3AN2C

The structure of the centromeric nucleosome containing cenp-a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure of the human centromeric nucleosome containing CENP-A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 23
structure length 97
sequence length 97
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3an2C00
5CP6D 4J8WB 3AZNA 3AYWD 5B2IB 3LJAC 5DNND 5B40D 5CPID 5B2JC 5B0ZB 1KX3B 3W98B 4H9QA 5DNMC 4QLCB 3AZLD 4H9RB 5GSUA 3TU4C 1TZYB 3MGSB 3REKB 5CPKA 3R45B 1P3OA 1F66B 4XZQB 2CV5C 5B32D 2F8NG 1P3AA 3AFAA 2L5AA 3X1VB 3KWQB 5B33C 3O62C 4Z2MH 3AZFC 4WZSB 4E44A 5AV9C 1KX4C 2NZDA 2JSSA 2BYMA 3AV1D 5G49B 2PYOA 1AOID 5CPIA 3B0CT 4XUJB 4YM6B 3REIC 1M18C 3LJAB 5B31B 3AZLA 2NQBC 4NE5A 1M19D 1ID3C 3UTAA 1BH8B 3W96A 5AVCA 3B6GD 1M1AA 4Z66A 3MVDC 3AZHB 3WTPD 3MNNA 1ZLAC 3C1BC 5B24D 3VH6T 5B32A 3WA9A 5BNVB 3AZGC 3NQJB 5JRGD 3UTBA 5GT0B 3X1SB 5E5AA 1KX5A 4Z5TC 5JA4B 3X1UD 5AVBB 4J8XC 3AZFB 4ZUXB 1KX4B 2YFWB 2AROD 3A6ND 5B1LC 5AY8C 3X1VD 5AV6D 4J8VB 3MGQA 3LZ0C 1P3MB 5BO0B 4ZBJC 4EO5B 4WU8B 3AZMA 5F99C 4X23A 2BYKB 3WKJC 5B32G 1P3GA 3RELD 5B1MC 2NQBB 3LELA 3AZKC 3AZJB 3C1CC 3AN2C 1Q9CA 4R8PC 5CPJC 3WTPA 1P3LA 4H9OB 4YS3C 5B2JD 4NE3A 3B0DB 5DNMD 3B0CW 3REJC 5KDMA 5GXQC 3TU4D 3AZGB 3VH6A 5AV5C 3AZIC 4UUZA 3AZNB 4LD9B 2FJ7D 5FUGB 3X1TC 3W99C 1P3PC 4H9QB 2CV5D 3UT9C 5GSUB 4WV4B 5B33D 4WNNA 3O62D 3LZ1D 1EQZA 4ZBJB 5AV9D 5F99B 5CPKB 3RELA 4J8WC 1P34B 5B2IC 5C3IB 5B1MB 5B0YD 3W98C 1P3AB 4QLCC 3AFAB 3REID 3KUYA 1M18D 3MGRA 3REJB 2HUEC 1ID3D 2BYMB 3REKC 2PYOB 2FJ7A 3MVDD 3B0BA 4DRBA 4XZQC 1ZLAD 5BS7C 3C1BD 3KWQC 3AZGD 1P3FA 2YFVB 3O62A 3W96B 5AVCB 3LZ1A 4Z5TD 4Z66B 4J8XD 4AWLB 3B6FC 5B1LD 5B0YA 5AY8D 3WA9B 4XUJC 4YM6C 3LZ0D 4JJNA 5B31C 3UTBB 5E5AB 1P3IA 1KX5B 1P3KA 4KHAA 5GT3A 3WKJD 2HUEB 3AZKD 3C1CD 3AZHC 3AN2D 5CPJD 4R8PD 3MGQB 4J8UC 4KGCA 4YS3D 3C1BA 3AZMB 4H9SA 5AV8A 3WAAC 5GT0C 3X1SC 4X23B 3AV2B 5GXQD 4H9NA 1P3GB 4G91B 5AVBC 3LELB 5AV5D 1U35C 1P3BD 3AZID 4ZUXC 1S32A 4WU9C 4H9PA 3REHA 1P3LB 3X1TD 1P3PD 3W99D 5BT1C 4J8VC 4CAYA 4E45A 1KU5A 5CP6A 3AYWA 3W97D 1P3MC 4EO5C 4WU8C 5DNNA 3UT9D 3B6FB 5B40A 1HQ3D 4UUZB 4KUDC 3AZJC 3KXBC 4J8WD 3AZKA 2HIOC 5B2ID 4HGAB 5B0ZD 1KX3D 3W98D 3B0DC 4QLCD 4J8UB 1BFMA 4WNNB 1EQZB 1TZYD 3WAAB 3MGSD 3AZNC 1P3BA 3REKD 4LD9C 3VH5A 1JFIB 3AZEB 1U35B 5BNXA 4WU9B 1F66D 2RVQC 4XZQD 3AV1A 3KUYB 3W97A 5GSUC 1AOIA 3KWQD 3MGRB 4NE6A 5CPKC 1HQ3A 3V9RA 3MGPB 1P34C 1M19A 5C3IC 1P3OC 4J8WA 4KUDB 3B6GA 3KXBB 1P3AC 3AFAC 2HIOB 5B0ZA 4XUJD 4YM6D 1KX3A 3LJAD 4Z2MG 5B31D 1P3FB 5B24A 1TZYA 1H3OA 5JRGA 3MGSA 2PYOC 2F8NB 3AZHD 2CWEA 3X1UA 4M6BA 1F66A 4XZQA 4JJNB 2AROA 3A6NA 3AZLC 1P3IB 1N1JA 1P3KB 3X1VA 5AV6A 5GT0D 4KHAB 5GT3B 3X1SD 3UTAC 3VH6W 3W96C 5AVCC 1M1AC 4Z66C 5AVBD 1WWSA 3AZFD 4ZUXD 1KX4D 4AWLC 3MNNC 4KGCB 3WA9C 5BT1D 4J8VD 1P3OB 5AV8B 1P3MD 3UTBC 1KX5C 5E5AC 4WU8D 3LJAA 5B2JA 4CSRA 5DNMA 2NQBD 4H9PB 3REHB 3AZJD 4KUDD 2NZDB 3TU4A 3NQUA 1R4VA 4CAYB 3MGQC 5CP6B 3AZMC 5DNNB 5B40B 5CPIB 4X23C 3AV2C 2CV5A 3AZLB 1P3GC 4G91C 2F8NH 3LELC 5B33A 3UTAB 3AZND 4LD9D 3AZFA 5B31G 1M1AB 5AV9A 3WTPC 1P3LC 1KX4A 2RVQD 3MNNB 5GSUD 5BO0A 5B32B 3REIA 1M18A 5F99D 5CPKD 2NQBA 1P34D 5BNXB 1ID3A 1P3OD 3AV1B 5B1MD 4HGAC 1P3AD 3KSYA 3AFAD 3MVDA 1AOIB 1EQZC 1ZLAA 3REJD 1TAFA 3VH5T 3RELC 3AZGA 1M19B 3AZEC 2PYOD 4LD9A 3B6GB 4Z5TA 5FUGA 4J8XA 3KUYC 3WTPB 5B1LA 5B24B 3MGRC 5AY8A 5KDMB 3UTAD 3LZ0A 1H3OB 5JRGB 3W96D 5AVCD 1BH9A 1M1AD 4Z66D 5F99A 3MGPC 2FJ7C 3X1UB 1P34A 3MNND 3WKJA 5B1MA 2AROB 3A6NB 3C1CA 3WA9D 1N1JB 3AN2A 5AV6B 3UTBD 1KX5D 4R8PA 5E5AD 5CPJA 1P3FC 4YS3A 3LZ1C 3REJA 2F8NK 5GXQA 3RELB 5B0YC 5AV5A 3AZIA 1B67A 3MGQD 4JJNC 1P3IC 3AZMD 3X1TA 1P3KC 1P3PA 3W99A 5B2JB 4CSRB 5GT3C 4X23D 5DNMB 3AV2D 1P3GD 2YFVA 3UT9A 3LELD 3VH5W 3TU4B 3NQUB 4NFTA 2IO5C 1P3LD 4KGCC 2FJ7B 4H9SC 5AV8C 5B2IA 3B6FD 2CV5B 3W98A 4QLCA 5B33B 1S32C 4H9RA 3O62B 2NZDC 3REHC 3LZ1B 5AV9B 1HTAA 2LY8A 5CP6C 3AYWC 3REKA 5DNNC 3R45A 5B0YB 5CPIC 5B40C 4J8UD 3REIB 1M18B 5BS7A 1EQZD 3AV2A 1F1EA 3KWQA 3WAAD 4G92C 1ID3B 3AZED 1U35D 3WTPE 4WU9D 3MVDB 3KUYD 5G49A 2IO5B 5B32C 1ZLAB 1A7WA 3C1BB 3B6FA 3MGRD 1TAFB 4XUJA 4YM6A 1P3BC 5B31A 4H9NB 3MGPD 4Z5TB 1WWIA 1S32B 1BH8A 4J8XB 3AV1C 3KXBD 3W97C 1AOIC 2HIOD 3AZHA 5B1LB 3AYWB 5AY8B 4J8UA 3LZ0B 1P3FD 1HQ3C 1BH9B 5BNVA 3NQJA 4DRAA 5GT0A 3X1SA 1B6WA 1M19C 3WAAA 3WKJB 3B6GC 2F8ND 5JA4A 1JFIA 3AZEA 5AVBA 3AZKB 1U35A 5B0ZC 3C1CB 4G92B 4ZUXA 1KX3C 4WU9A 3AN2B 2YFWA 4JJND 5CHLB 4R8PB 5CPJB 1P3ID 5B24C 4YS3B 1P3KD 4J8VA 5GT3D 1TZYC 5JRGC 1ULYA 1P3MA 4WU8A 3MGSC 5GXQB 3X1UC 3MGPA 2BYKA 1P3BB 5AV5B 3AZIB 1F66C 4KGCD 4KUDA 3AZJA 2AROC 3A6NC 3KXBA 3X1TB 1P3PB 3W99B 2HIOA 5AV8D 5AV6C 3X1VC 3W97B 4H9OA 3UT9B 1S32D 2NZDD 3REHD 1HQ3B 3V9RB 2F8NA
