3UTAC

Crystal structure of nucleosome core particle assembled with an alpha-satellite sequence containing two ttaaa elements (ncp-ta2)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utaC00
5GT3D 3LZ0C 2NZDD 3B0CT 3W97A 4WU9A 4KUDB 5GXQD 1P3GA 1P3KC 1P3LD 5B2JC 3W99B 5B2ID 3MGQD 3R45B 4H9PB 5AV6A 5AV8A 3AZMB 5CPKD 4AWLC 5JRGC 5B1LC 5C3IB 5B33A 5DNMA 4QLCB 2PYOD 4EO5C 1S32C 4WU8A 1P3FC 3LZ1C 3WA9B 3LZ0D 5AV5C 3MVDB 1P34C 4KGCA 5B0YD 1P3KD 3NQUB 3AZHD 5B2JD 4Z2MG 3AFAC 3NQJA 3AZLC 4HGAC 2AROB 3VH6T 3MGSC 5GT3A 5JRGD 1Q9CA 2NZDA 5B1LD 1M18C 5BO0A 5B24C 3AZEB 1P3LA 4JJNC 5AVCB 1JFIA 1S32D 1P3FD 3LZ1D 3WKJA 3REIC 3REHA 4ZUXD 3AZGB 4XZQA 2YFWA 3UTAC 5AV6B 3AFAD 3REKC 3X1TA 3AZLD 5B31B 3X1VC 4KUDC 3MGSD 3LZ0A 1M18D 5B24D 3W99C 1ZLAB 5CPIC 4JJND 3AZKB 5GSUB 3AZMC 5FUGA 3LJAA 5C3IC 1EQZB 4QLCC 3AZID 4G92B 5B1MB 2BYMB 3AN2A 1H3OA 1F1EA 4NE3A 3WA9C 3A6ND 5B0ZC 4J8WB 2RVQC 5DNNA 3MVDC 4E45A 3X1VD 3LZ1A 4KUDD 3UT9B 5AV5A 1P34A 4J8VC 5CPJA 5CPID 4G91B 3AZMD 1KU5A 2HIOB 4LD9A 3AZEC 3B6GD 4NE5A 5B24A 4H9RA 4WU9C 3WA9D 1P3GC 5B0ZD 2RVQD 3MVDD 5B32B 3AZGC 3C1CB 4CAYA 1BH8A 3C1BD 1HTAA 5AV8C 5AV6C 3REIA 4Z66A 4J8VD 3RELD 1KX4A 1ULYA 5AV9B 5GT0B 5B31C 3UTAA 3REKA 4XUJB 1WWIA 4H9SC 3AZED 3AN2B 1F66B 4NE6A 5BNXB 3KXBB 3AZKC 5B40B 3B0DB 5DNNB 3W99A 4DRBA 3R45A 4H9PA 4WU9D 4UUZB 1P3GD 3AZMA 1EQZC 5AY8B 4G92C 5CPJB 5B1MC 4J8XB 4QLCA 5AV6D 5AV8D 4J8WC 1P3IA 5B31D 3WA9A 5DNMD 2FJ7B 3NQUA 4G91C 3AYWB 3MGPB 2HIOC 2AROA 4XZQC 1EQZD 4YM6B 4R8PB 1N1JB 5B1MD 1KX5B 4Z5TB 3X1UB 5AVCA 4KHAB 4J8WD 4WZSB 5B32C 3C1CC 1P3PB 3AZGA 5AV9C 5BT1C 5GT0C 1B6WA 3LJAC 1P3AB 1AOIB 3WKJD 3REHD 5B31A 2HIOD 4XZQD 3AN2C 1F66C 3X1TD 1P3IB 4H9SA 3AZFB 5DNNC 1ZLAA 3AZKA 5GSUA 5CPJC 5B32D 3C1CD 3KUYA 1EQZA 4J8XC 1P3BB 1KX3A 5B1MA 2BYMA 5AV9D 5GT0D 3LJAD 4LD9C 3AV2A 4J8WA 2FJ7C 3W98B 3VH5T 3AN2D 4J8UB 3UT9A 3AYWC 1M1AB 5DNND 