1H3OA

Crystal structure of the human taf4-taf12 (tafii135-tafii20) complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
49
structure length
49
Chain Sequence
MFLLQAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/tbp-associated factors
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID 135 KDA SUBUNIT
publication title Crystal Structure of a Subcomplex of Human Transcription Factor TFIID Formed by TATA Binding Protein-Associated Factors Htaf4 (Htaf(II)135) and Htaf12 (Htaf(II)20).
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 49
sequence length 49
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1h3oA00
3AZIC 1M19A 5B32B 2NQBC 5GXQD 3B6GC 4Z66D 3WAAD 5AVBC 3KWQB 3REHB 1R4VA 4YS3B 2HIOD 4Z5TC 4XZQB 4LD9B 3A6NA 5F99D 5CPKD 4X23C 4CAYA 1P3LA 5BT1C 3AYWA 3W97D 2PYOC 3R45B 4H9RB 4WU8B 1S32B 5GSUA 3AZHB 3O62C 4H9OA 4JJND 1ZLAA 5CPJD 3AZLB 1P3IA 2IO5B 2RVQC 4WNNB 3W96A 3AZGC 4QLCB 1M1AD 3REKD 1M19C 3C1CD 3WA9D 5B2ID 4WU9B 1ID3C 2CV5D 5JRGB 3X1UD 3B6FD 5E5AD 3KXBD 3A6NC 4CSRB 3X1VB 3AFAA 1P3LC 2F8NB 3AYWC 4HGAB 1WWSA 5B40B 1BFMA 3MVDD 3REIA 3AZJB 1ZLAC 1BH9B 5B2JB 4ZUXD 1P3IC 3B0CW 4J8WD 1P3MB 3W98B 5AV8D 4G92B 2BYMB 3W96C 3WAAC 3NQUA 5GXQB 3LZ0A 3LZ1B 3KUYD 2AROD 4AWLB 2HIOC 5B0ZB 5AY8D 5B1MD 1F66D 5CPKB 1KX4D 3KSYA 1AOIA 3MGSD 3W97C 3AFAC 1P3KA 5GT3D 3LJAD 4G91B 1P3OD 5B32D 5CPJB 1N1JB 3KWQD 1Q9CA 3AZMA 3REHD 4YS3D 3C1BB 5DNNA 1P3FA 1U35B 1KX5B 4XZQD 4J8VA 4LD9D 3UTAD 1F1EA 3AZEA 3REKB 3VH5A 5B2IC 3WA9B 3LZ0C 3MGPA 1S32D 5BNVA 5CPIA 2CV5B 3X1UC 3AV2D 3B6FB 5E5AB 5BO0A 3KXBB 4KHAA 5DNMB 4H9NB 3AZLD 5B31A 3W99A 1P3KC 2YFVA 5CP6D 3MVDB 4Z2MH 3UT9D 3X1SA 5AV9A 2NZDD 4NE5A 3V9RA 3AZMC 4J8WC 4ZUXB 1P3FC 5JRGD 5DNNC 2YFWA 4J8VC 3AZEC 3R45A 5B0YD 4R8PB 4WU8A 5AV6B 3KUYB 2AROB 5B1LD 5AY8B 5CPIC 5B1MB 1F66B 3UTBD 1KX4C 1EQZD 2LY8A 1P3BD 3AZKA 3RELB 4H9PB 4WNNA 1WWIA 3WTPD 5B2JD 5GT3C 5B31C 4QLCA 1BH8B 3W99C 5C3IB 3LJAC 1P3MD 1P3OB 5B32C 5B24D 4NFTA 3X1SC 4WU9A 5CHLB 3VH5T 5AV9C 3LZ1D 3REHC 3AZFD 1ID3A 4YS3C 4NE6A 3TU4B 5B0ZD 3X1TD 4CSRA 2F8NH 3X1VA 3UTAB 4XUJA 3AV1D 1P3GD 3AZND 5B33A 2F8NA 1M18B 2L5AA 5B40A 3NQJA 3AZJA 4WU8C 1S32C 4KGCD 3AZHC 4KUDB 3AN2B 3B0DB 1P3PA 3AV2B 1TZYB 2FJ7B 5AV5D 1KX3D 4J8XD 1P34B 4H9QA 3AZKC 3AZIB 5BNXB 3C1BD 3W98A 1U35D 3MNND 2BYMA 1KX5D 5AVBB 4QLCC 5CP6B 5GXQA 3WAAA 4Z66A 4J8UD 3UT9B 2NZDB 1ULYA 4WU9C 2HIOA 3REJB 5JRGC 5F99A 5CPKA 5DNMD 5GT0D 3W97A 3X1VC 4XUJC 5B0YB 5B33C 5G49B 4WZSB 4HGAC 5B40C 1TAFB 4JJNA 5B1LB 3AZJC 3LELD 2CWEA 5CPJA 3UTBB 1EQZB 1P3PC 1P3BB 4EO5B 5BS7A 3WTPB 3VH6A 2BYKB 1M19B 3W98C 1M1AA 3REKA 4G92C 3WKJD 3WA9A 3C1CA 2JSSA 5GXQC 5B2IA 4Z66C 5B24B 3LZ1C 3AZFB 4R8PD 5AV6D 2CV5A 4AWLC 5B0ZC 3X1UA 3B6FA 3KXBA 3X1TB 4CAYB 5F99C 5CPKC 1P3GB 3AV1B 3AZNB 4YM6D 3MGRD 3RELD 1P3AD 4UUZA 2F8NK 5B31G 5GSUB 3MVDA 4KGCB 4JJNC 5CPJC 5AV5B 1KX3B 4J8XB 4ZUXA 3TU4D 5BS7C 4J8WA 5AVCD 5AV8A 3MNNB 5KDMB 1M1AC 3REKC 4J8UB 5JA4B 3C1CC 1M18D 3WA9C 3KUYA 2AROA 3MGQD 5AY8A 2CV5C 5B1MA 1F66A 4KUDD 3AN2D 1KX4A 3B6FC 5E5AC 3AFAB 3KXBC 3MGSA 1HQ3D 1TZYD 5GT0B 2FJ7D 1P34D 5GT3A 3AZID 3REIB 2NQBD 3LJAA 3B6GD 3VH6T 1P3OA 5AVBD 3MVDC 4ZBJB 5B32A 3LELB 3KWQA 4Z5TD 3REHA 4YS3A 4DRBA 4X23D 4ZUXC 4XZQA 3REJD 4LD9A 3UTAA 4E44A 5AV8C 2PYOD 3WKJB 2F8NG 4H9RA 4R8PC 3O62D 5AV6C 3KUYC 1S32A 2AROC 3AZHA 5AY8C 2HUEB 3AV2A 1AOIB 5B1MC 1F66C 2RVQD 3AZLA 3RELC 3MGSC 4YM6B 3MGRB 3AZGD 1P3AB 5C3IC 5CP6A 1M19D 3UT9A 1P3OC 5FUGB 3WTPE 3VH5W 3KWQC 1HTAA 3TU4C 4WV4B 5JRGA 5AVCB 3A6ND 4XZQC 1P3LD 4LD9C 3UTAC 3AYWD 5B0YA 5G49A 3MGPB 5GSUD 3MGQB 5B1LA 1ZLAD 3B0DC 4KHAB 3UTBA 1EQZA 1P3BA 3AV2C 5B31B 1P3ID 1BH9A 1HQ3B 4E45A 3WTPA 2FJ7C 5B2JA 3AZLC 2BYKA 1P34C 3W96D 2YFVB 2IO5C 1P3MA 4H9SA 2NQBB 3B6GB 3B0BA 3X1SB 5AV9B 5CP6C 3V9RB 5B24A 3UT9C 3LZ1A 3AZFA 2NZDC 4Z5TB 5B0ZA 4X23B 2YFWB 3REJC 3X1TA 1JFIB 1P3GA 3AV1A 3AZNA 2PYOB 3AFAD 5B0YC 3O62B 4KGCA 3REID 1H3OB 5B1LC 3AZKB 3UTBC 1EQZC 5AV5A 1P3BC 1N1JA 4J8XA 1KX3A 4EO5C 3AZGB 3C1BA 1U35A 3WTPC 5B2JC 3MNNA 5KDMA 1KX5A 1A7WA 1P3MC 4J8UA 4H9SC 3LZ0D 5JA4A 1ID3B 5B24C 3AZFC 3A6NB 4XUJB 5E5AA 3X1TC 5B33B 1AOID 5GT0A 5DNMA 1P3LB 4H9NA 1P3GC 3AV1C 3AYWB 3AZNC 1P3KD 3NQJB 5GSUC 1P3PB 3LELA 4H9OB 4KGCC 4G91C 1ZLAB 5B32G 3AZMD 4H9QB 1P3IB 3B0CT 5DNND 1P3FD 5AV5C 4Z2MG 1KX3C 4J8XC 3W96B 3C1BC 4J8VD 1U35C 3WAAB 4Z66B 3MNNC 3AZED 3WKJA 1KX5C 4J8UC 2HIOB 4R8PA 3MGPD 5AV6A 5CPID 5F99B 3W97B 4YM6A 3MGRA 3RELA 4H9PA 5B31D 5GT0C 3W99D 5DNMC 1P3AA 4JJNB 1BH8A 3REIC 3VH6W 3X1SD 5FUGA 4ZBJC 5AV9D 3LELC 4NE3A 3TU4A 5AVCA 1M1AB 3C1CB 5BT1D 3NQUB 5B2IB 3WKJC 3LZ0B 1M18A 4WU8D 3MGQA 3AZHD 4DRAA 3X1UB 4KUDA 3AN2A 2HUEC 1AOIC 3AZKD 1HQ3A 1KU5A 1TZYA 4UUZB 2FJ7A 1P34A 4YM6C 3MGRC 1P3KB 3AZIA 5BNXA 4QLCD 1P3AC 2NQBA 3B6GA 5AVBA 4WU9D 4Z5TA 1ID3D 2NZDA 3AZMB 4J8WB 1P3FB 5DNNB 5AV8B 4X23A 1B67A 1JFIA 3REJA 5AVCC 4J8VB 3X1VD 2PYOA 4XUJD 1B6WA 3AZEB 5B33D 2F8ND 4M6BA 5B40D 3MGPC 3O62A 1M18C 3AZJD 3MGQC 1H3OA 5BNVB 5CPIB 1KX4B 1TAFA 1P3PD 3MGSB 5BO0B 4KUDC 3AN2C 3AZGA 5GT3B 1HQ3C 3W98D 1TZYC 3W99B 3LJAB
