5CPJD

Nucleosome containing methylated sat2r dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags "structural protein/dna
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpjD00
4XUJB 3O62C 4KHAA 3W99B 1P3OA 3UTBC 3AZEC 3O62A 1P3OD 1M1AC 4LD9D 5GSUC 2IO5B 5CPIC 3NQUA 1P3AC 5F99B 3B0CT 5CPJB 4WNNA 3UTBA 5AVCC 3X1UC 4QLCB 5B31B 3R45B 3AZEA 1HQ3C 3W96A 4CSRA 1P3MB 3X1VC 3LJAC 1M1AA 5C3IB 3VH6T 5B2IC 1EQZC 5CPIA 1P3AA 4H9RA 3W96D 4YM6B 5AVCA 3X1UA 1AOID 1P3KD 3WKJA 1HQ3A 3X1VA 2BYMB 3LJAA 1P3PD 5B2IA 3WKJD 1BH8B 3W98B 5B0ZC 4J8UB 3RELC 3V9RB 3AZIB 1ZLAB 4ZUXB 1P3BA 3NQJB 3AV2C 4KUDB 1WWIA 4XZQB 5B40C 3AFAC 3MGPB 3AZFC 5GT0C 3X1SD 1P3BD 4YS3D 3A6NA 5BNVB 3KXBB 3UTAC 1M18D 4Z66B 3AFAA 4AWLC 3AYWA 3AZLB 3REHC 3A6ND 3AZFA 5GT0A 5B0YC 1KX5D 5BS7C 4LD9B 3AYWD 1A7WA 3UTAA 3REHA 4G92B 5B0YA 3WA9C 5BS7A 3MNNB 5AVBC 3KWQC 1AOIB 1P3KB 3LZ0D 3LZ1D 3WA9A 3WTPC 1P3PB 4G91B 1P3GC 2CV5D 5B24D 5AVBA 5B1MB 3REIC 4H9PB 2NQBC 5AVBD 5BNXA 3WAAC 3WTPA 4H9QB 1P3GA 3AZKA 3KUYC 5GT3C 3X1SB 3REIA 4YS3B 4WU8C 5AV8C 4J8XD 3B0CW 3MGRC 2NQBA 3AZKD 3C1CB 4WZSB 3WAAA 2JSSA 1P3FC 4X23D 3AZND 4WV4B 3VH6W 3LELC 5E5AA 5AY8B 3MGSD 4R8PC 4Z5TC 1H3OA 3MGRA 1ID3C 1TZYC 2RVQD 1P3FA 5E5AD 2F8ND 3REJC 3LELA 1TAFB 1R4VA 4R8PA 4KGCD 4Z5TA 1M19D 1ID3A 1TZYA 5G49A 4CAYA 5JRGD 3AZGC 5DNMD 4XUJC 1KX3B 5BT1D 5GXQB 3REJA 3LZ1B 5CPKB 1Q9CA 2CV5B 2HIOA 4NE6A 5B24B 3MGQC 3AZGA 3AZHB 5B32D 1N1JB 5AV6D 3B6FC 2HIOD 4WU9C 2IO5C 3UT9B 4JJND 3MGQA 3AZJC 4J8VB 2PYOD 4J8XB 3REKC 3AN2B 1F66B 1JFIB 3B6FA 4WU9A 5AV5C 4X23B 3AZJA 5B33C 3MGSB 3REKA 2AROA 3AV1C 5AV5A 1U35D 4H9OA 3W98C 4J8UC 1BH9B 2F8NB 1ZLAC 2FJ7D 2AROD 5B33A 2BYKB 4KGCB 1M19B 2NZDC 5JRGB 5JA4A 5KDMB 5DNMB 3AV1A 4UUZB 5B1LB 3W98A 2YFWB 3KXBC 4ZBJB 1P34B 3AZLC 3WTPE 5BO0B 2NZDA 3O62D 3AZMB 5B32B 2L5AA 5B2JB 1B67A 5AV6B 1S32B 3KXBA 5GSUA 3UTBD 4JJNB 3AZED 3MVDC 5CP6B 1M1AD 3VH5A 5GSUD 1WWSA 5CPID 1P3AD 3MNNC 1EQZA 5AVCD 5DNNC 3X1UD 1HQ3D 3X1VD 3MVDA 3LJAD 5B2ID 1EQZD 4G91C 1U35B 5B1MC 5DNNA 5B0ZA 3RELA 2FJ7B 3B6GC 3AV2A 5B40A 5B0ZD 3RELD 4KHAB 1P3OB 3AV2D 4NE5A 5B40D 3B6GA 3AFAD 4EO5C 3C1CC 1P3IC 3AZFD 5GT0D 3O62B 4DRAA 3UTAD 5AY8C 3NQUB 4WNNB 3UTBB 3C1CA 3REHD 3AZEB 1P3IA 4CSRB 3W96B 5B0YD 1M1AB 4J8WC 1F1EA 5CPIB 4DRBA 4H9RB 1B6WA 5AVCB 3X1UB 3WKJB 3KWQA 1HQ3B 1KX3C 3X1VB 3LJAB 5GXQC 4J8WA 5AV9C 3WA9D 5B2IB 5CPKC 4H9SC 3KWQD 3C1BC 1P3BB 1P3LC 3AZHC 1M18B 5AV9A 3WTPD 1P3GD 3TU4C 3X1TC 3UT9C 5B31G 3REID 3A6NB 3C1BA 4J8VC 3KUYA 5GT3A 1P3LA 1HTAA 3AZHA 4WU8A 5AV8A 1KX5B 2NQBD 3W97C 3AFAB 3AYWB 2CWEA 1N1JA 3AN2C 1F66C 3WAAD 3KUYD 5GT3D 5GT0B 3TU4A 3AZFB 3X1TA 5FUGB 4WU8D 5AV8D 4J8VA 3UTAB 3MGRD 3W97A 3B0DB 1P3FD 3REHB 1KX4C 5B0YB 2YFVA 3LELD 3VH5W 4H9NA 3LZ0B 3W99C 4R8PD 4Z5TD 1ID3D 1TZYD 1KX4A 3REJD 3KSYA 5B1LC 4XUJA 3WA9B 3W99A 5AVBB 1P34C 3AZGD 5F99C 4XUJD 5CPJC 4QLCC 5B31C 3AZMC 1P3MC 5BNXB 3WTPB 5C3IC 1S32C 3AZKB 3MGQD 5F99A 5BO0A 3AZNB 4YM6C 5CPJA 5CP6C 2HUEB 4QLCA 3R45A 5B31A 2NQBB 3B6FD 1P3MA 4WU9D 3WAAB 3AZJD 5E5AB 4YM6A 3REKD 5CP6A 3AZIC 3MGRB 1H3OB 4ZUXC 4KUDC 4XZQC 2BYMA 5AV5D 3MGPC 1P3FB 5B33D 1BH8A 3LELB 4J8UA 3V9RA 3AZIA 1ZLAA 4Z5TB 4ZUXA 3NQJA 1ID3B 1TZYB 5G49B 4CAYB 4XZQA 4KUDA 4Z66C 3AV1D 3MGPA 3W98D 4J8UD 3REJB 1ZLAD 1P3OC 4LD9C 5BNVA 2HIOB 2NZDD 3AZGB 4Z66A 3AZLA 4G92C 2PYOB 3KXBD 4E44A 4Z66D 4LD9A 3AZLD 3MGQB 3W96C 3VH6A 1AOIC 1P3KC 3B6FB 4WU9B 3VH5T 1P3PC 3MNNA 3AZJB 3WKJC 3MVDD 3REKB 1AOIA 2AROB 1P3KA 3MNND 5AV5B 4H9OB 5DNND 1P3PA 4HGAB 1P3BC 5B33B 3X1SC 5B1MA 4YS3C 1M18C 4H9PA 5JA4B 3AV1B 5B1MD 4H9QA 3A6NC 3X1SA 3B6GD 4YS3A 1KX5C 3AYWC 1M18A 4M6BA 2NZDB 5GSUB 1KX5A 5AY8A 3B0BA 3C1CD 1P3AB 1P3ID 2F8NK 3B0DC 2F8NG 5FUGA 5AY8D 3LZ0C 2LY8A 3LZ1C 1EQZB 1TAFA 2CV5C 5B24C 3MVDB 4NE3A 4J8WD 1KX3A 3LZ0A 5GXQA 3LZ1A 5CPKA 5DNNB 4H9SA 5B0ZB 2CV5A 5B24A 3RELB 1KX3D 5B32G 4Z2MG 5GXQD 5AV9D 5CHLB 3AV2B 5CPKD 4J8XC 5B40B 3AZKC 3C1BD 1P3LD 3UT9A 4X23C 3AZNC 3AZHD 3B6GB 2HUEC 3MGSC 4J8XA 4AWLB 3TU4D 3X1TD 4E45A 3UT9D 3AN2A 1F66A 1JFIA 2RVQC 4J8VD 5E5AC 4X23A 3AZNA 3W97D 3AN2D 1F66D 4EO5B 3MGSA 1P3IB 4KGCC 1M19C 1BFMA 5JRGC 5DNMC 5BT1C 1BH9A 2F8NA 4ZBJC 3KWQB 2BYKA 1KX4D 4KGCA 1M19A 5JRGA 5KDMA 5DNMA 4J8WB 4UUZA 3W99D 5B1LA 5B32C 5B2JC 5AV6C 2HIOC 2YFWA 1P3GB 4JJNC 3REIB 1P34A 5B1LD 1KU5A 5AV9B 3AZMA 2PYOC 2F8NH 5B32A 5B2JA 5AV6A 1P34D 5F99D 3C1BB 1S32A 5CPJD 3KUYB 5GT3B 1P3LB 4JJNA 4QLCD 5B31D 4WU8B 5AV8B 3AZMD 1P3MD 5B2JD 2PYOA 1S32D 3TU4B 3X1TB 1U35C 4YM6D 5CP6D 1ULYA 3W97B 4NFTA 2FJ7C 2AROC 4R8PB 4Z2MH 2YFVB 4H9NB 1U35A 4HGAC 3AZID 4ZUXD 4KUDD 4XZQD 2FJ7A 3MGPD 1KX4B