4YM6C 3VH6W 4R8PC 5AV5D 4Z66C 2HIOA 5CPJD 1P34D 1KX4C 4Z5TC 4J8XD 3X1UC 4LD9D 5KDMA 2CWEA 1P3PC 5CP6A 5B32A 3C1CA 1AOIC 3X1SA 4CSRB 4YS3B 5AV9A 5GT0A 2NQBB 3KUYB 4YM6D 3REID 1A7WA 4XUJA 4Z66D 3UTBB 3AV1B 1P3MB 1P3IC 1KX3B 1KX4D 3AZFC 3UTAD 3X1UD 1F66A 5BNXA 3AV2B 3KXBA 5B31G 3REKD 5B40A 2F8NB 4X23B 4UUZA 1P3PD 3MGRB 1P3BC 5AY8A 1WWSA 3W99D 4J8XA 1U35B 1AOID 2AROC 3B6FB 3W98C 3AZJB 3TU4A 4QLCD 5F99B 4J8UC 2FJ7A 5AVCC 1M1AC 1P3ID 3AZFD 5KDMB 3AYWA 5CP6B 3MGPA 4YM6A 1P3BD 5GXQB 4R8PA 3X1SB 1B67A 1N1JA 1KX5A 4Z5TA 3X1UA 2AROD 5G49B 4KHAA 5B2IB 3MGQB 3W98D 5CPKB 1P3PA 1ZLAC 3W96A 4J8UD 5GSUC 5AVCD 2PYOB 1P3AA 1AOIA 2NQBC 3KUYC 5B32G 3UTBC 3AZGD 1KX3C 5BS7A 5B0YB 3AV2C 5JA4B 3AZHB 2BYKB 3AZFA 1ID3B 4X23C 3MGRC 3TU4B 3UT9C 4AWLB 5JRGB 5BNVB 1ZLAD 1P3BA 3WTPB 3AZKD 1U35C 5GSUD 3WTPE 2YFVB 3B6FC 1BH9B 3AZJC 3KUYD 1S32B 1P3FB 5F99C 3W98A 3UTBD 1KX3D 4ZUXB 4J8UA 4WNNB 3AV2D 1M1AA 5CP6C 3VH6A 3V9RB 3AFAB 2LY8A 3B0BA 3AZLB 3MGRD 3W96B 4H9OA 3UT9D 3X1SC 4H9NB 1TZYB 5B2IC 3B6FD 3KWQB 4JJNB 4XUJC 5AVBA 3AZJD 3B0CW 2L5AA 3REJB 3KXBC 5B40C 3AZIB 3WAAB 3B0DC 3MNNB 2PYOC 3LELB 5CP6D 4CSRA 5AY8C 4YS3A 3A6NB 2NQBA 4E44A 5E5AB 3X1VB 5B0YC 3X1SD 3UTBA 3AV1A 1P3MA 3AZHC 1M19B 5BT1D 1ID3C 2F8NH 2F8NA 1HQ3B 3TU4C 5CPIB 4H9QB 4XUJD 4X23A 3MGRA 1F66D 3WTPC 3KXBD 5B40D 2HUEB 3MGPC 3B6GB 1U35A 1P3OA 5AY8D 4H9OB 3B6FA 3O62B 5B0ZB 3AZJA 1KX5C 5F99A 4ZUXC 3VH5W 3C1BB 2CV5B 5AVBB 4J8VB 1R4VA 3RELB 1ID3D 3TU4D 3W96C 4M6BA 2FJ7D 1P3AC 4ZBJB 3WTPD 5GXQA 3AYWD 1TZYC 3MGPD 3KWQC 3AZNB 2IO5B 5G49A 5B2IA 3MGQA 3W97B 4WU9B 4R8PD 5BS7C 3REJC 1P3GB 5CPKA 3AZIC 1KX5D 3WAAC 4Z5TD 3MNNC 3LELC 5AV8B 2PYOA 3A6NC 5E5AC 3W96D 5B33B 5DNMB 1M19C 1P3AD 3KSYA 1P3OB 5B0YA 1TZYD 1P3KA 1HQ3C 5JA4A 4WU8B 3KWQD 2BYKA 3AZHA 5B2JA 1ID3A 4KGCB 3REJD 2HUEC 5JRGA 2F8NG 5BNVA 3MNND 5B1LA 2F8NK 3LELD 3B6GC 3NQJB 3WAAD 3WTPA 2YFVA 3O62C 1BH9A 