chains in the Genus database with same CATH superfamily
3AZIC 1M19A 5B32B 2NQBC 5GXQD 3B6GC 4Z66D 3WAAD 5AVBC 3KWQB 3REHB 1R4VA 4YS3B 2HIOD 4Z5TC 4XZQB 2ZY2A 4LD9B 3A6NA 5F99D 5CPKD 4X23C 4CAYA 1P3LA 5BT1C 3AYWA 3W97D 2PYOC 3R45B 4H9RB 4WU8B 1S32B 5GSUA 3AZHB 3O62C 4H9OA 4JJND 1ZLAA 5CPJD 3AZLB 1P3IA 2IO5B 2Y2GA 2RVQC 4WNNB 3W96A 3AZGC 4QLCB 1M1AD 3REKD 1M19C 3C1CD 3WA9D 5B2ID 4WU9B 1ID3C 2CV5D 5JRGB 4UPKA 3X1UD 3B6FD 5E5AD 3KXBD 2F2AC 3A6NC 4CSRB 3X1VB 3AFAA 1P3LC 2F8NB 3KFUG 3AYWC 2Y2QA 4HGAB 1WWSA 5B40B 1BFMA 3MVDD 3REIA 3AZJB 3EPHA 1ZLAC 1BH9B 5B2JB 4ZUXD 1P3IC 3B0CW 4J8WD 1P3MB 3W98B 5AV8D 4G92B 3AL0C 2BYMB 3W96C 3WAAC 3NQUA 5GXQB 3LZ0A 3LZ1B 3KUYD 2AROD 4AWLB 2HIOC 5B0ZB 5AY8D 5B1MD 1F66D 5CPKB 1KX4D 3KSYA 1AOIA 3MGSD 3W97C 3AFAC 1P3KA 5GT3D 3LJAD 4G91B 1P3OD 5B32D 5CPJB 1N1JB 3KWQD 1Q9CA 3AZMA 3REHD 4YS3D 3C1BB 5DNNA 1P3FA 1U35B 2DF4C 2Y2LA 1KX5B 4XZQD 4J8VA 4LD9D 3UTAD 1F1EA 3AZEA 3REKB 3VH5A 2ZY4A 5B2IC 3WA9B 3LZ0C 3MGPA 1S32D 5BNVA 5CPIA 2CV5B 3X1UC 2RIQA 3AV2D 3B6FB 2Y2PA 5E5AB 5BO0A 3KXBB 4KHAA 3IP4C 5DNMB 4H9NB 3AZLD 1W2EA 5B31A 1PZRA 3W99A 1P3KC 2YFVA 5CP6D 3MVDB 4Z2MH 3UT9D 3X1SA 5AV9A 2NZDD 4NE5A 3V9RA 3AZMC 4J8WC 4ZUXB 1P3FC 5JRGD 5DNNC 4WJ3C 2YFWA 4J8VC 3AZEC 3R45A 5B0YD 4R8PB 4WU8A 5AV6B 3KUYB 2AROB 5B1LD 5AY8B 5CPIC 5B1MB 1F66B 2Y2NA 3UTBD 1KX4C 2LY8A 1P3BD 1EQZD 3AZKA 3RELB 4H9PB 4WNNA 1WWIA 3WTPD 5B2JD 5GT3C 3EPJA 5B31C 4QLCA 1BH8B 3W99C 5C3IB 3LJAC 1P3MD 2Y2OA 1P3OB 5B32C 5B24D 4NFTA 3X1SC 4WU9A 5CHLB 3VH5T 5AV9C 3LZ1D 3REHC 3AZFD 1ID3A 4YS3C 4NE6A 3TU4B 1T3UA 2JE5A 5B0ZD 2UWXA 3X1TD 4CSRA 2F8NH 3X1VA 3UTAB 4XUJA 3AV1D 2XD5A 3AZND 1P3GD 5B33A 2F8NA 1M18B 2L5AA 5B40A 3NQJA 3AZJA 4WU8C 1S32C 4KGCD 3AZHC 4KUDB 3AN2B 3B0DB 1P3PA 3AV2B 1TZYB 2FJ7B 5AV5D 1KX3D 4J8XD 1P34B 4H9QA 3AZKC 3AZIB 5BNXB 3C1BD 3W98A 1U35D 3MNND 2BYMA 1KX5D 5AVBB 4QLCC 5CP6B 5GXQA 3WAAA 4Z66A 4J8UD 3UT9B 2NZDB 1ULYA 3A1IA 4WU9C 2Y2IA 2HIOA 3REJB 5JRGC 5F99A 5CPKA 5DNMD 5GT0D 3W97A 3X1VC 4XUJC 5B0YB 5B33C 5G49B 2G5HC 4WZSB 4HGAC 5B40C 1TAFB 4JJNA 5B1LB 3AZJC 3LELD 2CWEA 5CPJA 2FFFB 3UTBB 1EQZB 1P3PC 1P3BB 4EO5B 5BS7A 3WTPB 3VH6A 2BYKB 1M19B 3W98C 1M1AA 3REKA 4G92C 3WKJD 2J8PA 3WA9A 3C1CA 2JSSA 5GXQC 5B2IA 4Z66C 5B24B 3LZ1C 3AZFB 4R8PD 5AV6D 2CV5A 3A1KA 4AWLC 5B0ZC 3X1UA 3B6FA 3KXBA 3X1TB 4CAYB 3EPLA 5F99C 5CPKC 1P3GB 3AV1B 3AZNB 4YM6D 3MGRD 3RELD 1P3AD 4UUZA 2F8NK 5B31G 5GSUB 3MVDA 4KGCB 4JJNC 5CPJC 5AV5B 1KX3B 4J8XB 4ZUXA 3TU4D 5BS7C 4J8WA 5AVCD 5AV8A 3MNNB 5KDMB 2Y2KA 2DQNC 1M1AC 3REKC 4J8UB 3F6TA 5JA4B 3C1CC 1M18D 3WA9C 3KUYA 2AROA 3MGQD 5AY8A 4DQYB 2CV5C 5B1MA 1F66A 4KUDD 3AN2D 1KX4A 3B6FC 5E5AC 3AFAB 3KXBC 3MGSA 1HQ3D 1TZYD 5GT0B 2FJ7D 2G5IC 1P34D 5GT3A 3AZID 3REIB 2NQBD 3LJAA 3B6GD 2Y2MA 3VH6T 1P3OA 5AVBD 3FDDA 4ZBJB 5B32A 3MVDC 3LELB 3KWQA 4Z5TD 3REHA 4YS3A 4DRBA 4X23D 2ZM5A 4ZUXC 4XZQA 3REJD 4LD9A 3UTAA 4E44A 5AV8C 2PYOD 3EPKA 3WKJB 2F8NG 4H9RA 4R8PC 3O62D 5AV6C 3KUYC 1S32A 2AROC 3AZHA 5AY8C 2HUEB 3AV2A 1AOIB 5B1MC 1F66C 2RVQD 3AZLA 3RELC 3MGSC 4YM6B 3MGRB 3H0LC 3AZGD 1P3AB 2VQRA 2XD1A 5C3IC 5CP6A 1M19D 3UT9A 1P3OC 5FUGB 3WTPE 3VH5W 3KWQC 1HTAA 3TU4C 4WV4B 5JRGA 5AVCB 3A6ND 4XZQC 1P3LD 4LD9C 3UTAC 3AYWD 5B0YA 5G49A 3MGPB 5GSUD 3MGQB 5B1LA 2JCHA 2BG1A 1ZLAD 3B0DC 4KHAB 3UTBA 1EQZA 1P3BA 3AV2C 5B31B 1P3ID 1BH9A 1HQ3B 4E45A 3WTPA 2FJ7C 5B2JA 3AZLC 2BYKA 1P34C 3W96D 2YFVB 2IO5C 1P3MA 4H9SA 2NQBB 3B6GB 3B0BA 3X1SB 2ZY3A 5AV9B 5CP6C 3V9RB 5B24A 3UT9C 3P5JB 3LZ1A 3AZFA 2NZDC 4Z5TB 5B0ZA 4X23B 2YFWB 3REJC 3X1TA 1JFIB 1P3GA 3AV1A 3AZNA 2PYOB 3AFAD 5B0YC 3O62B 4KGCA 3REID 1H3OB 5B1LC 3AZKB 3UTBC 1EQZC 5AV5A 1P3BC 1N1JA 4J8XA 1KX3A 4EO5C 3AZGB 3C1BA 1U35A 3H0MC 3WTPC 5B2JC 3MNNA 5KDMA 1KX5A 1A7WA 1P3MC 4J8UA 4H9SC 3LZ0D 5JA4A 1ID3B 3EG5B 5B24C 3AZFC 3A6NB 4XUJB 5E5AA 3X1TC 5B33B 1AOID 5GT0A 5DNMA 1P3LB 4H9NA 