chains in the Genus database with same CATH superfamily
5CP6D 4J8WB 3AZNA 3AYWD 5B2IB 3LJAC 5DNND 5B40D 5CPID 5B2JC 5B0ZB 1KX3B 3W98B 4H9QA 5DNMC 4QLCB 3AZLD 4H9RB 5GSUA 3TU4C 1TZYB 3MGSB 3REKB 5CPKA 3R45B 1T3UA 2Y2MA 1P3OA 4XZQB 1F66B 2CV5C 5B32D 2F8NG 1P3AA 3AFAA 2L5AA 3X1VB 3KWQB 5B33C 3O62C 4Z2MH 3AZFC 4WZSB 4E44A 5AV9C 1KX4C 2NZDA 2JSSA 2BYMA 3AV1D 5G49B 2PYOA 3EPLA 1AOID 5CPIA 3B0CT 4XUJB 4YM6B 3REIC 1M18C 3LJAB 5B31B 3AZLA 2NQBC 4NE5A 1M19D 1ID3C 3UTAA 1BH8B 3W96A 3H0LC 5AVCA 3B6GD 1M1AA 4Z66A 3MVDC 3AZHB 3WTPD 3MNNA 1ZLAC 3C1BC 5B24D 3VH6T 5B32A 3WA9A 5BNVB 3AZGC 3NQJB 5JRGD 3UTBA 5GT0B 3X1SB 5E5AA 1KX5A 4Z5TC 5JA4B 3X1UD 5AVBB 4J8XC 3AZFB 4ZUXB 1KX4B 3AL0C 2YFWB 2AROD 2VQRA 3A6ND 5B1LC 5AY8C 3X1VD 5AV6D 4J8VB 2Y2QA 3MGQA 3LZ0C 1P3MB 5BO0B 4ZBJC 4EO5B 4WU8B 3AZMA 5F99C 4X23A 2BYKB 3WKJC 5B32G 1P3GA 3RELD 5B1MC 2NQBB 3LELA 3AZKC 3AZJB 3C1CC 3AN2C 1Q9CA 4R8PC 5CPJC 3WTPA 1P3LA 4H9OB 4YS3C 5B2JD 4NE3A 3B0DB 5DNMD 2XD1A 3B0CW 3REJC 5KDMA 5GXQC 3TU4D 3AZGB 3VH6A 5AV5C 2XD5A 3AZIC 4UUZA 3AZNB 4LD9B 2FJ7D 5FUGB 3X1TC 3W99C 1P3PC 4H9QB 2CV5D 2RIQA 5GSUB 3UT9C 4WV4B 5B33D 4WNNA 3O62D 3LZ1D 2ZM5A 1EQZA 4ZBJB 5AV9D 5F99B 5CPKB 3RELA 4J8WC 1P34B 5B2IC 5C3IB 5B1MB 5B0YD 3KFUG 3W98C 1P3AB 4QLCC 3AFAB 3REID 3KUYA 1M18D 3MGRA 3REJB 2HUEC 1ID3D 2BYMB 3REKC 2PYOB 2FJ7A 3MVDD 3B0BA 4DRBA 4XZQC 1ZLAD 5BS7C 3C1BD 3KWQC 3AZGD 1P3FA 2YFVB 3O62A 3W96B 5AVCB 3LZ1A 4Z5TD 4Z66B 4J8XD 4AWLB 3B6FC 5B1LD 5B0YA 5AY8D 3WA9B 4XUJC 4YM6C 3LZ0D 4JJNA 5B31C 3UTBB 5E5AB 2JE5A 1P3IA 1KX5B 1P3KA 4KHAA 5GT3A 3WKJD 3A1KA 2HUEB 3AZKD 3C1CD 3AZHC 3AN2D 5CPJD 4R8PD 3MGQB 4J8UC 4KGCA 4YS3D 3C1BA 3AZMB 4H9SA 5AV8A 3WAAC 5GT0C 3X1SC 4X23B 3AV2B 5GXQD 4H9NA 1P3GB 4G91B 5AVBC 3LELB 5AV5D 1U35C 1P3BD 3AZID 4ZUXC 1S32A 4WU9C 4H9PA 3REHA 1P3LB 3X1TD 1P3PD 3W99D 5BT1C 4J8VC 4CAYA 4E45A 1KU5A 5CP6A 3AYWA 3W97D 1P3MC 4EO5C 4WU8C 5DNNA 3UT9D 3B6FB 5B40A 1HQ3D 4UUZB 3EPKA 4KUDC 2DF4C 3AZJC 3KXBC 4UPKA 4J8WD 3AZKA 2HIOC 5B2ID 4WJ3C 4HGAB 5B0ZD 1KX3D 3W98D 3B0DC 4QLCD 2Y2IA 4J8UB 1BFMA 4WNNB 1EQZB 1TZYD 3WAAB 3MGSD 3AZNC 1P3BA 3REKD 4LD9C 3VH5A 1JFIB 3AZEB 1U35B 5BNXA 4WU9B 1F66D 2RVQC 4XZQD 3AV1A 3KUYB 3W97A 5GSUC 1AOIA 3KWQD 3MGRB 2W8SA 4NE6A 5CPKC 1HQ3A 3V9RA 2J8PA 3MGPB 1P34C 2F2AC 1M19A 5C3IC 2Y2KA 4J8WA 1P3OC 4KUDB 3B6GA 3KXBB 1P3AC 3AFAC 2HIOB 3H0RC 5B0ZA 4XUJD 4YM6D 1KX3A 3LJAD 4Z2MG 5B31D 1P3FB 5B24A 4DQYB 1TZYA 1H3OA 5JRGA 3MGSA 2PYOC 2F8NB 2ZY5A 3AZHD 2CWEA 3X1UA 2BG1A 1PZRA 4M6BA 1F66A 4XZQA 4JJNB 2AROA 3A6NA 2DQNC 3AZLC 1P3IB 1N1JA 2UWXA 1P3KB 3X1VA 5AV6A 5GT0D 4KHAB 5GT3B 1W2EA 3X1SD 3UTAC 3VH6W 3W96C 5AVCC 1M1AC 4Z66C 5AVBD 1WWSA 3AZFD 4ZUXD 1KX4D 4AWLC 3MNNC 4KGCB 3WA9C 5BT1D 4J8VD 3EPHA 1P3OB 5AV8B 1P3MD 3UTBC 1KX5C 5E5AC 4WU8D 3LJAA 5B2JA 4CSRA 5DNMA 2Y2JA 2NQBD 4H9PB 3REHB 3AZJD 4KUDD 2NZDB 3TU4A 3NQUA 1R4VA 4CAYB 3MGQC 5CP6B 3AZMC 5DNNB 5B40B 5CPIB 4X23C 3AV2C 2CV5A 3AZLB 1P3GC 4G91C 2F8NH 3LELC 5B33A 3UTAB 3AZND 4LD9D 3AZFA 5B31G 1M1AB 5AV9A 3WTPC 1P3LC 1KX4A 1Z2CB 2RVQD 3MNNB 5GSUD 5BO0A 5B32B 3REIA 1M18A 5F99D 5CPKD 2NQBA 1P34D 5BNXB 1ID3A 1P3OD 3AV1B 5B1MD 4HGAC 1P3AD 3KSYA 3AFAD 3MVDA 1AOIB 1EQZC 1ZLAA 3REJD 1TAFA 3P5JB 3VH5T 3RELC 3AZGA 3IP4C 1M19B 3AZEC 2PYOD 4LD9A 3B6GB 4Z5TA 3EPJA 2Y2PA 5FUGA 4J8XA 3KUYC 3WTPB 5B1LA 5B24B 3MGRC 5AY8A 5KDMB 3F6TA 3UTAD 3LZ0A 1H3OB 5JRGB 3W96D 5AVCD 1BH9A 1M1AD 4Z66D 5F99A 3MGPC 2FJ7C 3X1UB 1P34A 3MNND 3WKJA 2Y2OA 5B1MA 2AROB 3A6NB 3C1CA 3EG5B 3WA9D 1N1JB 3AN2A 5AV6B 3UTBD 1KX5D 4R8PA 5E5AD 5CPJA 1P3FC 4YS3A 3LZ1C 3REJA 2F8NK 5GXQA 3RELB 5B0YC 5AV5A 3AZIA 1B67A 2ZY2A 3MGQD 4JJNC 1P3IC 3AZMD 3X1TA 1P3KC 1P3PA 3W99A 5B2JB 4CSRB 5GT3C 4X23D 5DNMB 3AV2D 1P3GD 2YFVA 3UT9A 3LELD 3VH5W 3TU4B 3NQUB 4NFTA 2IO5C 1P3LD 4KGCC 2FJ7B 2Y2NA 4H9SC 5AV8C 5B2IA 3B6FD 2CV5B 3W98A 4QLCA 5B33B 1S32C 4H9RA 3O62B 2NZDC 3REHC 3LZ1B 5AV9B 3H0MC 1HTAA 2LY8A 5CP6C 3AYWC 3REKA 5DNNC 3R45A 5B0YB 5CPIC 5B40C 4J8UD 3REIB 1M18B 5BS7A 1EQZD 3AV2A 2FFFB 1F1EA 3KWQA 3WAAD 4G92C 1ID3B 3FDDA 3AZED 2G5HC 1U35D 3WTPE 4WU9D 3MVDB 3KUYD 5G49A 2IO5B 