5GT3B 2NZDB 1S32A 5E5AD 1P3FA 1TAFA 5BO0B 3C1BC 1P3LB 1M19D 2CV5C 5AVBC 4ZUXA 3RELC 1JFIB 4WNNA 1HQ3D 3V9RA 3AFAA 3WKJB 3REHB 3AZLA 4ZBJC 4XZQB 3MGSA 1M1AD 2YFWB 4YS3C 3AZNC 2IO5C 3X1TB 1M18A 4H9NA 1TZYA 3W97C 3KWQA 4JJNA 3O62D 4DRAA 3AV1C 1P3MC 3LZ0B 3REJA 1P3KB 3AZIA 2JSSA 3MNNA 3WAAA 5B2JB 5AVBD 3LELA 5FUGB 2CV5D 3LJAB 1BFMA 3A6NA 5DNMC 5B33C 4NFTA 5B1LB 5E5AA 3X1VA 1P3OC 4KUDA 1H3OB 4WU8C 4YS3D 3AZND 1M19A 4EO5B 4Z2MH 2NQBD 3W97D 1HQ3A 4KGCC 3LZ1B 1TAFB 4H9QA 5CPIA 3AV1D 1P3MD 5AV5B 1P34B 4WV4B 2F8ND 5CHLB 3B6GA 4X23D 5GT3C 2NZDC 4HGAB 4LD9B 3VH5A 5GXQC 5B0ZA 5B33D 3O62A 3MGSB 1P3LC 3MVDA 1U35D 1P3OD 1M18B 5B24B 4H9RB 3MGQC 3C1BA 4WU8D 2CV5A 4J8VA 3RELA 5CPKC 3WKJC 3REHC 4KGCD 5F99D 4CAYB 1BH8B 3REIB 4Z66B 3X1TC 1KX4B 3AZEA 3UTAB 3AZNA 3REKB
chains in the Genus database with same CATH superfamily
5GT3D 3LZ0C 2NZDD 3B0CT 3W97A 4WU9A 2Y2LA 5GXQD 1P3GA 4KUDB 1P3KC 1P3LD 5B2JC 3W99B 5B2ID 3MGQD 3R45B 4H9PB 5AV6A 5AV8A 3AZMB 5CPKD 4AWLC 5JRGC 5B1LC 5C3IB 5B33A 5DNMA 4QLCB 2PYOD 4EO5C 3WAAA 1S32C 4WU8A 1P3FC 3LZ1C 3WA9B 3LZ0D 5AV5C 3MVDB 1P34C 4KGCA 2ZY5A 5B0YD 1P3KD 3NQUB 3AZHD 5B2JD 4Z2MG 3AFAC 3NQJA 3AZLC 4HGAC 2AROB 3VH6T 3MGSC 5GT3A 5JRGD 1Q9CA 2NZDA 5B1LD 1M18C 5BO0A 5B24C 3AZEB 1P3LA 4JJNC 5AVCB 1JFIA 1S32D 3FDDA 1P3FD 3LZ1D 3WKJA 3REIC 3REHA 4ZUXD 4DQYB 3AZGB 4XZQA 2YFWA 3UTAC 5AV6B 3AFAD 3REKC 3X1TA 3AZLD 5B31B 3X1VC 4KUDC 3MGSD 3LZ0A 1M18D 5B24D 3W99C 1ZLAB 5CPIC 4JJND 3AZKB 5GSUB 3AZMC 5FUGA 3LJAA 5C3IC 1EQZB 4QLCC 3AZID 4G92B 5B1MB 2BYMB 3EPHA 3AN2A 1H3OA 1F1EA 4NE3A 3WA9C 3A6ND 5B0ZC 4J8WB 2RVQC 5DNNA 3MVDC 4E45A 3X1VD 3LZ1A 4KUDD 3UT9B 5AV5A 1P34A 4J8VC 5CPJA 5CPID 4G91B 3AZMD 1KU5A 2HIOB 4LD9A 3AZEC 3B6GD 4NE5A 5B24A 4H9RA 4WU9C 3WA9D 1P3GC 5B0ZD 2RVQD 3MVDD 5B32B 3AZGC 3C1CB 4CAYA 1BH8A 3C1BD 1HTAA 5AV8C 5AV6C 3REIA 4Z66A 4J8VD 3RELD 1KX4A 1ULYA 5AV9B 5GT0B 