chains in the Genus database with same CATH superfamily
4XUJB 3O62C 4KHAA 3W99B 1P3OA 3UTBC 3AZEC 3H0RC 3O62A 1P3OD 1M1AC 4LD9D 5GSUC 2IO5B 5CPIC 3NQUA 1P3AC 5F99B 3B0CT 5CPJB 4WNNA 3UTBA 3EPHA 5AVCC 3X1UC 5B31B 4QLCB 3R45B 3AZEA 1HQ3C 3W96A 4CSRA 1P3MB 3X1VC 3LJAC 1M1AA 5C3IB 3VH6T 5B2IC 1EQZC 5CPIA 1P3AA 4H9RA 3W96D 2Y2IA 4YM6B 5AVCA 3X1UA 1AOID 1P3KD 3WKJA 1HQ3A 3X1VA 2BYMB 3LJAA 1P3PD 5B2IA 3WKJD 2J8PA 1BH8B 3W98B 5B0ZC 4J8UB 3RELC 3V9RB 3AZIB 1ZLAB 4ZUXB 1P3BA 4WJ3C 3NQJB 3AV2C 4KUDB 1WWIA 2Y2PA 4XZQB 5B40C 3AFAC 3MGPB 3AZFC 5GT0C 3X1SD 1P3BD 4YS3D 3A6NA 5BNVB 3KXBB 3UTAC 1M18D 4Z66B 3AFAA 4AWLC 3AYWA 3AZLB 3REHC 3A6ND 3AZFA 5GT0A 5B0YC 2ZM5A 1KX5D 5BS7C 4LD9B 3AYWD 1A7WA 3UTAA 3REHA 4G92B 5B0YA 2ZY5A 3WA9C 5BS7A 4DQYB 3MNNB 5AVBC 3KWQC 1AOIB 1P3KB 3LZ0D 3LZ1D 3WA9A 3WTPC 1P3PB 4G91B 1P3GC 2CV5D 5B24D 5AVBA 5B1MB 3REIC 4H9PB 2NQBC 5AVBD 5BNXA 3WAAC 3WTPA 4H9QB 1P3GA 3AZKA 3KUYC 5GT3C 3X1SB 3REIA 4YS3B 4WU8C 5AV8C 4J8XD 3B0CW 3MGRC 2NQBA 3AZKD 3C1CB 4WZSB 3WAAA 2JSSA 1P3FC 2JCHA 4X23D 3AZND 4WV4B 3VH6W 3LELC 5E5AA 5AY8B 3MGSD 3FDDA 4R8PC 4Z5TC 1H3OA 3MGRA 1ID3C 1TZYC 2RVQD 1P3FA 5E5AD 2F8ND 3REJC 3LELA 1TAFB 1R4VA 4R8PA 4KGCD 4Z5TA 1M19D 1ID3A 1TZYA 5G49A 4CAYA 5JRGD 3AZGC 5DNMD 3EPKA 4XUJC 1KX3B 5BT1D 5GXQB 3REJA 3LZ1B 5CPKB 3IP4C 3EPLA 3AL0C 1Q9CA 2CV5B 2HIOA 4NE6A 5B24B 3MGQC 3AZGA 3AZHB 2ZY3A 5B32D 1N1JB 5AV6D 3B6FC 2HIOD 4WU9C 2IO5C 3UT9B 4JJND 3MGQA 3AZJC 4J8VB 2PYOD 4J8XB 3REKC 3AN2B 1F66B 1JFIB 3B6FA 4WU9A 5AV5C 4X23B 3AZJA 2Y2GA 5B33C 3MGSB 3P5JB 3REKA 2AROA 2VQRA 3AV1C 5AV5A 1U35D 2JE5A 4H9OA 3W98C 4J8UC 1BH9B 2F8NB 1ZLAC 2FJ7D 2AROD 5B33A 2BYKB 4KGCB 1M19B 2NZDC 5JRGB 5JA4A 5KDMB 5DNMB 3AV1A 4UUZB 5B1LB 3W98A 2YFWB 3KXBC 4ZBJB 1P34B 3AZLC 3WTPE 5BO0B 2NZDA 3O62D 3AZMB 5B32B 2L5AA 5B2JB 1B67A 2DF4C 5AV6B 1S32B 3KXBA 5GSUA 3UTBD 4JJNB 3AZED 3MVDC 5CP6B 1M1AD 3VH5A 5GSUD 1WWSA 1PZRA 5CPID 1P3AD 3MNNC 1EQZA 5AVCD 5DNNC 3X1UD 1HQ3D 3X1VD 3MVDA 3LJAD 5B2ID 1EQZD 4G91C 1U35B 5B1MC 5DNNA 5B0ZA 3RELA 2FJ7B 3B6GC 3AV2A 5B40A 5B0ZD 3RELD 4KHAB 1P3OB 3AV2D 4NE5A 5B40D 3B6GA 3AFAD 4EO5C 3C1CC 1P3IC 1W2EA 3AZFD 5GT0D 3O62B 4DRAA 3UTAD 5AY8C 3NQUB 4WNNB 3UTBB 2XD5A 3C1CA 3REHD 3AZEB 1P3IA 4CSRB 3W96B 5B0YD 1M1AB 4J8WC 1F1EA 5CPIB 4DRBA 4H9RB 1B6WA 5AVCB 3X1UB 3WKJB 3KWQA 1HQ3B 2BG1A 1KX3C 3X1VB 3LJAB 5GXQC 4J8WA 5AV9C 2Y2MA 5B2IB 5CPKC 3WA9D 4H9SC 3KWQD 3C1BC 1P3BB 1P3LC 3AZHC 1M18B 5AV9A 3WTPD 3EG5B 1P3GD 3TU4C 3X1TC 3UT9C 5B31G 3REID 3A6NB 3C1BA 4J8VC 3KUYA 5GT3A 1P3LA 1HTAA 3AZHA 4WU8A 5AV8A 1KX5B 2NQBD 3W97C 2Y2LA 3AFAB 2CWEA 1N1JA 3AYWB 3AN2C 1F66C 3WAAD 2UWXA 3KUYD 5GT3D 5GT0B 3TU4A 3AZFB 3X1TA 5FUGB 4WU8D 5AV8D 4J8VA 3UTAB 3MGRD 3W97A 3B0DB 1P3FD 3REHB 1KX4C 5B0YB 2YFVA 4UPKA 3LELD 3VH5W 4H9NA 3LZ0B 3W99C 4R8PD 4Z5TD 1ID3D 1TZYD 1KX4A 3REJD 3KSYA 5B1LC 4XUJA 2RIQA 3WA9B 3W99A 5AVBB 1P34C 3AZGD 5F99C 4XUJD 5CPJC 2Y2OA 4QLCC 5B31C 3AZMC 1P3MC 1T3UA 5BNXB 3WTPB 5C3IC 1S32C 3AZKB 3MGQD 2Y2HA 5F99A 5BO0A 3AZNB 4YM6C 5CPJA 5CP6C 2HUEB 4QLCA 1Z2CB 3R45A 5B31A 2NQBB 3B6FD 1P3MA 4WU9D 3WAAB 3H0MC 3AZJD 5E5AB 4YM6A 3REKD 5CP6A 3AZIC 3H0LC 1H3OB 4ZUXC 3MGRB 4KUDC 4XZQC 2BYMA 5AV5D 3MGPC 1P3FB 2Y2JA 3KFUG 5B33D 1BH8A 3LELB 2W8SA 4J8UA 3V9RA 3AZIA 1ZLAA 4Z5TB 4ZUXA 3NQJA 1ID3B 1TZYB 5G49B 4CAYB 4XZQA 4KUDA 4Z66C 3AV1D 3MGPA 3A1KA 4J8UD 3W98D 3REJB 1ZLAD 1P3OC 2ZY4A 4LD9C 5BNVA 2HIOB 2NZDD 3AZGB 4Z66A 3A1IA 3AZLA 4G92C 2PYOB 3KXBD 4E44A 4Z66D 4LD9A 3AZLD 3MGQB 2Y2KA 3W96C 3VH6A 1AOIC 1P3KC 3B6FB 4WU9B 3VH5T 1P3PC 3MNNA 3AZJB 3WKJC 3MVDD 3REKB 1AOIA 2AROB 1P3KA 3MNND 5AV5B 4H9OB 5DNND 1P3PA 4HGAB 1P3BC 5B33B 3X1SC 5B1MA 4YS3C 3EPJA 1M18C 4H9PA 5JA4B 3AV1B 5B1MD 4H9QA 3A6NC 2G5IC 3X1SA 3B6GD 4YS3A 1KX5C 3AYWC 1M18A 4M6BA 2NZDB 2XD1A 2Y2NA 2G5HC 5GSUB 1KX5A 5AY8A 3B0BA 3C1CD 1P3AB 1P3ID 2F8NK 3B0DC 3F6TA 2F8NG 5FUGA 5AY8D 3LZ0C 2LY8A 3LZ1C 1EQZB 1TAFA 2CV5C 5B24C 3MVDB 4NE3A 4J8WD 1KX3A 3LZ0A 5GXQA 3LZ1A 5CPKA 5DNNB 4H9SA 2FFFB 5B0ZB 2CV5A 5B24A 3RELB 1KX3D 5B32G 4Z2MG 2Y2QA 5GXQD 5AV9D 5CHLB 3AV2B 5CPKD 4J8XC 5B40B 3AZKC 3C1BD 1P3LD 3UT9A 4X23C 3AZNC 3AZHD 3B6GB 2HUEC 3MGSC 4J8XA 4AWLB 3TU4D 3X1TD 4E45A 3UT9D 3AN2A 1F66A 1JFIA 2RVQC 4J8VD 5E5AC 4X23A 3AZNA 3W97D 3AN2D 1F66D 4EO5B 3MGSA 1P3IB 4KGCC 1M19C 1BFMA 5JRGC 5DNMC 5BT1C 1BH9A 2F8NA 2ZY2A 4ZBJC 2DQNC 3KWQB 2BYKA 1KX4D 4KGCA 1M19A 5JRGA 5KDMA 5DNMA 4J8WB 4UUZA 3W99D 5B1LA 5B32C 5B2JC 5AV6C 2HIOC 2YFWA 1P3GB 4JJNC 3REIB 1P34A 5B1LD 1KU5A 5AV9B 3AZMA 2PYOC 2F2AC 2F8NH 5B32A 5B2JA 5AV6A 1P34D 5F99D 3C1BB 1S32A 5CPJD 3KUYB 5GT3B 1P3LB 4JJNA 4QLCD 5B31D 4WU8B 5AV8B 3AZMD 1P3MD 5B2JD 2PYOA 1S32D 3TU4B 3X1TB 1U35C 4YM6D 5CP6D 1ULYA 3W97B 4NFTA 2FJ7C 2AROC 4R8PB 4Z2MH 2YFVB 4H9NB 1U35A 4HGAC 3AZID 4ZUXD 4KUDD 4XZQD 2FJ7A 3MGPD 1KX4B
