC 4H9RB 1M19A 3X1TA 1KX5C 3LELA 3O62C 3A6NC 4ZBJB 3AZKC 1P34A 5AVBD 5B0ZD 1ZLAC 5B32A 1BH8B 5DNNA 3AN2B 1P3LB 4J8WD 3AV1B 5B1LB 1BH9A 1Q9CA 3WKJB 3LZ0D 1P3KD 3AZMB 5AVBC 5B0ZC 3AZLD 2F8NK 1P3GB 4J8WC 5GXQB 3W97D 3WTPE 3LZ0C 5FUGB 4YM6B 5CP6D 1P3KC 4X23A
chains in the Genus database with same CATH superfamily
1AOIB 3AZLC 3C1CB 3W97C 1P3BA 5DNMA 4LD9A 3KXBB 5CP6C 3VH5T 3UTBA 1TAFB 2FJ7D 3MVDB 5BS7A 5AVCB 4QLCB 1KX3A 2NQBD 2YFVB 4ZUXD 5CPJD 1B67A 4EO5B 3H0LC 2IO5C 5B40B 3X1TD 3LELD 5AV5B 1M19D 2F8NB 2FJ7C 4HGAC 4G91C 5GSUB 5B0YB 3AZIA 2NQBC 4ZUXC 3AV2A 3REIB 1P3FA 2NZDA 1N1JB 3MGSD 5CPJC 5B32D 5DNND 5B2IA 1M19C 3X1TC 4H9QB 3LELC 3UTAB 2F8NG 4J8VA 5B2JB 4KHAB 1TZYB 2HUEB 3AZJD 3MGSC 4H9RA 5B32C 5CPID 5B31D 5DNNC 3FDDA 3W96B 3X1UD 5CPKD 3WAAB 3W99D 4Z5TD 5GT0B 3AZJC 5BNVB 4KUDD 3AN2A 1P3LA 2FFFB 1M18D 5CPIC 3REHB 4Z66B 5B31C 3REKA 3WKJA 2G5IC 3B0DB 3RELD 3AZMA 1P3BD 3X1UC 3VH5W 5CPKC 3W99C 4LD9D 3AZGB 4Z5TC 3UTBD 3C1BA 4KUDC 4J8UD 1KX3D 1M18C 3AZFA 3KWQD 5GXQA 3MGPD 3B6FD 5FUGA 3B6GB 3RELC 1P3PD 1P3BC 4LD9C 5C3IB 1AOIA 3UTBC 3C1CA 5JRGB 5BS7C 4WU9D 4J8UC 1KX3C 1Z2CB 3KWQC 3MGPC 3AV2D 5B1MB 1P3FD 3B6FC 3KXBA 1P3PC 1M1AB 1TAFA 4NE5A 3MVDA 5B2ID 3UT9B 5AVCA 2AROA 2Y2MA 4QLCA 2YFVA 4WU9C 3H0RC 3AV2C 2Y2NA 3AZNA 1P3FC 2F8NA 3TU4A 2CV5B 5AV5A 4WJ3C 5BO0B 5B2IC 5GSUA 5B0YA 3R45B 4H9OB 3NQJB 2HIOA 3REIA 1N1JA 3AN2D 5BT1D 4E45A 4XUJB 3REKD 3UTAA 3A1KA 5B2JA 4KHAA 4ZBJC 5JA4B 5AV8D 3REJB 3C1BD 1P3MB 3AN2C 5BT1C 3AFAD 3AZFD 3LJAB 2Y2GA 3REKC 3W96A 2ZM5A 3WAAA 3KFUG 3WTPB 1PZRA 1A7WA 2ZY5A 5GT0A 3EPKA 5BNVA 5AV8C 3C1BC 4Z66A 1KU5A 4R8PB 5E5AB 1HQ3A 3AFAC 3AZFC 5AV9D 3KXBD 3MVDD 3WA9D 3MGQB 4J8XB 2AROD 4QLCD 1F1EA 1P3IB 4CAYB 3B6GA 3AZND 5CHLB 2VQRA 5AV9C 3KXBC 3AYWB 2RIQA 5GT3B 3TU4D 3MVDC 5JRGA 3AZEB 3WA9C 5GSUD 3H0MC 2AROC 4QLCC 2HIOD 3AZHB 3AZNC 1M1AA 3KUYB 3TU4C 4YS3D 3LZ1B 5GSUC 5B2JD 3X1SB 2HIOC 3X1VB 2Y2OA 2CV5A 5BO0A 2PYOA 1KX5B 2XD1A 3O62B 3R45A 4YS3C 3A6NB 1F66D 3NQJA 5B2JC 1ZLAB 5GT0D 4DRBA 1JFIB 4XUJA 1HQ3D 1H3OB 1F66C 5AVBB 3REJA 5GT0C 5AV6B 3LJAA 4Z2MH 1KX4B 1P3OB 1HQ3C 2JCHA 4J8WB 3WTPA 3B6GD 3LZ0B 1P3KB 2Y2PA 4R8PA 3AZLB 4NFTA 5G49B 5E5AA 1P34D 4X23D 3B6GC 3W97B 1M1AD 4H9PB 1BH8A 5C3IC 4J8XA 3AV1A 5B1LA 1BFMA 2RVQD 4CAYA 5DNMD 1P34C 4X23C 3AYWA 1S32B 1M1AC 5GT3A 3AZEA 4UUZB 2PYOD 2IO5B 1P3GA 2FJ7B 5F99B 4JJNB 4G91B 2BYMB 4YM6A 2RVQC 2NQBB 3AZHA 4ZUXB 5DNMC 5CPJB 3KUYA 4KGCB 3A1IA 3LZ1A 3AZID 2PYOC 4XZQB 2NZDD 3X1SA 3F6TA 4WNNB 3X1VA 5B24B 3MGSB 3O62A 4J8VD 3AZIC 3AL0C 2NZDC 2LY8A 2Y2QA 1ZLAA 5B40A 4G92C 1JFIA 2YFWB 5B33B 4R8PD 2CWEA 3AZJB 3W98B 2W8SA 5CPIB 5B31B 4J8VC 2ZY4A 1H3OA 3X1UB 5CPKB 3W99B 1P3LD 4Z5TB 5AV6A 4H9QA 3AV1D 5B1LD 3MNNB 1B6WA 4R8PC 3WKJD 4KUDB 1M18B 1KX4A 1TZYA 4NE3A 3AZMD 1P3OA 4J8WA 1EQZB 5B31G 3LZ0A 4H9NB 3RELB 1P3KA 3AZED 1P3LC 2JSSA 3UTBB 2JE5A 3AZLA 1P3GD 1WWIA 3AV1C 5GXQD 5B1LC 1P3AB 3WKJC 4YM6D 4J8UB 1KX3B 3AZMC 3KWQB 3W97A 3V9RB 3MGPB 1ID3B 1AOID 4H9PA 3B6FB 3MGRB 3C1CD 3REHA 1P3PB 3AZEC 1P3GC 5GXQC 4WU9B 4YM6C 3AZGA 3X1VD 3EPLA 4CSRB 5KDMB 1S32A 1P3FB 4AWLB 1AOIC 5AVCD 3C1CC 4UUZA 3NQUB 2FJ7A 5F99A 4JJNA 2BYMA 2NQBA 4ZUXA 1U35B 3X1VC 5B40D 5CPJA 2F8ND 5AV5D 5BNXB 2Y2LA 5B0YD 5AVCC 4KGCA 3EPHA 4XZQA 3REID 5B1MA 3B0CT 4EO5C 4WNNA 2Y2HA 5AY8B 5AV6D 5B24A 3MGSA 4UPKA 5AV5C 3UT9A 5B40C 3UTAD 5B0YC 4WU8B 1KX4D 1TZYD 1P3OD 3B0BA 3REIC 3REKB 2YFWA 5B33A 5AV8B 5AV6C 3AZJA 3C1BB 3W98A 3UTAC 5CPIA 3W96D 4Z2MG 4H9OA 5B31A 3WAAD 1KX4C 1TZYC 3AFAB 3AZKB 1ULYA 3AZFB 1P3OC 2HUEC 3X1UA 5CPKA 3W99A 3VH6A 4Z5TA 3REHD 4Z66D 3MNNA 4KUDA 1M18A 3W96C 3WAAC 5JA4A 4DRAA 1EQZA 2BYKB 3AZGD 4H9NA 5B0ZB 3RELA 1P3MA 1S32D 3EG5B 5AV9B 3REHC 4Z66C 1P3AA 5F99D 3WA9B 4JJND 4M6BA 4J8UA 2AROB 3B0DC 3KWQA 3V9RA 3MGPA 3AZGC 1ID3A 3B6FA 3MGRA 3AZNB 5JRGD 1S32C 1P3PA 2XD5A 4KGCD 3TU4B 3B0CW 5F99C 4XZQD 5B1MD 