5B31C 3UTAA 3REKA 4XUJB 1WWIA 2Y2NA 4H9SC 3AZED 3AN2B 1F66B 4NE6A 5BNXB 3KXBB 3AZKC 5B40B 3B0DB 5DNNB 2Y2IA 4DRBA 3W99A 3R45A 4H9PA 4WU9D 3A1KA 4UUZB 1P3GD 3AZMA 1EQZC 5AY8B 4G92C 5CPJB 5B1MC 4J8XB 4QLCA 5AV6D 5AV8D 4J8WC 1P3IA 5B31D 3WA9A 5DNMD 2FJ7B 3NQUA 4G91C 3AYWB 3MGPB 2HIOC 2AROA 4XZQC 1EQZD 4YM6B 4R8PB 1N1JB 3H0MC 5B1MD 1KX5B 4Z5TB 3X1UB 5AVCA 4KHAB 2G5HC 4J8WD 4WZSB 5B32C 3C1CC 1P3PB 2Y2QA 3AZGA 5AV9C 5BT1C 5GT0C 1B6WA 3LJAC 1P3AB 1AOIB 3WKJD 3REHD 5B31A 2HIOD 4XZQD 3AN2C 1F66C 3X1TD 1P3IB 4H9SA 3AZFB 5DNNC 1ZLAA 3AZKA 5GSUA 5CPJC 5B32D 3C1CD 3KUYA 1EQZA 4J8XC 1P3BB 1KX3A 5B1MA 2BYMA 5AV9D 5GT0D 3LJAD 2F2AC 4UPKA 3AV2A 4LD9C 4J8WA 2FJ7C 3W98B 3VH5T 2ZM5A 3AN2D 4J8UB 3UT9A 3AYWC 1M1AB 5DNND 4YM6C 3VH6W 4R8PC 5AV5D 4Z66C 2HIOA 5CPJD 1P34D 1KX4C 4Z5TC 4J8XD 3X1UC 4LD9D 5KDMA 2CWEA 1P3PC 5CP6A 5B32A 3C1CA 1AOIC 3X1SA 4CSRB 4YS3B 5AV9A 5GT0A 2NQBB 3KUYB 4YM6D 3REID 1A7WA 4XUJA 4Z66D 3UTBB 3AV1B 1P3MB 2FFFB 1P3IC 1KX3B 3AZFC 1KX4D 2Y2MA 3X1UD 3UTAD 1F66A 5BNXA 3AV2B 3KXBA 5B31G 3REKD 5B40A 2F8NB 4X23B 3AL0C 3EPJA 4UUZA 1P3PD 3MGRB 1P3BC 5AY8A 2JE5A 1WWSA 3W99D 4J8XA 2UWXA 1U35B 1AOID 2AROC 1W2EA 3B6FB 3W98C 3AZJB 3TU4A 4QLCD 5F99B 4J8UC 2FJ7A 5AVCC 1M1AC 1P3ID 3AZFD 5KDMB 3AYWA 2DF4C 5CP6B 3MGPA 4YM6A 1P3BD 2Y2PA 5GXQB 4R8PA 3X1SB 1B67A 1N1JA 1KX5A 4Z5TA 3X1UA 2AROD 5G49B 4KHAA 5B2IB 3MGQB 3W98D 1T3UA 5CPKB 1P3PA 1ZLAC 3W96A 4J8UD 5GSUC 5AVCD 2PYOB 1P3AA 1AOIA 2NQBC 3KUYC 2Y2JA 5B32G 3UTBC 3AZGD 1KX3C 5BS7A 5B0YB 3AV2C 5JA4B 3AZHB 2BYKB 3AZFA 1ID3B 4X23C 3MGRC 3TU4B 3UT9C 4AWLB 5JRGB 4WJ3C 5BNVB 1ZLAD 1P3BA 3WTPB 3AZKD 1U35C 5GSUD 3WTPE 2YFVB 3B6FC 1BH9B 3AZJC 3KUYD 1S32B 1P3FB 5F99C 3W98A 3UTBD 1KX3D 4ZUXB 4J8UA 4WNNB 3AV2D 1M1AA 5CP6C 3VH6A 3V9RB 3AFAB 2LY8A 3B0BA 3EPKA 3MGRD 3AZLB 3W96B 4H9OA 3UT9D 3X1SC 2RIQA 4H9NB 1TZYB 5B2IC 3B6FD 3KWQB 4JJNB 4XUJC 5AVBA 3AZJD 