chains in the Genus database with same CATH topology
4XUJB 3O62C 4KHAA 3W99B 1P3OA 3UTBC 3AZEC 3H0RC 3O62A 1P3OD 1M1AC 4LD9D 5GSUC 2IO5B 5CPIC 3NQUA 1P3AC 5F99B 3B0CT 5CPJB 4WNNA 3UTBA 3EPHA 5AVCC 3X1UC 5B31B 4QLCB 3R45B 3AZEA 1HQ3C 3W96A 4CSRA 1P3MB 3X1VC 3LJAC 1M1AA 5C3IB 3VH6T 5B2IC 1EQZC 5CPIA 1P3AA 4H9RA 3W96D 2Y2IA 4YM6B 5AVCA 3X1UA 1AOID 1P3KD 3WKJA 1HQ3A 3X1VA 2BYMB 3LJAA 1P3PD 5B2IA 3WKJD 2J8PA 1BH8B 3W98B 5B0ZC 4J8UB 3RELC 3V9RB 3AZIB 1ZLAB 4ZUXB 1P3BA 4WJ3C 3NQJB 3AV2C 4KUDB 1WWIA 2Y2PA 4XZQB 5B40C 3AFAC 3MGPB 3AZFC 5GT0C 3X1SD 1P3BD 4YS3D 3A6NA 5BNVB 3KXBB 3UTAC 1M18D 4Z66B 3AFAA 4AWLC 3AYWA 3AZLB 3REHC 3A6ND 3AZFA 5GT0A 5B0YC 2ZM5A 1KX5D 5BS7C 4LD9B 3AYWD 1A7WA 3UTAA 3REHA 4G92B 5B0YA 2ZY5A 3WA9C 5BS7A 4DQYB 3MNNB 5AVBC 3KWQC 1AOIB 1P3KB 3LZ0D 3LZ1D 3WA9A 3WTPC 1P3PB 4G91B 1P3GC 2CV5D 5B24D 5AVBA 5B1MB 3REIC 4H9PB 2NQBC 5AVBD 5BNXA 3WAAC 3WTPA 4H9QB 1P3GA 3AZKA 3KUYC 5GT3C 3X1SB 3REIA 4YS3B 4WU8C 5AV8C 4J8XD 3B0CW 3MGRC 2NQBA 3AZKD 3C1CB 4WZSB 3WAAA 2JSSA 1P3FC 2JCHA 4X23D 3AZND 4WV4B 3VH6W 3LELC 5E5AA 5AY8B 3MGSD 3FDDA 4R8PC 4Z5TC 1H3OA 3MGRA 1ID3C 1TZYC 2RVQD 1P3FA 5E5AD 2F8ND 3REJC 3LELA 1TAFB 1R4VA 4R8PA 4KGCD 4Z5TA 1M19D 1ID3A 1TZYA 5G49A 4CAYA 5JRGD 3AZGC 5DNMD 3EPKA 4XUJC 1KX3B 5BT1D 5GXQB 3REJA 3LZ1B 5CPKB 3IP4C 3EPLA 3AL0C 1Q9CA 2CV5B 2HIOA 4NE6A 5B24B 3MGQC 3AZGA 3AZHB 2ZY3A 5B32D 1N1JB 5AV6D 3B6FC 2HIOD 4WU9C 2IO5C 3UT9B 4JJND 3MGQA 3AZJC 4J8VB 2PYOD 4J8XB 3REKC 3AN2B 1F66B 1JFIB 3B6FA 4WU9A 5AV5C 4X23B 3AZJA 2Y2GA 5B33C 3MGSB 3P5JB 3REKA 2AROA 2VQRA 3AV1C 5AV5A 1U35D 2JE5A 4H9OA 3W98C 4J8UC 1BH9B 2F8NB 1ZLAC 2FJ7D 2AROD 5B33A 2BYKB 4KGCB 1M19B 2NZDC 5JRGB 5JA4A 5KDMB 5DNMB 3AV1A 4UUZB 5B1LB 3W98A 2YFWB 3KXBC 4ZBJB 1P34B 3AZLC 3WTPE 5BO0B 2NZDA 3O62D 3AZMB 5B32B 2L5AA 5B2JB 1B67A 2DF4C 5AV6B 1S32B 3KXBA 5GSUA 3UTBD 4JJNB 3AZED 3MVDC 5CP6B 1M1AD 3VH5A 5GSUD 1WWSA 1PZRA 5CPID 1P3AD 3MNNC 1EQZA 5AVCD 5DNNC 3X1UD 1HQ3D 3X1VD 3MVDA 3LJAD 5B2ID 1EQZD 4G91C 1U35B 5B1MC 5DNNA 5B0ZA 3RELA 2FJ7B 3B6GC 3AV2A 5B40A 5B0ZD 3RELD 4KHAB 1P3OB 3AV2D 4NE5A 5B40D 3B6GA 3AFAD 4EO5C 3C1CC 1P3IC 1W2EA 3AZFD 5GT0D 3O62B 4DRAA 3UTAD 5AY8C 3NQUB 4WNNB 3UTBB 2XD5A 3C1CA 3REHD 3AZEB 1P3IA 4CSRB 3W96B 5B0YD 1M1AB 4J8WC 1F1EA 5CPIB 4DRBA 4H9RB 1B6WA 5AVCB 3X1UB 3WKJB 3KWQA 1HQ3B 2BG1A 1KX3C 3X1VB 3LJAB 5GXQC 4J8WA 5AV9C 2Y2MA 5B2IB 5CPKC 3WA9D 4H9SC 3KWQD 3C1BC 1P3BB 1P3LC 3AZHC 1M18B 5AV9A 3WTPD 3EG5B 1P3GD 3TU4C 3X1TC 3UT9C 5B31G 3REID 3A6NB 3C1BA 4J8VC 3KUYA 5GT3A 1P3LA 1HTAA 3AZHA 4WU8A 5AV8A 1KX5B 2NQBD 3W97C 2Y2LA 3AFAB 2CWEA 1N1JA 3AYWB 3AN2C 1F66C 3WAAD 2UWXA 3KUYD 5GT3D 5GT0B 3TU4A 3AZFB 3X1TA 5FUGB 4WU8D 5AV8D 4J8VA 3UTAB 3MGRD 3W97A 3B0DB 1P3FD 3REHB 1KX4C 5B0YB 2YFVA 4UPKA 3LELD 3VH5W 4H9NA 3LZ0B 3W99C 4R8PD 4Z5TD 1ID3D 1TZYD 1KX4A 3REJD 3KSYA 5B1LC 4XUJA 2RIQA 3WA9B 3W99A 5AVBB 1P34C 3AZGD 5F99C 4XUJD 5CPJC 2Y2OA 4QLCC 5B31C 3AZMC 1P3MC 1T3UA 5BNXB 3WTPB 5C3IC 1S32C 3AZKB 3MGQD 2Y2HA 5F99A 5BO0A 3AZNB 4YM6C 5CPJA 5CP6C 2HUEB 4QLCA 1Z2CB 3R45A 5B31A 2NQBB 3B6FD 1P3MA 4WU9D 3WAAB 3H0MC 3AZJD 5E5AB 4YM6A 3REKD 5CP6A 3AZIC 3H0LC 1H3OB 4ZUXC 3MGRB 4KUDC 4XZQC 2BYMA 5AV5D 3MGPC 1P3FB 2Y2JA 3KFUG 5B33D 1BH8A 3LELB 2W8SA 4J8UA 3V9RA 3AZIA 1ZLAA 4Z5TB 4ZUXA 3NQJA 1ID3B 1TZYB 5G49B 4CAYB 4XZQA 4KUDA 4Z66C 3AV1D 3MGPA 3A1KA 4J8UD 3W98D 3REJB 1ZLAD 1P3OC 2ZY4A 4LD9C 5BNVA 2HIOB 2NZDD 3AZGB 4Z66A 3A1IA 3AZLA 4G92C 2PYOB 3KXBD 4E44A 4Z66D 4LD9A 3AZLD 3MGQB 2Y2KA 3W96C 3VH6A 1AOIC 1P3KC 3B6FB 4WU9B 3VH5T 1P3PC 3MNNA 3AZJB 3WKJC 3MVDD 3REKB 1AOIA 2AROB 1P3KA 3MNND 5AV5B 4H9OB 5DNND 1P3PA 4HGAB 1P3BC 5B33B 3X1SC 5B1MA 4YS3C 3EPJA 1M18C 4H9PA 5JA4B 3AV1B 5B1MD 4H9QA 3A6NC 2G5IC 3X1SA 3B6GD 4YS3A 1KX5C 3AYWC 1M18A 4M6BA 2NZDB 2XD1A 2Y2NA 2G5HC 5GSUB 1KX5A 5AY8A 3B0BA 