5B32C 1ZLAB 1A7WA 3C1BB 3B6FA 3MGRD 1TAFB 4XUJA 4YM6A 1P3BC 5B31A 4H9NB 3MGPD 4Z5TB 1WWIA 1S32B 1BH8A 2Y2HA 4J8XB 3AV1C 3KXBD 3W97C 1AOIC 2HIOD 3AZHA 5B1LB 3AYWB 5AY8B 4J8UA 3LZ0B 1P3FD 1HQ3C 1BH9B 5BNVA 3NQJA 3A1IA 4DRAA 5GT0A 3X1SA 1B6WA 1M19C 3WAAA 3WKJB 3B6GC 2F8ND 5JA4A 1JFIA 3AZEA 5AVBA 3AZKB 1U35A 5B0ZC 3C1CB 4G92B 4ZUXA 1KX3C 4WU9A 3AN2B 2YFWA 4JJND 5CHLB 4R8PB 5CPJB 1P3ID 5B24C 4YS3B 1P3KD 4J8VA 5GT3D 1TZYC 5JRGC 1ULYA 1P3MA 4WU8A 3MGSC 5GXQB 2G5IC 3X1UC 3MGPA 2BYKA 1P3BB 5AV5B 3AZIB 2JCHA 1F66C 4KGCD 4KUDA 2ZY3A 2AROC 3A6NC 3AZJA 3KXBA 2ZY4A 3X1TB 1P3PB 2Y2GA 2HIOA 5AV8D 5AV6C 3X1VC 3W99B 3W97B 4H9OA 3UT9B 1S32D 2NZDD 3REHD 1HQ3B 3V9RB 2F8NA 2Y2LA
chains in the Genus database with same CATH topology
5CP6D 4J8WB 3AZNA 3AYWD 5B2IB 3LJAC 5DNND 5B40D 5CPID 5B2JC 5B0ZB 1KX3B 3W98B 4H9QA 5DNMC 4QLCB 3AZLD 4H9RB 5GSUA 3TU4C 1TZYB 3MGSB 3REKB 5CPKA 3R45B 1T3UA 2Y2MA 1P3OA 4XZQB 1F66B 2CV5C 5B32D 2F8NG 1P3AA 3AFAA 2L5AA 3X1VB 3KWQB 5B33C 3O62C 4Z2MH 3AZFC 4WZSB 4E44A 5AV9C 1KX4C 2NZDA 2JSSA 2BYMA 3AV1D 5G49B 2PYOA 3EPLA 1AOID 5CPIA 3B0CT 4XUJB 4YM6B 3REIC 1M18C 3LJAB 5B31B 3AZLA 2NQBC 4NE5A 1M19D 1ID3C 3UTAA 1BH8B 3W96A 3H0LC 5AVCA 3B6GD 1M1AA 4Z66A 3MVDC 3AZHB 3WTPD 3MNNA 1ZLAC 3C1BC 5B24D 3VH6T 5B32A 3WA9A 5BNVB 3AZGC 3NQJB 5JRGD 3UTBA 5GT0B 3X1SB 5E5AA 1KX5A 4Z5TC 5JA4B 3X1UD 5AVBB 4J8XC 3AZFB 4ZUXB 1KX4B 3AL0C 2YFWB 2AROD 2VQRA 3A6ND 5B1LC 5AY8C 3X1VD 5AV6D 4J8VB 2Y2QA 3MGQA 3LZ0C 1P3MB 5BO0B 4ZBJC 4EO5B 4WU8B 3AZMA 5F99C 4X23A 2BYKB 3WKJC 5B32G 1P3GA 3RELD 5B1MC 2NQBB 3LELA 3AZKC 3AZJB 3C1CC 3AN2C 1Q9CA 4R8PC 5CPJC 3WTPA 1P3LA 4H9OB 4YS3C 5B2JD 4NE3A 3B0DB 5DNMD 2XD1A 3B0CW 3REJC 5KDMA 5GXQC 3TU4D 3AZGB 3VH6A 5AV5C 2XD5A 3AZIC 4UUZA 3AZNB 4LD9B 2FJ7D 5FUGB 3X1TC 3W99C 1P3PC 4H9QB 2CV5D 2RIQA 5GSUB 3UT9C 4WV4B 5B33D 4WNNA 3O62D 3LZ1D 2ZM5A 1EQZA 4ZBJB 5AV9D 5F99B 5CPKB 3RELA 4J8WC 1P34B 5B2IC 5C3IB 5B1MB 5B0YD 3KFUG 3W98C 1P3AB 4QLCC 3AFAB 3REID 3KUYA 1M18D 3MGRA 3REJB 2HUEC 1ID3D 2BYMB 3REKC 2PYOB 2FJ7A 3MVDD 3B0BA 4DRBA 4XZQC 1ZLAD 5BS7C 3C1BD 3KWQC 3AZGD 1P3FA 2YFVB 3O62A 3W96B 5AVCB 3LZ1A 4Z5TD 4Z66B 4J8XD 4AWLB 3B6FC 5B1LD 5B0YA 5AY8D 3WA9B 4XUJC 4YM6C 3LZ0D 4JJNA 5B31C 3UTBB 5E5AB 2JE5A 1P3IA 1KX5B 1P3KA 4KHAA 5GT3A 3WKJD 3A1KA 2HUEB 3AZKD 3C1CD 3AZHC 3AN2D 5CPJD 4R8PD 3MGQB 4J8UC 4KGCA 4YS3D 3C1BA 3AZMB 4H9SA 5AV8A 3WAAC 5GT0C 3X1SC 4X23B 3AV2B 5GXQD 4H9NA 1P3GB 4G91B 5AVBC 3LELB 5AV5D 1U35C 1P3BD 3AZID 4ZUXC 1S32A 4WU9C 4H9PA 3REHA 1P3LB 3X1TD 1P3PD 3W99D 5BT1C 4J8VC 4CAYA 4E45A 1KU5A 5CP6A 3AYWA 3W97D 1P3MC 4EO5C 4WU8C 5DNNA 3UT9D 3B6FB 5B40A 1HQ3D 4UUZB 3EPKA 4KUDC 2DF4C 3AZJC 3KXBC 4UPKA 4J8WD 3AZKA 2HIOC 5B2ID 4WJ3C 4HGAB 5B0ZD 1KX3D 3W98D 3B0DC 4QLCD 2Y2IA 4J8UB 1BFMA 4WNNB 1EQZB 1TZYD 3WAAB 3MGSD 3AZNC 1P3BA 3REKD 4LD9C 3VH5A 1JFIB 3AZEB 1U35B 5BNXA 4WU9B 1F66D 2RVQC 4XZQD 3AV1A 3KUYB 3W97A 5GSUC 1AOIA 3KWQD 3MGRB 2W8SA 4NE6A 5CPKC 1HQ3A 3V9RA 2J8PA 3MGPB 1P34C 2F2AC 1M19A 5C3IC 2Y2KA 4J8WA 1P3OC 4KUDB 3B6GA 3KXBB 1P3AC 3AFAC 2HIOB 3H0RC 5B0ZA 4XUJD 4YM6D 1KX3A 3LJAD 4Z2MG 5B31D 1P3FB 5B24A 4DQYB 1TZYA 1H3OA 5JRGA 3MGSA 2PYOC 2F8NB 2ZY5A 3AZHD 2CWEA 3X1UA 2BG1A 1PZRA 4M6BA 1F66A 4XZQA 4JJNB 2AROA 3A6NA 2DQNC 3AZLC 1P3IB 1N1JA 2UWXA 1P3KB 3X1VA 5AV6A 5GT0D 4KHAB 5GT3B 1W2EA 3X1SD 3UTAC 3VH6W 3W96C 5AVCC 1M1AC 4Z66C 5AVBD 1WWSA 3AZFD 4ZUXD 1KX4D 4AWLC 3MNNC 4KGCB 3WA9C 5BT1D 4J8VD 3EPHA 1P3OB 5AV8B 1P3MD 3UTBC 1KX5C 5E5AC 4WU8D 3LJAA 5B2JA 4CSRA 5DNMA 2Y2JA 2NQBD 4H9PB 3REHB 3AZJD 4KUDD 2NZDB 3TU4A 3NQUA 1R4VA 4CAYB 3MGQC 5CP6B 3AZMC 5DNNB 5B40B 5CPIB 4X23C 3AV2C 2CV5A 3AZLB 1P3GC 4G91C 2F8NH 3LELC 5B33A 3UTAB 3AZND 4LD9D 3AZFA 5B31G 1M1AB 5AV9A 3WTPC 1P3LC 1KX4A 1Z2CB 2RVQD 3MNNB 5GSUD 5BO0A 5B32B 3REIA 1M18A 5F99D 5CPKD 2NQBA 1P34D 5BNXB 1ID3A 1P3OD 3AV1B 5B1MD 4HGAC 1P3AD 3KSYA 3AFAD 3MVDA 1AOIB 1EQZC 1ZLAA 3REJD 1TAFA 3P5JB 3VH5T 3RELC 3AZGA 3IP4C 1M19B 3AZEC 2PYOD 4LD9A 3B6GB 4Z5TA 3EPJA 2Y2PA 5FUGA 4J8XA 3KUYC 3WTPB 5B1LA 5B24B 3MGRC 5AY8A 5KDMB 3F6TA 3UTAD 3LZ0A 1H3OB 5JRGB 3W96D 5AVCD 1BH9A 1M1AD 4Z66D 5F99A 3MGPC 2FJ7C 3X1UB 1P34A 3MNND 3WKJA 2Y2OA 5B1MA 2AROB 3A6NB 3C1CA 3EG5B 3WA9D 1N1JB 3AN2A 5AV6B 3UTBD 1KX5D 4R8PA 5E5AD 5CPJA 1P3FC 4YS3A 3LZ1C 3REJA 2F8NK 5GXQA 3RELB 5B0YC 5AV5A 3AZIA 1B67A 2ZY2A 3MGQD 4JJNC 1P3IC 3AZMD 3X1TA 1P3KC 1P3PA 3W99A 5B2JB 4CSRB 5GT3C 4X23D 5DNMB 3AV2D 1P3GD 2YFVA 