3P5JB 3B0CW 2L5AA 3REJB 3KXBC 5B40C 3AZIB 3WAAB 3B0DC 3MNNB 2PYOC 3LELB 5CP6D 4CSRA 5AY8C 4YS3A 3A6NB 2NQBA 4E44A 5E5AB 3X1VB 5B0YC 3X1SD 3UTBA 3AV1A 1P3MA 3AZHC 1M19B 2W8SA 5BT1D 1ID3C 2F8NH 2F8NA 1HQ3B 3TU4C 5CPIB 4H9QB 4XUJD 2Y2GA 4X23A 3MGRA 1F66D 3WTPC 3KXBD 5B40D 2HUEB 3MGPC 2ZY2A 3B6GB 2VQRA 1U35A 1P3OA 2BG1A 5AY8D 4H9OB 3B6FA 3O62B 5B0ZB 3AZJA 2Y2KA 1KX5C 5F99A 4ZUXC 3VH5W 3C1BB 2CV5B 5AVBB 4J8VB 1R4VA 3RELB 1ID3D 2DQNC 3TU4D 2Y2OA 3W96C 4M6BA 2FJ7D 1P3AC 4ZBJB 3WTPD 5GXQA 3AYWD 1TZYC 3MGPD 3F6TA 3KWQC 3AZNB 2IO5B 3H0RC 5G49A 5B2IA 3MGQA 3W97B 4WU9B 4R8PD 5BS7C 3REJC 1P3GB 5CPKA 3AZIC 1KX5D 3WAAC 4Z5TD 3MNNC 3LELC 5AV8B 3EPLA 2PYOA 3A6NC 5E5AC 3W96D 3A1IA 5B33B 5DNMB 1M19C 1P3AD 3KSYA 1P3OB 5B0YA 1TZYD 1P3KA 1HQ3C 5JA4A 4WU8B 3KWQD 2BYKA 3H0LC 5B2JA 3AZHA 1ID3A 2ZY3A 4KGCB 3REJD 2HUEC 5JRGA 2F8NG 5BNVA 3MNND 5B1LA 2F8NK 3LELD 3B6GC 3NQJB 2JCHA 3WTPA 3WAAD 2YFVA 3O62C 1BH9A 5GT3B 2NZDB 1S32A 5E5AD 1P3FA 1TAFA 5BO0B 3C1BC 1P3LB 1M19D 2CV5C 5AVBC 4ZUXA 3RELC 1JFIB 4WNNA 1HQ3D 3V9RA 3AFAA 2XD5A 3WKJB 3REHB 3AZLA 4ZBJC 4XZQB 3MGSA 1M1AD 2YFWB 4YS3C 3AZNC 2IO5C 3X1TB 1M18A 3EG5B 4H9NA 1TZYA 3W97C 3KWQA 4JJNA 3O62D 4DRAA 3AV1C 1P3MC 3LZ0B 3REJA 1P3KB 3AZIA 2G5IC 2JSSA 3MNNA 5B2JB 5AVBD 2J8PA 5FUGB 3LELA 1PZRA 2CV5D 3LJAB 1BFMA 3A6NA 5DNMC 5B33C 4NFTA 5B1LB 5E5AA 3IP4C 3X1VA 3KFUG 1P3OC 4KUDA 1H3OB 1Z2CB 4YS3D 4WU8C 3AZND 1M19A 2Y2HA 4EO5B 4Z2MH 2NQBD 3W97D 1HQ3A 4KGCC 3LZ1B 1TAFB 4H9QA 5CPIA 3AV1D 1P3MD 5AV5B 1P34B 4WV4B 2F8ND 5CHLB 3B6GA 4X23D 5GT3C 2NZDC 4HGAB 4LD9B 3VH5A 5GXQC 5B0ZA 5B33D 3O62A 3MGSB 1P3LC 3MVDA 1U35D 1P3OD 1M18B 5B24B 4H9RB 3MGQC 3C1BA 4WU8D 2CV5A 4J8VA 3RELA 2XD1A 5CPKC 3WKJC 3REHC 2ZY4A 4KGCD 5F99D 4CAYB 1BH8B 3REIB 4Z66B 3X1TC 1KX4B 3AZEA 3UTAB 3AZNA 3REKB
chains in the Genus database with same CATH topology