4JJNC 4WU9A 4CSRA 2HIOB 5KDMA 5CP6B 5B24D 3MGQA 3UT9D 5JRGC 4WZSB 3NQUA 2UWXA 4KGCC 2Y2KA 1P3IA 4XZQC 1R4VA 5B1MC 4YS3B 1U35A 1WWSA 2CV5D 5BNXA 5B24C 5B33D 1W2EA 3UT9C 3W98D 4HGAB 1F66B 4WV4B 5AY8A 3VH6T 2CV5C 4XUJD 3MNND 5B33C 1M19B 3X1TB 3LELB 4WU8A 3W98C 1EQZD 2F8NH 2DQNC 1HQ3B 3REJD 4H9SA 1P3MD 5B32B 5AV8A 1KX5A 2J8PA 3LJAD 4XUJC 3A6NA 5DNNB 1P3AD 3MNNC 3WTPD 1BH9B 3AFAA 3AZKA 4DQYB 1EQZC 1ID3D 3MGRD 3REJC 1P3MC 4NE6A 2L5AA 5E5AD 5B32G 3LJAC 1P3AC 2BG1A 2BYKA 3WTPC 5AVBA 5B0ZA 1P34B 1ID3C 3MGQD 4X23B 5AV9A 3MGRC 4J8XD 3WA9A 5E5AC 1P3ID 1U35D 3AYWD 1P3BB 5GT3D 5DNMB 4LD9B 3MGQC 4AWLC 4J8XC 5G49A 2ZY2A 2PYOB 3AZHD 1P3IC 2Y2JA 1U35C 3VH6W 5CP6A 3AYWC 3KUYD 5AY8D 3KSYA 5GT3C 3LZ1D 4WU8D 4E44A 3X1SD 2G5HC 4YS3A 3AZIB 3AZHC 2ZY3A 3P5JB 3AV2B 2NZDB 3VH5A 3KUYC 5AY8C 4G92B 1KX5D 2F2AC 3O62D 3A6ND 5B2IB 3LZ1C 4WU8C 3AZKD 3X1SC 2Y2IA 1ZLAD 1HTAA 4J8VB 1F66A 4H9SC 4H9RB 1M19A 3X1TA 1KX5C 3LELA 3O62C 3A6NC 4ZBJB 3AZKC 1P34A 5AVBD 5B0ZD 1ZLAC 5B32A 1BH8B 5DNNA 3EPJA 3AN2B 1P3LB 4J8WD 3AV1B 5B1LB 1BH9A 1Q9CA 3WKJB 3LZ0D 1P3KD 3AZMB 5AVBC 5B0ZC 3AZLD 1T3UA 3IP4C 2F8NK 1P3GB 4J8WC 5GXQB 3W97D 2DF4C 3WTPE 3LZ0C 5FUGB 4YM6B 5CP6D 1P3KC 4X23A
chains in the Genus database with same CATH topology
1AOIB 3AZLC 3C1CB 3W97C 1P3BA 5DNMA 4LD9A 3KXBB 5CP6C 3VH5T 3UTBA 1TAFB 2FJ7D 3MVDB 5BS7A 5AVCB 4QLCB 1KX3A 2NQBD 2YFVB 4ZUXD 5CPJD 1B67A 4EO5B 3H0LC 2IO5C 5B40B 3X1TD 3LELD 5AV5B 1M19D 2F8NB 2FJ7C 4HGAC 4G91C 5GSUB 5B0YB 3AZIA 2NQBC 4ZUXC 3AV2A 3REIB 1P3FA 2NZDA 1N1JB 3MGSD 5CPJC 5B32D 5DNND 5B2IA 1M19C 3X1TC 4H9QB 3LELC 3UTAB 2F8NG 4J8VA 5B2JB 4KHAB 1TZYB 2HUEB 3AZJD 3MGSC 4H9RA 5B32C 5CPID 5B31D 5DNNC 3FDDA 3W96B 3X1UD 5CPKD 3WAAB 3W99D 4Z5TD 5GT0B 3AZJC 5BNVB 4KUDD 3AN2A 1P3LA 2FFFB 1M18D 5CPIC 3REHB 4Z66B 5B31C 3REKA 3WKJA 2G5IC 3B0DB 3RELD 3AZMA 1P3BD 3X1UC 3VH5W 5CPKC 3W99C 4LD9D 3AZGB 4Z5TC 3UTBD 3C1BA 4KUDC 4J8UD 1KX3D 1M18C 3AZFA 3KWQD 5GXQA 3MGPD 3B6FD 5FUGA 3B6GB 3RELC 1P3PD 1P3BC 4LD9C 5C3IB 1AOIA 3UTBC 3C1CA 5JRGB 5BS7C 4WU9D 4J8UC 1KX3C 1Z2CB 3KWQC 3MGPC 3AV2D 5B1MB 1P3FD 3B6FC 3KXBA 1P3PC 1M1AB 1TAFA 4NE5A 3MVDA 5B2ID 3UT9B 5AVCA 2AROA 2Y2MA 4QLCA 2YFVA 4WU9C 3H0RC 3AV2C 2Y2NA 3AZNA 1P3FC 2F8NA 3TU4A 2CV5B 5AV5A 4WJ3C 5BO0B 5B2IC 5GSUA 5B0YA 3R45B 4H9OB 3NQJB 2HIOA 3REIA 1N1JA 3AN2D 5BT1D 4E45A 4XUJB 3REKD 3UTAA 3A1KA 5B2JA 4KHAA 4ZBJC 5JA4B 5AV8D 3REJB 3C1BD 1P3MB 3AN2C 5BT1C 3AFAD 3AZFD 3LJAB 2Y2GA 3REKC 3W96A 2ZM5A 3WAAA 3KFUG 3WTPB 1PZRA 1A7WA 2ZY5A 5GT0A 3EPKA 5BNVA 5AV8C 3C1BC 4Z66A 1KU5A 4R8PB 5E5AB 1HQ3A 3AFAC 3AZFC 5AV9D 3KXBD 3MVDD 3WA9D 3MGQB 4J8XB 2AROD 4QLCD 1F1EA 1P3IB 4CAYB 3B6GA 3AZND 5CHLB 2VQRA 5AV9C 3KXBC 3AYWB 2RIQA 5GT3B 3TU4D 3MVDC 5JRGA 3AZEB 3WA9C 5GSUD 3H0MC 2AROC 4QLCC 2HIOD 3AZHB 3AZNC 1M1AA 3KUYB 3TU4C 4YS3D 3LZ1B 5GSUC 5B2JD 3X1SB 2HIOC 3X1VB 2Y2OA 2CV5A 5BO0A 2PYOA 1KX5B 2XD1A 3O62B 3R45A 4YS3C 3A6NB 1F66D 3NQJA 5B2JC 1ZLAB 5GT0D 4DRBA 1JFIB 4XUJA 1HQ3D 1H3OB 1F66C 5AVBB 3REJA 5GT0C 5AV6B 3LJAA 4Z2MH 1KX4B 1P3OB 1HQ3C 2JCHA 4J8WB 3WTPA 3B6GD 3LZ0B 1P3KB 2Y2PA 4R8PA 3AZLB 4NFTA 5G49B 5E5AA 1P34D 4X23D 3B6GC 3W97B 1M1AD 4H9PB 1BH8A 5C3IC 4J8XA 3AV1A 5B1LA 1BFMA 2RVQD 4CAYA 5DNMD 1P34C 4X23C 3AYWA 1S32B 1M1AC 5GT3A 3AZEA 4UUZB 2PYOD 2IO5B 1P3GA 2FJ7B 5F99B 4JJNB 4G91B 2BYMB 4YM6A 2RVQC 2NQBB 3AZHA 4ZUXB 5DNMC 5CPJB 3KUYA 4KGCB 3A1IA 3LZ1A 3AZID 2PYOC 4XZQB 2NZDD 3X1SA 3F6TA 4WNNB 3X1VA 5B24B 3MGSB 3O62A 4J8VD 3AZIC 3AL0C 2NZDC 2LY8A 2Y2QA 1ZLAA 5B40A 4G92C 1JFIA 2YFWB 5B33B 4R8PD 2CWEA 3AZJB 3W98B 2W8SA 5CPIB 5B31B 4J8VC 2ZY4A 1H3OA 3X1UB 5CPKB 3W99B 1P3LD 4Z5TB 5AV6A 4H9QA 3AV1D 5B1LD 3MNNB 1B6WA 4R8PC 3WKJD 4KUDB 1M18B 1KX4A 1TZYA 4NE3A 3AZMD 1P3OA 4J8WA 1EQZB 5B31G 3LZ0A 4H9NB 3RELB 1P3KA 3AZED 1P3LC 2JSSA 3UTBB 2JE5A 3AZLA 1P3GD 1WWIA 3AV1C 5GXQD 5B1LC 1P3AB 3WKJC 4YM6D 4J8UB 