3C1CD 1P3AB 1P3ID 2F8NK 3B0DC 3F6TA 2F8NG 5FUGA 5AY8D 3LZ0C 2LY8A 3LZ1C 1EQZB 1TAFA 2CV5C 5B24C 3MVDB 4NE3A 4J8WD 1KX3A 3LZ0A 5GXQA 3LZ1A 5CPKA 5DNNB 4H9SA 2FFFB 5B0ZB 2CV5A 5B24A 3RELB 1KX3D 5B32G 4Z2MG 2Y2QA 5GXQD 5AV9D 5CHLB 3AV2B 5CPKD 4J8XC 5B40B 3AZKC 3C1BD 1P3LD 3UT9A 4X23C 3AZNC 3AZHD 3B6GB 2HUEC 3MGSC 4J8XA 4AWLB 3TU4D 3X1TD 4E45A 3UT9D 3AN2A 1F66A 1JFIA 2RVQC 4J8VD 5E5AC 4X23A 3AZNA 3W97D 3AN2D 1F66D 4EO5B 3MGSA 1P3IB 4KGCC 1M19C 1BFMA 5JRGC 5DNMC 5BT1C 1BH9A 2F8NA 2ZY2A 4ZBJC 2DQNC 3KWQB 2BYKA 1KX4D 4KGCA 1M19A 5JRGA 5KDMA 5DNMA 4J8WB 4UUZA 3W99D 5B1LA 5B32C 5B2JC 5AV6C 2HIOC 2YFWA 1P3GB 4JJNC 3REIB 1P34A 5B1LD 1KU5A 5AV9B 3AZMA 2PYOC 2F2AC 2F8NH 5B32A 5B2JA 5AV6A 1P34D 5F99D 3C1BB 1S32A 5CPJD 3KUYB 5GT3B 1P3LB 4JJNA 4QLCD 5B31D 4WU8B 5AV8B 3AZMD 1P3MD 5B2JD 2PYOA 1S32D 3TU4B 3X1TB 1U35C 4YM6D 5CP6D 1ULYA 3W97B 4NFTA 2FJ7C 2AROC 4R8PB 4Z2MH 2YFVB 4H9NB 1U35A 4HGAC 3AZID 4ZUXD 4KUDD 4XZQD 2FJ7A 3MGPD 1KX4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUJ B;  3O62 C;  4KHA A;  3W99 B;  1P3O A;  3UTB C;  3AZE C;  3O62 A;  1P3O D;  1M1A C;  4LD9 D;  5GSU C;  2IO5 B;  5CPI C;  3NQU A;  1P3A C;  5F99 B;  3B0C T;  5CPJ B;  4WNN A;  3UTB A;  5AVC C;  3X1U C;  4QLC B;  5B31 B;  3R45 B;  3AZE A;  1HQ3 C;  3W96 A;  4CSR A;  1P3M B;  3X1V C;  3LJA C;  1M1A A;  5C3I B;  3VH6 T;  5B2I C;  1EQZ C;  5CPI A;  1P3A A;  4H9R A;  3W96 D;  4YM6 B;  5AVC A;  3X1U A;  1AOI D;  1P3K D;  3WKJ A;  1HQ3 A;  3X1V A;  2BYM B;  3LJA A;  1P3P D;  5B2I A;  3WKJ D;  1BH8 B;  3W98 B;  5B0Z C;  4J8U B;  3REL C;  3V9R B;  3AZI B;  1ZLA B;  4ZUX B;  1P3B A;  3NQJ B;  3AV2 C;  4KUD B;  1WWI A;  4XZQ B;  5B40 C;  3AFA C;  3MGP B;  3AZF C;  5GT0 C;  3X1S D;  1P3B D;  4YS3 D;  3A6N A;  5BNV B;  3KXB B;  3UTA C;  1M18 D;  4Z66 B;  3AFA A;  4AWL C;  3AYW A;  3AZL B;  3REH C;  3A6N D;  3AZF A;  5GT0 A;  5B0Y C;  1KX5 D;  5BS7 C;  4LD9 B;  3AYW D;  1A7W A;  3UTA A;  3REH A;  4G92 B;  5B0Y A;  3WA9 C;  5BS7 A;  3MNN B;  5AVB C;  3KWQ C;  1AOI B;  1P3K B;  3LZ0 D;  3LZ1 D;  3WA9 A;  3WTP C;  1P3P B;  4G91 B;  1P3G C;  2CV5 D;  5B24 D;  5AVB A;  5B1M B;  3REI C;  4H9P B;  2NQB C;  5AVB D;  5BNX A;  3WAA C;  3WTP A;  4H9Q B;  1P3G A;  3AZK A;  3KUY C;  5GT3 C;  3X1S B;  3REI A;  4YS3 B;  4WU8 C;  5AV8 C;  4J8X D;  3B0C W;  3MGR C;  2NQB A;  3AZK D;  3C1C B;  4WZS B;  3WAA A;  2JSS A;  1P3F C;  4X23 D;  3AZN D;  4WV4 B;  3VH6 W;  3LEL C;  5E5A A;  5AY8 B;  3MGS D;  4R8P C;  4Z5T C;  1H3O A;  3MGR A;  1ID3 C;  1TZY C;  2RVQ D;  1P3F A;  5E5A D;  2F8N D;  3REJ C;  3LEL A;  1TAF B;  1R4V A;  4R8P A;  4KGC D;  4Z5T A;  1M19 D;  1ID3 A;  1TZY A;  5G49 A;  4CAY A;  5JRG D;  3AZG C;  5DNM D;  4XUJ C;  1KX3 B;  5BT1 D;  5GXQ B;  3REJ A;  3LZ1 B;  5CPK B;  1Q9C A;  2CV5 B;  2HIO A;  4NE6 A;  5B24 B;  3MGQ C;  3AZG A;  3AZH B;  5B32 D;  1N1J B;  5AV6 D;  3B6F C;  2HIO D;  4WU9 C;  2IO5 C;  3UT9 B;  4JJN D;  3MGQ A;  3AZJ C;  4J8V B;  2PYO D;  4J8X B;  3REK C;  3AN2 B;  1F66 B;  1JFI B;  3B6F A;  4WU9 A;  5AV5 C;  4X23 B;  3AZJ A;  5B33 C;  3MGS B;  3REK A;  2ARO A;  3AV1 C;  5AV5 A;  1U35 D;  4H9O A;  3W98 C;  4J8U C;  1BH9 B;  2F8N B;  1ZLA C;  2FJ7 D;  2ARO D;  5B33 A;  2BYK B;  4KGC B;  1M19 B;  2NZD C;  5JRG B;  5JA4 A;  5KDM B;  5DNM B;  3AV1 A;  4UUZ B;  5B1L B;  3W98 A;  2YFW B;  3KXB C;  4ZBJ B;  1P34 B;  3AZL C;  3WTP E;  5BO0 B;  2NZD A;  3O62 D;  3AZM B;  5B32 B;  2L5A A;  5B2J B;  1B67 A;  5AV6 B;  1S32 B;  3KXB A;  5GSU A;  3UTB D;  4JJN B;  3AZE D;  3MVD C;  5CP6 B;  1M1A D;  3VH5 A;  5GSU D;  1WWS A;  5CPI D;  1P3A D;  3MNN C;  1EQZ A;  5AVC D;  5DNN C;  3X1U D;  1HQ3 D;  3X1V D;  3MVD A;  3LJA D;  5B2I D;  1EQZ D;  4G91 C;  1U35 B;  5B1M C;  5DNN A;  5B0Z A;  3REL A;  2FJ7 B;  3B6G C;  3AV2 A;  5B40 A;  5B0Z D;  3REL D;  4KHA B;  1P3O B;  3AV2 D;  4NE5 A;  5B40 D;  3B6G A;  3AFA D;  4EO5 C;  3C1C C;  1P3I C;  3AZF D;  5GT0 D;  3O62 B;  4DRA A;  3UTA D;  5AY8 C;  3NQU B;  4WNN B;  3UTB B;  3C1C A;  3REH D;  3AZE B;  1P3I A;  4CSR B;  3W96 B;  5B0Y D;  1M1A B;  4J8W C;  1F1E A;  5CPI B;  4DRB A;  4H9R B;  1B6W A;  5AVC B;  3X1U B;  3WKJ B;  3KWQ A;  1HQ3 B;  1KX3 C;  3X1V B;  3LJA B;  5GXQ C;  4J8W A;  5AV9 C;  3WA9 D;  5B2I B;  5CPK C;  4H9S C;  3KWQ D;  3C1B C;  1P3B B;  1P3L C;  3AZH C;  1M18 B;  5AV9 A;  3WTP D;  1P3G D;  3TU4 