3UT9A 3LELD 3VH5W 3TU4B 3NQUB 4NFTA 2IO5C 1P3LD 4KGCC 2FJ7B 2Y2NA 4H9SC 5AV8C 5B2IA 3B6FD 2CV5B 3W98A 4QLCA 5B33B 1S32C 4H9RA 3O62B 2NZDC 3REHC 3LZ1B 5AV9B 3H0MC 1HTAA 2LY8A 5CP6C 3AYWC 3REKA 5DNNC 3R45A 5B0YB 5CPIC 5B40C 4J8UD 3REIB 1M18B 5BS7A 1EQZD 3AV2A 2FFFB 1F1EA 3KWQA 3WAAD 4G92C 1ID3B 3FDDA 3AZED 2G5HC 1U35D 3WTPE 4WU9D 3MVDB 3KUYD 5G49A 2IO5B 5B32C 1ZLAB 1A7WA 3C1BB 3B6FA 3MGRD 1TAFB 4XUJA 4YM6A 1P3BC 5B31A 4H9NB 3MGPD 4Z5TB 1WWIA 1S32B 1BH8A 2Y2HA 4J8XB 3AV1C 3KXBD 3W97C 1AOIC 2HIOD 3AZHA 5B1LB 3AYWB 5AY8B 4J8UA 3LZ0B 1P3FD 1HQ3C 1BH9B 5BNVA 3NQJA 3A1IA 4DRAA 5GT0A 3X1SA 1B6WA 1M19C 3WAAA 3WKJB 3B6GC 2F8ND 5JA4A 1JFIA 3AZEA 5AVBA 3AZKB 1U35A 5B0ZC 3C1CB 4G92B 4ZUXA 1KX3C 4WU9A 3AN2B 2YFWA 4JJND 5CHLB 4R8PB 5CPJB 1P3ID 5B24C 4YS3B 1P3KD 4J8VA 5GT3D 1TZYC 5JRGC 1ULYA 1P3MA 4WU8A 3MGSC 5GXQB 2G5IC 3X1UC 3MGPA 2BYKA 1P3BB 5AV5B 3AZIB 2JCHA 1F66C 4KGCD 4KUDA 2ZY3A 2AROC 3A6NC 3AZJA 3KXBA 2ZY4A 3X1TB 1P3PB 2Y2GA 2HIOA 5AV8D 5AV6C 3X1VC 3W99B 3W97B 4H9OA 3UT9B 1S32D 2NZDD 3REHD 1HQ3B 3V9RB 2F8NA 2Y2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP6 D;  4J8W B;  3AZN A;  3AYW D;  5B2I B;  3LJA C;  5DNN D;  5B40 D;  5CPI D;  5B2J C;  5B0Z B;  1KX3 B;  3W98 B;  4H9Q A;  5DNM C;  4QLC B;  3AZL D;  4H9R B;  5GSU A;  3TU4 C;  1TZY B;  3MGS B;  3REK B;  5CPK A;  3R45 B;  1P3O A;  1F66 B;  4XZQ B;  2CV5 C;  5B32 D;  2F8N G;  1P3A A;  3AFA A;  2L5A A;  3X1V B;  3KWQ B;  5B33 C;  3O62 C;  4Z2M H;  3AZF C;  4WZS B;  4E44 A;  5AV9 C;  1KX4 C;  2NZD A;  2JSS A;  2BYM A;  3AV1 D;  5G49 B;  2PYO A;  1AOI D;  5CPI A;  3B0C T;  4XUJ B;  4YM6 B;  3REI C;  1M18 C;  3LJA B;  5B31 B;  3AZL A;  2NQB C;  4NE5 A;  1M19 D;  1ID3 C;  3UTA A;  1BH8 B;  3W96 A;  5AVC A;  3B6G D;  1M1A A;  4Z66 A;  3MVD C;  3AZH B;  3WTP D;  3MNN A;  1ZLA C;  3C1B C;  5B24 D;  3VH6 T;  5B32 A;  3WA9 A;  5BNV B;  3AZG C;  3NQJ B;  5JRG D;  3UTB A;  5GT0 B;  3X1S B;  5E5A A;  1KX5 A;  4Z5T C;  5JA4 B;  3X1U D;  5AVB B;  4J8X C;  3AZF B;  4ZUX B;  1KX4 B;  2YFW B;  2ARO D;  3A6N D;  5B1L C;  5AY8 C;  3X1V D;  5AV6 D;  4J8V B;  3MGQ A;  3LZ0 C;  1P3M B;  5BO0 B;  4ZBJ C;  4EO5 B;  4WU8 B;  3AZM A;  5F99 C;  4X23 A;  2BYK B;  3WKJ C;  5B32 G;  1P3G A;  3REL D;  5B1M C;  2NQB B;  3LEL A;  3AZK C;  3AZJ B;  3C1C C;  3AN2 C;  1Q9C A;  4R8P C;  5CPJ C;  3WTP A;  1P3L A;  4H9O B;  4YS3 C;  5B2J D;  4NE3 A;  3B0D B;  5DNM D;  3B0C W;  3REJ C;  5KDM A;  5GXQ C;  3TU4 D;  3AZG B;  3VH6 A;  5AV5 C;  3AZI C;  4UUZ A;  3AZN B;  4LD9 B;  2FJ7 D;  5FUG B;  3X1T C;  3W99 C;  1P3P C;  4H9Q B;  2CV5 D;  3UT9 C;  5GSU B;  4WV4 B;  5B33 D;  4WNN A;  3O62 D;  3LZ1 D;  1EQZ A;  4ZBJ B;  5AV9 D;  5F99 B;  5CPK B;  3REL A;  4J8W C;  1P34 B;  5B2I C;  5C3I B;  5B1M B;  5B0Y D;  3W98 C;  1P3A B;  4QLC C;  3AFA B;  3REI D;  3KUY A;  1M18 D;  3MGR A;  3REJ B;  2HUE C;  1ID3 D;  2BYM B;  3REK C;  2PYO B;  2FJ7 A;  3MVD D;  3B0B A;  4DRB A;  4XZQ C;  1ZLA D;  5BS7 C;  3C1B D;  3KWQ C;  3AZG D;  1P3F A;  2YFV B;  3O62 A;  3W96 B;  5AVC B;  3LZ1 A;  4Z5T D;  4Z66 B;  4J8X D;  4AWL B;  3B6F C;  5B1L D;  5B0Y A;  5AY8 D;  3WA9 B;  4XUJ C;  4YM6 C;  3LZ0 D;  4JJN A;  5B31 C;  3UTB B;  5E5A B;  1P3I A;  1KX5 B;  1P3K A;  4KHA A;  5GT3 A;  3WKJ D;  2HUE B;  3AZK D;  3C1C D;  3AZH C;  3AN2 D;  5CPJ D;  4R8P D;  3MGQ B;  4J8U C;  4KGC A;  4YS3 D;  3C1B A;  3AZM B;  4H9S A;  5AV8 A;  3WAA C;  5GT0 C;  3X1S C;  4X23 B;  3AV2 B;  5GXQ D;  4H9N A;  1P3G B;  4G91 B;  5AVB C;  3LEL B;  5AV5 D;  1U35 C;  1P3B D;  3AZI D;  4ZUX C;  1S32 A;  4WU9 C;  4H9P A;  3REH A;  1P3L B;  3X1T D;  1P3P D;  3W99 D;  5BT1 C;  4J8V C;  4CAY A;  4E45 A;  1KU5 A;  5CP6 A;  3AYW A;  3W97 D;  1P3M C;  4EO5 C;  4WU8 C;  5DNN A;  3UT9 D;  3B6F B;  5B40 A;  1HQ3 D;  4UUZ B;  4KUD C;  3AZJ C;  3KXB C;  4J8W D;  3AZK A;  2HIO C;  5B2I D;  4HGA B;  5B0Z D;  1KX3 D;  3W98 D;  3B0D C;  4QLC D;  4J8U B;  1BFM A;  4WNN B;  1EQZ B;  1TZY D;  3WAA B;  3MGS D;  3AZN C;  1P3B A;  3REK D;  4LD9 C;  3VH5 A;  1JFI B;  3AZE B;  1U35 B;  5BNX A;  4WU9 B;  1F66 D;  2RVQ C;  4XZQ D;  3AV1 A;  3KUY B;  3W97 A;  5GSU C;  1AOI A;  3KWQ D;  3MGR B;  4NE6 A;  5CPK C;  1HQ3 A;  3V9R A;  3MGP B;  1P34 C;  1M19 A;  5C3I C;  1P3O C;  4J8W A;  4KUD B;  3B6G A;  3KXB B;  1P3A C;  3AFA C;  2HIO B;  5B0Z A;  4XUJ D;  4YM6 D;  1KX3 A;  3LJA D;  4Z2M G;  5B31 