3AN2C

The structure of the centromeric nucleosome containing cenp-a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
b'TRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure of the human centromeric nucleosome containing CENP-A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 23
structure length 97
sequence length 97
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3an2C00
5AVCA 1ID3B 3AFAA 3W96D 3REKB 3WKJC 5GT0B 5CPIC 2HIOC 5G49A 3AYWC 2AROA 2YFVA 4H9OB 3LZ0B 3AZFA 4J8UD 4J8WC 4CSRA 1HQ3A 5AV8D 1KX5C 1KX4C 2NQBD 4ZUXC 1P3GC 3AZJD 3RELC 1P3MB 3AZGA 3X1UA 3LELA 3AZLD 5C3IB 3LJAD 4KGCA 5CPJC 3MNNC 4EO5B 5BNXB 5AV9A 4LD9D 2CV5D 1U35A 5BS7C 3VH5A 1KX3C 5KDMB 4DRBA 4XZQC 3C1CC 4KUDA 3O62B 5AVBB 2IO5B 3LZ0A 1JFIB 1F66C 3UTAB 3UTBC 2F8ND 4YM6C 2HUEC 5B24B 3A6NC 3MVDC 3B6FA 4ZBJC 3MGQD 3W96B 5F99A 4H9PB 1P3BD 1P3IA 1BH9B 3X1TD 5CPIA 4QLCC 1TAFB 4Z5TC 3AYWA 2YFWA 4WZSB 5BT1D 4J8UB 5AV8B 4J8WA 4UUZB 5KDMA 5DNNC 2NQBB 4J8VC 1N1JB 3KXBA 3AZJB 1P3AC 3WA9C 5B1LC 5JRGD 5DNMC 3VH6A 5AVCD 4NE3A 4WU8A 3RELA 3AZLB 3LJAB 1WWIA 5CP6A 1H3OA 3WAAC 5CPJA 3W97C 1P3FC 5FUGA 5B32C 4LD9B 2CV5B 3AZIC 3X1SC 2AROD 4H9PA 3NQJA 1BH9A 5CHLB 4NE5A 5BS7A 5B31C 3AZFD 1KX3A 4XZQA 1HQ3D 5B0YC 3KUYA 1P34C 3C1CA 4J8XC 2BYMA 5GSUC 2NZDC 3MGPA 3B0CT 3AZMC 3AZGD 3X1UD 4X23C 3MGSC 4AWLC 2F8NB 3LELD 5AV5C 3UTBA 3MGQB 5GXQC 1P3BB 3X1TB 5AV9D 1P3OC 3AZKC 4G92C 3AZNC 3AV2A 1U35D 4QLCA 4Z5TA 5JA4A 3AZEC 4LD9A 2FJ7A 3UT9C 4KUDD 2F8NG 3NQUA 1P3LC 4Z2MH 5JRGB 5AVCB 1S32C 3B6FD 5B40C 4G91C 5E5AC 5F99D 1M18C 3AN2A 1P3ID 3MGQA 5CPID 4HGAB 1M1AC 3WAAA 1P3FA 4KHAA 5G49B 4WU9C 5B32A 2AROB 3B6GA 1P3BA 2YFVB 3X1SA 3X1VC 3REIC 3AYWD 3X1TA 3AZFB 4R8PC 3REJC 5B31A 4CSRB 1HQ3B 4J8WD 5B0YA 1P34A 4J8XA 3KXBD 3AZGB 3X1UB 3RELD 3AZMA 4WU8D 4XUJA 3LELB 5AV5A 1TZYA 3R45A 5CP6D 5B2IC 5CPJD 5AV9B 3VH5T 1P3OA 3REHC 1U35B 1ID3C 3REKC 5GT0C 1KX3D 2BYKA 1AOIC 4XZQD 3KUYD 4KUDB 3C1BB 3C1CD 3UT9A 3MGRC 3AZHC 3MGPD 4Z66C 1M19A 3UTBD 3B6FB 1S32A 4YS3A 3B0DC 5B40A 5F99B 5E5AA 2L5AA 4M6BA 1P3IB 5CPIB 3AV2D 1M1AA 4QLCD 4H9SC 4Z5TD 3AYWB 5GT3C 5B1MC 2YFWB 2FJ7D 4R8PA 4J8WB 1KX4B 5DNND 3KXBB 3VH6T 3C1BA 3RELB 4WU8B 1P3AD 2PYOC 3W99C 3KWQA 3O62C 3WA9D 1P3KC 1BH8A 5CP6B 3WTPC 1H3OB 3UTAC 3AN2D 5CPJB 3LZ1C 5B2IA 3WAAD 5B24C 5FUGB 3AV1C 1P3FD 5B32D 3B6GD 3NQJB 3WKJA 3X1SD 3W96C 3REHA 2HIOA 1KX3B 5B31D 4XZQB 3KUYB 1ZLAC 3C1CB 1KU5A 1AOIA 5B0YD 1P34D 2BYMB 3B0CW 4J8XD 3MGPB 3AZHA 3AZMD 4X23D 4XUJD 4H9QA 3UTBB 1KX4A 1KX5A 5AV8C 2HUEB 4ZUXA 5AV5D 1TZYD 1P3GA 4JJNC 1A7WA 3AZLC 3AV2B 1P3OD 3AZKD 4QLCB 4Z5TB 3MNNA 5JA4B 3TU4C 2FJ7B 5GT3A 3AZED 3UT9D 3NQUB 5DNNB 2CWEA 1M19D 1P3AB 3WA9B 2JSSA 1S32D 2PYOA 4YS3D 1F66A 4WNNA 5B40D 5AY8C 5E5AD 1P3PC 3AN2B 4YM6A 2LY8A 3MVDA 3A6NA 3WTPA 3WAAB 1P3FB 4KHAB 1M1AD 3AV1A 5B32B 3B6GB 3X1SB 4H9NB 3W98C 5B31B 5B0ZC 4R8PD 5B0YB 5CPKC 1P34B 1ZLAA 4J8XB 2NZDB 3C1BD 4NFTA 3AZMB 4X23B 5BT1C 4XUJB 3KWQD 4AWLB 5B33C 5DNNA 5B2JC 5AV5B 4J8VA 1TZYB 3R45B 1P3AA 4JJNA 3WA9A 5B1LA 5DNMA 5BO0A 5B2ID 3VH5W 5AVCC 2RVQC 1P3OB 3AZKB 4G92B 3WKJD 3AFAC 3REHD 2HIOD 4WV4B 3W97A 2BYKB 1HTAA 3AZEB 2F8NH 3AZIA 3UT9B 4CAYA 1AOID 4H9NA 3MGRD 3AZHD 3V9RA 1M19B 4Z66D 1KX5D 1KX4D 1EQZC 1S32B 4ZUXD 5GSUA 5AV6C 2NZDA 4YS3B 1P3GD 5B40B 4X23A 3MGSA 5E5AB 3AZGC 3X1UC 5AY8A 1B6WA 1P3PA 3LELC 1M1AB 5GXQA 3MNND 4KGCC 5GT3D 5B1MD 3AZKA 3AZNA 4R8PB 3VH6W 1U35C 3AZEA 3KWQB 4KUDC 2PYOD 3LZ0C 1F66D 1BH8B 5B2JA 1P3LA 1P3KD 4YM6D 3MVDD 3A6ND 3WTPD 5B2IB 1R4VA 3LZ1D 1ULYA 3B6FC 3AV1D 1P3MC 3WKJB 1F1EA 1M18A 3REHB 2HIOB 5F99C 5C3IC 1P3IC 4WU9A 3WTPE 1AOIB 3X1VA 1ZLAD 3REIA 4EO5C 3MGRB 3AZHB 3REJA 4H9RA 4Z66B 4H9QB 1KX5B 2F8NK 4J8VD 4ZUXB 1P3GB 1EQZA 3B0BA 5AV6A 3KXBC 3B0DB 4JJND 5B1LD 5DNMD 5AVBC 4WU8C 2IO5C 3MNNB 3W97D 5CP6C 5GT3B 5B1MB 3TU4D 4DRAA 3AZID 1ID3A 3REKA 5GT0A 3KUYC 3MGRA 5GSUD 2PYOB 3W99B 2NZDD 1F66B 4H9OA 4WNNB 3MGPC 3MGSD 4J8UC 4Z66A 1P3KB 4YM6B 5AY8D 3MVDB 3WTPB 3A6NB 1P3PD 2NQBC 4ZBJB 3LZ1B 5GXQD 3AZJC 3AV1B 1P3MA 3W98D 3AZND 3LJAC 5B0ZD 4H9SA 3AV2C 1ZLAB 5B1MA 5CPKD 4LD9C 2FJ7C 2CV5C 5BNXA 1Q9CA 4J8VB 5B33D 5B2JD 1P3LD 4JJNB 5B1LB 5DNMB 5BO0B 3W99A 3O62A 5AVBA 1P3KA 2RVQD 1JFIA 3UTAA 1M18D 3LZ1A 3AFAD 3W97B 3AN2C 3TU4B 5B24A 3MGQC 4WU9D 3AZIB 4CAYB 3X1VD 3REID 3B6GC 3W96A 1P3BC 3X1TC 3REJD 3V9RB 1TAFA 5GSUB 4NE6A 1EQZD 5AV6D 3MGSB 5BNVB 4J8UA 5AY8B 1P3PB 5AV8A 4XUJC 4UUZA 2NQBA 5GXQB 1N1JA 5B32G 1TZYC 3AZJA 5JRGC 4KGCD 3W98B 3AZNB 5B31G 3AZLA 4Z2MG 5B0ZB 3LJAA 1ID3D 3REKD 3TU4A 5CPKB 5GT0D 4E44A 4HGAC 2AROC 2CV5A 5B33B 1WWSA 3AZFC 5B2JB 1P3LB 3LZ0D 1HQ3C 4E45A 1BFMA 1M19C 4G91B 5BNVA 4YS3C 1P3MD 1M18B 3AFAB 2F8NA 4WU9B 3X1VB 3REIB 3W98A 5AV9C 3REJB 4H9RB 5B0ZA 3KSYA 5CPKA 1EQZB 1B67A 5AV6B 3C1BC 3W99D 5B33A 3O62D 5AVBD 3KWQC 3UTAD 4KGCB 5JRGA 5B24D