1P3GC 3AV1C 3AYWB 3AZNC 1P3KD 3NQJB 2Y2HA 5GSUC 1P3PB 3LELA 4H9OB 4KGCC 4G91C 1ZLAB 5B32G 3AZMD 4H9QB 1P3IB 3B0CT 5DNND 1P3FD 5AV5C 4Z2MG 1KX3C 4J8XC 3W96B 3C1BC 2ZY5A 4J8VD 1U35C 3WAAB 4Z66B 3MNNC 3AZED 3WKJA 1KX5C 4J8UC 2HIOB 4R8PA 3MGPD 5AV6A 5CPID 5F99B 2W8SA 3W97B 4YM6A 3MGRA 3RELA 4H9PA 5B31D 5GT0C 3W99D 5DNMC 1P3AA 4JJNB 1BH8A 3REIC 3VH6W 3X1SD 5FUGA 4ZBJC 5AV9D 3LELC 4NE3A 3TU4A 5AVCA 1M1AB 3C1CB 5BT1D 3NQUB 5B2IB 3WKJC 3LZ0B 1M18A 4WU8D 3MGQA 3AZHD 4DRAA 3X1UB 2Y2JA 4KUDA 3AN2A 2HUEC 1AOIC 3AZKD 1Z2CB 1HQ3A 1KU5A 1TZYA 4UUZB 2FJ7A 1P34A 4YM6C 3MGRC 1P3KB 3AZIA 5BNXA 4QLCD 1P3AC 2NQBA 3B6GA 5AVBA 4WU9D 4Z5TA 1ID3D 2NZDA 3AZMB 4J8WB 1P3FB 5DNNB 5AV8B 4X23A 1B67A 1JFIA 3REJA 5AVCC 4J8VB 3X1VD 2PYOA 4XUJD 1B6WA 3AZEB 5B33D 2F8ND 4M6BA 5B40D 3MGPC 3O62A 1M18C 3AZJD 3MGQC 1H3OA 3H0RC 5BNVB 5CPIB 1KX4B 1TAFA 1P3PD 3MGSB 5BO0B 4KUDC 3AN2C 3AZGA 5GT3B 1HQ3C 3W98D 1TZYC 3W99B 3LJAB
chains in the Genus database with same CATH topology
3AZIC 1M19A 5B32B 2NQBC 5GXQD 3B6GC 4Z66D 3WAAD 5AVBC 3KWQB 3REHB 1R4VA 4YS3B 2HIOD 4Z5TC 4XZQB 2ZY2A 4LD9B 3A6NA 5F99D 5CPKD 4X23C 4CAYA 1P3LA 5BT1C 3AYWA 3W97D 2PYOC 3R45B 4H9RB 4WU8B 1S32B 5GSUA 3AZHB 3O62C 4H9OA 4JJND 1ZLAA 5CPJD 3AZLB 1P3IA 2IO5B 2Y2GA 2RVQC 4WNNB 3W96A 3AZGC 4QLCB 1M1AD 3REKD 1M19C 3C1CD 3WA9D 5B2ID 4WU9B 1ID3C 2CV5D 5JRGB 4UPKA 3X1UD 3B6FD 5E5AD 3KXBD 2F2AC 3A6NC 4CSRB 3X1VB 3AFAA 1P3LC 2F8NB 3KFUG 3AYWC 2Y2QA 4HGAB 1WWSA 5B40B 1BFMA 3MVDD 3REIA 3AZJB 3EPHA 1ZLAC 1BH9B 5B2JB 4ZUXD 1P3IC 3B0CW 4J8WD 1P3MB 3W98B 5AV8D 4G92B 3AL0C 2BYMB 3W96C 3WAAC 3NQUA 5GXQB 3LZ0A 3LZ1B 3KUYD 2AROD 4AWLB 2HIOC 5B0ZB 5AY8D 5B1MD 1F66D 5CPKB 1KX4D 3KSYA 1AOIA 3MGSD 3W97C 3AFAC 1P3KA 5GT3D 3LJAD 4G91B 1P3OD 5B32D 5CPJB 1N1JB 3KWQD 1Q9CA 3AZMA 3REHD 4YS3D 3C1BB 5DNNA 1P3FA 1U35B 2DF4C 2Y2LA 1KX5B 4XZQD 4J8VA 4LD9D 3UTAD 1F1EA 3AZEA 3REKB 3VH5A 2ZY4A 5B2IC 3WA9B 3LZ0C 3MGPA 1S32D 5BNVA 5CPIA 2CV5B 3X1UC 2RIQA 3AV2D 3B6FB 2Y2PA 5E5AB 5BO0A 3KXBB 4KHAA 3IP4C 5DNMB 4H9NB 3AZLD 1W2EA 5B31A 1PZRA 3W99A 1P3KC 2YFVA 5CP6D 3MVDB 4Z2MH 3UT9D 3X1SA 5AV9A 2NZDD 4NE5A 3V9RA 3AZMC 4J8WC 4ZUXB 1P3FC 5JRGD 5DNNC 4WJ3C 2YFWA 4J8VC 3AZEC 3R45A 5B0YD 4R8PB 4WU8A 5AV6B 3KUYB 2AROB 5B1LD 5AY8B 5CPIC 5B1MB 1F66B 2Y2NA 3UTBD 1KX4C 2LY8A 1P3BD 1EQZD 3AZKA 3RELB 4H9PB 4WNNA 1WWIA 3WTPD 5B2JD 5GT3C 3EPJA 5B31C 4QLCA 1BH8B 3W99C 5C3IB 3LJAC 1P3MD 2Y2OA 1P3OB 5B32C 5B24D 4NFTA 3X1SC 4WU9A 5CHLB 3VH5T 5AV9C 3LZ1D 3REHC 3AZFD 1ID3A 4YS3C 4NE6A 3TU4B 1T3UA 2JE5A 5B0ZD 2UWXA 3X1TD 4CSRA 2F8NH 3X1VA 3UTAB 4XUJA 3AV1D 2XD5A 3AZND 1P3GD 5B33A 2F8NA 1M18B 2L5AA 5B40A 3NQJA 3AZJA 4WU8C 1S32C 4KGCD 3AZHC 4KUDB 3AN2B 3B0DB 1P3PA 3AV2B 1TZYB 2FJ7B 5AV5D 1KX3D 4J8XD 1P34B 4H9QA 3AZKC 3AZIB 5BNXB 3C1BD 3W98A 1U35D 3MNND 2BYMA 1KX5D 5AVBB 4QLCC 5CP6B 5GXQA 3WAAA 4Z66A 4J8UD 3UT9B 2NZDB 1ULYA 3A1IA 4WU9C 2Y2IA 2HIOA 3REJB 5JRGC 5F99A 5CPKA 5DNMD 5GT0D 3W97A 3X1VC 4XUJC 5B0YB 5B33C 5G49B 2G5HC 4WZSB 4HGAC 5B40C 1TAFB 4JJNA 5B1LB 3AZJC 3LELD 2CWEA 5CPJA 2FFFB 3UTBB 1EQZB 1P3PC 1P3BB 4EO5B 5BS7A 3WTPB 3VH6A 2BYKB 1M19B 3W98C 1M1AA 3REKA 4G92C 3WKJD 2J8PA 3WA9A 3C1CA 2JSSA 5GXQC 5B2IA 4Z66C 5B24B 3LZ1C 3AZFB 4R8PD 5AV6D 2CV5A 3A1KA 4AWLC 5B0ZC 3X1UA 3B6FA 3KXBA 3X1TB 4CAYB 3EPLA 5F99C 5CPKC 1P3GB 3AV1B 3AZNB 4YM6D 3MGRD 3RELD 1P3AD 4UUZA 2F8NK 5B31G 5GSUB 3MVDA 4KGCB 4JJNC 5CPJC 5AV5B 1KX3B 4J8XB 4ZUXA 3TU4D 5BS7C 4J8WA 5AVCD 5AV8A 3MNNB 5KDMB 2Y2KA 2DQNC 1M1AC 3REKC 4J8UB 3F6TA 5JA4B 3C1CC 1M18D 3WA9C 3KUYA 2AROA 3MGQD 5AY8A 4DQYB 2CV5C 5B1MA 1F66A 4KUDD 3AN2D 1KX4A 3B6FC 5E5AC 3AFAB 3KXBC 3MGSA 1HQ3D 1TZYD 5GT0B 2FJ7D 2G5IC 1P34D 5GT3A 3AZID 3REIB 2NQBD 3LJAA 3B6GD 2Y2MA 3VH6T 1P3OA 5AVBD 3FDDA 4ZBJB 5B32A 3MVDC 3LELB 3KWQA 4Z5TD 3REHA 4YS3A 4DRBA 4X23D 2ZM5A 4ZUXC 4XZQA 3REJD 4LD9A 3UTAA 4E44A 5AV8C 2PYOD 3EPKA 3WKJB 2F8NG 4H9RA 4R8PC 3O62D 5AV6C 3KUYC 1S32A 2AROC 3AZHA 5AY8C 2HUEB 3AV2A 1AOIB 5B1MC 1F66C 2RVQD 3AZLA 3RELC 3MGSC 4YM6B 3MGRB 3H0LC 3AZGD 1P3AB 2VQRA 2XD1A 5C3IC 5CP6A 1M19D 3UT9A 1P3OC 5FUGB 3WTPE 3VH5W 3KWQC 1HTAA 3TU4C 4WV4B 5JRGA 5AVCB 3A6ND 4XZQC 1P3LD 4LD9C 3UTAC 3AYWD 5B0YA 5G49A 3MGPB 5GSUD 3MGQB 5B1LA 2JCHA 2BG1A 1ZLAD 3B0DC 4KHAB 3UTBA 1EQZA 1P3BA 3AV2C 5B31B 1P3ID 1BH9A 1HQ3B 4E45A 3WTPA 2FJ7C 5B2JA 3AZLC 2BYKA 1P34C 3W96D 2YFVB 2IO5C 1P3MA 4H9SA 2NQBB 3B6GB 3B0BA 3X1SB 2ZY3A 5AV9B 5CP6C 3V9RB 5B24A 3UT9C 3P5JB 3LZ1A 3AZFA 2NZDC 4Z5TB 5B0ZA 4X23B 