D;  1P3F B;  5B24 A;  1TZY A;  1H3O A;  5JRG A;  3MGS A;  2PYO C;  2F8N B;  3AZH D;  2CWE A;  3X1U A;  4M6B A;  1F66 A;  4XZQ A;  4JJN B;  2ARO A;  3A6N A;  3AZL C;  1P3I B;  1N1J A;  1P3K B;  3X1V A;  5AV6 A;  5GT0 D;  4KHA B;  5GT3 B;  3X1S D;  3UTA C;  3VH6 W;  3W96 C;  5AVC C;  1M1A C;  4Z66 C;  5AVB D;  1WWS A;  3AZF D;  4ZUX D;  1KX4 D;  4AWL C;  3MNN C;  4KGC B;  3WA9 C;  5BT1 D;  4J8V D;  1P3O B;  5AV8 B;  1P3M D;  3UTB C;  1KX5 C;  5E5A C;  4WU8 D;  3LJA A;  5B2J A;  4CSR A;  5DNM A;  2NQB D;  4H9P B;  3REH B;  3AZJ D;  4KUD D;  2NZD B;  3TU4 A;  3NQU A;  1R4V A;  4CAY B;  3MGQ C;  5CP6 B;  3AZM C;  5DNN B;  5B40 B;  5CPI B;  4X23 C;  3AV2 C;  2CV5 A;  3AZL B;  1P3G C;  4G91 C;  2F8N H;  3LEL C;  5B33 A;  3UTA B;  3AZN D;  4LD9 D;  3AZF A;  5B31 G;  1M1A B;  5AV9 A;  3WTP C;  1P3L C;  1KX4 A;  2RVQ D;  3MNN B;  5GSU D;  5BO0 A;  5B32 B;  3REI A;  1M18 A;  5F99 D;  5CPK D;  2NQB A;  1P34 D;  5BNX B;  1ID3 A;  1P3O D;  3AV1 B;  5B1M D;  4HGA C;  1P3A D;  3KSY A;  3AFA D;  3MVD A;  1AOI B;  1EQZ C;  1ZLA A;  3REJ D;  1TAF A;  3VH5 T;  3REL C;  3AZG A;  1M19 B;  3AZE C;  2PYO D;  4LD9 A;  3B6G B;  4Z5T A;  5FUG A;  4J8X A;  3KUY C;  3WTP B;  5B1L A;  5B24 B;  3MGR C;  5AY8 A;  5KDM B;  3UTA D;  3LZ0 A;  1H3O B;  5JRG B;  3W96 D;  5AVC D;  1BH9 A;  1M1A D;  4Z66 D;  5F99 A;  3MGP C;  2FJ7 C;  3X1U B;  1P34 A;  3MNN D;  3WKJ A;  5B1M A;  2ARO B;  3A6N B;  3C1C A;  3WA9 D;  1N1J B;  3AN2 A;  5AV6 B;  3UTB D;  1KX5 D;  4R8P A;  5E5A D;  5CPJ A;  1P3F C;  4YS3 A;  3LZ1 C;  3REJ A;  2F8N K;  5GXQ A;  3REL B;  5B0Y C;  5AV5 A;  3AZI A;  1B67 A;  3MGQ D;  4JJN C;  1P3I C;  3AZM D;  3X1T A;  1P3K C;  1P3P A;  3W99 A;  5B2J B;  4CSR B;  5GT3 C;  4X23 D;  5DNM B;  3AV2 D;  1P3G D;  2YFV A;  3UT9 A;  3LEL D;  3VH5 W;  3TU4 B;  3NQU B;  4NFT A;  2IO5 C;  1P3L D;  4KGC C;  2FJ7 B;  4H9S C;  5AV8 C;  5B2I A;  3B6F D;  2CV5 B;  3W98 A;  4QLC A;  5B33 B;  1S32 C;  4H9R A;  3O62 B;  2NZD C;  3REH C;  3LZ1 B;  5AV9 B;  1HTA A;  2LY8 A;  5CP6 C;  3AYW C;  3REK A;  5DNN C;  3R45 A;  5B0Y B;  5CPI C;  5B40 C;  4J8U D;  3REI B;  1M18 B;  5BS7 A;  1EQZ D;  3AV2 A;  1F1E A;  3KWQ A;  3WAA D;  4G92 C;  1ID3 B;  3AZE D;  1U35 D;  3WTP E;  4WU9 D;  3MVD B;  3KUY D;  5G49 A;  2IO5 B;  5B32 C;  1ZLA B;  1A7W A;  3C1B B;  3B6F A;  3MGR D;  1TAF B;  4XUJ A;  4YM6 A;  1P3B C;  5B31 A;  4H9N B;  3MGP D;  4Z5T B;  1WWI A;  1S32 B;  1BH8 A;  4J8X B;  3AV1 C;  3KXB D;  3W97 C;  1AOI C;  2HIO D;  3AZH A;  5B1L B;  3AYW B;  5AY8 B;  4J8U A;  3LZ0 B;  1P3F D;  1HQ3 C;  1BH9 B;  5BNV A;  3NQJ A;  4DRA A;  5GT0 A;  3X1S A;  1B6W A;  1M19 C;  3WAA A;  3WKJ B;  3B6G C;  2F8N D;  5JA4 A;  1JFI A;  3AZE A;  5AVB A;  3AZK B;  1U35 A;  5B0Z C;  3C1C B;  4G92 B;  4ZUX A;  1KX3 C;  4WU9 A;  3AN2 B;  2YFW A;  4JJN D;  5CHL B;  4R8P B;  5CPJ B;  1P3I D;  5B24 C;  4YS3 B;  1P3K D;  4J8V A;  5GT3 D;  1TZY C;  5JRG C;  1ULY A;  1P3M A;  4WU8 A;  3MGS C;  5GXQ B;  3X1U C;  3MGP A;  2BYK A;  1P3B B;  5AV5 B;  3AZI B;  1F66 C;  4KGC D;  4KUD A;  3AZJ A;  2ARO C;  3A6N C;  3KXB A;  3X1T B;  1P3P B;  3W99 B;  2HIO A;  5AV8 D;  5AV6 C;  3X1V C;  3W97 B;  4H9O A;  3UT9 B;  1S32 D;  2NZD D;  3REH D;  1HQ3 B;  3V9R B;  2F8N A; 
#chains in the Genus database with same CATH topology
 5CP6 D;  4J8W B;  3AZN A;  3AYW D;  5B2I B;  3LJA C;  5DNN D;  5B40 D;  5CPI D;  5B2J C;  5B0Z B;  1KX3 B;  3W98 B;  4H9Q A;  5DNM C;  4QLC B;  3AZL D;  4H9R B;  5GSU A;  3TU4 C;  1TZY B;  3MGS B;  3REK B;  5CPK A;  3R45 B;  1T3U A;  2Y2M A;  1P3O A;  4XZQ B;  1F66 B;  2CV5 C;  5B32 D;  2F8N G;  1P3A A;  3AFA A;  2L5A A;  3X1V B;  3KWQ B;  5B33 C;  3O62 C;  4Z2M H;  3AZF C;  4WZS B;  4E44 A;  5AV9 C;  1KX4 C;  2NZD A;  2JSS A;  2BYM A;  3AV1 D;  5G49 B;  2PYO A;  3EPL A;  1AOI D;  5CPI A;  3B0C T;  4XUJ B;  4YM6 B;  3REI C;  1M18 C;  3LJA B;  5B31 B;  3AZL A;  2NQB C;  4NE5 A;  1M19 D;  1ID3 C;  3UTA A;  1BH8 B;  3W96 A;  3H0L C;  5AVC A;  3B6G D;  1M1A A;  4Z66 A;  3MVD C;  3AZH B;  3WTP D;  3MNN A;  1ZLA C;  3C1B C;  5B24 D;  3VH6 T;  5B32 A;  3WA9 A;  5BNV B;  3AZG C;  3NQJ B;  5JRG D;  3UTB A;  5GT0 B;  3X1S B;  5E5A A;  1KX5 A;  4Z5T C;  5JA4 B;  3X1U D;  5AVB B;  4J8X C;  3AZF B;  4ZUX B;  1KX4 B;  3AL0 C;  2YFW B;  2ARO D;  2VQR A;  3A6N D;  5B1L C;  5AY8 C;  3X1V D;  5AV6 D;  4J8V B;  2Y2Q