chains in the Genus database with same CATH superfamily
5AVCA 1ID3B 3AFAA 3W96D 2JE5A 3REKB 3WKJC 5GT0B 5CPIC 2HIOC 2Y2LA 5G49A 3AYWC 2AROA 2YFVA 4H9OB 3LZ0B 3AZFA 4J8UD 4J8WC 4CSRA 1HQ3A 5AV8D 1KX5C 1KX4C 2NQBD 2W8SA 4ZUXC 2G5HC 1P3GC 3AZJD 3RELC 1P3MB 3AZGA 3X1UA 3LELA 3AZLD 5C3IB 3LJAD 4KGCA 5CPJC 3MNNC 2Y2HA 4EO5B 5BNXB 5AV9A 4LD9D 2CV5D 3EPKA 1U35A 5BS7C 3VH5A 1KX3C 5KDMB 4DRBA 4XZQC 3C1CC 4KUDA 3O62B 5AVBB 2IO5B 3LZ0A 1JFIB 1F66C 2ZY4A 3UTAB 3UTBC 2F8ND 4YM6C 2HUEC 5B24B 3A6NC 3MVDC 3B6FA 4ZBJC 3MGQD 3W96B 5F99A 4H9PB 1P3BD 1P3IA 1BH9B 3X1TD 5CPIA 4QLCC 1TAFB 4Z5TC 2FFFB 3AYWA 2YFWA 4WZSB 5BT1D 4J8UB 5AV8B 4J8WA 4UUZB 5KDMA 5DNNC 2NQBB 4J8VC 1N1JB 3KXBA 3AZJB 1P3AC 3WA9C 5B1LC 5JRGD 5DNMC 3VH6A 5AVCD 4NE3A 4WU8A 3RELA 3AZLB 3LJAB 1WWIA 5CP6A 1H3OA 3WAAC 5CPJA 3W97C 1P3FC 5FUGA 5B32C 4LD9B 2CV5B 3AZIC 3X1SC 2AROD 4H9PA 3NQJA 1BH9A 5CHLB 4NE5A 5BS7A 5B31C 3AZFD 1KX3A 4XZQA 1HQ3D 5B0YC 3KUYA 1P34C 3C1CA 4J8XC 2BYMA 5GSUC 2NZDC 3MGPA 3B0CT 3AZMC 3AZGD 3X1UD 4X23C 3MGSC 4AWLC 2F8NB 3LELD 5AV5C 3UTBA 3MGQB 5GXQC 1P3BB 3X1TB 5AV9D 1P3OC 3AZKC 4G92C 3AZNC 3AV2A 1U35D 4QLCA 4Z5TA 5JA4A 3AZEC 4LD9A 2FJ7A 3UT9C 4KUDD 2F8NG 3NQUA 1P3LC 4Z2MH 5JRGB 5AVCB 1S32C 3B6FD 5B40C 4G91C 5E5AC 2Y2PA 5F99D 1M18C 3AN2A 1P3ID 3MGQA 5CPID 4HGAB 1M1AC 3WAAA 1P3FA 4KHAA 5G49B 4WU9C 5B32A 2AROB 3B6GA 1P3BA 2YFVB 3X1SA 3X1VC 3REIC 3AYWD 3X1TA 3AZFB 4R8PC 3REJC 5B31A 4CSRB 1HQ3B 4J8WD 5B0YA 1P34A 4J8XA 3KXBD 2G5IC 3AZGB 3X1UB 3RELD 3AZMA 4WU8D 4XUJA 3LELB 5AV5A 1TZYA 3R45A 5CP6D 5B2IC 5CPJD 1W2EA 5AV9B 3VH5T 1P3OA 3REHC 1U35B 1ID3C 3REKC 5GT0C 1KX3D 2BYKA 1PZRA 4XZQD 3KUYD 1AOIC 4KUDB 3C1BB 3C1CD 3UT9A 2XD5A 3MGRC 3AZHC 3FDDA 3MGPD 4Z66C 2JCHA 1M19A 3UTBD 3B6FB 1S32A 3A1KA 4YS3A 3B0DC 5B40A 5F99B 5E5AA 2L5AA 4M6BA 1P3IB 5CPIB 3AV2D 1M1AA 4QLCD 4H9SC 4Z5TD 3AYWB 5GT3C 5B1MC 2YFWB 2FJ7D 1T3UA 4R8PA 4J8WB 2ZY3A 1KX4B 5DNND 3KXBB 3VH6T 3C1BA 3RELB 4WU8B 2Y2IA 1P3AD 2PYOC 3W99C 3KWQA 3O62C 3WA9D 1P3KC 1BH8A 5CP6B 3WTPC 1H3OB 3UTAC 3AN2D 5CPJB 3LZ1C 5B2IA 3WAAD 5B24C 5FUGB 3AV1C 1P3FD 5B32D 3B6GD 3NQJB 3WKJA 3X1SD 3W96C 3REHA 2HIOA 1KX3B 5B31D 4XZQB 3KUYB 1ZLAC 3C1CB 1KU5A 1AOIA 5B0YD 1P34D 2BYMB 3B0CW 4J8XD 2RIQA 3MGPB 3AZHA 3AZMD 4X23D 4XUJD 4H9QA 3UTBB 1KX4A 1KX5A 5AV8C 2HUEB 4ZUXA 5AV5D 1TZYD 1P3GA 4JJNC 1A7WA 3AZLC 3AV2B 1P3OD 3AZKD 4QLCB 2DQNC 4Z5TB 3MNNA 5JA4B 3TU4C 2FJ7B 5GT3A 3AZED 3UT9D 3NQUB 5DNNB 2CWEA 1M19D 1P3AB 3WA9B 2JSSA 1S32D 2PYOA 4YS3D 3EG5B 1F66A 4WNNA 5B40D 5AY8C 5E5AD 1P3PC 3AN2B 4YM6A 2LY8A 3MVDA 3A6NA 3WTPA 3WAAB 1P3FB 4KHAB 1M1AD 3AV1A 5B32B 3B6GB 3X1SB 4H9NB 3W98C 5B31B 5B0ZC 4R8PD 5B0YB 1Z2CB 5CPKC 1P34B 1ZLAA 4J8XB 2NZDB 3C1BD 4NFTA 3AZMB 4X23B 5BT1C 4XUJB 3KWQD 4AWLB 5B33C 5DNNA 5B2JC 5AV5B 4J8VA 1TZYB 3R45B 1P3AA 4JJNA 3WA9A 5B1LA 5DNMA 2Y2JA 5BO0A 5B2ID 3VH5W 5AVCC 2RVQC 1P3OB 3AZKB 4G92B 3WKJD 3AFAC 2ZM5A 2Y2NA 3REHD 2HIOD 4WV4B 3W97A 2BYKB 1HTAA 3AZEB 2F8NH 3AZIA 3UT9B 4CAYA 1AOID 4H9NA 3MGRD 3AZHD 3V9RA 1M19B 4Z66D 1KX5D 1KX4D 1EQZC 1S32B 4ZUXD 5GSUA 5AV6C 2NZDA 4YS3B 1P3GD 5B40B 4X23A 3MGSA 5E5AB 3AZGC 3X1UC 5AY8A 1B6WA 1P3PA 3LELC 1M1AB 2Y2MA 5GXQA 3MNND 3F6TA 4KGCC 5GT3D 5B1MD 3AZKA 4UPKA 4R8PB 3AZNA 3VH6W 1U35C 3AZEA 2F2AC 3KWQB 4KUDC 2PYOD 3LZ0C 1F66D 1BH8B 5B2JA 1P3LA 1P3KD 4YM6D 3MVDD 3A6ND 3WTPD 5B2IB 1R4VA 2Y2OA 3LZ1D 1ULYA 3B6FC 3AV1D 1P3MC 3WKJB 1F1EA 1M18A 3REHB 2HIOB 5F99C 5C3IC 1P3IC 4WU9A 3WTPE 1AOIB 3X1VA 1ZLAD 3REIA 4EO5C 3MGRB 3AZHB 3REJA 3IP4C 4H9RA 3AL0C 4Z66B 4H9QB 1KX5B 2F8NK 4J8VD 4ZUXB 1P3GB 1EQZA 3B0BA 5AV6A 3KXBC 3B0DB 4JJND 5B1LD 5DNMD 5AVBC 4WJ3C 4WU8C 2IO5C 3MNNB 3W97D 2XD1A 5CP6C 5GT3B 5B1MB 3TU4D 4DRAA 3AZID 1ID3A 3REKA 5GT0A 3KUYC 3MGRA 5GSUD 2PYOB 3W99B 2NZDD 1F66B 4H9OA 4WNNB 3MGPC 3MGSD 4J8UC 4Z66A 4DQYB 1P3KB 4YM6B 5AY8D 3MVDB 3WTPB 3A6NB 1P3PD 3P5JB 4ZBJB 3LZ1B 2NQBC 5GXQD 3AZJC 3AV1B 1P3MA 2UWXA 3W98D 3AZND 3LJAC 3H0MC 5B0ZD 4H9SA 3AV2C 1ZLAB 5B1MA 5CPKD 4LD9C 2FJ7C 2CV5C 5BNXA 1Q9CA 4J8VB 3H0RC 5B33D 5B2JD 1P3LD 2Y2KA 4JJNB 5B1LB 5DNMB 