1KX3B 3AZMC 3KWQB 3W97A 3V9RB 3MGPB 1ID3B 1AOID 4H9PA 3B6FB 3MGRB 3C1CD 3REHA 1P3PB 3AZEC 1P3GC 5GXQC 4WU9B 4YM6C 3AZGA 3X1VD 3EPLA 4CSRB 5KDMB 1S32A 1P3FB 4AWLB 1AOIC 5AVCD 3C1CC 4UUZA 3NQUB 2FJ7A 5F99A 4JJNA 2BYMA 2NQBA 4ZUXA 1U35B 3X1VC 5B40D 5CPJA 2F8ND 5AV5D 5BNXB 2Y2LA 5B0YD 5AVCC 4KGCA 3EPHA 4XZQA 3REID 5B1MA 3B0CT 4EO5C 4WNNA 2Y2HA 5AY8B 5AV6D 5B24A 3MGSA 4UPKA 5AV5C 3UT9A 5B40C 3UTAD 5B0YC 4WU8B 1KX4D 1TZYD 1P3OD 3B0BA 3REIC 3REKB 2YFWA 5B33A 5AV8B 5AV6C 3AZJA 3C1BB 3W98A 3UTAC 5CPIA 3W96D 4Z2MG 4H9OA 5B31A 3WAAD 1KX4C 1TZYC 3AFAB 3AZKB 1ULYA 3AZFB 1P3OC 2HUEC 3X1UA 5CPKA 3W99A 3VH6A 4Z5TA 3REHD 4Z66D 3MNNA 4KUDA 1M18A 3W96C 3WAAC 5JA4A 4DRAA 1EQZA 2BYKB 3AZGD 4H9NA 5B0ZB 3RELA 1P3MA 1S32D 3EG5B 5AV9B 3REHC 4Z66C 1P3AA 5F99D 3WA9B 4JJND 4M6BA 4J8UA 2AROB 3B0DC 3KWQA 3V9RA 3MGPA 3AZGC 1ID3A 3B6FA 3MGRA 3AZNB 5JRGD 1S32C 1P3PA 2XD5A 4KGCD 3TU4B 3B0CW 5F99C 4XZQD 5B1MD 4JJNC 4WU9A 4CSRA 2HIOB 5KDMA 5CP6B 5B24D 3MGQA 3UT9D 5JRGC 4WZSB 3NQUA 2UWXA 4KGCC 2Y2KA 1P3IA 4XZQC 1R4VA 5B1MC 4YS3B 1U35A 1WWSA 2CV5D 5BNXA 5B24C 5B33D 1W2EA 3UT9C 3W98D 4HGAB 1F66B 4WV4B 5AY8A 3VH6T 2CV5C 4XUJD 3MNND 5B33C 1M19B 3X1TB 3LELB 4WU8A 3W98C 1EQZD 2F8NH 2DQNC 1HQ3B 3REJD 4H9SA 1P3MD 5B32B 5AV8A 1KX5A 2J8PA 3LJAD 4XUJC 3A6NA 5DNNB 1P3AD 3MNNC 3WTPD 1BH9B 3AFAA 3AZKA 4DQYB 1EQZC 1ID3D 3MGRD 3REJC 1P3MC 4NE6A 2L5AA 5E5AD 5B32G 3LJAC 1P3AC 2BG1A 2BYKA 3WTPC 5AVBA 5B0ZA 1P34B 1ID3C 3MGQD 4X23B 5AV9A 3MGRC 4J8XD 3WA9A 5E5AC 1P3ID 1U35D 3AYWD 1P3BB 5GT3D 5DNMB 4LD9B 3MGQC 4AWLC 4J8XC 5G49A 2ZY2A 2PYOB 3AZHD 1P3IC 2Y2JA 1U35C 3VH6W 5CP6A 3AYWC 3KUYD 5AY8D 3KSYA 5GT3C 3LZ1D 4WU8D 4E44A 3X1SD 2G5HC 4YS3A 3AZIB 3AZHC 2ZY3A 3P5JB 3AV2B 2NZDB 3VH5A 3KUYC 5AY8C 4G92B 1KX5D 2F2AC 3O62D 3A6ND 5B2IB 3LZ1C 4WU8C 3AZKD 3X1SC 2Y2IA 1ZLAD 1HTAA 4J8VB 1F66A 4H9SC 4H9RB 1M19A 3X1TA 1KX5C 3LELA 3O62C 3A6NC 4ZBJB 3AZKC 1P34A 5AVBD 5B0ZD 1ZLAC 5B32A 1BH8B 5DNNA 3EPJA 3AN2B 1P3LB 4J8WD 3AV1B 5B1LB 1BH9A 1Q9CA 3WKJB 3LZ0D 1P3KD 3AZMB 5AVBC 5B0ZC 3AZLD 1T3UA 3IP4C 2F8NK 1P3GB 4J8WC 5GXQB 3W97D 2DF4C 3WTPE 3LZ0C 5FUGB 4YM6B 5CP6D 1P3KC 4X23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOI B;  3AZL C;  3C1C B;  3W97 C;  1P3B A;  5DNM A;  4LD9 A;  3KXB B;  5CP6 C;  3VH5 T;  3UTB A;  1TAF B;  2FJ7 D;  3MVD B;  5BS7 A;  5AVC B;  4QLC B;  1KX3 A;  2NQB D;  2YFV B;  4ZUX D;  5CPJ D;  1B67 A;  4EO5 B;  5B40 B;  2IO5 C;  3X1T D;  1M19 D;  3LEL D;  5AV5 B;  2F8N B;  2FJ7 C;  4HGA C;  4G91 C;  5GSU B;  5B0Y B;  3AZI A;  2NQB C;  4ZUX C;  3AV2 A;  3REI B;  1P3F A;  2NZD A;  1N1J B;  3MGS D;  5CPJ C;  5B32 D;  5DNN D;  5B2I A;  1M19 C;  3X1T C;  4H9Q B;  3LEL C;  3UTA B;  2F8N G;  4J8V A;  5B2J B;  4KHA B;  1TZY B;  2HUE B;  3AZJ D;  3MGS C;  4H9R A;  5B32 C;  5CPI D;  5B31 D;  5DNN C;  3W96 B;  3X1U D;  5CPK D;  3WAA B;  3W99 D;  4Z5T D;  5GT0 B;  3AZJ C;  5BNV B;  4KUD D;  3AN2 A;  1P3L A;  1M18 D;  5CPI C;  3REH B;  4Z66 B;  5B31 C;  3REK A;  3WKJ A;  3B0D B;  3REL D;  3AZM A;  1P3B D;  3X1U C;  3VH5 W;  5CPK C;  3W99 C;  4LD9 D;  3AZG B;  4Z5T C;  3UTB D;  3C1B A;  4KUD C;  4J8U D;  1KX3 D;  1M18 C;  3AZF A;  3KWQ D;  5GXQ A;  3MGP D;  3B6F D;  5FUG A;  3B6G B;  3REL C;  1P3P D;  1P3B C;  4LD9 C;  5C3I B;  1AOI A;  3UTB C;  3C1C A;  5JRG B;  5BS7 C;  4WU9 D;  4J8U C;  1KX3 C;  3KWQ C;  3AV2 D;  3MGP C;  5B1M B;  1P3F D;  3B6F C;  3KXB A;  1P3P C;  1M1A B;  1TAF A;  4NE5 A;  3MVD A;  5B2I D;  3UT9 B;  5AVC A;  2ARO A;  4QLC A;  2YFV A;  4WU9 C;  3AV2 C;  3AZN A;  1P3F C;  2F8N A;  3TU4 A;  2CV5 B;  5AV5 A;  5BO0 B;  5B2I C;  5GSU A;  5B0Y A;  3R45 B;  4H9O B;  3NQJ B;  2HIO A;  3REI A;  1N1J A;  3AN2 D;  5BT1 D;  4E45 A;  4XUJ B;  3REK D;  3UTA A;  5B2J A;  4KHA A;  4ZBJ C;  5JA4 B;  5AV8 D;  3REJ B;  3C1B D;  1P3M B;  3AN2 C;  5BT1 C;  3AFA D;  