A;  3MGQ A;  3LZ0 C;  1P3M B;  5BO0 B;  4ZBJ C;  4EO5 B;  4WU8 B;  3AZM A;  5F99 C;  4X23 A;  2BYK B;  3WKJ C;  5B32 G;  1P3G A;  3REL D;  5B1M C;  2NQB B;  3LEL A;  3AZK C;  3AZJ B;  3C1C C;  3AN2 C;  1Q9C A;  4R8P C;  5CPJ C;  3WTP A;  1P3L A;  4H9O B;  4YS3 C;  5B2J D;  4NE3 A;  3B0D B;  5DNM D;  2XD1 A;  3B0C W;  3REJ C;  5KDM A;  5GXQ C;  3TU4 D;  3AZG B;  3VH6 A;  5AV5 C;  2XD5 A;  3AZI C;  4UUZ A;  3AZN B;  4LD9 B;  2FJ7 D;  5FUG B;  3X1T C;  3W99 C;  1P3P C;  4H9Q B;  2CV5 D;  2RIQ A;  5GSU B;  3UT9 C;  4WV4 B;  5B33 D;  4WNN A;  3O62 D;  3LZ1 D;  2ZM5 A;  1EQZ A;  4ZBJ B;  5AV9 D;  5F99 B;  5CPK B;  3REL A;  4J8W C;  1P34 B;  5B2I C;  5C3I B;  5B1M B;  5B0Y D;  3KFU G;  3W98 C;  1P3A B;  4QLC C;  3AFA B;  3REI D;  3KUY A;  1M18 D;  3MGR A;  3REJ B;  2HUE C;  1ID3 D;  2BYM B;  3REK C;  2PYO B;  2FJ7 A;  3MVD D;  3B0B A;  4DRB A;  4XZQ C;  1ZLA D;  5BS7 C;  3C1B D;  3KWQ C;  3AZG D;  1P3F A;  2YFV B;  3O62 A;  3W96 B;  5AVC B;  3LZ1 A;  4Z5T D;  4Z66 B;  4J8X D;  4AWL B;  3B6F C;  5B1L D;  5B0Y A;  5AY8 D;  3WA9 B;  4XUJ C;  4YM6 C;  3LZ0 D;  4JJN A;  5B31 C;  3UTB B;  5E5A B;  2JE5 A;  1P3I A;  1KX5 B;  1P3K A;  4KHA A;  5GT3 A;  3WKJ D;  3A1K A;  2HUE B;  3AZK D;  3C1C D;  3AZH C;  3AN2 D;  5CPJ D;  4R8P D;  3MGQ B;  4J8U C;  4KGC A;  4YS3 D;  3C1B A;  3AZM B;  4H9S A;  5AV8 A;  3WAA C;  5GT0 C;  3X1S C;  4X23 B;  3AV2 B;  5GXQ D;  4H9N A;  1P3G B;  4G91 B;  5AVB C;  3LEL B;  5AV5 D;  1U35 C;  1P3B D;  3AZI D;  4ZUX C;  1S32 A;  4WU9 C;  4H9P A;  3REH A;  1P3L B;  3X1T D;  1P3P D;  3W99 D;  5BT1 C;  4J8V C;  4CAY A;  4E45 A;  1KU5 A;  5CP6 A;  3AYW A;  3W97 D;  1P3M C;  4EO5 C;  4WU8 C;  5DNN A;  3UT9 D;  3B6F B;  5B40 A;  1HQ3 D;  4UUZ B;  3EPK A;  4KUD C;  2DF4 C;  3AZJ C;  3KXB C;  4UPK A;  4J8W D;  3AZK A;  2HIO C;  5B2I D;  4WJ3 C;  4HGA B;  5B0Z D;  1KX3 D;  3W98 D;  3B0D C;  4QLC D;  2Y2I A;  4J8U B;  1BFM A;  4WNN B;  1EQZ B;  1TZY D;  3WAA B;  3MGS D;  3AZN C;  1P3B A;  3REK D;  4LD9 C;  3VH5 A;  1JFI B;  3AZE B;  1U35 B;  5BNX A;  4WU9 B;  1F66 D;  2RVQ C;  4XZQ D;  3AV1 A;  3KUY B;  3W97 A;  5GSU C;  1AOI A;  3KWQ D;  3MGR B;  2W8S A;  4NE6 A;  5CPK C;  1HQ3 A;  3V9R A;  2J8P A;  3MGP B;  1P34 C;  2F2A C;  1M19 A;  5C3I C;  2Y2K A;  4J8W A;  1P3O C;  4KUD B;  3B6G A;  3KXB B;  1P3A C;  3AFA C;  2HIO B;  3H0R C;  5B0Z A;  4XUJ D;  4YM6 D;  1KX3 A;  3LJA D;  4Z2M G;  5B31 D;  1P3F B;  5B24 A;  4DQY B;  1TZY A;  1H3O A;  5JRG A;  3MGS A;  2PYO C;  2F8N B;  2ZY5 A;  3AZH D;  2CWE A;  3X1U A;  2BG1 A;  1PZR A;  4M6B A;  1F66 A;  4XZQ A;  4JJN B;  2ARO A;  3A6N A;  2DQN C;  3AZL C;  1P3I B;  1N1J A;  2UWX A;  1P3K B;  3X1V A;  5AV6 A;  5GT0 D;  4KHA B;  5GT3 B;  1W2E A;  3X1S D;  3UTA C;  3VH6 W;  3W96 C;  5AVC C;  1M1A C;  4Z66 C;  5AVB D;  1WWS A;  3AZF D;  4ZUX D;  1KX4 D;  4AWL C;  3MNN C;  4KGC B;  3WA9 C;  5BT1 D;  4J8V D;  3EPH A;  1P3O B;  5AV8 B;  1P3M D;  3UTB C;  1KX5 C;  5E5A C;  4WU8 D;  3LJA A;  5B2J A;  4CSR A;  5DNM A;  2Y2J A;  2NQB D;  4H9P B;  3REH B;  3AZJ D;  4KUD D;  2NZD B;  3TU4 A;  3NQU A;  1R4V A;  4CAY B;  3MGQ C;  5CP6 B;  3AZM C;  5DNN B;  5B40 B;  5CPI B;  4X23 C;  3AV2 C;  2CV5 A;  3AZL B;  1P3G C;  4G91 C;  2F8N H;  3LEL C;  5B33 A;  3UTA B;  3AZN D;  4LD9 D;  3AZF A;  5B31 G;  1M1A B;  5AV9 A;  3WTP C;  1P3L C;  1KX4 A;  1Z2C B;  2RVQ D;  3MNN B;  5GSU D;  5BO0 A;  5B32 B;  3REI A;  1M18 A;  5F99 D;  5CPK D;  2NQB A;  1P34 D;  5BNX B;  1ID3 A;  1P3O D;  3AV1 B;  5B1M D;  4HGA C;  1P3A D;  3KSY A;  3AFA D;  3MVD A;  1AOI B;  1EQZ C;  1ZLA A;  3REJ D;  1TAF A;  3P5J B;  3VH5 T;  3REL C;  3AZG A;  3IP4 C;  1M19 B;  3AZE C;  2PYO D;  4LD9 A;  3B6G B;  4Z5T A;  3EPJ A;  2Y2P A;  5FUG A;  4J8X A;  3KUY C;  3WTP B;  5B1L A;  5B24 B;  3MGR C;  5AY8 A;  5KDM B;  3F6T A;  3UTA D;  3LZ0 A;  1H3O B;  5JRG B;  3W96 D;  5AVC D;  1BH9 A;  1M1A D;  4Z66 D;  5F99 A;  3MGP C;  2FJ7 C;  3X1U B;  1P34 A;  3MNN D;  3WKJ A;  2Y2O A;  5B1M A;  2ARO B;  3A6N B;  3C1C A;  3EG5 B;  3WA9 D;  1N1J B;  3AN2 A;  5AV6 B;  3UTB D;  1KX5 D;  4R8P A;  5E5A D;  5CPJ A;  1P3F C;  4YS3 A;  3LZ1 C;  3REJ A;  2F8N K;  5GXQ A;  3REL B;  5B0Y C;  5AV5 A;  3AZI A;  1B67 A;  2ZY2 A;  3MGQ D;  4JJN C;  1P3I C;  3AZM D;  3X1T A;  1P3K C;  1P3P A;  3W99 A;  5B2J B;  4CSR B;  5GT3 C;  4X23 D;  5DNM B;  3AV2 D;  1P3G D;  