5BO0B 3W99A 3O62A 5AVBA 1P3KA 2RVQD 2Y2QA 1JFIA 3UTAA 1M18D 3LZ1A 3AFAD 3W97B 3AN2C 3TU4B 5B24A 3MGQC 4WU9D 2BG1A 2J8PA 2ZY2A 3AZIB 4CAYB 3X1VD 2DF4C 3REID 3B6GC 3W96A 1P3BC 3X1TC 3REJD 3KFUG 3V9RB 1TAFA 5GSUB 4NE6A 1EQZD 5AV6D 3MGSB 5BNVB 4J8UA 5AY8B 1P3PB 5AV8A 4XUJC 4UUZA 2NQBA 5GXQB 1N1JA 5B32G 1TZYC 3AZJA 5JRGC 4KGCD 3W98B 3AZNB 5B31G 3AZLA 4Z2MG 3A1IA 5B0ZB 3LJAA 1ID3D 3REKD 3TU4A 5CPKB 5GT0D 4E44A 4HGAC 2AROC 2CV5A 5B33B 1WWSA 3AZFC 5B2JB 1P3LB 3LZ0D 1HQ3C 4E45A 1BFMA 1M19C 4G91B 5BNVA 3EPJA 4YS3C 3H0LC 1P3MD 1M18B 3AFAB 2F8NA 4WU9B 2Y2GA 3X1VB 3REIB 3W98A 5AV9C 3REJB 4H9RB 5B0ZA 3EPLA 3KSYA 5CPKA 1EQZB 1B67A 5AV6B 2VQRA 3C1BC 3W99D 5B33A 3O62D 5AVBD 2ZY5A 3KWQC 3EPHA 3UTAD 4KGCB 5JRGA 5B24D
chains in the Genus database with same CATH topology
5AVCA 1ID3B 3AFAA 3W96D 2JE5A 3REKB 3WKJC 5GT0B 5CPIC 2HIOC 2Y2LA 5G49A 3AYWC 2AROA 2YFVA 4H9OB 3LZ0B 3AZFA 4J8UD 4J8WC 4CSRA 1HQ3A 5AV8D 1KX5C 1KX4C 2NQBD 2W8SA 4ZUXC 2G5HC 1P3GC 3AZJD 3RELC 1P3MB 3AZGA 3X1UA 3LELA 3AZLD 5C3IB 3LJAD 4KGCA 5CPJC 3MNNC 2Y2HA 4EO5B 5BNXB 5AV9A 4LD9D 2CV5D 3EPKA 1U35A 5BS7C 3VH5A 1KX3C 5KDMB 4DRBA 4XZQC 3C1CC 4KUDA 3O62B 5AVBB 2IO5B 3LZ0A 1JFIB 1F66C 2ZY4A 3UTAB 3UTBC 2F8ND 4YM6C 2HUEC 5B24B 3A6NC 3MVDC 3B6FA 4ZBJC 3MGQD 3W96B 5F99A 4H9PB 1P3BD 1P3IA 1BH9B 3X1TD 5CPIA 4QLCC 1TAFB 4Z5TC 2FFFB 3AYWA 2YFWA 4WZSB 5BT1D 4J8UB 5AV8B 4J8WA 4UUZB 5KDMA 5DNNC 2NQBB 4J8VC 1N1JB 3KXBA 3AZJB 1P3AC 3WA9C 5B1LC 5JRGD 5DNMC 3VH6A 5AVCD 4NE3A 4WU8A 3RELA 3AZLB 3LJAB 1WWIA 5CP6A 1H3OA 3WAAC 5CPJA 3W97C 1P3FC 5FUGA 5B32C 4LD9B 2CV5B 3AZIC 3X1SC 2AROD 4H9PA 3NQJA 1BH9A 5CHLB 4NE5A 5BS7A 5B31C 3AZFD 1KX3A 4XZQA 1HQ3D 5B0YC 3KUYA 1P34C 3C1CA 4J8XC 2BYMA 5GSUC 2NZDC 3MGPA 3B0CT 3AZMC 3AZGD 3X1UD 4X23C 3MGSC 4AWLC 2F8NB 3LELD 5AV5C 3UTBA 3MGQB 5GXQC 1P3BB 3X1TB 5AV9D 1P3OC 3AZKC 4G92C 3AZNC 3AV2A 1U35D 4QLCA 4Z5TA 5JA4A 3AZEC 4LD9A 2FJ7A 3UT9C 4KUDD 2F8NG 3NQUA 1P3LC 4Z2MH 5JRGB 5AVCB 1S32C 3B6FD 5B40C 4G91C 5E5AC 2Y2PA 5F99D 1M18C 3AN2A 1P3ID 3MGQA 5CPID 4HGAB 1M1AC 3WAAA 1P3FA 4KHAA 5G49B 4WU9C 5B32A 2AROB 3B6GA 1P3BA 2YFVB 3X1SA 3X1VC 3REIC 3AYWD 3X1TA 3AZFB 4R8PC 3REJC 5B31A 4CSRB 1HQ3B 4J8WD 5B0YA 1P34A 4J8XA 3KXBD 2G5IC 3AZGB 3X1UB 3RELD 3AZMA 4WU8D 4XUJA 3LELB 5AV5A 1TZYA 3R45A 5CP6D 5B2IC 5CPJD 1W2EA 5AV9B 3VH5T 1P3OA 3REHC 1U35B 1ID3C 3REKC 5GT0C 1KX3D 2BYKA 1PZRA 4XZQD 3KUYD 1AOIC 4KUDB 3C1BB 3C1CD 3UT9A 2XD5A 3MGRC 3AZHC 3FDDA 3MGPD 4Z66C 2JCHA 1M19A 3UTBD 3B6FB 1S32A 3A1KA 4YS3A 3B0DC 5B40A 5F99B 5E5AA 2L5AA 4M6BA 1P3IB 5CPIB 3AV2D 1M1AA 4QLCD 4H9SC 4Z5TD 3AYWB 5GT3C 5B1MC 2YFWB 2FJ7D 1T3UA 4R8PA 4J8WB 2ZY3A 1KX4B 5DNND 3KXBB 3VH6T 3C1BA 3RELB 4WU8B 2Y2IA 1P3AD 2PYOC 3W99C 3KWQA 3O62C 3WA9D 1P3KC 1BH8A 5CP6B 3WTPC 1H3OB 3UTAC 3AN2D 5CPJB 3LZ1C 5B2IA 3WAAD 5B24C 5FUGB 3AV1C 1P3FD 5B32D 3B6GD 3NQJB 3WKJA 3X1SD 3W96C 3REHA 2HIOA 1KX3B 5B31D 4XZQB 3KUYB 1ZLAC 3C1CB 1KU5A 1AOIA 5B0YD 1P34D 2BYMB 3B0CW 4J8XD 2RIQA 3MGPB 3AZHA 3AZMD 4X23D 4XUJD 4H9QA 3UTBB 1KX4A 1KX5A 5AV8C 2HUEB 4ZUXA 5AV5D 1TZYD 1P3GA 4JJNC 1A7WA 3AZLC 3AV2B 1P3OD 3AZKD 4QLCB 2DQNC 4Z5TB 3MNNA 5JA4B 3TU4C 2FJ7B 5GT3A 3AZED 3UT9D 3NQUB 5DNNB 2CWEA 1M19D 1P3AB 3WA9B 2JSSA 1S32D 2PYOA 4YS3D 3EG5B 1F66A 4WNNA 5B40D 5AY8C 5E5AD 1P3PC 3AN2B 4YM6A 2LY8A 3MVDA 3A6NA 3WTPA 3WAAB 1P3FB 4KHAB 1M1AD 3AV1A 5B32B 3B6GB 3X1SB 4H9NB 3W98C 5B31B 5B0ZC 4R8PD 5B0YB 1Z2CB 5CPKC 1P34B 1ZLAA 4J8XB 2NZDB 3C1BD 4NFTA 3AZMB 4X23B 5BT1C 4XUJB 3KWQD 4AWLB 5B33C 5DNNA 5B2JC 5AV5B 4J8VA 1TZYB 3R45B 1P3AA 4JJNA 3WA9A 5B1LA 5DNMA 2Y2JA 5BO0A 5B2ID 3VH5W 5AVCC 2RVQC 1P3OB 3AZKB 4G92B 3WKJD 3AFAC 2ZM5A 2Y2NA 3REHD 2HIOD 4WV4B 3W97A 2BYKB 1HTAA 3AZEB 2F8NH 3AZIA 3UT9B 4CAYA 1AOID 4H9NA 3MGRD 3AZHD 3V9RA 1M19B 4Z66D 1KX5D 1KX4D 1EQZC 1S32B 4ZUXD 5GSUA 5AV6C 2NZDA 4YS3B 1P3GD 5B40B 4X23A 3MGSA 5E5AB 3AZGC 3X1UC 5AY8A 1B6WA 1P3PA 3LELC 1M1AB 2Y2MA 5GXQA 3MNND 3F6TA 4KGCC 5GT3D 5B1MD 3AZKA 4UPKA 4R8PB 3AZNA 3VH6W 1U35C 3AZEA 2F2AC 3KWQB 4KUDC 2PYOD 3LZ0C 1F66D 1BH8B 5B2JA 1P3LA 1P3KD 4YM6D 3MVDD 3A6ND 3WTPD 5B2IB 1R4VA 2Y2OA 3LZ1D 1ULYA 3B6FC 3AV1D 1P3MC 3WKJB 1F1EA 1M18A 3REHB 2HIOB 5F99C 5C3IC 1P3IC 4WU9A 3WTPE 1AOIB 3X1VA 1ZLAD 3REIA 4EO5C 3MGRB 3AZHB 3REJA 3IP4C 4H9RA 3AL0C 4Z66B 4H9QB 1KX5B 2F8NK 4J8VD 4ZUXB 1P3GB 1EQZA 3B0BA 5AV6A 3KXBC 3B0DB 4JJND 5B1LD 5DNMD 5AVBC 4WJ3C 4WU8C 2IO5C 3MNNB 3W97D 2XD1A 5CP6C 5GT3B 5B1MB 3TU4D 4DRAA 