3AZF D;  3LJA B;  3REK C;  3W96 A;  3WAA A;  3WTP B;  1A7W A;  5GT0 A;  5BNV A;  5AV8 C;  3C1B C;  4Z66 A;  1KU5 A;  4R8P B;  5E5A B;  1HQ3 A;  3AFA C;  3AZF C;  5AV9 D;  3KXB D;  3MVD D;  3WA9 D;  3MGQ B;  4J8X B;  2ARO D;  4QLC D;  1F1E A;  1P3I B;  4CAY B;  3B6G A;  3AZN D;  5CHL B;  5AV9 C;  3KXB C;  3AYW B;  5GT3 B;  3TU4 D;  3MVD C;  5JRG A;  3AZE B;  3WA9 C;  5GSU D;  2ARO C;  4QLC C;  2HIO D;  3AZH B;  3AZN C;  1M1A A;  3KUY B;  3TU4 C;  4YS3 D;  3LZ1 B;  5GSU C;  5B2J D;  3X1S B;  2HIO C;  3X1V B;  2CV5 A;  5BO0 A;  2PYO A;  1KX5 B;  3O62 B;  3R45 A;  4YS3 C;  3A6N B;  1F66 D;  3NQJ A;  5B2J C;  1ZLA B;  5GT0 D;  4DRB A;  1JFI B;  4XUJ A;  1HQ3 D;  1H3O B;  1F66 C;  5AVB B;  3REJ A;  5GT0 C;  5AV6 B;  3LJA A;  4Z2M H;  1KX4 B;  1P3O B;  1HQ3 C;  4J8W B;  3B6G D;  3WTP A;  3LZ0 B;  1P3K B;  4R8P A;  3AZL B;  4NFT A;  5G49 B;  5E5A A;  1P34 D;  4X23 D;  3B6G C;  3W97 B;  1M1A D;  4H9P B;  1BH8 A;  5C3I C;  4J8X A;  3AV1 A;  5B1L A;  1BFM A;  2RVQ D;  4CAY A;  5DNM D;  1P34 C;  4X23 C;  3AYW A;  1S32 B;  1M1A C;  5GT3 A;  3AZE A;  4UUZ B;  2PYO D;  2IO5 B;  1P3G A;  2FJ7 B;  5F99 B;  4JJN B;  4G91 B;  2BYM B;  4YM6 A;  2RVQ C;  2NQB B;  3AZH A;  4ZUX B;  5DNM C;  5CPJ B;  3KUY A;  4KGC B;  3LZ1 A;  3AZI D;  2PYO C;  4XZQ B;  2NZD D;  3X1S A;  4WNN B;  3X1V A;  5B24 B;  3MGS B;  3O62 A;  4J8V D;  3AZI C;  2NZD C;  2LY8 A;  1ZLA A;  5B40 A;  4G92 C;  1JFI A;  2YFW B;  5B33 B;  4R8P D;  2CWE A;  3AZJ B;  3W98 B;  5CPI B;  5B31 B;  4J8V C;  1H3O A;  3X1U B;  5CPK B;  3W99 B;  1P3L D;  4Z5T B;  5AV6 A;  4H9Q A;  3AV1 D;  5B1L D;  3MNN B;  1B6W A;  4R8P C;  3WKJ D;  4KUD B;  1M18 B;  1KX4 A;  1TZY A;  4NE3 A;  3AZM D;  1P3O A;  4J8W A;  1EQZ B;  5B31 G;  3LZ0 A;  4H9N B;  3REL B;  1P3K A;  3AZE D;  1P3L C;  2JSS A;  3UTB B;  3AZL A;  1P3G D;  1WWI A;  3AV1 C;  5GXQ D;  5B1L C;  1P3A B;  3WKJ C;  4YM6 D;  4J8U B;  1KX3 B;  3AZM C;  3KWQ B;  3W97 A;  3V9R B;  3MGP B;  1ID3 B;  1AOI D;  4H9P A;  3B6F B;  3MGR B;  3C1C D;  3REH A;  1P3P B;  3AZE C;  1P3G C;  5GXQ C;  4WU9 B;  4YM6 C;  3AZG A;  3X1V D;  4CSR B;  5KDM B;  1S32 A;  1P3F B;  4AWL B;  1AOI C;  5AVC D;  3C1C C;  4UUZ A;  3NQU B;  2FJ7 A;  5F99 A;  4JJN A;  2BYM A;  2NQB A;  4ZUX A;  1U35 B;  3X1V C;  5B40 D;  5CPJ A;  2F8N D;  5AV5 D;  5BNX B;  5B0Y D;  4KGC A;  5AVC C;  4XZQ A;  3REI D;  5B1M A;  3B0C T;  4EO5 C;  4WNN A;  5B24 A;  5AY8 B;  5AV6 D;  3MGS A;  3UT9 A;  5B40 C;  5AV5 C;  3UTA D;  5B0Y C;  4WU8 B;  1KX4 D;  1TZY D;  1P3O D;  3B0B A;  3REI C;  3REK B;  2YFW A;  5B33 A;  5AV8 B;  5AV6 C;  3AZJ A;  3C1B B;  3W98 A;  3UTA C;  5CPI A;  3W96 D;  4Z2M G;  4H9O A;  5B31 A;  3WAA D;  1KX4 C;  1TZY C;  3AFA B;  3AZK B;  1ULY A;  3AZF B;  1P3O C;  2HUE C;  3X1U A;  5CPK A;  3W99 A;  3VH6 A;  4Z5T A;  3REH D;  4Z66 D;  3MNN A;  4KUD A;  1M18 A;  3W96 C;  3WAA C;  5JA4 A;  4DRA A;  1EQZ A;  2BYK B;  3AZG D;  4H9N A;  5B0Z B;  3REL A;  1P3M A;  1S32 D;  5AV9 B;  3REH C;  4Z66 C;  1P3A A;  5F99 D;  3WA9 B;  4JJN D;  4M6B A;  4J8U A;  2ARO B;  3B0D C;  3KWQ A;  3V9R A;  3MGP A;  3AZG C;  1ID3 A;  3B6F A;  3MGR A;  3AZN B;  5JRG D;  1S32 C;  1P3P A;  4KGC D;  3TU4 B;  3B0C W;  5F99 C;  4XZQ D;  5B1M D;  4JJN C;  4WU9 A;  4CSR A;  2HIO B;  5KDM A;  5CP6 B;  5B24 D;  3MGQ A;  3UT9 D;  5JRG C;  4WZS B;  3NQU A;  4KGC C;  1P3I A;  4XZQ C;  1R4V A;  5B1M C;  4YS3 B;  1U35 A;  1WWS A;  2CV5 D;  5BNX A;  5B24 C;  5B33 D;  3UT9 C;  3W98 D;  4HGA B;  1F66 B;  4WV4 B;  5AY8 A;  3VH6 T;  2CV5 C;  4XUJ D;  3MNN D;  5B33 C;  1M19 B;  3X1T B;  3LEL B;  4WU8 A;  3W98 C;  1EQZ D;  2F8N H;  1HQ3 B;  3REJ D;  4H9S A;  1P3M D;  5B32 B;  5AV8 A;  1KX5 A;  3LJA D;  4XUJ C;  3A6N A;  5DNN B;  1P3A D;  3MNN C;  3WTP D;  1BH9 B;  3AFA A;  3AZK A;  1EQZ C;  1ID3 D;  3MGR