2YFWB 3REJC 3X1TA 1JFIB 1P3GA 3AV1A 3AZNA 2PYOB 3AFAD 5B0YC 3O62B 4KGCA 3REID 1H3OB 5B1LC 3AZKB 3UTBC 1EQZC 5AV5A 1P3BC 1N1JA 4J8XA 1KX3A 4EO5C 3AZGB 3C1BA 1U35A 3H0MC 3WTPC 5B2JC 3MNNA 5KDMA 1KX5A 1A7WA 1P3MC 4J8UA 4H9SC 3LZ0D 5JA4A 1ID3B 3EG5B 5B24C 3AZFC 3A6NB 4XUJB 5E5AA 3X1TC 5B33B 1AOID 5GT0A 5DNMA 1P3LB 4H9NA 1P3GC 3AV1C 3AYWB 3AZNC 1P3KD 3NQJB 2Y2HA 5GSUC 1P3PB 3LELA 4H9OB 4KGCC 4G91C 1ZLAB 5B32G 3AZMD 4H9QB 1P3IB 3B0CT 5DNND 1P3FD 5AV5C 4Z2MG 1KX3C 4J8XC 3W96B 3C1BC 2ZY5A 4J8VD 1U35C 3WAAB 4Z66B 3MNNC 3AZED 3WKJA 1KX5C 4J8UC 2HIOB 4R8PA 3MGPD 5AV6A 5CPID 5F99B 2W8SA 3W97B 4YM6A 3MGRA 3RELA 4H9PA 5B31D 5GT0C 3W99D 5DNMC 1P3AA 4JJNB 1BH8A 3REIC 3VH6W 3X1SD 5FUGA 4ZBJC 5AV9D 3LELC 4NE3A 3TU4A 5AVCA 1M1AB 3C1CB 5BT1D 3NQUB 5B2IB 3WKJC 3LZ0B 1M18A 4WU8D 3MGQA 3AZHD 4DRAA 3X1UB 2Y2JA 4KUDA 3AN2A 2HUEC 1AOIC 3AZKD 1Z2CB 1HQ3A 1KU5A 1TZYA 4UUZB 2FJ7A 1P34A 4YM6C 3MGRC 1P3KB 3AZIA 5BNXA 4QLCD 1P3AC 2NQBA 3B6GA 5AVBA 4WU9D 4Z5TA 1ID3D 2NZDA 3AZMB 4J8WB 1P3FB 5DNNB 5AV8B 4X23A 1B67A 1JFIA 3REJA 5AVCC 4J8VB 3X1VD 2PYOA 4XUJD 1B6WA 3AZEB 5B33D 2F8ND 4M6BA 5B40D 3MGPC 3O62A 1M18C 3AZJD 3MGQC 1H3OA 3H0RC 5BNVB 5CPIB 1KX4B 1TAFA 1P3PD 3MGSB 5BO0B 4KUDC 3AN2C 3AZGA 5GT3B 1HQ3C 3W98D 1TZYC 3W99B 3LJAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZI C;  1M19 A;  5B32 B;  2NQB C;  5GXQ D;  3B6G C;  4Z66 D;  3WAA D;  5AVB C;  3KWQ B;  3REH B;  1R4V A;  4YS3 B;  2HIO D;  4Z5T C;  4XZQ B;  4LD9 B;  3A6N A;  5F99 D;  5CPK D;  4X23 C;  4CAY A;  1P3L A;  5BT1 C;  3AYW A;  3W97 D;  2PYO C;  3R45 B;  4H9R B;  4WU8 B;  1S32 B;  5GSU A;  3AZH B;  3O62 C;  4H9O A;  4JJN D;  1ZLA A;  5CPJ D;  3AZL B;  1P3I A;  2IO5 B;  2RVQ C;  4WNN B;  3W96 A;  3AZG C;  4QLC B;  1M1A D;  3REK D;  1M19 C;  3C1C D;  3WA9 D;  5B2I D;  4WU9 B;  1ID3 C;  2CV5 D;  5JRG B;  3X1U D;  3B6F D;  5E5A D;  3KXB D;  3A6N C;  4CSR B;  3X1V B;  3AFA A;  1P3L C;  2F8N B;  3AYW C;  4HGA B;  1WWS A;  5B40 B;  1BFM A;  3MVD D;  3REI A;  3AZJ B;  1ZLA C;  1BH9 B;  5B2J B;  4ZUX D;  1P3I C;  3B0C W;  4J8W D;  1P3M B;  3W98 B;  5AV8 D;  4G92 B;  2BYM B;  3W96 C;  3WAA C;  3NQU A;  5GXQ B;  3LZ0 A;  3LZ1 B;  3KUY D;  2ARO D;  4AWL B;  2HIO C;  5B0Z B;  5AY8 D;  5B1M D;  1F66 D;  5CPK B;  1KX4 D;  3KSY A;  1AOI A;  3MGS D;  3W97 C;  3AFA C;  1P3K A;  5GT3 D;  3LJA D;  4G91 B;  1P3O D;  5B32 D;  5CPJ B;  1N1J B;  3KWQ D;  1Q9C A;  3AZM A;  3REH D;  4YS3 D;  3C1B B;  5DNN A;  1P3F A;  1U35 B;  1KX5 B;  4XZQ D;  4J8V A;  4LD9 D;  3UTA D;  1F1E A;  3AZE A;  3REK B;  3VH5 A;  5B2I C;  3WA9 B;  3LZ0 C;  3MGP A;  1S32 D;  5BNV A;  5CPI A;  2CV5 B;  3X1U C;  3AV2 D;  3B6F B;  5E5A B;  5BO0 A;  3KXB B;  4KHA A;  5DNM B;  4H9N B;  3AZL D;  5B31 A;  3W99 A;  1P3K C;  2YFV A;  5CP6 D;  3MVD B;  4Z2M H;  3UT9 D;  3X1S A;  5AV9 A;  2NZD D;  4NE5 A;  3V9R A;  3AZM C;  4J8W C;  4ZUX B;  1P3F C;  5JRG D;  5DNN C;  2YFW A;  4J8V C;  3AZE C;  3R45 A;  5B0Y D;  4R8P B;  4WU8 A;  5AV6 B;  3KUY B;  2ARO B;  5B1L D;  5AY8 B;  5CPI C;  5B1M B;  1F66 B;  3UTB D;  1KX4 C;  1EQZ D;  2LY8 A;  1P3B D;  3AZK A;  3REL B;  4H9P B;  4WNN A;  1WWI A;  3WTP D;  5B2J D;  5GT3 C;  5B31 C;  4QLC A;  1BH8 B;  3W99 C;  5C3I B;  3LJA C;  1P3M D;  1P3O B;  5B32 C;  5B24 D;  4NFT A;  3X1S C;  4WU9 A;  5CHL B;  3VH5 T;  5AV9 C;  3LZ1 D;  3REH C;  3AZF D;  1ID3 A;  4YS3 C;  4NE6 A;  3TU4 B;  5B0Z D;  3X1T D;  4CSR A;  2F8N H;  3X1V A;  3UTA B;  4XUJ A;  3AV1 D;  1P3G D;  3AZN D;  5B33 A;  2F8N A;  1M18 B;  2L5A A;  5B40 A;  3NQJ A;  3AZJ A;  4WU8 C;  1S32 C;  4KGC D;  3AZH C;  4KUD B;  3AN2 B;  3B0D B;  1P3P A;  3AV2 B;  1TZY B;  2FJ7 B;  5AV5 D;  1KX3 D;  4J8X D;  1P34 B;  4H9Q A;  3AZK C;  3AZI B;  5BNX B;  3C1B D;  3W98 A;  1U35 D;  3MNN D;  2BYM A;  1KX5 D;  5AVB B;  4QLC C;  5CP6 B;  5GXQ A;  3WAA A;  4Z66 A;  4J8U D;  3UT9 B;  2NZD B;  1ULY A;  4WU9 C;  2HIO A;  3REJ B;  5JRG C;  5F99 A;  5CPK A;  5DNM D;  5GT0 D;  3W97 A;  3X1V C;  4XUJ C;  5B0Y B;  5B33 C;  5G49 B;  4WZS B;  4HGA C;  5B40 C;  1TAF B;  4JJN A;  5B1L B;  3AZJ C;  3LEL D;  2CWE A;  5CPJ A;  3UTB B;  1EQZ B;  1P3P C;  1P3B B;  4EO5 B;  5BS7 A;  3WTP B;  3VH6 A;  2BYK B;  1M19 B;  3W98 C;  1M1A A;  3REK A;  4G92 C;  3WKJ D;  3WA9 A;  3C1C A;  2JSS A;  5GXQ C;  5B2I A;  4Z66 C;  5B24 B;  3LZ1 C;  3AZF B;  4R8P D;  5AV6 D;  2CV5 A;  4AWL C;  5B0Z C;  3X1U A;  3B6F A;  3KXB A;  3X1T B;  4CAY