3AZID 1ID3A 3REKA 5GT0A 3KUYC 3MGRA 5GSUD 2PYOB 3W99B 2NZDD 1F66B 4H9OA 4WNNB 3MGPC 3MGSD 4J8UC 4Z66A 4DQYB 1P3KB 4YM6B 5AY8D 3MVDB 3WTPB 3A6NB 1P3PD 3P5JB 4ZBJB 3LZ1B 2NQBC 5GXQD 3AZJC 3AV1B 1P3MA 2UWXA 3W98D 3AZND 3LJAC 3H0MC 5B0ZD 4H9SA 3AV2C 1ZLAB 5B1MA 5CPKD 4LD9C 2FJ7C 2CV5C 5BNXA 1Q9CA 4J8VB 3H0RC 5B33D 5B2JD 1P3LD 2Y2KA 4JJNB 5B1LB 5DNMB 5BO0B 3W99A 3O62A 5AVBA 1P3KA 2RVQD 2Y2QA 1JFIA 3UTAA 1M18D 3LZ1A 3AFAD 3W97B 3AN2C 3TU4B 5B24A 3MGQC 4WU9D 2BG1A 2J8PA 2ZY2A 3AZIB 4CAYB 3X1VD 2DF4C 3REID 3B6GC 3W96A 1P3BC 3X1TC 3REJD 3KFUG 3V9RB 1TAFA 5GSUB 4NE6A 1EQZD 5AV6D 3MGSB 5BNVB 4J8UA 5AY8B 1P3PB 5AV8A 4XUJC 4UUZA 2NQBA 5GXQB 1N1JA 5B32G 1TZYC 3AZJA 5JRGC 4KGCD 3W98B 3AZNB 5B31G 3AZLA 4Z2MG 3A1IA 5B0ZB 3LJAA 1ID3D 3REKD 3TU4A 5CPKB 5GT0D 4E44A 4HGAC 2AROC 2CV5A 5B33B 1WWSA 3AZFC 5B2JB 1P3LB 3LZ0D 1HQ3C 4E45A 1BFMA 1M19C 4G91B 5BNVA 3EPJA 4YS3C 3H0LC 1P3MD 1M18B 3AFAB 2F8NA 4WU9B 2Y2GA 3X1VB 3REIB 3W98A 5AV9C 3REJB 4H9RB 5B0ZA 3EPLA 3KSYA 5CPKA 1EQZB 1B67A 5AV6B 2VQRA 3C1BC 3W99D 5B33A 3O62D 5AVBD 2ZY5A 3KWQC 3EPHA 3UTAD 4KGCB 5JRGA 5B24D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVC A;  1ID3 B;  3AFA A;  3W96 D;  3REK B;  3WKJ C;  5GT0 B;  5CPI C;  2HIO C;  5G49 A;  3AYW C;  2ARO A;  2YFV A;  4H9O B;  3LZ0 B;  3AZF A;  4J8U D;  4J8W C;  4CSR A;  1HQ3 A;  5AV8 D;  1KX5 C;  1KX4 C;  2NQB D;  4ZUX C;  1P3G C;  3AZJ D;  3REL C;  1P3M B;  3AZG A;  3X1U A;  3LEL A;  3AZL D;  5C3I B;  3LJA D;  4KGC A;  5CPJ C;  3MNN C;  4EO5 B;  5BNX B;  5AV9 A;  4LD9 D;  2CV5 D;  1U35 A;  5BS7 C;  3VH5 A;  1KX3 C;  5KDM B;  4DRB A;  4XZQ C;  3C1C C;  4KUD A;  3O62 B;  5AVB B;  2IO5 B;  3LZ0 A;  1JFI B;  1F66 C;  3UTA B;  3UTB C;  2F8N D;  4YM6 C;  2HUE C;  5B24 B;  3A6N C;  3MVD C;  3B6F A;  4ZBJ C;  3MGQ D;  3W96 B;  5F99 A;  4H9P B;  1P3B D;  1P3I A;  1BH9 B;  3X1T D;  5CPI A;  4QLC C;  1TAF B;  4Z5T C;  3AYW A;  2YFW A;  4WZS B;  5BT1 D;  4J8U B;  5AV8 B;  4J8W A;  4UUZ B;  5KDM A;  5DNN C;  2NQB B;  4J8V C;  1N1J B;  3KXB A;  3AZJ B;  1P3A C;  3WA9 C;  5B1L C;  5JRG D;  5DNM C;  3VH6 A;  5AVC D;  4NE3 A;  4WU8 A;  3REL A;  3AZL B;  3LJA B;  1WWI A;  5CP6 A;  1H3O A;  3WAA C;  5CPJ A;  3W97 C;  1P3F C;  5FUG A;  5B32 C;  4LD9 B;  2CV5 B;  3AZI C;  3X1S C;  2ARO D;  4H9P A;  3NQJ A;  1BH9 A;  5CHL B;  4NE5 A;  5BS7 A;  5B31 C;  3AZF D;  1KX3 A;  4XZQ A;  1HQ3 D;  5B0Y C;  3KUY A;  1P34 C;  3C1C A;  4J8X C;  2BYM A;  5GSU C;  2NZD C;  3MGP A;  3B0C T;  3AZM C;  3AZG D;  3X1U D;  4X23 C;  3MGS C;  4AWL C;  2F8N B;  3LEL D;  5AV5 C;  3UTB A;  3MGQ B;  5GXQ C;  1P3B B;  3X1T B;  5AV9 D;  1P3O C;  3AZK C;  4G92 C;  3AZN C;  3AV2 A;  1U35 D;  4QLC A;  4Z5T A;  5JA4 A;  3AZE C;  4LD9 A;  2FJ7 A;  3UT9 C;  4KUD D;  2F8N G;  3NQU A;  1P3L C;  4Z2M H;  5JRG B;  5AVC B;  1S32 C;  3B6F D;  5B40 C;  4G91 C;  5E5A C;  5F99 D;  1M18 C;  3AN2 A;  1P3I D;  3MGQ A;  5CPI D;  4HGA B;  1M1A C;  3WAA A;  1P3F A;  4KHA A;  5G49 B;  4WU9 C;  5B32 A;  2ARO B;  3B6G A;  1P3B A;  2YFV B;  3X1S A;  3X1V C;  3REI C;  3AYW D;  3X1T A;  3AZF B;  4R8P C;  3REJ C;  5B31 A;  4CSR B;  1HQ3 B;  4J8W D;  5B0Y A;  1P34 A;  4J8X A;  3KXB D;  3AZG B;  3X1U B;  3REL D;  3AZM A;  4WU8 D;  4XUJ A;  3LEL B;  5AV5 A;  1TZY A;  3R45 A;  5CP6 D;  5B2I C;  5CPJ D;  5AV9 B;  3VH5 T;  1P3O A;  3REH C;  1U35 B;  1ID3 C;  3REK C;  5GT0 C;  1KX3 D;  2BYK A;  1AOI C;  4XZQ D;  3KUY D;  4KUD B;  3C1B B;  3C1C D;  3UT9 A;  3MGR C;  3AZH C;  3MGP D;  4Z66 C;  1M19 A;  3UTB D;  3B6F B;  1S32 A;  4YS3 A;  3B0D C;  5B40 A;  5F99 B;  5E5A A;  2L5A A;  4M6B A;  1P3I B;  5CPI B;  3AV2 D;  1M1A A;  4QLC D;  4H9S C;  4Z5T D;  3AYW B;  5GT3 C;  5B1M C;  2YFW B;  2FJ7 D;  4R8P A;  4J8W B;  1KX4 B;  5DNN D;  3KXB B;  3VH6 T;  3C1B A;  3REL B;  4WU8 B;  1P3A D;  2PYO C;  3W99 C;  3KWQ A;  3O62 C;  3WA9 D;  1P3K C;  1BH8 A;  5CP6 B;  3WTP C;  1H3O B;  3UTA C;  3AN2 D;  5CPJ B;  3LZ1 C;  5B2I A;  3WAA D;  5B24 C;  5FUG B;  3AV1 C;  1P3F D;  5B32 D;  3B6G D;  3NQJ B;  3WKJ A;  3X1S D;  3W96 C;  3REH A;  2HIO A;  1KX3 B;  5B31 D;  4XZQ B;  3KUY B;  1ZLA C;  3C1C B;  1KU5 A;  1AOI A;  5B0Y D;  1P34 D;  2BYM B;  3B0C W;  4J8X D;  3MGP B;  3AZH A;  3AZM D;  4X23 D;  4XUJ D;  4H9Q A;  3UTB B;  1KX4 A;  1KX5 A;  5AV8 C;  2HUE B;  4ZUX A;  5AV5 D;  1TZY D;  1P3G A;  4JJN C;  1A7W A;  3AZL C;  3AV2 B;  1P3O D;  