D;  3REJ C;  1P3M C;  4NE6 A;  2L5A A;  5E5A D;  5B32 G;  3LJA C;  1P3A C;  2BYK A;  3WTP C;  5AVB A;  5B0Z A;  1P34 B;  1ID3 C;  3MGQ D;  4X23 B;  5AV9 A;  3MGR C;  4J8X D;  3WA9 A;  5E5A C;  1P3I D;  1U35 D;  3AYW D;  1P3B B;  5GT3 D;  5DNM B;  4LD9 B;  3MGQ C;  4AWL C;  4J8X C;  5G49 A;  2PYO B;  3AZH D;  1P3I C;  1U35 C;  3VH6 W;  5CP6 A;  3AYW C;  3KUY D;  5AY8 D;  3KSY A;  5GT3 C;  3LZ1 D;  4WU8 D;  4E44 A;  3X1S D;  4YS3 A;  3AZI B;  3AZH C;  3AV2 B;  2NZD B;  3VH5 A;  3KUY C;  5AY8 C;  4G92 B;  1KX5 D;  3O62 D;  3A6N D;  5B2I B;  3LZ1 C;  4WU8 C;  3AZK D;  3X1S C;  1ZLA D;  1HTA A;  4J8V B;  1F66 A;  4H9S C;  4H9R B;  1M19 A;  3X1T A;  1KX5 C;  3LEL A;  3O62 C;  3A6N C;  4ZBJ B;  3AZK C;  1P34 A;  5AVB D;  5B0Z D;  1ZLA C;  5B32 A;  1BH8 B;  5DNN A;  3AN2 B;  1P3L B;  4J8W D;  3AV1 B;  5B1L B;  1BH9 A;  1Q9C A;  3WKJ B;  3LZ0 D;  1P3K D;  3AZM B;  5AVB C;  5B0Z C;  3AZL D;  2F8N K;  1P3G B;  4J8W C;  5GXQ B;  3W97 D;  3WTP E;  3LZ0 C;  5FUG B;  4YM6 B;  5CP6 D;  1P3K C;  4X23 A; 
#chains in the Genus database with same CATH topology
 1AOI B;  3AZL C;  3C1C B;  3W97 C;  1P3B A;  5DNM A;  4LD9 A;  3KXB B;  5CP6 C;  3VH5 T;  3UTB A;  1TAF B;  2FJ7 D;  3MVD B;  5BS7 A;  5AVC B;  4QLC B;  1KX3 A;  2NQB D;  2YFV B;  4ZUX D;  5CPJ D;  1B67 A;  4EO5 B;  3H0L C;  2IO5 C;  5B40 B;  3X1T D;  3LEL D;  5AV5 B;  1M19 D;  2F8N B;  2FJ7 C;  4HGA C;  4G91 C;  5GSU B;  5B0Y B;  3AZI A;  2NQB C;  4ZUX C;  3AV2 A;  3REI B;  1P3F A;  2NZD A;  1N1J B;  3MGS D;  5CPJ C;  5B32 D;  5DNN D;  5B2I A;  1M19 C;  3X1T C;  4H9Q B;  3LEL C;  3UTA B;  2F8N G;  4J8V A;  5B2J B;  4KHA B;  1TZY B;  2HUE B;  3AZJ D;  3MGS C;  4H9R A;  5B32 C;  5CPI D;  5B31 D;  5DNN C;  3FDD A;  3W96 B;  3X1U D;  5CPK D;  3WAA B;  3W99 D;  4Z5T D;  5GT0 B;  3AZJ C;  5BNV B;  4KUD D;  3AN2 A;  1P3L A;  2FFF B;  1M18 D;  5CPI C;  3REH B;  4Z66 B;  5B31 C;  3REK A;  3WKJ A;  2G5I C;  3B0D B;  3REL D;  3AZM A;  1P3B D;  3X1U C;  3VH5 W;  5CPK C;  3W99 C;  4LD9 D;  3AZG B;  4Z5T C;  3UTB D;  3C1B A;  4KUD C;  4J8U D;  1KX3 D;  1M18 C;  3AZF A;  3KWQ D;  5GXQ A;  3MGP D;  3B6F D;  5FUG A;  3B6G B;  3REL C;  1P3P D;  1P3B C;  4LD9 C;  5C3I B;  1AOI A;  3UTB C;  3C1C A;  5JRG B;  5BS7 C;  4WU9 D;  4J8U C;  1KX3 C;  1Z2C B;  3KWQ C;  3MGP C;  3AV2 D;  5B1M B;  1P3F D;  3B6F C;  3KXB A;  1P3P C;  1M1A B;  1TAF A;  4NE5 A;  3MVD A;  5B2I D;  3UT9 B;  5AVC A;  2ARO A;  2Y2M A;  4QLC A;  2YFV A;  4WU9 C;  3H0R C;  3AV2 C;  2Y2N A;  3AZN A;  1P3F C;  2F8N A;  3TU4 A;  2CV5 B;  5AV5 A;  4WJ3 C;  5BO0 B;  5B2I C;  5GSU A;  5B0Y A;  3R45 B;  4H9O B;  3NQJ B;  2HIO A;  3REI A;  1N1J A;  3AN2 D;  5BT1 D;  4E45 A;  4XUJ B;  3REK D;  3UTA A;  3A1K A;  5B2J A;  4KHA A;  4ZBJ C;  5JA4 B;  5AV8 D;  3REJ B;  3C1B D;  1P3M B;  3AN2 C;  5BT1 C;  3AFA D;  3AZF D;  3LJA B;  2Y2G A;  3REK C;  3W96 A;  2ZM5 A;  3WAA A;  3KFU G;  3WTP B;  1PZR A;  1A7W A;  2ZY5 A;  5GT0 A;  3EPK A;  5BNV A;  5AV8 C;  3C1B C;  4Z66 A;  1KU5 A;  4R8P B;  5E5A B;  1HQ3 A;  3AFA C;  3AZF C;  5AV9 D;  3KXB D;  3MVD D;  3WA9 D;  3MGQ B;  4J8X B;  2ARO D;  4QLC D;  1F1E A;  1P3I B;  4CAY B;  3B6G A;  3AZN D;  5CHL B;  2VQR A;  5AV9 C;  3KXB C;  3AYW B;  2RIQ A;  5GT3 B;  3TU4 D;  3MVD C;  5JRG A;  3AZE B;  3WA9 C;  5GSU D;  3H0M C;  2ARO C;  4QLC C;  2HIO D;  3AZH B;  3AZN C;  1M1A A;  3KUY B;  3TU4 C;  4YS3 D;  3LZ1 B;  5GSU C;  5B2J D;  3X1S B;  2HIO C;  3X1V B;  2Y2O A;  2CV5 A;  5BO0 A;  2PYO A;  1KX5 B;  2XD1 A;  3O62 B;  3R45 A;  4YS3 C;  3A6N B;  1F66 D;  3NQJ A;  5B2J C;  1ZLA B;  5GT0 D;  4DRB A;  1JFI B;  4XUJ A;  1HQ3 D;  1H3O B;  1F66 C;  5AVB B;  3REJ A;  5GT0 C;  5AV6 B;  3LJA A;  4Z2M H;  1KX4 B;  1P3O B;  1HQ3 C;  2JCH A;  4J8W B;  3WTP A;  3B6G D;  3LZ0 B;  1P3K B;  2Y2P A;  4R8P