C;  3X1T C;  3UT9 C;  5B31 G;  3REI D;  3A6N B;  3C1B A;  4J8V C;  3KUY A;  5GT3 A;  1P3L A;  1HTA A;  3AZH A;  4WU8 A;  5AV8 A;  1KX5 B;  2NQB D;  3W97 C;  3AFA B;  3AYW B;  2CWE A;  1N1J A;  3AN2 C;  1F66 C;  3WAA D;  3KUY D;  5GT3 D;  5GT0 B;  3TU4 A;  3AZF B;  3X1T A;  5FUG B;  4WU8 D;  5AV8 D;  4J8V A;  3UTA B;  3MGR D;  3W97 A;  3B0D B;  1P3F D;  3REH B;  1KX4 C;  5B0Y B;  2YFV A;  3LEL D;  3VH5 W;  4H9N A;  3LZ0 B;  3W99 C;  4R8P D;  4Z5T D;  1ID3 D;  1TZY D;  1KX4 A;  3REJ D;  3KSY A;  5B1L C;  4XUJ A;  3WA9 B;  3W99 A;  5AVB B;  1P34 C;  3AZG D;  5F99 C;  4XUJ D;  5CPJ C;  4QLC C;  5B31 C;  3AZM C;  1P3M C;  5BNX B;  3WTP B;  5C3I C;  1S32 C;  3AZK B;  3MGQ D;  5F99 A;  5BO0 A;  3AZN B;  4YM6 C;  5CPJ A;  5CP6 C;  2HUE B;  4QLC A;  3R45 A;  5B31 A;  2NQB B;  3B6F D;  1P3M A;  4WU9 D;  3WAA B;  3AZJ D;  5E5A B;  4YM6 A;  3REK D;  5CP6 A;  3AZI C;  3MGR B;  1H3O B;  4ZUX C;  4KUD C;  4XZQ C;  2BYM A;  5AV5 D;  3MGP C;  1P3F B;  5B33 D;  1BH8 A;  3LEL B;  4J8U A;  3V9R A;  3AZI A;  1ZLA A;  4Z5T B;  4ZUX A;  3NQJ A;  1ID3 B;  1TZY B;  5G49 B;  4CAY B;  4XZQ A;  4KUD A;  4Z66 C;  3AV1 D;  3MGP A;  3W98 D;  4J8U D;  3REJ B;  1ZLA D;  1P3O C;  4LD9 C;  5BNV A;  2HIO B;  2NZD D;  3AZG B;  4Z66 A;  3AZL A;  4G92 C;  2PYO B;  3KXB D;  4E44 A;  4Z66 D;  4LD9 A;  3AZL D;  3MGQ B;  3W96 C;  3VH6 A;  1AOI C;  1P3K C;  3B6F B;  4WU9 B;  3VH5 T;  1P3P C;  3MNN A;  3AZJ B;  3WKJ C;  3MVD D;  3REK B;  1AOI A;  2ARO B;  1P3K A;  3MNN D;  5AV5 B;  4H9O B;  5DNN D;  1P3P A;  4HGA B;  1P3B C;  5B33 B;  3X1S C;  5B1M A;  4YS3 C;  1M18 C;  4H9P A;  5JA4 B;  3AV1 B;  5B1M D;  4H9Q A;  3A6N C;  3X1S A;  3B6G D;  4YS3 A;  1KX5 C;  3AYW C;  1M18 A;  4M6B A;  2NZD B;  5GSU B;  1KX5 A;  5AY8 A;  3B0B A;  3C1C D;  1P3A B;  1P3I D;  2F8N K;  3B0D C;  2F8N G;  5FUG A;  5AY8 D;  3LZ0 C;  2LY8 A;  3LZ1 C;  1EQZ B;  1TAF A;  2CV5 C;  5B24 C;  3MVD B;  4NE3 A;  4J8W D;  1KX3 A;  3LZ0 A;  5GXQ A;  3LZ1 A;  5CPK A;  5DNN B;  4H9S A;  5B0Z B;  2CV5 A;  5B24 A;  3REL B;  1KX3 D;  5B32 G;  4Z2M G;  5GXQ D;  5AV9 D;  5CHL B;  3AV2 B;  5CPK D;  4J8X C;  5B40 B;  3AZK C;  3C1B D;  1P3L D;  3UT9 A;  4X23 C;  3AZN C;  3AZH D;  3B6G B;  2HUE C;  3MGS C;  4J8X A;  4AWL B;  3TU4 D;  3X1T D;  4E45 A;  3UT9 D;  3AN2 A;  1F66 A;  1JFI A;  2RVQ C;  4J8V D;  5E5A C;  4X23 A;  3AZN A;  3W97 D;  3AN2 D;  1F66 D;  4EO5 B;  3MGS A;  1P3I B;  4KGC C;  1M19 C;  1BFM A;  5JRG C;  5DNM C;  5BT1 C;  1BH9 A;  2F8N A;  4ZBJ C;  3KWQ B;  2BYK A;  1KX4 D;  4KGC A;  1M19 A;  5JRG A;  5KDM A;  5DNM A;  4J8W B;  4UUZ A;  3W99 D;  5B1L A;  5B32 C;  5B2J C;  5AV6 C;  2HIO C;  2YFW A;  1P3G B;  4JJN C;  3REI B;  1P34 A;  5B1L D;  1KU5 A;  5AV9 B;  3AZM A;  2PYO C;  2F8N H;  5B32 A;  5B2J A;  5AV6 A;  1P34 D;  5F99 D;  3C1B B;  1S32 A;  5CPJ D;  3KUY B;  5GT3 B;  1P3L B;  4JJN A;  4QLC D;  5B31 D;  4WU8 B;  5AV8 B;  3AZM D;  1P3M D;  5B2J D;  2PYO A;  1S32 D;  3TU4 B;  3X1T B;  1U35 C;  4YM6 D;  5CP6 D;  1ULY A;  3W97 B;  4NFT A;  2FJ7 C;  2ARO C;  4R8P B;  4Z2M H;  2YFV B;  4H9N B;  1U35 A;  4HGA C;  3AZI D;  4ZUX D;  4KUD D;  4XZQ D;  2FJ7 A;  3MGP D;  1KX4 B; 
#chains in the Genus database with same CATH topology
 4XUJ B;  3O62 C;  4KHA A;  3W99 B;  1P3O A;  3UTB C;  3AZE C;  3H0R C;  3O62 A;  1P3O D;  1M1A C;  4LD9 D;  5GSU C;  2IO5 B;  5CPI C;  3NQU A;  1P3A C;  5F99 B;  3B0C T;  5CPJ B;  4WNN A;  3UTB A;  3EPH A;  5AVC C;  3X1U C;  5B31 B;  4QLC B;  3R45 B;  3AZE A;  1HQ3 C;  3W96 A;  4CSR A;  1P3M B;  3X1V C;  3LJA C;  1M1A A;  5C3I B;  3VH6 T;  5B2I C;  1EQZ C;  5CPI A;  1P3A A;  4H9R A;  3W96 D;  2Y2I A;  4YM6 B;  5AVC A;  3X1U A;  1AOI D;  1P3K D;  3WKJ A;  1HQ3 A;  3X1V A;  2BYM B;  3LJA A;  1P3P D;  5B2I A;  3WKJ D;  2J8P A;  1BH8 B;  3W98 B;  5B0Z C;  4J8U B;  3REL C;  3V9R B;  3AZI B;  1ZLA B;  4ZUX B;  1P3B A;  4WJ3 C;  3NQJ B;  3AV2 C;  4KUD B;  1WWI A;  2Y2P A;  4XZQ B;  5B40 C;  3AFA C;  3MGP B;  3AZF C;  5GT0 C;  3X1S D;  1P3B D;  4YS3 D;  3A6N A;  5BNV B;  3KXB B;  3UTA C;  1M18 D;  4Z66 B;  3AFA A;  4AWL C;  3AYW A;  3AZL B;  3REH C;  3A6N D;  3AZF A;  5GT0 A;  5B0Y C;  2ZM5 A;  1KX5 D;  5BS7 C;  4LD9 B;  3AYW D;  1A7W A;  3UTA A;  3REH A;  4G92 B;  5B0Y A;  2ZY5 A;  3WA9 C;  5BS7 A;  4DQY B;  3MNN B;  5AVB C;  3KWQ C;  1AOI B;  1P3K B;  3LZ0 D;  