3AZK D;  4QLC B;  4Z5T B;  3MNN A;  5JA4 B;  3TU4 C;  2FJ7 B;  5GT3 A;  3AZE D;  3UT9 D;  3NQU B;  5DNN B;  2CWE A;  1M19 D;  1P3A B;  3WA9 B;  2JSS A;  1S32 D;  2PYO A;  4YS3 D;  1F66 A;  4WNN A;  5B40 D;  5AY8 C;  5E5A D;  1P3P C;  3AN2 B;  4YM6 A;  2LY8 A;  3MVD A;  3A6N A;  3WTP A;  3WAA B;  1P3F B;  4KHA B;  1M1A D;  3AV1 A;  5B32 B;  3B6G B;  3X1S B;  4H9N B;  3W98 C;  5B31 B;  5B0Z C;  4R8P D;  5B0Y B;  5CPK C;  1P34 B;  1ZLA A;  4J8X B;  2NZD B;  3C1B D;  4NFT A;  3AZM B;  4X23 B;  5BT1 C;  4XUJ B;  3KWQ D;  4AWL B;  5B33 C;  5DNN A;  5B2J C;  5AV5 B;  4J8V A;  1TZY B;  3R45 B;  1P3A A;  4JJN A;  3WA9 A;  5B1L A;  5DNM A;  5BO0 A;  5B2I D;  3VH5 W;  5AVC C;  2RVQ C;  1P3O B;  3AZK B;  4G92 B;  3WKJ D;  3AFA C;  3REH D;  2HIO D;  4WV4 B;  3W97 A;  2BYK B;  1HTA A;  3AZE B;  2F8N H;  3AZI A;  3UT9 B;  4CAY A;  1AOI D;  4H9N A;  3MGR D;  3AZH D;  3V9R A;  1M19 B;  4Z66 D;  1KX5 D;  1KX4 D;  1EQZ C;  1S32 B;  4ZUX D;  5GSU A;  5AV6 C;  2NZD A;  4YS3 B;  1P3G D;  5B40 B;  4X23 A;  3MGS A;  5E5A B;  3AZG C;  3X1U C;  5AY8 A;  1B6W A;  1P3P A;  3LEL C;  1M1A B;  5GXQ A;  3MNN D;  4KGC C;  5GT3 D;  5B1M D;  3AZK A;  3AZN A;  4R8P B;  3VH6 W;  1U35 C;  3AZE A;  3KWQ B;  4KUD C;  2PYO D;  3LZ0 C;  1F66 D;  1BH8 B;  5B2J A;  1P3L A;  1P3K D;  4YM6 D;  3MVD D;  3A6N D;  3WTP D;  5B2I B;  1R4V A;  3LZ1 D;  1ULY A;  3B6F C;  3AV1 D;  1P3M C;  3WKJ B;  1F1E A;  1M18 A;  3REH B;  2HIO B;  5F99 C;  5C3I C;  1P3I C;  4WU9 A;  3WTP E;  1AOI B;  3X1V A;  1ZLA D;  3REI A;  4EO5 C;  3MGR B;  3AZH B;  3REJ A;  4H9R A;  4Z66 B;  4H9Q B;  1KX5 B;  2F8N K;  4J8V D;  4ZUX B;  1P3G B;  1EQZ A;  3B0B A;  5AV6 A;  3KXB C;  3B0D B;  4JJN D;  5B1L D;  5DNM D;  5AVB C;  4WU8 C;  2IO5 C;  3MNN B;  3W97 D;  5CP6 C;  5GT3 B;  5B1M B;  3TU4 D;  4DRA A;  3AZI D;  1ID3 A;  3REK A;  5GT0 A;  3KUY C;  3MGR A;  5GSU D;  2PYO B;  3W99 B;  2NZD D;  1F66 B;  4H9O A;  4WNN B;  3MGP C;  3MGS D;  4J8U C;  4Z66 A;  1P3K B;  4YM6 B;  5AY8 D;  3MVD B;  3WTP B;  3A6N B;  1P3P D;  2NQB C;  4ZBJ B;  3LZ1 B;  5GXQ D;  3AZJ C;  3AV1 B;  1P3M A;  3W98 D;  3AZN D;  3LJA C;  5B0Z D;  4H9S A;  3AV2 C;  1ZLA B;  5B1M A;  5CPK D;  4LD9 C;  2FJ7 C;  2CV5 C;  5BNX A;  1Q9C A;  4J8V B;  5B33 D;  5B2J D;  1P3L D;  4JJN B;  5B1L B;  5DNM B;  5BO0 B;  3W99 A;  3O62 A;  5AVB A;  1P3K A;  2RVQ D;  1JFI A;  3UTA A;  1M18 D;  3LZ1 A;  3AFA D;  3W97 B;  3AN2 C;  3TU4 B;  5B24 A;  3MGQ C;  4WU9 D;  3AZI B;  4CAY B;  3X1V D;  3REI D;  3B6G C;  3W96 A;  1P3B C;  3X1T C;  3REJ D;  3V9R B;  1TAF A;  5GSU B;  4NE6 A;  1EQZ D;  5AV6 D;  3MGS B;  5BNV B;  4J8U A;  5AY8 B;  1P3P B;  5AV8 A;  4XUJ C;  4UUZ A;  2NQB A;  5GXQ B;  1N1J A;  5B32 G;  1TZY C;  3AZJ A;  5JRG C;  4KGC D;  3W98 B;  3AZN B;  5B31 G;  3AZL A;  4Z2M G;  5B0Z B;  3LJA A;  1ID3 D;  3REK D;  3TU4 A;  5CPK B;  5GT0 D;  4E44 A;  4HGA C;  2ARO C;  2CV5 A;  5B33 B;  1WWS A;  3AZF C;  5B2J B;  1P3L B;  3LZ0 D;  1HQ3 C;  4E45 A;  1BFM A;  1M19 C;  4G91 B;  5BNV A;  4YS3 C;  1P3M D;  1M18 B;  3AFA B;  2F8N A;  4WU9 B;  3X1V B;  3REI B;  3W98 A;  5AV9 C;  3REJ B;  4H9R B;  5B0Z A;  3KSY A;  5CPK A;  1EQZ B;  1B67 A;  5AV6 B;  3C1B C;  3W99 D;  5B33 A;  3O62 D;  5AVB D;  3KWQ C;  3UTA D;  4KGC B;  5JRG A;  5B24 D; 
#chains in the Genus database with same CATH topology
 5AVC A;  1ID3 B;  3AFA A;  3W96 D;  2JE5 A;  3REK B;  3WKJ C;  5GT0 B;  5CPI C;  2HIO C;  2Y2L A;  5G49 A;  3AYW C;  2ARO A;  2YFV A;  4H9O B;  3LZ0 B;  3AZF A;  4J8U D;  4J8W C;  4CSR A;  1HQ3 A;  5AV8 D;  1KX5 C;  1KX4 C;  2NQB D;  2W8S A;  4ZUX C;  2G5H C;  1P3G C;  3AZJ D;  3REL C;  1P3M B;  3AZG A;  3X1U A;  3LEL A;  3AZL D;  5C3I B;  3LJA D;  4KGC A;  5CPJ C;  3MNN C;  2Y2H A;  4EO5 B;  5BNX B;  5AV9 A;  4LD9 D;  2CV5 D;  3EPK A;  1U35 A;  5BS7 C;  3VH5 A;  1KX3 C;  5KDM B;  4DRB A;  4XZQ C;  3C1C C;  4KUD A;  3O62 B;  5AVB B;  2IO5 B;  3LZ0 A;  1JFI B;  1F66 C;  2ZY4 A;  3UTA B;  3UTB C;  2F8N D;  4YM6 C;  2HUE C;  5B24 B;  3A6N C;  3MVD C;  3B6F A;  4ZBJ C;  3MGQ D;  3W96 B;  5F99 A;  4H9P B;  1P3B D;  1P3I A;  1BH9 B;  3X1T D;  5CPI A;  4QLC C;  1TAF B;  4Z5T C;  2FFF B;  3AYW A;  2YFW A;  4WZS B;  5BT1 D;  4J8U B;  5AV8 B;  4J8W A;  4UUZ B;  5KDM A;  5DNN C;  2NQB B;  4J8V C;  1N1J B;  3KXB A;  3AZJ B;  1P3A C;  3WA9 C;  5B1L C;  5JRG D;  5DNM C;  3VH6 A;  5AVC D;  