B;  5F99 C;  5CPK C;  1P3G B;  3AV1 B;  3AZN B;  4YM6 D;  3MGR D;  3REL D;  1P3A D;  4UUZ A;  2F8N K;  5B31 G;  5GSU B;  3MVD A;  4KGC B;  4JJN C;  5CPJ C;  5AV5 B;  1KX3 B;  4J8X B;  4ZUX A;  3TU4 D;  5BS7 C;  4J8W A;  5AVC D;  5AV8 A;  3MNN B;  5KDM B;  1M1A C;  3REK C;  4J8U B;  5JA4 B;  3C1C C;  1M18 D;  3WA9 C;  3KUY A;  2ARO A;  3MGQ D;  5AY8 A;  2CV5 C;  5B1M A;  1F66 A;  4KUD D;  3AN2 D;  1KX4 A;  3B6F C;  5E5A C;  3AFA B;  3KXB C;  3MGS A;  1HQ3 D;  1TZY D;  5GT0 B;  2FJ7 D;  1P34 D;  5GT3 A;  3AZI D;  3REI B;  2NQB D;  3LJA A;  3B6G D;  3VH6 T;  1P3O A;  5AVB D;  3MVD C;  4ZBJ B;  5B32 A;  3LEL B;  3KWQ A;  4Z5T D;  3REH A;  4YS3 A;  4DRB A;  4X23 D;  4ZUX C;  4XZQ A;  3REJ D;  4LD9 A;  3UTA A;  4E44 A;  5AV8 C;  2PYO D;  3WKJ B;  2F8N G;  4H9R A;  4R8P C;  3O62 D;  5AV6 C;  3KUY C;  1S32 A;  2ARO C;  3AZH A;  5AY8 C;  2HUE B;  3AV2 A;  1AOI B;  5B1M C;  1F66 C;  2RVQ D;  3AZL A;  3REL C;  3MGS C;  4YM6 B;  3MGR B;  3AZG D;  1P3A B;  5C3I C;  5CP6 A;  1M19 D;  3UT9 A;  1P3O C;  5FUG B;  3WTP E;  3VH5 W;  3KWQ C;  1HTA A;  3TU4 C;  4WV4 B;  5JRG A;  5AVC B;  3A6N D;  4XZQ C;  1P3L D;  4LD9 C;  3UTA C;  3AYW D;  5B0Y A;  5G49 A;  3MGP B;  5GSU D;  3MGQ B;  5B1L A;  1ZLA D;  3B0D C;  4KHA B;  3UTB A;  1EQZ A;  1P3B A;  3AV2 C;  5B31 B;  1P3I D;  1BH9 A;  1HQ3 B;  4E45 A;  3WTP A;  2FJ7 C;  5B2J A;  3AZL C;  2BYK A;  1P34 C;  3W96 D;  2YFV B;  2IO5 C;  1P3M A;  4H9S A;  2NQB B;  3B6G B;  3B0B A;  3X1S B;  5AV9 B;  5CP6 C;  3V9R B;  5B24 A;  3UT9 C;  3LZ1 A;  3AZF A;  2NZD C;  4Z5T B;  5B0Z A;  4X23 B;  2YFW B;  3REJ C;  3X1T A;  1JFI B;  1P3G A;  3AV1 A;  3AZN A;  2PYO B;  3AFA D;  5B0Y C;  3O62 B;  4KGC A;  3REI D;  1H3O B;  5B1L C;  3AZK B;  3UTB C;  1EQZ C;  5AV5 A;  1P3B C;  1N1J A;  4J8X A;  1KX3 A;  4EO5 C;  3AZG B;  3C1B A;  1U35 A;  3WTP C;  5B2J C;  3MNN A;  5KDM A;  1KX5 A;  1A7W A;  1P3M C;  4J8U A;  4H9S C;  3LZ0 D;  5JA4 A;  1ID3 B;  5B24 C;  3AZF C;  3A6N B;  4XUJ B;  5E5A A;  3X1T C;  5B33 B;  1AOI D;  5GT0 A;  5DNM A;  1P3L B;  4H9N A;  1P3G C;  3AV1 C;  3AYW B;  3AZN C;  1P3K D;  3NQJ B;  5GSU C;  1P3P B;  3LEL A;  4H9O B;  4KGC C;  4G91 C;  1ZLA B;  5B32 G;  3AZM D;  4H9Q B;  1P3I B;  3B0C T;  5DNN D;  1P3F D;  5AV5 C;  4Z2M G;  1KX3 C;  4J8X C;  3W96 B;  3C1B C;  4J8V D;  1U35 C;  3WAA B;  4Z66 B;  3MNN C;  3AZE D;  3WKJ A;  1KX5 C;  4J8U C;  2HIO B;  4R8P A;  3MGP D;  5AV6 A;  5CPI D;  5F99 B;  3W97 B;  4YM6 A;  3MGR A;  3REL A;  4H9P A;  5B31 D;  5GT0 C;  3W99 D;  5DNM C;  1P3A A;  4JJN B;  1BH8 A;  3REI C;  3VH6 W;  3X1S D;  5FUG A;  4ZBJ C;  5AV9 D;  3LEL C;  4NE3 A;  3TU4 A;  5AVC A;  1M1A B;  3C1C B;  5BT1 D;  3NQU B;  5B2I B;  3WKJ C;  3LZ0 B;  1M18 A;  4WU8 D;  3MGQ A;  3AZH D;  4DRA A;  3X1U B;  4KUD A;  3AN2 A;  2HUE C;  1AOI C;  3AZK D;  1HQ3 A;  1KU5 A;  1TZY A;  4UUZ B;  2FJ7 A;  1P34 A;  4YM6 C;  3MGR C;  1P3K B;  3AZI A;  5BNX A;  4QLC D;  1P3A C;  2NQB A;  3B6G A;  5AVB A;  4WU9 D;  4Z5T A;  1ID3 D;  2NZD A;  3AZM B;  4J8W B;  1P3F B;  5DNN B;  5AV8 B;  4X23 A;  1B67 A;  1JFI A;  3REJ A;  5AVC C;  4J8V B;  3X1V D;  2PYO A;  4XUJ D;  1B6W A;  3AZE B;  5B33 D;  2F8N D;  4M6B A;  5B40 D;  3MGP C;  3O62 A;  1M18 C;  3AZJ D;  3MGQ C;  1H3O A;  5BNV B;  5CPI B;  1KX4 B;  1TAF A;  1P3P D;  3MGS B;  5BO0 B;  4KUD C;  3AN2 C;  3AZG A;  5GT3 B;  1HQ3 C;  3W98 D;  1TZY C;  3W99 B;  3LJA B; 
#chains in the Genus database with same CATH topology
 3AZI C;  1M19 A;  5B32 B;  2NQB C;  5GXQ D;  3B6G C;  4Z66 D;  3WAA D;  5AVB C;  3KWQ B;  3REH B;  1R4V A;  4YS3 B;  2HIO D;  4Z5T C;  4XZQ B;  2ZY2 A;  4LD9 B;  3A6N A;  5F99 D;  5CPK D;  4X23 C;  4CAY A;  1P3L A;  5BT1 C;  3AYW A;  3W97 D;  2PYO C;  3R45 B;  4H9R B;  4WU8 B;  1S32 B;  5GSU A;  3AZH B;  3O62 C;  4H9O A;  4JJN D;  1ZLA A;  5CPJ D;  3AZL B;  1P3I A;  2IO5 B;  2Y2G A;  2RVQ C;  4WNN B;  3W96 A;  3AZG C;  4QLC B;  1M1A D;  3REK D;  1M19 C;  3C1C D;  3WA9 D;  5B2I D;  4WU9 B;  1ID3 C;  2CV5 D;  5JRG B;  4UPK A;  3X1U D;  3B6F D;  5E5A D;  3KXB D;  2F2A C;  3A6N C;  4CSR B;  3X1V B;  3AFA A;  1P3L C;  2F8N B;  3KFU G;  3AYW C;  2Y2Q A;  4HGA B;  1WWS A;  5B40 B;  1BFM A;  3MVD D;  3REI A;  3AZJ B;  3EPH A;  1ZLA C;  1BH9 B;  5B2J B;  4ZUX D;  1P3I C;  3B0C W;  4J8W D;  1P3M B;  3W98 B;  5AV8 D;  4G92 B;  3AL0 C;  2BYM B;  3W96 C;  3WAA C;  3NQU A;  5GXQ B;  3LZ0 A;  3LZ1 B;  