2YFV A;  3UT9 A;  3LEL D;  3VH5 W;  3TU4 B;  3NQU B;  4NFT A;  2IO5 C;  1P3L D;  4KGC C;  2FJ7 B;  2Y2N A;  4H9S C;  5AV8 C;  5B2I A;  3B6F D;  2CV5 B;  3W98 A;  4QLC A;  5B33 B;  1S32 C;  4H9R A;  3O62 B;  2NZD C;  3REH C;  3LZ1 B;  5AV9 B;  3H0M C;  1HTA A;  2LY8 A;  5CP6 C;  3AYW C;  3REK A;  5DNN C;  3R45 A;  5B0Y B;  5CPI C;  5B40 C;  4J8U D;  3REI B;  1M18 B;  5BS7 A;  1EQZ D;  3AV2 A;  2FFF B;  1F1E A;  3KWQ A;  3WAA D;  4G92 C;  1ID3 B;  3FDD A;  3AZE D;  2G5H C;  1U35 D;  3WTP E;  4WU9 D;  3MVD B;  3KUY D;  5G49 A;  2IO5 B;  5B32 C;  1ZLA B;  1A7W A;  3C1B B;  3B6F A;  3MGR D;  1TAF B;  4XUJ A;  4YM6 A;  1P3B C;  5B31 A;  4H9N B;  3MGP D;  4Z5T B;  1WWI A;  1S32 B;  1BH8 A;  2Y2H A;  4J8X B;  3AV1 C;  3KXB D;  3W97 C;  1AOI C;  2HIO D;  3AZH A;  5B1L B;  3AYW B;  5AY8 B;  4J8U A;  3LZ0 B;  1P3F D;  1HQ3 C;  1BH9 B;  5BNV A;  3NQJ A;  3A1I A;  4DRA A;  5GT0 A;  3X1S A;  1B6W A;  1M19 C;  3WAA A;  3WKJ B;  3B6G C;  2F8N D;  5JA4 A;  1JFI A;  3AZE A;  5AVB A;  3AZK B;  1U35 A;  5B0Z C;  3C1C B;  4G92 B;  4ZUX A;  1KX3 C;  4WU9 A;  3AN2 B;  2YFW A;  4JJN D;  5CHL B;  4R8P B;  5CPJ B;  1P3I D;  5B24 C;  4YS3 B;  1P3K D;  4J8V A;  5GT3 D;  1TZY C;  5JRG C;  1ULY A;  1P3M A;  4WU8 A;  3MGS C;  5GXQ B;  2G5I C;  3X1U C;  3MGP A;  2BYK A;  1P3B B;  5AV5 B;  3AZI B;  2JCH A;  1F66 C;  4KGC D;  4KUD A;  2ZY3 A;  2ARO C;  3A6N C;  3AZJ A;  3KXB A;  2ZY4 A;  3X1T B;  1P3P B;  2Y2G A;  2HIO A;  5AV8 D;  5AV6 C;  3X1V C;  3W99 B;  3W97 B;  4H9O A;  3UT9 B;  1S32 D;  2NZD D;  3REH D;  1HQ3 B;  3V9R B;  2F8N A;  2Y2L A; 
#chains in the Genus database with same CATH homology
 5CP6 D;  4J8W B;  3AZN A;  3AYW D;  5B2I B;  3LJA C;  5DNN D;  5B40 D;  5CPI D;  5B2J C;  5B0Z B;  1KX3 B;  3W98 B;  4H9Q A;  5DNM C;  4QLC B;  3AZL D;  4H9R B;  5GSU A;  3TU4 C;  1TZY B;  3MGS B;  3REK B;  5CPK A;  3R45 B;  1T3U A;  2Y2M A;  1P3O A;  4XZQ B;  1F66 B;  2CV5 C;  5B32 D;  2F8N G;  1P3A A;  3AFA A;  2L5A A;  3X1V B;  3KWQ B;  5B33 C;  3O62 C;  4Z2M H;  3AZF C;  4WZS B;  4E44 A;  5AV9 C;  1KX4 C;  2NZD A;  2JSS A;  2BYM A;  3AV1 D;  5G49 B;  2PYO A;  3EPL A;  1AOI D;  5CPI A;  3B0C T;  4XUJ B;  4YM6 B;  3REI C;  1M18 C;  3LJA B;  5B31 B;  3AZL A;  2NQB C;  4NE5 A;  1M19 D;  1ID3 C;  3UTA A;  1BH8 B;  3W96 A;  3H0L C;  5AVC A;  3B6G D;  1M1A A;  4Z66 A;  3MVD C;  3AZH B;  3WTP D;  3MNN A;  1ZLA C;  3C1B C;  5B24 D;  3VH6 T;  5B32 A;  3WA9 A;  5BNV B;  3AZG C;  3NQJ B;  5JRG D;  3UTB A;  5GT0 B;  3X1S B;  5E5A A;  1KX5 A;  4Z5T C;  5JA4 B;  3X1U D;  5AVB B;  4J8X C;  3AZF B;  4ZUX B;  1KX4 B;  3AL0 C;  2YFW B;  2ARO D;  2VQR A;  3A6N D;  5B1L C;  5AY8 C;  3X1V D;  5AV6 D;  4J8V B;  2Y2Q A;  3MGQ A;  3LZ0 C;  1P3M B;  5BO0 B;  4ZBJ C;  4EO5 B;  4WU8 B;  3AZM A;  5F99 C;  4X23 A;  2BYK B;  3WKJ C;  5B32 G;  1P3G A;  3REL D;  5B1M C;  2NQB B;  3LEL A;  3AZK C;  3AZJ B;  3C1C C;  3AN2 C;  1Q9C A;  4R8P C;  5CPJ C;  3WTP A;  1P3L A;  4H9O B;  4YS3 C;  5B2J D;  4NE3 A;  3B0D B;  5DNM D;  2XD1 A;  3B0C W;  3REJ C;  5KDM A;  5GXQ C;  3TU4 D;  3AZG B;  3VH6 A;  5AV5 C;  2XD5 A;  3AZI C;  4UUZ A;  3AZN B;  4LD9 B;  2FJ7 D;  5FUG B;  3X1T C;  3W99 C;  1P3P C;  4H9Q B;  2CV5 D;  2RIQ A;  5GSU B;  3UT9 C;  4WV4 B;  5B33 D;  4WNN A;  3O62 D;  3LZ1 D;  2ZM5 A;  1EQZ A;  4ZBJ B;  5AV9 D;  5F99 B;  5CPK B;  3REL A;  4J8W C;  1P34 B;  5B2I C;  5C3I B;  5B1M B;  5B0Y D;  3KFU G;  3W98 C;  1P3A B;  4QLC C;  3AFA B;  3REI D;  3KUY A;  1M18 D;  3MGR A;  3REJ B;  2HUE C;  1ID3 D;  2BYM B;  3REK C;  2PYO B;  2FJ7 A;  3MVD D;  3B0B A;  4DRB A;  4XZQ C;  1ZLA D;  5BS7 C;  3C1B D;  3KWQ C;  3AZG D;  1P3F A;  2YFV B;  3O62 A;  3W96 B;  5AVC B;  3LZ1 A;  4Z5T D;  4Z66 B;  4J8X D;  4AWL B;  3B6F C;  5B1L D;  5B0Y A;  5AY8 D;  3WA9 B;  4XUJ C;  4YM6 C;  3LZ0 D;  4JJN A;  5B31 C;  3UTB B;  5E5A B;  2JE5 A;  1P3I A;  1KX5 B;  1P3K A;  4KHA A;  5GT3 A;  3WKJ D;  3A1K A;  2HUE B;  3AZK D;  3C1C D;  3AZH C;  3AN2 D;  5CPJ D;  4R8P D;  3MGQ B;  4J8U C;  4KGC A;  4YS3 D;  3C1B A;  3AZM B;  4H9S A;  5AV8 A;  3WAA C;  5GT0 C;  3X1S C;  4X23 B;  3AV2 B;  5GXQ D;  4H9N A;  1P3G B;  4G91 B;  5AVB C;  3LEL B;  5AV5 D;  1U35 C;  1P3B D;  3AZI D;  4ZUX C;  1S32 A;  4WU9 C;  4H9P A;  3REH A;  1P3L B;  3X1T D;  1P3P D;  3W99 D;  5BT1 C;  4J8V C;  4CAY A;  4E45 A;  1KU5 A;  5CP6 A;  3AYW A;  