A;  3AZL B;  4NFT A;  5G49 B;  5E5A A;  1P34 D;  4X23 D;  3B6G C;  3W97 B;  1M1A D;  4H9P B;  1BH8 A;  5C3I C;  4J8X A;  3AV1 A;  5B1L A;  1BFM A;  2RVQ D;  4CAY A;  5DNM D;  1P34 C;  4X23 C;  3AYW A;  1S32 B;  1M1A C;  5GT3 A;  3AZE A;  4UUZ B;  2PYO D;  2IO5 B;  1P3G A;  2FJ7 B;  5F99 B;  4JJN B;  4G91 B;  2BYM B;  4YM6 A;  2RVQ C;  2NQB B;  3AZH A;  4ZUX B;  5DNM C;  5CPJ B;  3KUY A;  4KGC B;  3A1I A;  3LZ1 A;  3AZI D;  2PYO C;  4XZQ B;  2NZD D;  3X1S A;  3F6T A;  4WNN B;  3X1V A;  5B24 B;  3MGS B;  3O62 A;  4J8V D;  3AZI C;  3AL0 C;  2NZD C;  2LY8 A;  2Y2Q A;  1ZLA A;  5B40 A;  4G92 C;  1JFI A;  2YFW B;  5B33 B;  4R8P D;  2CWE A;  3AZJ B;  3W98 B;  2W8S A;  5CPI B;  5B31 B;  4J8V C;  2ZY4 A;  1H3O A;  3X1U B;  5CPK B;  3W99 B;  1P3L D;  4Z5T B;  5AV6 A;  4H9Q A;  3AV1 D;  5B1L D;  3MNN B;  1B6W A;  4R8P C;  3WKJ D;  4KUD B;  1M18 B;  1KX4 A;  1TZY A;  4NE3 A;  3AZM D;  1P3O A;  4J8W A;  1EQZ B;  5B31 G;  3LZ0 A;  4H9N B;  3REL B;  1P3K A;  3AZE D;  1P3L C;  2JSS A;  3UTB B;  2JE5 A;  3AZL A;  1P3G D;  1WWI A;  3AV1 C;  5GXQ D;  5B1L C;  1P3A B;  3WKJ C;  4YM6 D;  4J8U B;  1KX3 B;  3AZM C;  3KWQ B;  3W97 A;  3V9R B;  3MGP B;  1ID3 B;  1AOI D;  4H9P A;  3B6F B;  3MGR B;  3C1C D;  3REH A;  1P3P B;  3AZE C;  1P3G C;  5GXQ C;  4WU9 B;  4YM6 C;  3AZG A;  3X1V D;  3EPL A;  4CSR B;  5KDM B;  1S32 A;  1P3F B;  4AWL B;  1AOI C;  5AVC D;  3C1C C;  4UUZ A;  3NQU B;  2FJ7 A;  5F99 A;  4JJN A;  2BYM A;  2NQB A;  4ZUX A;  1U35 B;  3X1V C;  5B40 D;  5CPJ A;  2F8N D;  5AV5 D;  5BNX B;  2Y2L A;  5B0Y D;  5AVC C;  4KGC A;  3EPH A;  4XZQ A;  3REI D;  5B1M A;  3B0C T;  4EO5 C;  4WNN A;  2Y2H A;  5AY8 B;  5AV6 D;  5B24 A;  3MGS A;  4UPK A;  5AV5 C;  3UT9 A;  5B40 C;  3UTA D;  5B0Y C;  4WU8 B;  1KX4 D;  1TZY D;  1P3O D;  3B0B A;  3REI C;  3REK B;  2YFW A;  5B33 A;  5AV8 B;  5AV6 C;  3AZJ A;  3C1B B;  3W98 A;  3UTA C;  5CPI A;  3W96 D;  4Z2M G;  4H9O A;  5B31 A;  3WAA D;  1KX4 C;  1TZY C;  3AFA B;  3AZK B;  1ULY A;  3AZF B;  1P3O C;  2HUE C;  3X1U A;  5CPK A;  3W99 A;  3VH6 A;  4Z5T A;  3REH D;  4Z66 D;  3MNN A;  4KUD A;  1M18 A;  3W96 C;  3WAA C;  5JA4 A;  4DRA A;  1EQZ A;  2BYK B;  3AZG D;  4H9N A;  5B0Z B;  3REL A;  1P3M A;  1S32 D;  3EG5 B;  5AV9 B;  3REH C;  4Z66 C;  1P3A A;  5F99 D;  3WA9 B;  4JJN D;  4M6B A;  4J8U A;  2ARO B;  3B0D C;  3KWQ A;  3V9R A;  3MGP A;  3AZG C;  1ID3 A;  3B6F A;  3MGR A;  3AZN B;  5JRG D;  1S32 C;  1P3P A;  2XD5 A;  4KGC D;  3TU4 B;  3B0C W;  5F99 C;  4XZQ D;  5B1M D;  4JJN C;  4WU9 A;  4CSR A;  2HIO B;  5KDM A;  5CP6 B;  5B24 D;  3MGQ A;  3UT9 D;  5JRG C;  4WZS B;  3NQU A;  2UWX A;  4KGC C;  2Y2K A;  1P3I A;  4XZQ C;  1R4V A;  5B1M C;  4YS3 B;  1U35 A;  1WWS A;  2CV5 D;  5BNX A;  5B24 C;  5B33 D;  1W2E A;  3UT9 C;  3W98 D;  4HGA B;  1F66 B;  4WV4 B;  5AY8 A;  3VH6 T;  2CV5 C;  4XUJ D;  3MNN D;  5B33 C;  1M19 B;  3X1T B;  3LEL B;  4WU8 A;  3W98 C;  1EQZ D;  2F8N H;  2DQN C;  1HQ3 B;  3REJ D;  4H9S A;  1P3M D;  5B32 B;  5AV8 A;  1KX5 A;  2J8P A;  3LJA D;  4XUJ C;  3A6N A;  5DNN B;  1P3A D;  3MNN C;  3WTP D;  1BH9 B;  3AFA A;  3AZK A;  4DQY B;  1EQZ C;  1ID3 D;  3MGR D;  3REJ C;  1P3M C;  4NE6 A;  2L5A A;  5E5A D;  5B32 G;  3LJA C;  1P3A C;  2BG1 A;  2BYK A;  3WTP C;  5AVB A;  5B0Z A;  1P34 B;  1ID3 C;  3MGQ D;  4X23 B;  5AV9 A;  3MGR C;  4J8X D;  3WA9 A;  5E5A C;  1P3I D;  1U35 D;  3AYW D;  1P3B B;  5GT3 D;  5DNM B;  4LD9 B;  3MGQ C;  4AWL C;  4J8X C;  5G49 A;  2ZY2 A;  2PYO B;  3AZH D;  1P3I C;  2Y2J A;  1U35 C;  3VH6 W;  5CP6 A;  3AYW C;  3KUY D;  5AY8 D;  3KSY A;  5GT3 C;  3LZ1 D;  4WU8 D;  4E44 A;  3X1S D;  2G5H C;  4YS3 A;  3AZI B;  3AZH C;  2ZY3 A;  3P5J B;  3AV2 B;  2NZD B;  3VH5 A;  3KUY C;  5AY8 C;  4G92 B;  1KX5 D;  2F2A C;  3O62 D;  3A6N D;  5B2I B;  3LZ1 C;  4WU8 C;  3AZK D;  3X1S C;  2Y2I A;  1ZLA D;  1HTA A;  4J8V B;  1F66 A;  4H9S C;  4H9R B;  1M19 A;  3X1T A;  1KX5 C;  3LEL A;  3O62 C;  3A6N C;  4ZBJ B;  3AZK C;  1P34 A;  5AVB D;  5B0Z D;  1ZLA C;  5B32 A;  1BH8 B;  5DNN A;  3EPJ A;  3AN2 B;  1P3L B;  4J8W D;  3AV1 B;  5B1L B;  1BH9 A;  1Q9C A;  3WKJ B;  3LZ0 D;  1P3K D;  3AZM B;  5AVB C;  5B0Z C;  3AZL D;  1T3U A;  3IP4 C;  2F8N K;  1P3G B;  4J8W C;  5GXQ B;  3W97 D;  2DF4 C;  3WTP E;  3LZ0 C;  5FUG B;  4YM6 B;  5CP6 D;  1P3K C;  4X23 A; 