3LZ1 D;  3WA9 A;  3WTP C;  1P3P B;  4G91 B;  1P3G C;  2CV5 D;  5B24 D;  5AVB A;  5B1M B;  3REI C;  4H9P B;  2NQB C;  5AVB D;  5BNX A;  3WAA C;  3WTP A;  4H9Q B;  1P3G A;  3AZK A;  3KUY C;  5GT3 C;  3X1S B;  3REI A;  4YS3 B;  4WU8 C;  5AV8 C;  4J8X D;  3B0C W;  3MGR C;  2NQB A;  3AZK D;  3C1C B;  4WZS B;  3WAA A;  2JSS A;  1P3F C;  2JCH A;  4X23 D;  3AZN D;  4WV4 B;  3VH6 W;  3LEL C;  5E5A A;  5AY8 B;  3MGS D;  3FDD A;  4R8P C;  4Z5T C;  1H3O A;  3MGR A;  1ID3 C;  1TZY C;  2RVQ D;  1P3F A;  5E5A D;  2F8N D;  3REJ C;  3LEL A;  1TAF B;  1R4V A;  4R8P A;  4KGC D;  4Z5T A;  1M19 D;  1ID3 A;  1TZY A;  5G49 A;  4CAY A;  5JRG D;  3AZG C;  5DNM D;  3EPK A;  4XUJ C;  1KX3 B;  5BT1 D;  5GXQ B;  3REJ A;  3LZ1 B;  5CPK B;  3IP4 C;  3EPL A;  3AL0 C;  1Q9C A;  2CV5 B;  2HIO A;  4NE6 A;  5B24 B;  3MGQ C;  3AZG A;  3AZH B;  2ZY3 A;  5B32 D;  1N1J B;  5AV6 D;  3B6F C;  2HIO D;  4WU9 C;  2IO5 C;  3UT9 B;  4JJN D;  3MGQ A;  3AZJ C;  4J8V B;  2PYO D;  4J8X B;  3REK C;  3AN2 B;  1F66 B;  1JFI B;  3B6F A;  4WU9 A;  5AV5 C;  4X23 B;  3AZJ A;  2Y2G A;  5B33 C;  3MGS B;  3P5J B;  3REK A;  2ARO A;  2VQR A;  3AV1 C;  5AV5 A;  1U35 D;  2JE5 A;  4H9O A;  3W98 C;  4J8U C;  1BH9 B;  2F8N B;  1ZLA C;  2FJ7 D;  2ARO D;  5B33 A;  2BYK B;  4KGC B;  1M19 B;  2NZD C;  5JRG B;  5JA4 A;  5KDM B;  5DNM B;  3AV1 A;  4UUZ B;  5B1L B;  3W98 A;  2YFW B;  3KXB C;  4ZBJ B;  1P34 B;  3AZL C;  3WTP E;  5BO0 B;  2NZD A;  3O62 D;  3AZM B;  5B32 B;  2L5A A;  5B2J B;  1B67 A;  2DF4 C;  5AV6 B;  1S32 B;  3KXB A;  5GSU A;  3UTB D;  4JJN B;  3AZE D;  3MVD C;  5CP6 B;  1M1A D;  3VH5 A;  5GSU D;  1WWS A;  1PZR A;  5CPI D;  1P3A D;  3MNN C;  1EQZ A;  5AVC D;  5DNN C;  3X1U D;  1HQ3 D;  3X1V D;  3MVD A;  3LJA D;  5B2I D;  1EQZ D;  4G91 C;  1U35 B;  5B1M C;  5DNN A;  5B0Z A;  3REL A;  2FJ7 B;  3B6G C;  3AV2 A;  5B40 A;  5B0Z D;  3REL D;  4KHA B;  1P3O B;  3AV2 D;  4NE5 A;  5B40 D;  3B6G A;  3AFA D;  4EO5 C;  3C1C C;  1P3I C;  1W2E A;  3AZF D;  5GT0 D;  3O62 B;  4DRA A;  3UTA D;  5AY8 C;  3NQU B;  4WNN B;  3UTB B;  2XD5 A;  3C1C A;  3REH D;  3AZE B;  1P3I A;  4CSR B;  3W96 B;  5B0Y D;  1M1A B;  4J8W C;  1F1E A;  5CPI B;  4DRB A;  4H9R B;  1B6W A;  5AVC B;  3X1U B;  3WKJ B;  3KWQ A;  1HQ3 B;  2BG1 A;  1KX3 C;  3X1V B;  3LJA B;  5GXQ C;  4J8W A;  5AV9 C;  2Y2M A;  5B2I B;  5CPK C;  3WA9 D;  4H9S C;  3KWQ D;  3C1B C;  1P3B B;  1P3L C;  3AZH C;  1M18 B;  5AV9 A;  3WTP D;  3EG5 B;  1P3G D;  3TU4 C;  3X1T C;  3UT9 C;  5B31 G;  3REI D;  3A6N B;  3C1B A;  4J8V C;  3KUY A;  5GT3 A;  1P3L A;  1HTA A;  3AZH A;  4WU8 A;  5AV8 A;  1KX5 B;  2NQB D;  3W97 C;  2Y2L A;  3AFA B;  2CWE A;  1N1J A;  3AYW B;  3AN2 C;  1F66 C;  3WAA D;  2UWX A;  3KUY D;  5GT3 D;  5GT0 B;  3TU4 A;  3AZF B;  3X1T A;  5FUG B;  4WU8 D;  5AV8 D;  4J8V A;  3UTA B;  3MGR D;  3W97 A;  3B0D B;  1P3F D;  3REH B;  1KX4 C;  5B0Y B;  2YFV A;  4UPK A;  3LEL D;  3VH5 W;  4H9N A;  3LZ0 B;  3W99 C;  4R8P D;  4Z5T D;  1ID3 D;  1TZY D;  1KX4 A;  3REJ D;  3KSY A;  5B1L C;  4XUJ A;  2RIQ A;  3WA9 B;  3W99 A;  5AVB B;  1P34 C;  3AZG D;  5F99 C;  4XUJ D;  5CPJ C;  2Y2O A;  4QLC C;  5B31 C;  3AZM C;  1P3M C;  1T3U A;  5BNX B;  3WTP B;  5C3I C;  1S32 C;  3AZK B;  3MGQ D;  2Y2H A;  5F99 A;  5BO0 A;  3AZN B;  4YM6 C;  5CPJ A;  5CP6 C;  2HUE B;  4QLC A;  1Z2C B;  3R45 A;  5B31 A;  2NQB B;  3B6F D;  1P3M A;  4WU9 D;  3WAA B;  3H0M C;  3AZJ D;  5E5A B;  4YM6 A;  3REK D;  5CP6 A;  3AZI C;  3H0L C;  1H3O B;  4ZUX C;  3MGR B;  4KUD C;  4XZQ C;  2BYM A;  5AV5 D;  3MGP C;  1P3F B;  2Y2J A;  3KFU G;  5B33 D;  1BH8 A;  3LEL B;  2W8S A;  4J8U A;  3V9R A;  3AZI A;  1ZLA A;  4Z5T B;  4ZUX A;  3NQJ A;  1ID3 B;  1TZY B;  5G49 B;  4CAY B;  4XZQ A;  4KUD A;  4Z66 C;  3AV1 D;  3MGP A;  3A1K A;  4J8U D;  3W98 D;  3REJ B;  1ZLA D;  1P3O C;  2ZY4 A;  4LD9 C;  5BNV A;  2HIO B;  2NZD D;  3AZG B;  4Z66 A;  3A1I A;  3AZL A;  4G92 C;  2PYO B;  3KXB D;  4E44 A;  4Z66 D;  4LD9 A;  3AZL D;  3MGQ B;  2Y2K A;  3W96 C;  3VH6 A;  1AOI C;  1P3K C;  3B6F B;  4WU9 B;  3VH5 T;  1P3P C;  3MNN A;  3AZJ B;  3WKJ C;  3MVD D;  3REK B;  1AOI A;  2ARO B;  1P3K A;  3MNN D;  5AV5 B;  4H9O B;  5DNN D;  1P3P A;  4HGA B;  1P3B C;  5B33 B;  3X1S C;  5B1M A;  4YS3 C;  3EPJ A;  1M18 C;  4H9P A;  5JA4 B;  3AV1 B;  5B1M D;  4H9Q A;  3A6N C;  2G5I C;  3X1S A;  3B6G D;  4YS3 A;  