3KUY D;  2ARO D;  4AWL B;  2HIO C;  5B0Z B;  5AY8 D;  5B1M D;  1F66 D;  5CPK B;  1KX4 D;  3KSY A;  1AOI A;  3MGS D;  3W97 C;  3AFA C;  1P3K A;  5GT3 D;  3LJA D;  4G91 B;  1P3O D;  5B32 D;  5CPJ B;  1N1J B;  3KWQ D;  1Q9C A;  3AZM A;  3REH D;  4YS3 D;  3C1B B;  5DNN A;  1P3F A;  1U35 B;  2DF4 C;  2Y2L A;  1KX5 B;  4XZQ D;  4J8V A;  4LD9 D;  3UTA D;  1F1E A;  3AZE A;  3REK B;  3VH5 A;  2ZY4 A;  5B2I C;  3WA9 B;  3LZ0 C;  3MGP A;  1S32 D;  5BNV A;  5CPI A;  2CV5 B;  3X1U C;  2RIQ A;  3AV2 D;  3B6F B;  2Y2P A;  5E5A B;  5BO0 A;  3KXB B;  4KHA A;  3IP4 C;  5DNM B;  4H9N B;  3AZL D;  1W2E A;  5B31 A;  1PZR A;  3W99 A;  1P3K C;  2YFV A;  5CP6 D;  3MVD B;  4Z2M H;  3UT9 D;  3X1S A;  5AV9 A;  2NZD D;  4NE5 A;  3V9R A;  3AZM C;  4J8W C;  4ZUX B;  1P3F C;  5JRG D;  5DNN C;  4WJ3 C;  2YFW A;  4J8V C;  3AZE C;  3R45 A;  5B0Y D;  4R8P B;  4WU8 A;  5AV6 B;  3KUY B;  2ARO B;  5B1L D;  5AY8 B;  5CPI C;  5B1M B;  1F66 B;  2Y2N A;  3UTB D;  1KX4 C;  2LY8 A;  1P3B D;  1EQZ D;  3AZK A;  3REL B;  4H9P B;  4WNN A;  1WWI A;  3WTP D;  5B2J D;  5GT3 C;  3EPJ A;  5B31 C;  4QLC A;  1BH8 B;  3W99 C;  5C3I B;  3LJA C;  1P3M D;  2Y2O A;  1P3O B;  5B32 C;  5B24 D;  4NFT A;  3X1S C;  4WU9 A;  5CHL B;  3VH5 T;  5AV9 C;  3LZ1 D;  3REH C;  3AZF D;  1ID3 A;  4YS3 C;  4NE6 A;  3TU4 B;  1T3U A;  2JE5 A;  5B0Z D;  2UWX A;  3X1T D;  4CSR A;  2F8N H;  3X1V A;  3UTA B;  4XUJ A;  3AV1 D;  2XD5 A;  3AZN D;  1P3G D;  5B33 A;  2F8N A;  1M18 B;  2L5A A;  5B40 A;  3NQJ A;  3AZJ A;  4WU8 C;  1S32 C;  4KGC D;  3AZH C;  4KUD B;  3AN2 B;  3B0D B;  1P3P A;  3AV2 B;  1TZY B;  2FJ7 B;  5AV5 D;  1KX3 D;  4J8X D;  1P34 B;  4H9Q A;  3AZK C;  3AZI B;  5BNX B;  3C1B D;  3W98 A;  1U35 D;  3MNN D;  2BYM A;  1KX5 D;  5AVB B;  4QLC C;  5CP6 B;  5GXQ A;  3WAA A;  4Z66 A;  4J8U D;  3UT9 B;  2NZD B;  1ULY A;  3A1I A;  4WU9 C;  2Y2I A;  2HIO A;  3REJ B;  5JRG C;  5F99 A;  5CPK A;  5DNM D;  5GT0 D;  3W97 A;  3X1V C;  4XUJ C;  5B0Y B;  5B33 C;  5G49 B;  2G5H C;  4WZS B;  4HGA C;  5B40 C;  1TAF B;  4JJN A;  5B1L B;  3AZJ C;  3LEL D;  2CWE A;  5CPJ A;  2FFF B;  3UTB B;  1EQZ B;  1P3P C;  1P3B B;  4EO5 B;  5BS7 A;  3WTP B;  3VH6 A;  2BYK B;  1M19 B;  3W98 C;  1M1A A;  3REK A;  4G92 C;  3WKJ D;  2J8P A;  3WA9 A;  3C1C A;  2JSS A;  5GXQ C;  5B2I A;  4Z66 C;  5B24 B;  3LZ1 C;  3AZF B;  4R8P D;  5AV6 D;  2CV5 A;  3A1K A;  4AWL C;  5B0Z C;  3X1U A;  3B6F A;  3KXB A;  3X1T B;  4CAY B;  3EPL A;  5F99 C;  5CPK C;  1P3G B;  3AV1 B;  3AZN B;  4YM6 D;  3MGR D;  3REL D;  1P3A D;  4UUZ A;  2F8N K;  5B31 G;  5GSU B;  3MVD A;  4KGC B;  4JJN C;  5CPJ C;  5AV5 B;  1KX3 B;  4J8X B;  4ZUX A;  3TU4 D;  5BS7 C;  4J8W A;  5AVC D;  5AV8 A;  3MNN B;  5KDM B;  2Y2K A;  2DQN C;  1M1A C;  3REK C;  4J8U B;  3F6T A;  5JA4 B;  3C1C C;  1M18 D;  3WA9 C;  3KUY A;  2ARO A;  3MGQ D;  5AY8 A;  4DQY B;  2CV5 C;  5B1M A;  1F66 A;  4KUD D;  3AN2 D;  1KX4 A;  3B6F C;  5E5A C;  3AFA B;  3KXB C;  3MGS A;  1HQ3 D;  1TZY D;  5GT0 B;  2FJ7 D;  2G5I C;  1P34 D;  5GT3 A;  3AZI D;  3REI B;  2NQB D;  3LJA A;  3B6G D;  2Y2M A;  3VH6 T;  1P3O A;  5AVB D;  3FDD A;  4ZBJ B;  5B32 A;  3MVD C;  3LEL B;  3KWQ A;  4Z5T D;  3REH A;  4YS3 A;  4DRB A;  4X23 D;  2ZM5 A;  4ZUX C;  4XZQ A;  3REJ D;  4LD9 A;  3UTA A;  4E44 A;  5AV8 C;  2PYO D;  3EPK A;  3WKJ B;  2F8N G;  4H9R A;  4R8P C;  3O62 D;  5AV6 C;  3KUY C;  1S32 A;  2ARO C;  3AZH A;  5AY8 C;  2HUE B;  3AV2 A;  1AOI B;  5B1M C;  1F66 C;  2RVQ D;  3AZL A;  3REL C;  3MGS C;  4YM6 B;  3MGR B;  3H0L C;  3AZG D;  1P3A B;  2VQR A;  2XD1 A;  5C3I C;  5CP6 A;  1M19 D;  3UT9 A;  1P3O C;  5FUG B;  3WTP E;  3VH5 W;  3KWQ C;  1HTA A;  3TU4 C;  4WV4 B;  5JRG A;  5AVC B;  3A6N D;  4XZQ C;  1P3L D;  4LD9 C;  3UTA C;  3AYW D;  5B0Y A;  5G49 A;  3MGP B;  5GSU D;  3MGQ B;  5B1L A;  2JCH A;  2BG1 A;  1ZLA D;  3B0D C;  4KHA B;  3UTB A;  1EQZ A;  1P3B A;  3AV2 C;  5B31 B;  1P3I D;  1BH9 A;  1HQ3 B;  4E45 A;  3WTP A;  2FJ7 C;  5B2J A;  3AZL C;  2BYK A;  1P34 C;  3W96 D;  2YFV B;  2IO5 C;  1P3M A;  4H9S A;  2NQB B;  3B6G B;  3B0B A;  3X1S B;  2ZY3 A;  5AV9 B;  5CP6 C;  3V9R B;  5B24 A;  3UT9 C;  3P5J B;  3LZ1 A;  3AZF A;  2NZD C;  4Z5T B;  5B0Z A;  4X23 B;  2YFW B;  3REJ C;  3X1T A;  1JFI B;  1P3G A;  3AV1 A;  3AZN A;  2PYO B;  3AFA D;  5B0Y C;  3O62 B;  4KGC A;  3REI D;  1H3O B;  5B1L C;  3AZK B;  3UTB C;  1EQZ C;  5AV5 A;  1P3B C;  1N1J A;  4J8X A;  1KX3 