5GT3D 3LZ0C 2NZDD 3B0CT 3W97A 4WU9A 2Y2LA 5GXQD 1P3GA 4KUDB 1P3KC 1P3LD 5B2JC 3W99B 5B2ID 3MGQD 3R45B 4H9PB 5AV6A 5AV8A 3AZMB 5CPKD 4AWLC 5JRGC 5B1LC 5C3IB 5B33A 5DNMA 4QLCB 2PYOD 4EO5C 3WAAA 1S32C 4WU8A 1P3FC 3LZ1C 3WA9B 3LZ0D 5AV5C 3MVDB 1P34C 4KGCA 2ZY5A 5B0YD 1P3KD 3NQUB 3AZHD 5B2JD 4Z2MG 3AFAC 3NQJA 3AZLC 4HGAC 2AROB 3VH6T 3MGSC 5GT3A 5JRGD 1Q9CA 2NZDA 5B1LD 1M18C 5BO0A 5B24C 3AZEB 1P3LA 4JJNC 5AVCB 1JFIA 1S32D 3FDDA 1P3FD 3LZ1D 3WKJA 3REIC 3REHA 4ZUXD 4DQYB 3AZGB 4XZQA 2YFWA 3UTAC 5AV6B 3AFAD 3REKC 3X1TA 3AZLD 5B31B 3X1VC 4KUDC 3MGSD 3LZ0A 1M18D 5B24D 3W99C 1ZLAB 5CPIC 4JJND 3AZKB 5GSUB 3AZMC 5FUGA 3LJAA 5C3IC 1EQZB 4QLCC 3AZID 4G92B 5B1MB 2BYMB 3EPHA 3AN2A 1H3OA 1F1EA 4NE3A 3WA9C 3A6ND 5B0ZC 4J8WB 2RVQC 5DNNA 3MVDC 4E45A 3X1VD 3LZ1A 4KUDD 3UT9B 5AV5A 1P34A 4J8VC 5CPJA 5CPID 4G91B 3AZMD 1KU5A 2HIOB 4LD9A 3AZEC 3B6GD 4NE5A 5B24A 4H9RA 4WU9C 3WA9D 1P3GC 5B0ZD 2RVQD 3MVDD 5B32B 3AZGC 3C1CB 4CAYA 1BH8A 3C1BD 1HTAA 5AV8C 5AV6C 3REIA 4Z66A 4J8VD 3RELD 1KX4A 1ULYA 5AV9B 5GT0B 5B31C 3UTAA 3REKA 4XUJB 1WWIA 2Y2NA 4H9SC 3AZED 3AN2B 1F66B 4NE6A 5BNXB 3KXBB 3AZKC 5B40B 3B0DB 5DNNB 2Y2IA 4DRBA 3W99A 3R45A 4H9PA 4WU9D 3A1KA 4UUZB 1P3GD 3AZMA 1EQZC 5AY8B 4G92C 5CPJB 5B1MC 4J8XB 4QLCA 5AV6D 5AV8D 4J8WC 1P3IA 5B31D 3WA9A 5DNMD 2FJ7B 3NQUA 4G91C 3AYWB 3MGPB 2HIOC 2AROA 4XZQC 1EQZD 4YM6B 4R8PB 1N1JB 3H0MC 5B1MD 1KX5B 4Z5TB 3X1UB 5AVCA 4KHAB 2G5HC 4J8WD 4WZSB 5B32C 3C1CC 1P3PB 2Y2QA 3AZGA 5AV9C 5BT1C 5GT0C 1B6WA 3LJAC 1P3AB 1AOIB 3WKJD 3REHD 5B31A 2HIOD 4XZQD 3AN2C 1F66C 3X1TD 1P3IB 4H9SA 3AZFB 5DNNC 1ZLAA 3AZKA 5GSUA 5CPJC 5B32D 3C1CD 3KUYA 1EQZA 4J8XC 1P3BB 1KX3A 5B1MA 2BYMA 5AV9D 5GT0D 3LJAD 2F2AC 4UPKA 3AV2A 4LD9C 4J8WA 2FJ7C 3W98B 3VH5T 2ZM5A 3AN2D 4J8UB 3UT9A 3AYWC 1M1AB 5DNND 4YM6C 3VH6W 4R8PC 5AV5D 4Z66C 2HIOA 5CPJD 1P34D 1KX4C 4Z5TC 4J8XD 3X1UC 4LD9D 5KDMA 2CWEA 1P3PC 5CP6A 5B32A 3C1CA 1AOIC 3X1SA 4CSRB 4YS3B 5AV9A 5GT0A 