#chains in the Genus database with same CATH homology
 1AOI B;  3AZL C;  3C1C B;  3W97 C;  1P3B A;  5DNM A;  4LD9 A;  3KXB B;  5CP6 C;  3VH5 T;  3UTB A;  1TAF B;  2FJ7 D;  3MVD B;  5BS7 A;  5AVC B;  4QLC B;  1KX3 A;  2NQB D;  2YFV B;  4ZUX D;  5CPJ D;  1B67 A;  4EO5 B;  3H0L C;  2IO5 C;  5B40 B;  3X1T D;  3LEL D;  5AV5 B;  1M19 D;  2F8N B;  2FJ7 C;  4HGA C;  4G91 C;  5GSU B;  5B0Y B;  3AZI A;  2NQB C;  4ZUX C;  3AV2 A;  3REI B;  1P3F A;  2NZD A;  1N1J B;  3MGS D;  5CPJ C;  5B32 D;  5DNN D;  5B2I A;  1M19 C;  3X1T C;  4H9Q B;  3LEL C;  3UTA B;  2F8N G;  4J8V A;  5B2J B;  4KHA B;  1TZY B;  2HUE B;  3AZJ D;  3MGS C;  4H9R A;  5B32 C;  5CPI D;  5B31 D;  5DNN C;  3FDD A;  3W96 B;  3X1U D;  5CPK D;  3WAA B;  3W99 D;  4Z5T D;  5GT0 B;  3AZJ C;  5BNV B;  4KUD D;  3AN2 A;  1P3L A;  2FFF B;  1M18 D;  5CPI C;  3REH B;  4Z66 B;  5B31 C;  3REK A;  3WKJ A;  2G5I C;  3B0D B;  3REL D;  3AZM A;  1P3B D;  3X1U C;  3VH5 W;  5CPK C;  3W99 C;  4LD9 D;  3AZG B;  4Z5T C;  3UTB D;  3C1B A;  4KUD C;  4J8U D;  1KX3 D;  1M18 C;  3AZF A;  3KWQ D;  5GXQ A;  3MGP D;  3B6F D;  5FUG A;  3B6G B;  3REL C;  1P3P D;  1P3B C;  4LD9 C;  5C3I B;  1AOI A;  3UTB C;  3C1C A;  5JRG B;  5BS7 C;  4WU9 D;  4J8U C;  1KX3 C;  1Z2C B;  3KWQ C;  3MGP C;  3AV2 D;  5B1M B;  1P3F D;  3B6F C;  3KXB A;  1P3P C;  1M1A B;  1TAF A;  4NE5 A;  3MVD A;  5B2I D;  3UT9 B;  5AVC A;  2ARO A;  2Y2M A;  4QLC A;  2YFV A;  4WU9 C;  3H0R C;  3AV2 C;  2Y2N A;  3AZN A;  1P3F C;  2F8N A;  3TU4 A;  2CV5 B;  5AV5 A;  4WJ3 C;  5BO0 B;  5B2I C;  5GSU A;  5B0Y A;  3R45 B;  4H9O B;  3NQJ B;  2HIO A;  3REI A;  1N1J A;  3AN2 D;  5BT1 D;  4E45 A;  4XUJ B;  3REK D;  3UTA A;  3A1K A;  5B2J A;  4KHA A;  4ZBJ C;  5JA4 B;  5AV8 D;  3REJ B;  3C1B D;  1P3M B;  3AN2 C;  5BT1 C;  3AFA D;  3AZF D;  3LJA B;  2Y2G A;  3REK C;  3W96 A;  2ZM5 A;  3WAA A;  3KFU G;  3WTP B;  1PZR A;  1A7W A;  2ZY5 A;  5GT0 A;  3EPK A;  5BNV A;  5AV8 C;  3C1B C;  4Z66 A;  1KU5 A;  4R8P B;  5E5A B;  1HQ3 A;  3AFA C;  3AZF C;  5AV9 D;  3KXB D;  3MVD D;  3WA9 D;  3MGQ B;  4J8X B;  2ARO D;  4QLC D;  1F1E A;  1P3I B;  4CAY B;  3B6G A;  3AZN D;  5CHL B;  2VQR A;  5AV9 C;  3KXB C;  3AYW B;  2RIQ A;  5GT3 B;  3TU4 D;  3MVD C;  5JRG A;  3AZE B;  3WA9 C;  5GSU D;  3H0M C;  2ARO C;  4QLC C;  2HIO D;  3AZH B;  3AZN C;  1M1A A;  3KUY B;  3TU4 C;  4YS3 D;  3LZ1 B;  5GSU C;  5B2J D;  3X1S B;  2HIO C;  3X1V B;  2Y2O A;  2CV5 A;  5BO0 A;  2PYO A;  1KX5 B;  2XD1 A;  3O62 B;  3R45 A;  4YS3 C;  3A6N B;  1F66 D;  3NQJ A;  5B2J C;  1ZLA B;  5GT0 D;  4DRB A;  1JFI B;  4XUJ A;  1HQ3 D;  1H3O B;  1F66 C;  5AVB B;  3REJ A;  5GT0 C;  5AV6 B;  3LJA A;  4Z2M H;  1KX4 B;  1P3O B;  1HQ3 C;  2JCH A;  4J8W B;  3WTP A;  3B6G D;  3LZ0 B;  1P3K B;  2Y2P A;  4R8P A;  3AZL B;  4NFT A;  5G49 B;  5E5A A;  1P34 D;  4X23 D;  3B6G C;  3W97 B;  1M1A D;  4H9P B;  1BH8 A;  5C3I C;  4J8X A;  3AV1 A;  5B1L A;  1BFM A;  2RVQ D;  4CAY A;  5DNM D;  1P34 C;  4X23 C;  3AYW A;  1S32 B;  1M1A C;  5GT3 A;  3AZE A;  4UUZ B;  2PYO D;  2IO5 B;  1P3G A;  2FJ7 B;  5F99 B;  4JJN B;  4G91 B;  2BYM B;  4YM6 A;  2RVQ C;  2NQB B;  3AZH A;  4ZUX B;  5DNM C;  5CPJ B;  3KUY A;  4KGC B;  3A1I A;  3LZ1 A;  3AZI D;  2PYO C;  4XZQ B;  2NZD D;  3X1S A;  3F6T A;  4WNN B;  3X1V A;  5B24 B;  3MGS B;  3O62 A;  4J8V D;  3AZI