1KX5 C;  3AYW C;  1M18 A;  4M6B A;  2NZD B;  2XD1 A;  2Y2N A;  2G5H C;  5GSU B;  1KX5 A;  5AY8 A;  3B0B A;  3C1C D;  1P3A B;  1P3I D;  2F8N K;  3B0D C;  3F6T A;  2F8N G;  5FUG A;  5AY8 D;  3LZ0 C;  2LY8 A;  3LZ1 C;  1EQZ B;  1TAF A;  2CV5 C;  5B24 C;  3MVD B;  4NE3 A;  4J8W D;  1KX3 A;  3LZ0 A;  5GXQ A;  3LZ1 A;  5CPK A;  5DNN B;  4H9S A;  2FFF B;  5B0Z B;  2CV5 A;  5B24 A;  3REL B;  1KX3 D;  5B32 G;  4Z2M G;  2Y2Q A;  5GXQ D;  5AV9 D;  5CHL B;  3AV2 B;  5CPK D;  4J8X C;  5B40 B;  3AZK C;  3C1B D;  1P3L D;  3UT9 A;  4X23 C;  3AZN C;  3AZH D;  3B6G B;  2HUE C;  3MGS C;  4J8X A;  4AWL B;  3TU4 D;  3X1T D;  4E45 A;  3UT9 D;  3AN2 A;  1F66 A;  1JFI A;  2RVQ C;  4J8V D;  5E5A C;  4X23 A;  3AZN A;  3W97 D;  3AN2 D;  1F66 D;  4EO5 B;  3MGS A;  1P3I B;  4KGC C;  1M19 C;  1BFM A;  5JRG C;  5DNM C;  5BT1 C;  1BH9 A;  2F8N A;  2ZY2 A;  4ZBJ C;  2DQN C;  3KWQ B;  2BYK A;  1KX4 D;  4KGC A;  1M19 A;  5JRG A;  5KDM A;  5DNM A;  4J8W B;  4UUZ A;  3W99 D;  5B1L A;  5B32 C;  5B2J C;  5AV6 C;  2HIO C;  2YFW A;  1P3G B;  4JJN C;  3REI B;  1P34 A;  5B1L D;  1KU5 A;  5AV9 B;  3AZM A;  2PYO C;  2F2A C;  2F8N H;  5B32 A;  5B2J A;  5AV6 A;  1P34 D;  5F99 D;  3C1B B;  1S32 A;  5CPJ D;  3KUY B;  5GT3 B;  1P3L B;  4JJN A;  4QLC D;  5B31 D;  4WU8 B;  5AV8 B;  3AZM D;  1P3M D;  5B2J D;  2PYO A;  1S32 D;  3TU4 B;  3X1T B;  1U35 C;  4YM6 D;  5CP6 D;  1ULY A;  3W97 B;  4NFT A;  2FJ7 C;  2ARO C;  4R8P B;  4Z2M H;  2YFV B;  4H9N B;  1U35 A;  4HGA C;  3AZI D;  4ZUX D;  4KUD D;  4XZQ D;  2FJ7 A;  3MGP D;  1KX4 B; 
#chains in the Genus database with same CATH homology
 4XUJ B;  3O62 C;  4KHA A;  3W99 B;  1P3O A;  3UTB C;  3AZE C;  3H0R C;  3O62 A;  1P3O D;  1M1A C;  4LD9 D;  5GSU C;  2IO5 B;  5CPI C;  3NQU A;  1P3A C;  5F99 B;  3B0C T;  5CPJ B;  4WNN A;  3UTB A;  3EPH A;  5AVC C;  3X1U C;  5B31 B;  4QLC B;  3R45 B;  3AZE A;  1HQ3 C;  3W96 A;  4CSR A;  1P3M B;  3X1V C;  3LJA C;  1M1A A;  5C3I B;  3VH6 T;  5B2I C;  1EQZ C;  5CPI A;  1P3A A;  4H9R A;  3W96 D;  2Y2I A;  4YM6 B;  5AVC A;  3X1U A;  1AOI D;  1P3K D;  3WKJ A;  1HQ3 A;  3X1V A;  2BYM B;  3LJA A;  1P3P D;  5B2I A;  3WKJ D;  2J8P A;  1BH8 B;  3W98 B;  5B0Z C;  4J8U B;  3REL C;  3V9R B;  3AZI B;  1ZLA B;  4ZUX B;  1P3B A;  4WJ3 C;  3NQJ B;  3AV2 C;  4KUD B;  1WWI A;  2Y2P A;  4XZQ B;  5B40 C;  3AFA C;  3MGP B;  3AZF C;  5GT0 C;  3X1S D;  1P3B D;  4YS3 D;  3A6N A;  5BNV B;  3KXB B;  3UTA C;  1M18 D;  4Z66 B;  3AFA A;  4AWL C;  3AYW A;  3AZL B;  3REH C;  3A6N D;  3AZF A;  5GT0 A;  5B0Y C;  2ZM5 A;  1KX5 D;  5BS7 C;  4LD9 B;  3AYW D;  1A7W A;  3UTA A;  3REH A;  4G92 B;  5B0Y A;  2ZY5 A;  3WA9 C;  5BS7 A;  4DQY B;  3MNN B;  5AVB C;  3KWQ C;  1AOI B;  1P3K B;  3LZ0 D;  3LZ1 D;  3WA9 A;  3WTP C;  1P3P B;  4G91 B;  1P3G C;  2CV5 D;  5B24 D;  5AVB A;  5B1M B;  3REI C;  4H9P B;  2NQB C;  5AVB D;  5BNX A;  3WAA C;  3WTP A;  4H9Q B;  1P3G A;  3AZK A;  3KUY C;  5GT3 C;  3X1S B;  3REI A;  4YS3 B;  4WU8 C;  5AV8 C;  4J8X D;  3B0C W;  3MGR C;  2NQB A;  3AZK D;  3C1C B;  4WZS B;  3WAA A;  2JSS A;  1P3F C;  2JCH A;  4X23 D;  3AZN D;  4WV4 B;  3VH6 W;  3LEL C;  5E5A A;  5AY8 B;  3MGS D;  3FDD A;  4R8P C;  4Z5T C;  1H3O A;  3MGR A;  1ID3 C;  1TZY C;  2RVQ D;  1P3F A;  5E5A D;  2F8N D;  3REJ C;  3LEL A;  1TAF B;  1R4V A;  4R8P A;  4KGC D;  4Z5T A;  1M19 D;  1ID3 A;  1TZY A;  5G49 A;  4CAY A;  5JRG D;  3AZG C;  5DNM D;  3EPK A;  4XUJ C;  1KX3 B;  5BT1 D;  5GXQ B;  3REJ A;  3LZ1 B;  5CPK B;  3IP4 C;  3EPL A;  3AL0 C;  1Q9C A;  2CV5 B;  2HIO A;  4NE6 A;  5B24 B;  3MGQ C;  3AZG A;  3AZH B;  2ZY3 A;  5B32 D;  1N1J B;  5AV6 D;  3B6F C;  2HIO D;  4WU9 C;  2IO5 C;  3UT9 B;  4JJN D;  3MGQ A;  3AZJ C;  4J8V B;  2PYO D;  4J8X B;  3REK C;  3AN2 B;  1F66 B;  1JFI B;  3B6F A;  4WU9 A;  5AV5 C;  4X23 B;  3AZJ A;  2Y2G A;  5B33 C;  3MGS B;  3P5J B;  3REK A;  2ARO A;  2VQR A;  3AV1 C;  5AV5 A;  1U35 D;  2JE5 A;  4H9O A;  3W98 C;  4J8U C;  1BH9 B;  2F8N B;  1ZLA C;  2FJ7 D;  2ARO D;  5B33 A;  2BYK B;  4KGC B;  1M19 B;  2NZD C;  5JRG B;  5JA4 A;  5KDM B;  5DNM B;  3AV1 A;  4UUZ B;  5B1L B;  3W98 A;  2YFW B;  3KXB C;  4ZBJ B;  1P34 B;  3AZL C;  3WTP E;  5BO0 B;  2NZD A;  3O62 D;  3AZM B;  5B32 B;  2L5A A;  5B2J B;  1B67 A;  2DF4 C;  5AV6 B;  1S32 B;  3KXB A;  5GSU A;  3UTB D;  4JJN B;  3AZE D;  3MVD C;  5CP6 B;  1M1A D;  3VH5 