2NQBB 3KUYB 4YM6D 3REID 1A7WA 4XUJA 4Z66D 3UTBB 3AV1B 1P3MB 2FFFB 1P3IC 1KX3B 3AZFC 1KX4D 2Y2MA 3X1UD 3UTAD 1F66A 5BNXA 3AV2B 3KXBA 5B31G 3REKD 5B40A 2F8NB 4X23B 3AL0C 3EPJA 4UUZA 1P3PD 3MGRB 1P3BC 5AY8A 2JE5A 1WWSA 3W99D 4J8XA 2UWXA 1U35B 1AOID 2AROC 1W2EA 3B6FB 3W98C 3AZJB 3TU4A 4QLCD 5F99B 4J8UC 2FJ7A 5AVCC 1M1AC 1P3ID 3AZFD 5KDMB 3AYWA 2DF4C 5CP6B 3MGPA 4YM6A 1P3BD 2Y2PA 5GXQB 4R8PA 3X1SB 1B67A 1N1JA 1KX5A 4Z5TA 3X1UA 2AROD 5G49B 4KHAA 5B2IB 3MGQB 3W98D 1T3UA 5CPKB 1P3PA 1ZLAC 3W96A 4J8UD 5GSUC 5AVCD 2PYOB 1P3AA 1AOIA 2NQBC 3KUYC 2Y2JA 5B32G 3UTBC 3AZGD 1KX3C 5BS7A 5B0YB 3AV2C 5JA4B 3AZHB 2BYKB 3AZFA 1ID3B 4X23C 3MGRC 3TU4B 3UT9C 4AWLB 5JRGB 4WJ3C 5BNVB 1ZLAD 1P3BA 3WTPB 3AZKD 1U35C 5GSUD 3WTPE 2YFVB 3B6FC 1BH9B 3AZJC 3KUYD 1S32B 1P3FB 5F99C 3W98A 3UTBD 1KX3D 4ZUXB 4J8UA 4WNNB 3AV2D 1M1AA 5CP6C 3VH6A 3V9RB 3AFAB 2LY8A 3B0BA 3EPKA 3MGRD 3AZLB 3W96B 4H9OA 3UT9D 3X1SC 2RIQA 4H9NB 1TZYB 5B2IC 3B6FD 3KWQB 4JJNB 4XUJC 5AVBA 3AZJD 3P5JB 3B0CW 2L5AA 3REJB 3KXBC 5B40C 3AZIB 3WAAB 3B0DC 3MNNB 2PYOC 3LELB 5CP6D 4CSRA 5AY8C 4YS3A 3A6NB 2NQBA 4E44A 5E5AB 3X1VB 5B0YC 3X1SD 3UTBA 3AV1A 1P3MA 3AZHC 1M19B 2W8SA 5BT1D 1ID3C 2F8NH 2F8NA 1HQ3B 3TU4C 5CPIB 4H9QB 4XUJD 2Y2GA 4X23A 3MGRA 1F66D 3WTPC 3KXBD 5B40D 2HUEB 3MGPC 2ZY2A 3B6GB 2VQRA 1U35A 1P3OA 2BG1A 5AY8D 4H9OB 3B6FA 3O62B 5B0ZB 3AZJA 2Y2KA 1KX5C 5F99A 4ZUXC 3VH5W 3C1BB 2CV5B 5AVBB 4J8VB 1R4VA 3RELB 1ID3D 2DQNC 3TU4D 2Y2OA 3W96C 4M6BA 2FJ7D 1P3AC 4ZBJB 3WTPD 5GXQA 3AYWD 1TZYC 3MGPD 3F6TA 3KWQC 3AZNB 2IO5B 3H0RC 5G49A 5B2IA 3MGQA 3W97B 4WU9B 4R8PD 5BS7C 3REJC 1P3GB 5CPKA 3AZIC 1KX5D 3WAAC 4Z5TD 3MNNC 3LELC 5AV8B 3EPLA 2PYOA 3A6NC 5E5AC 3W96D 3A1IA 5B33B 5DNMB 1M19C 1P3AD 3KSYA 1P3OB 5B0YA 1TZYD 1P3KA 1HQ3C 5JA4A 4WU8B 3KWQD 2BYKA 3H0LC 5B2JA 3AZHA 1ID3A 2ZY3A 4KGCB 3REJD 2HUEC 5JRGA 2F8NG 5BNVA 3MNND 5B1LA 2F8NK 3LELD 3B6GC 3NQJB 