A;  4EO5 C;  3AZG B;  3C1B A;  1U35 A;  3H0M C;  3WTP C;  5B2J C;  3MNN A;  5KDM A;  1KX5 A;  1A7W A;  1P3M C;  4J8U A;  4H9S C;  3LZ0 D;  5JA4 A;  1ID3 B;  3EG5 B;  5B24 C;  3AZF C;  3A6N B;  4XUJ B;  5E5A A;  3X1T C;  5B33 B;  1AOI D;  5GT0 A;  5DNM A;  1P3L B;  4H9N A;  1P3G C;  3AV1 C;  3AYW B;  3AZN C;  1P3K D;  3NQJ B;  2Y2H A;  5GSU C;  1P3P B;  3LEL A;  4H9O B;  4KGC C;  4G91 C;  1ZLA B;  5B32 G;  3AZM D;  4H9Q B;  1P3I B;  3B0C T;  5DNN D;  1P3F D;  5AV5 C;  4Z2M G;  1KX3 C;  4J8X C;  3W96 B;  3C1B C;  2ZY5 A;  4J8V D;  1U35 C;  3WAA B;  4Z66 B;  3MNN C;  3AZE D;  3WKJ A;  1KX5 C;  4J8U C;  2HIO B;  4R8P A;  3MGP D;  5AV6 A;  5CPI D;  5F99 B;  2W8S A;  3W97 B;  4YM6 A;  3MGR A;  3REL A;  4H9P A;  5B31 D;  5GT0 C;  3W99 D;  5DNM C;  1P3A A;  4JJN B;  1BH8 A;  3REI C;  3VH6 W;  3X1S D;  5FUG A;  4ZBJ C;  5AV9 D;  3LEL C;  4NE3 A;  3TU4 A;  5AVC A;  1M1A B;  3C1C B;  5BT1 D;  3NQU B;  5B2I B;  3WKJ C;  3LZ0 B;  1M18 A;  4WU8 D;  3MGQ A;  3AZH D;  4DRA A;  3X1U B;  2Y2J A;  4KUD A;  3AN2 A;  2HUE C;  1AOI C;  3AZK D;  1Z2C B;  1HQ3 A;  1KU5 A;  1TZY A;  4UUZ B;  2FJ7 A;  1P34 A;  4YM6 C;  3MGR C;  1P3K B;  3AZI A;  5BNX A;  4QLC D;  1P3A C;  2NQB A;  3B6G A;  5AVB A;  4WU9 D;  4Z5T A;  1ID3 D;  2NZD A;  3AZM B;  4J8W B;  1P3F B;  5DNN B;  5AV8 B;  4X23 A;  1B67 A;  1JFI A;  3REJ A;  5AVC C;  4J8V B;  3X1V D;  2PYO A;  4XUJ D;  1B6W A;  3AZE B;  5B33 D;  2F8N D;  4M6B A;  5B40 D;  3MGP C;  3O62 A;  1M18 C;  3AZJ D;  3MGQ C;  1H3O A;  3H0R C;  5BNV B;  5CPI B;  1KX4 B;  1TAF A;  1P3P D;  3MGS B;  5BO0 B;  4KUD C;  3AN2 C;  3AZG A;  5GT3 B;  1HQ3 C;  3W98 D;  1TZY C;  3W99 B;  3LJA B; 
#chains in the Genus database with same CATH homology
 3AZI C;  1M19 A;  5B32 B;  2NQB C;  5GXQ D;  3B6G C;  4Z66 D;  3WAA D;  5AVB C;  3KWQ B;  3REH B;  1R4V A;  4YS3 B;  2HIO D;  4Z5T C;  4XZQ B;  2ZY2 A;  4LD9 B;  3A6N A;  5F99 D;  5CPK D;  4X23 C;  4CAY A;  1P3L A;  5BT1 C;  3AYW A;  3W97 D;  2PYO C;  3R45 B;  4H9R B;  4WU8 B;  1S32 B;  5GSU A;  3AZH B;  3O62 C;  4H9O A;  4JJN D;  1ZLA A;  5CPJ D;  3AZL B;  1P3I A;  2IO5 B;  2Y2G A;  2RVQ C;  4WNN B;  3W96 A;  3AZG C;  4QLC B;  1M1A D;  3REK D;  1M19 C;  3C1C D;  3WA9 D;  5B2I D;  4WU9 B;  1ID3 C;  2CV5 D;  5JRG B;  4UPK A;  3X1U D;  3B6F D;  5E5A D;  3KXB D;  2F2A C;  3A6N C;  4CSR B;  3X1V B;  3AFA A;  1P3L C;  2F8N B;  3KFU G;  3AYW C;  2Y2Q A;  4HGA B;  1WWS A;  5B40 B;  1BFM A;  3MVD D;  3REI A;  3AZJ B;  3EPH A;  1ZLA C;  1BH9 B;  5B2J B;  4ZUX D;  1P3I C;  3B0C W;  4J8W D;  1P3M B;  3W98 B;  5AV8 D;  4G92 B;  3AL0 C;  2BYM B;  3W96 C;  3WAA C;  3NQU A;  5GXQ B;  3LZ0 A;  3LZ1 B;  3KUY D;  2ARO D;  4AWL B;  2HIO C;  5B0Z B;  5AY8 D;  5B1M D;  1F66 D;  5CPK B;  1KX4 D;  3KSY A;  1AOI A;  3MGS D;  3W97 C;  3AFA C;  1P3K A;  5GT3 D;  3LJA D;  4G91 B;  1P3O D;  5B32 D;  5CPJ B;  1N1J B;  3KWQ D;  1Q9C A;  3AZM A;  3REH D;  4YS3 D;  3C1B B;  5DNN A;  1P3F A;  1U35 B;  2DF4 C;  2Y2L A;  1KX5 B;  4XZQ D;  4J8V A;  4LD9 D;  3UTA D;  1F1E A;  3AZE A;  3REK B;  3VH5 A;  2ZY4 A;  5B2I C;  3WA9 B;  3LZ0 C;  3MGP A;  1S32 D;  5BNV A;  5CPI A;  2CV5 B;  3X1U C;  2RIQ A;  3AV2 D;  3B6F B;  2Y2P A;  5E5A B;  5BO0 A;  3KXB B;  4KHA A;  3IP4 C;  5DNM B;  4H9N B;  3AZL D;  1W2E A;  5B31 A;  1PZR A;  3W99 A;  1P3K C;  2YFV A;  5CP6 D;  3MVD B;  4Z2M H;  3UT9 D;  3X1S A;  5AV9 A;  2NZD D;  4NE5 A;  3V9R A;  3AZM C;  4J8W C;  4ZUX B;  1P3F C;  5JRG D;  5DNN C;  4WJ3 C;  2YFW A;  4J8V C;  3AZE C;  3R45 A;  5B0Y D;  4R8P B;  4WU8 A;  5AV6 B;  3KUY B;  2ARO B;  5B1L D;  5AY8 B;  5CPI C;  5B1M B;  1F66 B;  2Y2N A;  3UTB D;  1KX4 C;  2LY8 A;  1P3B D;  1EQZ D;  3AZK A;  3REL B;  4H9P B;  4WNN A;  1WWI A;  3WTP D;  5B2J D;  5GT3 C;  3EPJ A;  5B31 C;  4QLC A;  1BH8 B;  3W99 C;  5C3I B;  3LJA C;  1P3M D;  2Y2O A;  1P3O B;  5B32 C;  5B24 D;  4NFT A;  3X1S C;  4WU9 A;  5CHL B;  3VH5 T;  5AV9 C;  3LZ1 D;  3REH C;  3AZF D;  1ID3 A;  4YS3 C;  4NE6 A;  3TU4 B;  1T3U A;  2JE5 A;  5B0Z D;  2UWX A;  3X1T D;  4CSR A;  2F8N H;  3X1V A;  3UTA B;  4XUJ A;  3AV1 D;  2XD5 A;  3AZN D;  1P3G D;  5B33 A;  2F8N A;  1M18 B;  2L5A A;  5B40 A;  3NQJ A;  3AZJ A;  4WU8 C;  1S32 C;  4KGC D;  3AZH C;  4KUD B;  3AN2 B;  3B0D B;  1P3P A;  3AV2 B;  1TZY B;  2FJ7 B;  5AV5 D;  1KX3 D;  4J8X D;  1P34 B;  4H9Q A;  3AZK C;  3AZI B;  5BNX B;  3C1B D;  3W98 A;  1U35 D;  3MNN D;  