4NE3 A;  4WU8 A;  3REL A;  3AZL B;  3LJA B;  1WWI A;  5CP6 A;  1H3O A;  3WAA C;  5CPJ A;  3W97 C;  1P3F C;  5FUG A;  5B32 C;  4LD9 B;  2CV5 B;  3AZI C;  3X1S C;  2ARO D;  4H9P A;  3NQJ A;  1BH9 A;  5CHL B;  4NE5 A;  5BS7 A;  5B31 C;  3AZF D;  1KX3 A;  4XZQ A;  1HQ3 D;  5B0Y C;  3KUY A;  1P34 C;  3C1C A;  4J8X C;  2BYM A;  5GSU C;  2NZD C;  3MGP A;  3B0C T;  3AZM C;  3AZG D;  3X1U D;  4X23 C;  3MGS C;  4AWL C;  2F8N B;  3LEL D;  5AV5 C;  3UTB A;  3MGQ B;  5GXQ C;  1P3B B;  3X1T B;  5AV9 D;  1P3O C;  3AZK C;  4G92 C;  3AZN C;  3AV2 A;  1U35 D;  4QLC A;  4Z5T A;  5JA4 A;  3AZE C;  4LD9 A;  2FJ7 A;  3UT9 C;  4KUD D;  2F8N G;  3NQU A;  1P3L C;  4Z2M H;  5JRG B;  5AVC B;  1S32 C;  3B6F D;  5B40 C;  4G91 C;  5E5A C;  2Y2P A;  5F99 D;  1M18 C;  3AN2 A;  1P3I D;  3MGQ A;  5CPI D;  4HGA B;  1M1A C;  3WAA A;  1P3F A;  4KHA A;  5G49 B;  4WU9 C;  5B32 A;  2ARO B;  3B6G A;  1P3B A;  2YFV B;  3X1S A;  3X1V C;  3REI C;  3AYW D;  3X1T A;  3AZF B;  4R8P C;  3REJ C;  5B31 A;  4CSR B;  1HQ3 B;  4J8W D;  5B0Y A;  1P34 A;  4J8X A;  3KXB D;  2G5I C;  3AZG B;  3X1U B;  3REL D;  3AZM A;  4WU8 D;  4XUJ A;  3LEL B;  5AV5 A;  1TZY A;  3R45 A;  5CP6 D;  5B2I C;  5CPJ D;  1W2E A;  5AV9 B;  3VH5 T;  1P3O A;  3REH C;  1U35 B;  1ID3 C;  3REK C;  5GT0 C;  1KX3 D;  2BYK A;  1PZR A;  4XZQ D;  3KUY D;  1AOI C;  4KUD B;  3C1B B;  3C1C D;  3UT9 A;  2XD5 A;  3MGR C;  3AZH C;  3FDD A;  3MGP D;  4Z66 C;  2JCH A;  1M19 A;  3UTB D;  3B6F B;  1S32 A;  3A1K A;  4YS3 A;  3B0D C;  5B40 A;  5F99 B;  5E5A A;  2L5A A;  4M6B A;  1P3I B;  5CPI B;  3AV2 D;  1M1A A;  4QLC D;  4H9S C;  4Z5T D;  3AYW B;  5GT3 C;  5B1M C;  2YFW B;  2FJ7 D;  1T3U A;  4R8P A;  4J8W B;  2ZY3 A;  1KX4 B;  5DNN D;  3KXB B;  3VH6 T;  3C1B A;  3REL B;  4WU8 B;  2Y2I A;  1P3A D;  2PYO C;  3W99 C;  3KWQ A;  3O62 C;  3WA9 D;  1P3K C;  1BH8 A;  5CP6 B;  3WTP C;  1H3O B;  3UTA C;  3AN2 D;  5CPJ B;  3LZ1 C;  5B2I A;  3WAA D;  5B24 C;  5FUG B;  3AV1 C;  1P3F D;  5B32 D;  3B6G D;  3NQJ B;  3WKJ A;  3X1S D;  3W96 C;  3REH A;  2HIO A;  1KX3 B;  5B31 D;  4XZQ B;  3KUY B;  1ZLA C;  3C1C B;  1KU5 A;  1AOI A;  5B0Y D;  1P34 D;  2BYM B;  3B0C W;  4J8X D;  2RIQ A;  3MGP B;  3AZH A;  3AZM D;  4X23 D;  4XUJ D;  4H9Q A;  3UTB B;  1KX4 A;  1KX5 A;  5AV8 C;  2HUE B;  4ZUX A;  5AV5 D;  1TZY D;  1P3G A;  4JJN C;  1A7W A;  3AZL C;  3AV2 B;  1P3O D;  3AZK D;  4QLC B;  2DQN C;  4Z5T B;  3MNN A;  5JA4 B;  3TU4 C;  2FJ7 B;  5GT3 A;  3AZE D;  3UT9 D;  3NQU B;  5DNN B;  2CWE A;  1M19 D;  1P3A B;  3WA9 B;  2JSS A;  1S32 D;  2PYO A;  4YS3 D;  3EG5 B;  1F66 A;  4WNN A;  5B40 D;  5AY8 C;  5E5A D;  1P3P C;  3AN2 B;  4YM6 A;  2LY8 A;  3MVD A;  3A6N A;  3WTP A;  3WAA B;  1P3F B;  4KHA B;  1M1A D;  3AV1 A;  5B32 B;  3B6G B;  3X1S B;  4H9N B;  3W98 C;  5B31 B;  5B0Z C;  4R8P D;  5B0Y B;  1Z2C B;  5CPK C;  1P34 B;  1ZLA A;  4J8X B;  2NZD B;  3C1B D;  4NFT A;  3AZM B;  4X23 B;  5BT1 C;  4XUJ B;  3KWQ D;  4AWL B;  5B33 C;  5DNN A;  5B2J C;  5AV5 B;  4J8V A;  1TZY B;  3R45 B;  1P3A A;  4JJN A;  3WA9 A;  5B1L A;  5DNM A;  2Y2J A;  5BO0 A;  5B2I D;  3VH5 W;  5AVC C;  2RVQ C;  1P3O B;  3AZK B;  4G92 B;  3WKJ D;  3AFA C;  2ZM5 A;  2Y2N A;  3REH D;  2HIO D;  4WV4 B;  3W97 A;  2BYK B;  1HTA A;  3AZE B;  2F8N H;  3AZI A;  3UT9 B;  4CAY A;  1AOI D;  4H9N A;  3MGR D;  3AZH D;  3V9R A;  1M19 B;  4Z66 D;  1KX5 D;  1KX4 D;  1EQZ C;  1S32 B;  4ZUX D;  5GSU A;  5AV6 C;  2NZD A;  4YS3 B;  1P3G D;  5B40 B;  4X23 A;  3MGS A;  5E5A B;  3AZG C;  3X1U C;  5AY8 A;  1B6W A;  1P3P A;  3LEL C;  1M1A B;  2Y2M A;  5GXQ A;  3MNN D;  3F6T A;  4KGC C;  5GT3 D;  5B1M D;  3AZK A;  4UPK A;  4R8P B;  3AZN A;  3VH6 W;  1U35 C;  3AZE A;  2F2A C;  3KWQ B;  4KUD C;  2PYO D;  3LZ0 C;  1F66 D;  1BH8 B;  5B2J A;  1P3L A;  1P3K D;  4YM6 D;  3MVD D;  3A6N D;  3WTP D;  5B2I B;  1R4V A;  2Y2O A;  3LZ1 D;  1ULY A;  3B6F C;  3AV1 D;  1P3M C;  3WKJ B;  1F1E A;  1M18 A;  3REH B;  2HIO B;  5F99 C;  5C3I C;  1P3I C;  4WU9 A;  3WTP E;  1AOI B;  3X1V A;  1ZLA D;  3REI A;  4EO5 C;  3MGR B;  3AZH B;  3REJ A;  3IP4 C;  4H9R A;  3AL0 C;  4Z66 B;  4H9Q B;  1KX5 B;  2F8N K;  4J8V D;  4ZUX B;  1P3G B;  1EQZ A;  3B0B A;  5AV6 A;  3KXB C;  3B0D B;  4JJN D;  5B1L D;  5DNM D;  5AVB C;  4WJ3 C;  4WU8 C;  2IO5 C;  3MNN B;  3W97 D;  2XD1 A;  5CP6 C;  5GT3 B;  5B1M B;  3TU4 D;  4DRA A;  3AZI D;  1ID3 A;  3REK A;  5GT0 