3W97 D;  1P3M C;  4EO5 C;  4WU8 C;  5DNN A;  3UT9 D;  3B6F B;  5B40 A;  1HQ3 D;  4UUZ B;  3EPK A;  4KUD C;  2DF4 C;  3AZJ C;  3KXB C;  4UPK A;  4J8W D;  3AZK A;  2HIO C;  5B2I D;  4WJ3 C;  4HGA B;  5B0Z D;  1KX3 D;  3W98 D;  3B0D C;  4QLC D;  2Y2I A;  4J8U B;  1BFM A;  4WNN B;  1EQZ B;  1TZY D;  3WAA B;  3MGS D;  3AZN C;  1P3B A;  3REK D;  4LD9 C;  3VH5 A;  1JFI B;  3AZE B;  1U35 B;  5BNX A;  4WU9 B;  1F66 D;  2RVQ C;  4XZQ D;  3AV1 A;  3KUY B;  3W97 A;  5GSU C;  1AOI A;  3KWQ D;  3MGR B;  2W8S A;  4NE6 A;  5CPK C;  1HQ3 A;  3V9R A;  2J8P A;  3MGP B;  1P34 C;  2F2A C;  1M19 A;  5C3I C;  2Y2K A;  4J8W A;  1P3O C;  4KUD B;  3B6G A;  3KXB B;  1P3A C;  3AFA C;  2HIO B;  3H0R C;  5B0Z A;  4XUJ D;  4YM6 D;  1KX3 A;  3LJA D;  4Z2M G;  5B31 D;  1P3F B;  5B24 A;  4DQY B;  1TZY A;  1H3O A;  5JRG A;  3MGS A;  2PYO C;  2F8N B;  2ZY5 A;  3AZH D;  2CWE A;  3X1U A;  2BG1 A;  1PZR A;  4M6B A;  1F66 A;  4XZQ A;  4JJN B;  2ARO A;  3A6N A;  2DQN C;  3AZL C;  1P3I B;  1N1J A;  2UWX A;  1P3K B;  3X1V A;  5AV6 A;  5GT0 D;  4KHA B;  5GT3 B;  1W2E A;  3X1S D;  3UTA C;  3VH6 W;  3W96 C;  5AVC C;  1M1A C;  4Z66 C;  5AVB D;  1WWS A;  3AZF D;  4ZUX D;  1KX4 D;  4AWL C;  3MNN C;  4KGC B;  3WA9 C;  5BT1 D;  4J8V D;  3EPH A;  1P3O B;  5AV8 B;  1P3M D;  3UTB C;  1KX5 C;  5E5A C;  4WU8 D;  3LJA A;  5B2J A;  4CSR A;  5DNM A;  2Y2J A;  2NQB D;  4H9P B;  3REH B;  3AZJ D;  4KUD D;  2NZD B;  3TU4 A;  3NQU A;  1R4V A;  4CAY B;  3MGQ C;  5CP6 B;  3AZM C;  5DNN B;  5B40 B;  5CPI B;  4X23 C;  3AV2 C;  2CV5 A;  3AZL B;  1P3G C;  4G91 C;  2F8N H;  3LEL C;  5B33 A;  3UTA B;  3AZN D;  4LD9 D;  3AZF A;  5B31 G;  1M1A B;  5AV9 A;  3WTP C;  1P3L C;  1KX4 A;  1Z2C B;  2RVQ D;  3MNN B;  5GSU D;  5BO0 A;  5B32 B;  3REI A;  1M18 A;  5F99 D;  5CPK D;  2NQB A;  1P34 D;  5BNX B;  1ID3 A;  1P3O D;  3AV1 B;  5B1M D;  4HGA C;  1P3A D;  3KSY A;  3AFA D;  3MVD A;  1AOI B;  1EQZ C;  1ZLA A;  3REJ D;  1TAF A;  3P5J B;  3VH5 T;  3REL C;  3AZG A;  3IP4 C;  1M19 B;  3AZE C;  2PYO D;  4LD9 A;  3B6G B;  4Z5T A;  3EPJ A;  2Y2P A;  5FUG A;  4J8X A;  3KUY C;  3WTP B;  5B1L A;  5B24 B;  3MGR C;  5AY8 A;  5KDM B;  3F6T A;  3UTA D;  3LZ0 A;  1H3O B;  5JRG B;  3W96 D;  5AVC D;  1BH9 A;  1M1A D;  4Z66 D;  5F99 A;  3MGP C;  2FJ7 C;  3X1U B;  1P34 A;  3MNN D;  3WKJ A;  2Y2O A;  5B1M A;  2ARO B;  3A6N B;  3C1C A;  3EG5 B;  3WA9 D;  1N1J B;  3AN2 A;  5AV6 B;  3UTB D;  1KX5 D;  4R8P A;  5E5A D;  5CPJ A;  1P3F C;  4YS3 A;  3LZ1 C;  3REJ A;  2F8N K;  5GXQ A;  3REL B;  5B0Y C;  5AV5 A;  3AZI A;  1B67 A;  2ZY2 A;  3MGQ D;  4JJN C;  1P3I C;  3AZM D;  3X1T A;  1P3K C;  1P3P A;  3W99 A;  5B2J B;  4CSR B;  5GT3 C;  4X23 D;  5DNM B;  3AV2 D;  1P3G D;  2YFV A;  3UT9 A;  3LEL D;  3VH5 W;  3TU4 B;  3NQU B;  4NFT A;  2IO5 C;  1P3L D;  4KGC C;  2FJ7 B;  2Y2N A;  4H9S C;  5AV8 C;  5B2I A;  3B6F D;  2CV5 B;  3W98 A;  4QLC A;  5B33 B;  1S32 C;  4H9R A;  3O62 B;  2NZD C;  3REH C;  3LZ1 B;  5AV9 B;  3H0M C;  1HTA A;  2LY8 A;  5CP6 C;  3AYW C;  3REK A;  5DNN C;  3R45 A;  5B0Y B;  5CPI C;  5B40 C;  4J8U D;  3REI B;  1M18 B;  5BS7 A;  1EQZ D;  3AV2 A;  2FFF B;  1F1E A;  3KWQ A;  3WAA D;  4G92 C;  1ID3 B;  3FDD A;  3AZE D;  2G5H C;  1U35 D;  3WTP E;  4WU9 D;  3MVD B;  3KUY D;  5G49 A;  2IO5 B;  5B32 C;  1ZLA B;  1A7W A;  3C1B B;  3B6F A;  3MGR D;  1TAF B;  4XUJ A;  4YM6 A;  1P3B C;  5B31 A;  4H9N B;  3MGP D;  4Z5T B;  1WWI A;  1S32 B;  1BH8 A;  2Y2H A;  4J8X B;  3AV1 C;  3KXB D;  3W97 C;  1AOI C;  2HIO D;  3AZH A;  5B1L B;  3AYW B;  5AY8 B;  4J8U A;  3LZ0 B;  1P3F D;  1HQ3 C;  1BH9 B;  5BNV A;  3NQJ A;  3A1I A;  4DRA A;  5GT0 A;  3X1S A;  1B6W A;  1M19 C;  3WAA A;  3WKJ B;  3B6G C;  2F8N D;  5JA4 A;  1JFI A;  3AZE A;  5AVB A;  3AZK B;  1U35 A;  5B0Z C;  3C1C B;  4G92 B;  4ZUX A;  1KX3 C;  4WU9 A;  3AN2 B;  2YFW A;  4JJN D;  5CHL B;  4R8P B;  5CPJ B;  1P3I D;  5B24 C;  4YS3 B;  1P3K D;  4J8V A;  5GT3 D;  1TZY C;  5JRG C;  1ULY A;  1P3M A;  4WU8 A;  3MGS C;  5GXQ B;  2G5I C;  3X1U C;  3MGP A;  2BYK A;  1P3B B;  5AV5 B;  3AZI B;  2JCH A;  1F66 C;  4KGC D;  4KUD A;  2ZY3 A;  2ARO C;  3A6N C;  3AZJ A;  3KXB A;  2ZY4 A;  3X1T B;  1P3P B;  2Y2G A;  2HIO A;  5AV8 D;  5AV6 C;  3X1V C;  3W99 B;  3W97 B;  4H9O A;  3UT9 B;  1S32 D;  2NZD D;  3REH D;  1HQ3 B;  3V9R B;  2F8N A;  2Y2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...