2BYM A;  1KX5 D;  5AVB B;  4QLC C;  5CP6 B;  5GXQ A;  3WAA A;  4Z66 A;  4J8U D;  3UT9 B;  2NZD B;  1ULY A;  3A1I A;  4WU9 C;  2Y2I A;  2HIO A;  3REJ B;  5JRG C;  5F99 A;  5CPK A;  5DNM D;  5GT0 D;  3W97 A;  3X1V C;  4XUJ C;  5B0Y B;  5B33 C;  5G49 B;  2G5H C;  4WZS B;  4HGA C;  5B40 C;  1TAF B;  4JJN A;  5B1L B;  3AZJ C;  3LEL D;  2CWE A;  5CPJ A;  2FFF B;  3UTB B;  1EQZ B;  1P3P C;  1P3B B;  4EO5 B;  5BS7 A;  3WTP B;  3VH6 A;  2BYK B;  1M19 B;  3W98 C;  1M1A A;  3REK A;  4G92 C;  3WKJ D;  2J8P A;  3WA9 A;  3C1C A;  2JSS A;  5GXQ C;  5B2I A;  4Z66 C;  5B24 B;  3LZ1 C;  3AZF B;  4R8P D;  5AV6 D;  2CV5 A;  3A1K A;  4AWL C;  5B0Z C;  3X1U A;  3B6F A;  3KXB A;  3X1T B;  4CAY B;  3EPL A;  5F99 C;  5CPK C;  1P3G B;  3AV1 B;  3AZN B;  4YM6 D;  3MGR D;  3REL D;  1P3A D;  4UUZ A;  2F8N K;  5B31 G;  5GSU B;  3MVD A;  4KGC B;  4JJN C;  5CPJ C;  5AV5 B;  1KX3 B;  4J8X B;  4ZUX A;  3TU4 D;  5BS7 C;  4J8W A;  5AVC D;  5AV8 A;  3MNN B;  5KDM B;  2Y2K A;  2DQN C;  1M1A C;  3REK C;  4J8U B;  3F6T A;  5JA4 B;  3C1C C;  1M18 D;  3WA9 C;  3KUY A;  2ARO A;  3MGQ D;  5AY8 A;  4DQY B;  2CV5 C;  5B1M A;  1F66 A;  4KUD D;  3AN2 D;  1KX4 A;  3B6F C;  5E5A C;  3AFA B;  3KXB C;  3MGS A;  1HQ3 D;  1TZY D;  5GT0 B;  2FJ7 D;  2G5I C;  1P34 D;  5GT3 A;  3AZI D;  3REI B;  2NQB D;  3LJA A;  3B6G D;  2Y2M A;  3VH6 T;  1P3O A;  5AVB D;  3FDD A;  4ZBJ B;  5B32 A;  3MVD C;  3LEL B;  3KWQ A;  4Z5T D;  3REH A;  4YS3 A;  4DRB A;  4X23 D;  2ZM5 A;  4ZUX C;  4XZQ A;  3REJ D;  4LD9 A;  3UTA A;  4E44 A;  5AV8 C;  2PYO D;  3EPK A;  3WKJ B;  2F8N G;  4H9R A;  4R8P C;  3O62 D;  5AV6 C;  3KUY C;  1S32 A;  2ARO C;  3AZH A;  5AY8 C;  2HUE B;  3AV2 A;  1AOI B;  5B1M C;  1F66 C;  2RVQ D;  3AZL A;  3REL C;  3MGS C;  4YM6 B;  3MGR B;  3H0L C;  3AZG D;  1P3A B;  2VQR A;  2XD1 A;  5C3I C;  5CP6 A;  1M19 D;  3UT9 A;  1P3O C;  5FUG B;  3WTP E;  3VH5 W;  3KWQ C;  1HTA A;  3TU4 C;  4WV4 B;  5JRG A;  5AVC B;  3A6N D;  4XZQ C;  1P3L D;  4LD9 C;  3UTA C;  3AYW D;  5B0Y A;  5G49 A;  3MGP B;  5GSU D;  3MGQ B;  5B1L A;  2JCH A;  2BG1 A;  1ZLA D;  3B0D C;  4KHA B;  3UTB A;  1EQZ A;  1P3B A;  3AV2 C;  5B31 B;  1P3I D;  1BH9 A;  1HQ3 B;  4E45 A;  3WTP A;  2FJ7 C;  5B2J A;  3AZL C;  2BYK A;  1P34 C;  3W96 D;  2YFV B;  2IO5 C;  1P3M A;  4H9S A;  2NQB B;  3B6G B;  3B0B A;  3X1S B;  2ZY3 A;  5AV9 B;  5CP6 C;  3V9R B;  5B24 A;  3UT9 C;  3P5J B;  3LZ1 A;  3AZF A;  2NZD C;  4Z5T B;  5B0Z A;  4X23 B;  2YFW B;  3REJ C;  3X1T A;  1JFI B;  1P3G A;  3AV1 A;  3AZN A;  2PYO B;  3AFA D;  5B0Y C;  3O62 B;  4KGC A;  3REI D;  1H3O B;  5B1L C;  3AZK B;  3UTB C;  1EQZ C;  5AV5 A;  1P3B C;  1N1J A;  4J8X A;  1KX3 A;  4EO5 C;  3AZG B;  3C1B A;  1U35 A;  3H0M C;  3WTP C;  5B2J C;  3MNN A;  5KDM A;  1KX5 A;  1A7W A;  1P3M C;  4J8U A;  4H9S C;  3LZ0 D;  5JA4 A;  1ID3 B;  3EG5 B;  5B24 C;  3AZF C;  3A6N B;  4XUJ B;  5E5A A;  3X1T C;  5B33 B;  1AOI D;  5GT0 A;  5DNM A;  1P3L B;  4H9N A;  1P3G C;  3AV1 C;  3AYW B;  3AZN C;  1P3K D;  3NQJ B;  2Y2H A;  5GSU C;  1P3P B;  3LEL A;  4H9O B;  4KGC C;  4G91 C;  1ZLA B;  5B32 G;  3AZM D;  4H9Q B;  1P3I B;  3B0C T;  5DNN D;  1P3F D;  5AV5 C;  4Z2M G;  1KX3 C;  4J8X C;  3W96 B;  3C1B C;  2ZY5 A;  4J8V D;  1U35 C;  3WAA B;  4Z66 B;  3MNN C;  3AZE D;  3WKJ A;  1KX5 C;  4J8U C;  2HIO B;  4R8P A;  3MGP D;  5AV6 A;  5CPI D;  5F99 B;  2W8S A;  3W97 B;  4YM6 A;  3MGR A;  3REL A;  4H9P A;  5B31 D;  5GT0 C;  3W99 D;  5DNM C;  1P3A A;  4JJN B;  1BH8 A;  3REI C;  3VH6 W;  3X1S D;  5FUG A;  4ZBJ C;  5AV9 D;  3LEL C;  4NE3 A;  3TU4 A;  5AVC A;  1M1A B;  3C1C B;  5BT1 D;  3NQU B;  5B2I B;  3WKJ C;  3LZ0 B;  1M18 A;  4WU8 D;  3MGQ A;  3AZH D;  4DRA A;  3X1U B;  2Y2J A;  4KUD A;  3AN2 A;  2HUE C;  1AOI C;  3AZK D;  1Z2C B;  1HQ3 A;  1KU5 A;  1TZY A;  4UUZ B;  2FJ7 A;  1P34 A;  4YM6 C;  3MGR C;  1P3K B;  3AZI A;  5BNX A;  4QLC D;  1P3A C;  2NQB A;  3B6G A;  5AVB A;  4WU9 D;  4Z5T A;  1ID3 D;  2NZD A;  3AZM B;  4J8W B;  1P3F B;  5DNN B;  5AV8 B;  4X23 A;  1B67 A;  1JFI A;  3REJ A;  5AVC C;  4J8V B;  3X1V D;  2PYO A;  4XUJ D;  1B6W A;  3AZE B;  5B33 D;  2F8N D;  4M6B A;  5B40 D;  3MGP C;  3O62 A;  1M18 C;  3AZJ D;  3MGQ C;  1H3O A;  3H0R C;  5BNV B;  5CPI B;  1KX4 B;  1TAF A;  1P3P D;  3MGS B;  5BO0 B;  4KUD C;  3AN2 C;  3AZG A;  5GT3 B;  1HQ3 C;  3W98 D;  1TZY C;  3W99 B;  3LJA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...