A;  3KUY C;  3MGR A;  5GSU D;  2PYO B;  3W99 B;  2NZD D;  1F66 B;  4H9O A;  4WNN B;  3MGP C;  3MGS D;  4J8U C;  4Z66 A;  4DQY B;  1P3K B;  4YM6 B;  5AY8 D;  3MVD B;  3WTP B;  3A6N B;  1P3P D;  3P5J B;  4ZBJ B;  3LZ1 B;  2NQB C;  5GXQ D;  3AZJ C;  3AV1 B;  1P3M A;  2UWX A;  3W98 D;  3AZN D;  3LJA C;  3H0M C;  5B0Z D;  4H9S A;  3AV2 C;  1ZLA B;  5B1M A;  5CPK D;  4LD9 C;  2FJ7 C;  2CV5 C;  5BNX A;  1Q9C A;  4J8V B;  3H0R C;  5B33 D;  5B2J D;  1P3L D;  2Y2K A;  4JJN B;  5B1L B;  5DNM B;  5BO0 B;  3W99 A;  3O62 A;  5AVB A;  1P3K A;  2RVQ D;  2Y2Q A;  1JFI A;  3UTA A;  1M18 D;  3LZ1 A;  3AFA D;  3W97 B;  3AN2 C;  3TU4 B;  5B24 A;  3MGQ C;  4WU9 D;  2BG1 A;  2J8P A;  2ZY2 A;  3AZI B;  4CAY B;  3X1V D;  2DF4 C;  3REI D;  3B6G C;  3W96 A;  1P3B C;  3X1T C;  3REJ D;  3KFU G;  3V9R B;  1TAF A;  5GSU B;  4NE6 A;  1EQZ D;  5AV6 D;  3MGS B;  5BNV B;  4J8U A;  5AY8 B;  1P3P B;  5AV8 A;  4XUJ C;  4UUZ A;  2NQB A;  5GXQ B;  1N1J A;  5B32 G;  1TZY C;  3AZJ A;  5JRG C;  4KGC D;  3W98 B;  3AZN B;  5B31 G;  3AZL A;  4Z2M G;  3A1I A;  5B0Z B;  3LJA A;  1ID3 D;  3REK D;  3TU4 A;  5CPK B;  5GT0 D;  4E44 A;  4HGA C;  2ARO C;  2CV5 A;  5B33 B;  1WWS A;  3AZF C;  5B2J B;  1P3L B;  3LZ0 D;  1HQ3 C;  4E45 A;  1BFM A;  1M19 C;  4G91 B;  5BNV A;  3EPJ A;  4YS3 C;  3H0L C;  1P3M D;  1M18 B;  3AFA B;  2F8N A;  4WU9 B;  2Y2G A;  3X1V B;  3REI B;  3W98 A;  5AV9 C;  3REJ B;  4H9R B;  5B0Z A;  3EPL A;  3KSY A;  5CPK A;  1EQZ B;  1B67 A;  5AV6 B;  2VQR A;  3C1B C;  3W99 D;  5B33 A;  3O62 D;  5AVB D;  2ZY5 A;  3KWQ C;  3EPH A;  3UTA D;  4KGC B;  5JRG A;  5B24 D; 
#chains in the Genus database with same CATH homology
 5AVC A;  1ID3 B;  3AFA A;  3W96 D;  2JE5 A;  3REK B;  3WKJ C;  5GT0 B;  5CPI C;  2HIO C;  2Y2L A;  5G49 A;  3AYW C;  2ARO A;  2YFV A;  4H9O B;  3LZ0 B;  3AZF A;  4J8U D;  4J8W C;  4CSR A;  1HQ3 A;  5AV8 D;  1KX5 C;  1KX4 C;  2NQB D;  2W8S A;  4ZUX C;  2G5H C;  1P3G C;  3AZJ D;  3REL C;  1P3M B;  3AZG A;  3X1U A;  3LEL A;  3AZL D;  5C3I B;  3LJA D;  4KGC A;  5CPJ C;  3MNN C;  2Y2H A;  4EO5 B;  5BNX B;  5AV9 A;  4LD9 D;  2CV5 D;  3EPK A;  1U35 A;  5BS7 C;  3VH5 A;  1KX3 C;  5KDM B;  4DRB A;  4XZQ C;  3C1C C;  4KUD A;  3O62 B;  5AVB B;  2IO5 B;  3LZ0 A;  1JFI B;  1F66 C;  2ZY4 A;  3UTA B;  3UTB C;  2F8N D;  4YM6 C;  2HUE C;  5B24 B;  3A6N C;  3MVD C;  3B6F A;  4ZBJ C;  3MGQ D;  3W96 B;  5F99 A;  4H9P B;  1P3B D;  1P3I A;  1BH9 B;  3X1T D;  5CPI A;  4QLC C;  1TAF B;  4Z5T C;  2FFF B;  3AYW A;  2YFW A;  4WZS B;  5BT1 D;  4J8U B;  5AV8 B;  4J8W A;  4UUZ B;  5KDM A;  5DNN C;  2NQB B;  4J8V C;  1N1J B;  3KXB A;  3AZJ B;  1P3A C;  3WA9 C;  5B1L C;  5JRG D;  5DNM C;  3VH6 A;  5AVC D;  4NE3 A;  4WU8 A;  3REL A;  3AZL B;  3LJA B;  1WWI A;  5CP6 A;  1H3O A;  3WAA C;  5CPJ A;  3W97 C;  1P3F C;  5FUG A;  5B32 C;  4LD9 B;  2CV5 B;  3AZI C;  3X1S C;  2ARO D;  4H9P A;  3NQJ A;  1BH9 A;  5CHL B;  4NE5 A;  5BS7 A;  5B31 C;  3AZF D;  1KX3 A;  4XZQ A;  1HQ3 D;  5B0Y C;  3KUY A;  1P34 C;  3C1C A;  4J8X C;  2BYM A;  5GSU C;  2NZD C;  3MGP A;  3B0C T;  3AZM C;  3AZG D;  3X1U D;  4X23 C;  3MGS C;  4AWL C;  2F8N B;  3LEL D;  5AV5 C;  3UTB A;  3MGQ B;  5GXQ C;  1P3B B;  3X1T B;  5AV9 D;  1P3O C;  3AZK C;  4G92 C;  3AZN C;  3AV2 A;  1U35 D;  4QLC A;  4Z5T A;  5JA4 A;  3AZE C;  4LD9 A;  2FJ7 A;  3UT9 C;  4KUD D;  2F8N G;  3NQU A;  1P3L C;  4Z2M H;  5JRG B;  5AVC B;  1S32 C;  3B6F D;  5B40 C;  4G91 C;  5E5A C;  2Y2P A;  5F99 D;  1M18 C;  3AN2 A;  1P3I D;  3MGQ A;  5CPI D;  4HGA B;  1M1A C;  3WAA A;  1P3F A;  4KHA A;  5G49 B;  4WU9 C;  5B32 A;  2ARO B;  3B6G A;  1P3B A;  2YFV B;  3X1S A;  3X1V C;  3REI C;  3AYW D;  3X1T A;  3AZF B;  4R8P C;  3REJ C;  5B31 A;  4CSR B;  1HQ3 B;  4J8W D;  5B0Y A;  1P34 A;  4J8X A;  3KXB D;  2G5I C;  3AZG B;  3X1U B;  3REL D;  3AZM A;  4WU8 D;  4XUJ A;  3LEL B;  5AV5 A;  1TZY A;  3R45 A;  5CP6 D;  5B2I C;  5CPJ D;  1W2E A;  5AV9 B;  3VH5 T;  1P3O A;  3REH C;  1U35 B;  1ID3 C;  3REK C;  5GT0 C;  1KX3 D;  2BYK A;  1PZR A;  4XZQ D;  3KUY D;  1AOI C;  4KUD B;  3C1B B;  3C1C D;  3UT9 A;  2XD5 A;  3MGR C;  3AZH C;  3FDD A;  3MGP D;  4Z66 C;  2JCH A;  1M19 A;  3UTB D;  3B6F B;  1S32 A;  3A1K A;  4YS3 A;  3B0D C;  5B40 A;  5F99 B;  5E5A A;  2L5A A;  4M6B A;  1P3I B;  5CPI B;  3AV2 D;  1M1A A;  4QLC D;  4H9S C;  4Z5T D;  3AYW B;  5GT3 C;  5B1M C;  2YFW B;  2FJ7 