A;  5GSU D;  1WWS A;  1PZR A;  5CPI D;  1P3A D;  3MNN C;  1EQZ A;  5AVC D;  5DNN C;  3X1U D;  1HQ3 D;  3X1V D;  3MVD A;  3LJA D;  5B2I D;  1EQZ D;  4G91 C;  1U35 B;  5B1M C;  5DNN A;  5B0Z A;  3REL A;  2FJ7 B;  3B6G C;  3AV2 A;  5B40 A;  5B0Z D;  3REL D;  4KHA B;  1P3O B;  3AV2 D;  4NE5 A;  5B40 D;  3B6G A;  3AFA D;  4EO5 C;  3C1C C;  1P3I C;  1W2E A;  3AZF D;  5GT0 D;  3O62 B;  4DRA A;  3UTA D;  5AY8 C;  3NQU B;  4WNN B;  3UTB B;  2XD5 A;  3C1C A;  3REH D;  3AZE B;  1P3I A;  4CSR B;  3W96 B;  5B0Y D;  1M1A B;  4J8W C;  1F1E A;  5CPI B;  4DRB A;  4H9R B;  1B6W A;  5AVC B;  3X1U B;  3WKJ B;  3KWQ A;  1HQ3 B;  2BG1 A;  1KX3 C;  3X1V B;  3LJA B;  5GXQ C;  4J8W A;  5AV9 C;  2Y2M A;  5B2I B;  5CPK C;  3WA9 D;  4H9S C;  3KWQ D;  3C1B C;  1P3B B;  1P3L C;  3AZH C;  1M18 B;  5AV9 A;  3WTP D;  3EG5 B;  1P3G D;  3TU4 C;  3X1T C;  3UT9 C;  5B31 G;  3REI D;  3A6N B;  3C1B A;  4J8V C;  3KUY A;  5GT3 A;  1P3L A;  1HTA A;  3AZH A;  4WU8 A;  5AV8 A;  1KX5 B;  2NQB D;  3W97 C;  2Y2L A;  3AFA B;  2CWE A;  1N1J A;  3AYW B;  3AN2 C;  1F66 C;  3WAA D;  2UWX A;  3KUY D;  5GT3 D;  5GT0 B;  3TU4 A;  3AZF B;  3X1T A;  5FUG B;  4WU8 D;  5AV8 D;  4J8V A;  3UTA B;  3MGR D;  3W97 A;  3B0D B;  1P3F D;  3REH B;  1KX4 C;  5B0Y B;  2YFV A;  4UPK A;  3LEL D;  3VH5 W;  4H9N A;  3LZ0 B;  3W99 C;  4R8P D;  4Z5T D;  1ID3 D;  1TZY D;  1KX4 A;  3REJ D;  3KSY A;  5B1L C;  4XUJ A;  2RIQ A;  3WA9 B;  3W99 A;  5AVB B;  1P34 C;  3AZG D;  5F99 C;  4XUJ D;  5CPJ C;  2Y2O A;  4QLC C;  5B31 C;  3AZM C;  1P3M C;  1T3U A;  5BNX B;  3WTP B;  5C3I C;  1S32 C;  3AZK B;  3MGQ D;  2Y2H A;  5F99 A;  5BO0 A;  3AZN B;  4YM6 C;  5CPJ A;  5CP6 C;  2HUE B;  4QLC A;  1Z2C B;  3R45 A;  5B31 A;  2NQB B;  3B6F D;  1P3M A;  4WU9 D;  3WAA B;  3H0M C;  3AZJ D;  5E5A B;  4YM6 A;  3REK D;  5CP6 A;  3AZI C;  3H0L C;  1H3O B;  4ZUX C;  3MGR B;  4KUD C;  4XZQ C;  2BYM A;  5AV5 D;  3MGP C;  1P3F B;  2Y2J A;  3KFU G;  5B33 D;  1BH8 A;  3LEL B;  2W8S A;  4J8U A;  3V9R A;  3AZI A;  1ZLA A;  4Z5T B;  4ZUX A;  3NQJ A;  1ID3 B;  1TZY B;  5G49 B;  4CAY B;  4XZQ A;  4KUD A;  4Z66 C;  3AV1 D;  3MGP A;  3A1K A;  4J8U D;  3W98 D;  3REJ B;  1ZLA D;  1P3O C;  2ZY4 A;  4LD9 C;  5BNV A;  2HIO B;  2NZD D;  3AZG B;  4Z66 A;  3A1I A;  3AZL A;  4G92 C;  2PYO B;  3KXB D;  4E44 A;  4Z66 D;  4LD9 A;  3AZL D;  3MGQ B;  2Y2K A;  3W96 C;  3VH6 A;  1AOI C;  1P3K C;  3B6F B;  4WU9 B;  3VH5 T;  1P3P C;  3MNN A;  3AZJ B;  3WKJ C;  3MVD D;  3REK B;  1AOI A;  2ARO B;  1P3K A;  3MNN D;  5AV5 B;  4H9O B;  5DNN D;  1P3P A;  4HGA B;  1P3B C;  5B33 B;  3X1S C;  5B1M A;  4YS3 C;  3EPJ A;  1M18 C;  4H9P A;  5JA4 B;  3AV1 B;  5B1M D;  4H9Q A;  3A6N C;  2G5I C;  3X1S A;  3B6G D;  4YS3 A;  1KX5 C;  3AYW C;  1M18 A;  4M6B A;  2NZD B;  2XD1 A;  2Y2N A;  2G5H C;  5GSU B;  1KX5 A;  5AY8 A;  3B0B A;  3C1C D;  1P3A B;  1P3I D;  2F8N K;  3B0D C;  3F6T A;  2F8N G;  5FUG A;  5AY8 D;  3LZ0 C;  2LY8 A;  3LZ1 C;  1EQZ B;  1TAF A;  2CV5 C;  5B24 C;  3MVD B;  4NE3 A;  4J8W D;  1KX3 A;  3LZ0 A;  5GXQ A;  3LZ1 A;  5CPK A;  5DNN B;  4H9S A;  2FFF B;  5B0Z B;  2CV5 A;  5B24 A;  3REL B;  1KX3 D;  5B32 G;  4Z2M G;  2Y2Q A;  5GXQ D;  5AV9 D;  5CHL B;  3AV2 B;  5CPK D;  4J8X C;  5B40 B;  3AZK C;  3C1B D;  1P3L D;  3UT9 A;  4X23 C;  3AZN C;  3AZH D;  3B6G B;  2HUE C;  3MGS C;  4J8X A;  4AWL B;  3TU4 D;  3X1T D;  4E45 A;  3UT9 D;  3AN2 A;  1F66 A;  1JFI A;  2RVQ C;  4J8V D;  5E5A C;  4X23 A;  3AZN A;  3W97 D;  3AN2 D;  1F66 D;  4EO5 B;  3MGS A;  1P3I B;  4KGC C;  1M19 C;  1BFM A;  5JRG C;  5DNM C;  5BT1 C;  1BH9 A;  2F8N A;  2ZY2 A;  4ZBJ C;  2DQN C;  3KWQ B;  2BYK A;  1KX4 D;  4KGC A;  1M19 A;  5JRG A;  5KDM A;  5DNM A;  4J8W B;  4UUZ A;  3W99 D;  5B1L A;  5B32 C;  5B2J C;  5AV6 C;  2HIO C;  2YFW A;  1P3G B;  4JJN C;  3REI B;  1P34 A;  5B1L D;  1KU5 A;  5AV9 B;  3AZM A;  2PYO C;  2F2A C;  2F8N H;  5B32 A;  5B2J A;  5AV6 A;  1P34 D;  5F99 D;  3C1B B;  1S32 A;  5CPJ D;  3KUY B;  5GT3 B;  1P3L B;  4JJN A;  4QLC D;  5B31 D;  4WU8 B;  5AV8 B;  3AZM D;  1P3M D;  5B2J D;  2PYO A;  1S32 D;  3TU4 B;  3X1T B;  1U35 C;  4YM6 D;  5CP6 D;  1ULY A;  3W97 B;  4NFT A;  2FJ7 C;  2ARO C;  4R8P B;  4Z2M H;  2YFV B;  4H9N B;  1U35 A;  4HGA C;  3AZI D;  4ZUX D;  4KUD D;  4XZQ D;  2FJ7 A;  3MGP D;  1KX4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...