C;  3AL0 C;  2NZD C;  2LY8 A;  2Y2Q A;  1ZLA A;  5B40 A;  4G92 C;  1JFI A;  2YFW B;  5B33 B;  4R8P D;  2CWE A;  3AZJ B;  3W98 B;  2W8S A;  5CPI B;  5B31 B;  4J8V C;  2ZY4 A;  1H3O A;  3X1U B;  5CPK B;  3W99 B;  1P3L D;  4Z5T B;  5AV6 A;  4H9Q A;  3AV1 D;  5B1L D;  3MNN B;  1B6W A;  4R8P C;  3WKJ D;  4KUD B;  1M18 B;  1KX4 A;  1TZY A;  4NE3 A;  3AZM D;  1P3O A;  4J8W A;  1EQZ B;  5B31 G;  3LZ0 A;  4H9N B;  3REL B;  1P3K A;  3AZE D;  1P3L C;  2JSS A;  3UTB B;  2JE5 A;  3AZL A;  1P3G D;  1WWI A;  3AV1 C;  5GXQ D;  5B1L C;  1P3A B;  3WKJ C;  4YM6 D;  4J8U B;  1KX3 B;  3AZM C;  3KWQ B;  3W97 A;  3V9R B;  3MGP B;  1ID3 B;  1AOI D;  4H9P A;  3B6F B;  3MGR B;  3C1C D;  3REH A;  1P3P B;  3AZE C;  1P3G C;  5GXQ C;  4WU9 B;  4YM6 C;  3AZG A;  3X1V D;  3EPL A;  4CSR B;  5KDM B;  1S32 A;  1P3F B;  4AWL B;  1AOI C;  5AVC D;  3C1C C;  4UUZ A;  3NQU B;  2FJ7 A;  5F99 A;  4JJN A;  2BYM A;  2NQB A;  4ZUX A;  1U35 B;  3X1V C;  5B40 D;  5CPJ A;  2F8N D;  5AV5 D;  5BNX B;  2Y2L A;  5B0Y D;  5AVC C;  4KGC A;  3EPH A;  4XZQ A;  3REI D;  5B1M A;  3B0C T;  4EO5 C;  4WNN A;  2Y2H A;  5AY8 B;  5AV6 D;  5B24 A;  3MGS A;  4UPK A;  5AV5 C;  3UT9 A;  5B40 C;  3UTA D;  5B0Y C;  4WU8 B;  1KX4 D;  1TZY D;  1P3O D;  3B0B A;  3REI C;  3REK B;  2YFW A;  5B33 A;  5AV8 B;  5AV6 C;  3AZJ A;  3C1B B;  3W98 A;  3UTA C;  5CPI A;  3W96 D;  4Z2M G;  4H9O A;  5B31 A;  3WAA D;  1KX4 C;  1TZY C;  3AFA B;  3AZK B;  1ULY A;  3AZF B;  1P3O C;  2HUE C;  3X1U A;  5CPK A;  3W99 A;  3VH6 A;  4Z5T A;  3REH D;  4Z66 D;  3MNN A;  4KUD A;  1M18 A;  3W96 C;  3WAA C;  5JA4 A;  4DRA A;  1EQZ A;  2BYK B;  3AZG D;  4H9N A;  5B0Z B;  3REL A;  1P3M A;  1S32 D;  3EG5 B;  5AV9 B;  3REH C;  4Z66 C;  1P3A A;  5F99 D;  3WA9 B;  4JJN D;  4M6B A;  4J8U A;  2ARO B;  3B0D C;  3KWQ A;  3V9R A;  3MGP A;  3AZG C;  1ID3 A;  3B6F A;  3MGR A;  3AZN B;  5JRG D;  1S32 C;  1P3P A;  2XD5 A;  4KGC D;  3TU4 B;  3B0C W;  5F99 C;  4XZQ D;  5B1M D;  4JJN C;  4WU9 A;  4CSR A;  2HIO B;  5KDM A;  5CP6 B;  5B24 D;  3MGQ A;  3UT9 D;  5JRG C;  4WZS B;  3NQU A;  2UWX A;  4KGC C;  2Y2K A;  1P3I A;  4XZQ C;  1R4V A;  5B1M C;  4YS3 B;  1U35 A;  1WWS A;  2CV5 D;  5BNX A;  5B24 C;  5B33 D;  1W2E A;  3UT9 C;  3W98 D;  4HGA B;  1F66 B;  4WV4 B;  5AY8 A;  3VH6 T;  2CV5 C;  4XUJ D;  3MNN D;  5B33 C;  1M19 B;  3X1T B;  3LEL B;  4WU8 A;  3W98 C;  1EQZ D;  2F8N H;  2DQN C;  1HQ3 B;  3REJ D;  4H9S A;  1P3M D;  5B32 B;  5AV8 A;  1KX5 A;  2J8P A;  3LJA D;  4XUJ C;  3A6N A;  5DNN B;  1P3A D;  3MNN C;  3WTP D;  1BH9 B;  3AFA A;  3AZK A;  4DQY B;  1EQZ C;  1ID3 D;  3MGR D;  3REJ C;  1P3M C;  4NE6 A;  2L5A A;  5E5A D;  5B32 G;  3LJA C;  1P3A C;  2BG1 A;  2BYK A;  3WTP C;  5AVB A;  5B0Z A;  1P34 B;  1ID3 C;  3MGQ D;  4X23 B;  5AV9 A;  3MGR C;  4J8X D;  3WA9 A;  5E5A C;  1P3I D;  1U35 D;  3AYW D;  1P3B B;  5GT3 D;  5DNM B;  4LD9 B;  3MGQ C;  4AWL C;  4J8X C;  5G49 A;  2ZY2 A;  2PYO B;  3AZH D;  1P3I C;  2Y2J A;  1U35 C;  3VH6 W;  5CP6 A;  3AYW C;  3KUY D;  5AY8 D;  3KSY A;  5GT3 C;  3LZ1 D;  4WU8 D;  4E44 A;  3X1S D;  2G5H C;  4YS3 A;  3AZI B;  3AZH C;  2ZY3 A;  3P5J B;  3AV2 B;  2NZD B;  3VH5 A;  3KUY C;  5AY8 C;  4G92 B;  1KX5 D;  2F2A C;  3O62 D;  3A6N D;  5B2I B;  3LZ1 C;  4WU8 C;  3AZK D;  3X1S C;  2Y2I A;  1ZLA D;  1HTA A;  4J8V B;  1F66 A;  4H9S C;  4H9R B;  1M19 A;  3X1T A;  1KX5 C;  3LEL A;  3O62 C;  3A6N C;  4ZBJ B;  3AZK C;  1P34 A;  5AVB D;  5B0Z D;  1ZLA C;  5B32 A;  1BH8 B;  5DNN A;  3EPJ A;  3AN2 B;  1P3L B;  4J8W D;  3AV1 B;  5B1L B;  1BH9 A;  1Q9C A;  3WKJ B;  3LZ0 D;  1P3K D;  3AZM B;  5AVB C;  5B0Z C;  3AZL D;  1T3U A;  3IP4 C;  2F8N K;  1P3G B;  4J8W C;  5GXQ B;  3W97 D;  2DF4 C;  3WTP E;  3LZ0 C;  5FUG B;  4YM6 B;  5CP6 D;  1P3K C;  4X23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...