D;  1T3U A;  4R8P A;  4J8W B;  2ZY3 A;  1KX4 B;  5DNN D;  3KXB B;  3VH6 T;  3C1B A;  3REL B;  4WU8 B;  2Y2I A;  1P3A D;  2PYO C;  3W99 C;  3KWQ A;  3O62 C;  3WA9 D;  1P3K C;  1BH8 A;  5CP6 B;  3WTP C;  1H3O B;  3UTA C;  3AN2 D;  5CPJ B;  3LZ1 C;  5B2I A;  3WAA D;  5B24 C;  5FUG B;  3AV1 C;  1P3F D;  5B32 D;  3B6G D;  3NQJ B;  3WKJ A;  3X1S D;  3W96 C;  3REH A;  2HIO A;  1KX3 B;  5B31 D;  4XZQ B;  3KUY B;  1ZLA C;  3C1C B;  1KU5 A;  1AOI A;  5B0Y D;  1P34 D;  2BYM B;  3B0C W;  4J8X D;  2RIQ A;  3MGP B;  3AZH A;  3AZM D;  4X23 D;  4XUJ D;  4H9Q A;  3UTB B;  1KX4 A;  1KX5 A;  5AV8 C;  2HUE B;  4ZUX A;  5AV5 D;  1TZY D;  1P3G A;  4JJN C;  1A7W A;  3AZL C;  3AV2 B;  1P3O D;  3AZK D;  4QLC B;  2DQN C;  4Z5T B;  3MNN A;  5JA4 B;  3TU4 C;  2FJ7 B;  5GT3 A;  3AZE D;  3UT9 D;  3NQU B;  5DNN B;  2CWE A;  1M19 D;  1P3A B;  3WA9 B;  2JSS A;  1S32 D;  2PYO A;  4YS3 D;  3EG5 B;  1F66 A;  4WNN A;  5B40 D;  5AY8 C;  5E5A D;  1P3P C;  3AN2 B;  4YM6 A;  2LY8 A;  3MVD A;  3A6N A;  3WTP A;  3WAA B;  1P3F B;  4KHA B;  1M1A D;  3AV1 A;  5B32 B;  3B6G B;  3X1S B;  4H9N B;  3W98 C;  5B31 B;  5B0Z C;  4R8P D;  5B0Y B;  1Z2C B;  5CPK C;  1P34 B;  1ZLA A;  4J8X B;  2NZD B;  3C1B D;  4NFT A;  3AZM B;  4X23 B;  5BT1 C;  4XUJ B;  3KWQ D;  4AWL B;  5B33 C;  5DNN A;  5B2J C;  5AV5 B;  4J8V A;  1TZY B;  3R45 B;  1P3A A;  4JJN A;  3WA9 A;  5B1L A;  5DNM A;  2Y2J A;  5BO0 A;  5B2I D;  3VH5 W;  5AVC C;  2RVQ C;  1P3O B;  3AZK B;  4G92 B;  3WKJ D;  3AFA C;  2ZM5 A;  2Y2N A;  3REH D;  2HIO D;  4WV4 B;  3W97 A;  2BYK B;  1HTA A;  3AZE B;  2F8N H;  3AZI A;  3UT9 B;  4CAY A;  1AOI D;  4H9N A;  3MGR D;  3AZH D;  3V9R A;  1M19 B;  4Z66 D;  1KX5 D;  1KX4 D;  1EQZ C;  1S32 B;  4ZUX D;  5GSU A;  5AV6 C;  2NZD A;  4YS3 B;  1P3G D;  5B40 B;  4X23 A;  3MGS A;  5E5A B;  3AZG C;  3X1U C;  5AY8 A;  1B6W A;  1P3P A;  3LEL C;  1M1A B;  2Y2M A;  5GXQ A;  3MNN D;  3F6T A;  4KGC C;  5GT3 D;  5B1M D;  3AZK A;  4UPK A;  4R8P B;  3AZN A;  3VH6 W;  1U35 C;  3AZE A;  2F2A C;  3KWQ B;  4KUD C;  2PYO D;  3LZ0 C;  1F66 D;  1BH8 B;  5B2J A;  1P3L A;  1P3K D;  4YM6 D;  3MVD D;  3A6N D;  3WTP D;  5B2I B;  1R4V A;  2Y2O A;  3LZ1 D;  1ULY A;  3B6F C;  3AV1 D;  1P3M C;  3WKJ B;  1F1E A;  1M18 A;  3REH B;  2HIO B;  5F99 C;  5C3I C;  1P3I C;  4WU9 A;  3WTP E;  1AOI B;  3X1V A;  1ZLA D;  3REI A;  4EO5 C;  3MGR B;  3AZH B;  3REJ A;  3IP4 C;  4H9R A;  3AL0 C;  4Z66 B;  4H9Q B;  1KX5 B;  2F8N K;  4J8V D;  4ZUX B;  1P3G B;  1EQZ A;  3B0B A;  5AV6 A;  3KXB C;  3B0D B;  4JJN D;  5B1L D;  5DNM D;  5AVB C;  4WJ3 C;  4WU8 C;  2IO5 C;  3MNN B;  3W97 D;  2XD1 A;  5CP6 C;  5GT3 B;  5B1M B;  3TU4 D;  4DRA A;  3AZI D;  1ID3 A;  3REK A;  5GT0 A;  3KUY C;  3MGR A;  5GSU D;  2PYO B;  3W99 B;  2NZD D;  1F66 B;  4H9O A;  4WNN B;  3MGP C;  3MGS D;  4J8U C;  4Z66 A;  4DQY B;  1P3K B;  4YM6 B;  5AY8 D;  3MVD B;  3WTP B;  3A6N B;  1P3P D;  3P5J B;  4ZBJ B;  3LZ1 B;  2NQB C;  5GXQ D;  3AZJ C;  3AV1 B;  1P3M A;  2UWX A;  3W98 D;  3AZN D;  3LJA C;  3H0M C;  5B0Z D;  4H9S A;  3AV2 C;  1ZLA B;  5B1M A;  5CPK D;  4LD9 C;  2FJ7 C;  2CV5 C;  5BNX A;  1Q9C A;  4J8V B;  3H0R C;  5B33 D;  5B2J D;  1P3L D;  2Y2K A;  4JJN B;  5B1L B;  5DNM B;  5BO0 B;  3W99 A;  3O62 A;  5AVB A;  1P3K A;  2RVQ D;  2Y2Q A;  1JFI A;  3UTA A;  1M18 D;  3LZ1 A;  3AFA D;  3W97 B;  3AN2 C;  3TU4 B;  5B24 A;  3MGQ C;  4WU9 D;  2BG1 A;  2J8P A;  2ZY2 A;  3AZI B;  4CAY B;  3X1V D;  2DF4 C;  3REI D;  3B6G C;  3W96 A;  1P3B C;  3X1T C;  3REJ D;  3KFU G;  3V9R B;  1TAF A;  5GSU B;  4NE6 A;  1EQZ D;  5AV6 D;  3MGS B;  5BNV B;  4J8U A;  5AY8 B;  1P3P B;  5AV8 A;  4XUJ C;  4UUZ A;  2NQB A;  5GXQ B;  1N1J A;  5B32 G;  1TZY C;  3AZJ A;  5JRG C;  4KGC D;  3W98 B;  3AZN B;  5B31 G;  3AZL A;  4Z2M G;  3A1I A;  5B0Z B;  3LJA A;  1ID3 D;  3REK D;  3TU4 A;  5CPK B;  5GT0 D;  4E44 A;  4HGA C;  2ARO C;  2CV5 A;  5B33 B;  1WWS A;  3AZF C;  5B2J B;  1P3L B;  3LZ0 D;  1HQ3 C;  4E45 A;  1BFM A;  1M19 C;  4G91 B;  5BNV A;  3EPJ A;  4YS3 C;  3H0L C;  1P3M D;  1M18 B;  3AFA B;  2F8N A;  4WU9 B;  2Y2G A;  3X1V B;  3REI B;  3W98 A;  5AV9 C;  3REJ B;  4H9R B;  5B0Z A;  3EPL A;  3KSY A;  5CPK A;  1EQZ B;  1B67 A;  5AV6 B;  2VQR A;  3C1B C;  3W99 D;  5B33 A;  3O62 D;  5AVB D;  2ZY5 A;  3KWQ C;  3EPH A;  3UTA D;  4KGC B;  5JRG A;  5B24 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...