2JCHA 3WTPA 3WAAD 2YFVA 3O62C 1BH9A 5GT3B 2NZDB 1S32A 5E5AD 1P3FA 1TAFA 5BO0B 3C1BC 1P3LB 1M19D 2CV5C 5AVBC 4ZUXA 3RELC 1JFIB 4WNNA 1HQ3D 3V9RA 3AFAA 2XD5A 3WKJB 3REHB 3AZLA 4ZBJC 4XZQB 3MGSA 1M1AD 2YFWB 4YS3C 3AZNC 2IO5C 3X1TB 1M18A 3EG5B 4H9NA 1TZYA 3W97C 3KWQA 4JJNA 3O62D 4DRAA 3AV1C 1P3MC 3LZ0B 3REJA 1P3KB 3AZIA 2G5IC 2JSSA 3MNNA 5B2JB 5AVBD 2J8PA 5FUGB 3LELA 1PZRA 2CV5D 3LJAB 1BFMA 3A6NA 5DNMC 5B33C 4NFTA 5B1LB 5E5AA 3IP4C 3X1VA 3KFUG 1P3OC 4KUDA 1H3OB 1Z2CB 4YS3D 4WU8C 3AZND 1M19A 2Y2HA 4EO5B 4Z2MH 2NQBD 3W97D 1HQ3A 4KGCC 3LZ1B 1TAFB 4H9QA 5CPIA 3AV1D 1P3MD 5AV5B 1P34B 4WV4B 2F8ND 5CHLB 3B6GA 4X23D 5GT3C 2NZDC 4HGAB 4LD9B 3VH5A 5GXQC 5B0ZA 5B33D 3O62A 3MGSB 1P3LC 3MVDA 1U35D 1P3OD 1M18B 5B24B 4H9RB 3MGQC 3C1BA 4WU8D 2CV5A 4J8VA 3RELA 2XD1A 5CPKC 3WKJC 3REHC 2ZY4A 4KGCD 5F99D 4CAYB 1BH8B 3REIB 4Z66B 3X1TC 1KX4B 3AZEA 3UTAB 3AZNA 3REKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT3 D;  3LZ0 C;  2NZD D;  3B0C T;  3W97 A;  4WU9 A;  4KUD B;  5GXQ D;  1P3G A;  1P3K C;  1P3L D;  5B2J C;  3W99 B;  5B2I D;  3MGQ D;  3R45 B;  4H9P B;  5AV6 A;  5AV8 A;  3AZM B;  5CPK D;  4AWL C;  5JRG C;  5B1L C;  5C3I B;  5B33 A;  5DNM A;  4QLC B;  2PYO D;  4EO5 C;  1S32 C;  4WU8 A;  1P3F C;  3LZ1 C;  3WA9 B;  3LZ0 D;  5AV5 C;  3MVD B;  1P34 C;  4KGC A;  5B0Y D;  1P3K D;  3NQU B;  3AZH D;  5B2J D;  4Z2M G;  3AFA C;  3NQJ A;  3AZL C;  4HGA C;  2ARO B;  3VH6 T;  3MGS C;  5GT3 A;  5JRG D;  1Q9C A;  2NZD A;  5B1L D;  1M18 C;  5BO0 A;  5B24 C;  3AZE B;  1P3L A;  4JJN C;  5AVC B;  1JFI A;  1S32 D;  1P3F D;  3LZ1 D;  3WKJ A;  3REI C;  3REH A;  4ZUX D;  3AZG B;  4XZQ A;  2YFW A;  3UTA C;  5AV6 B;  3AFA D;  3REK C;  3X1T A;  3AZL D;  5B31 B;  3X1V C;  4KUD C;  3MGS D;  3LZ0 A;  1M18 D;  5B24 D;  3W99 C;  1ZLA B;  5CPI C;  4JJN D;  3AZK B;  5GSU B;  3AZM C;  5FUG A;  3LJA A;  5C3I C;  1EQZ B;  4QLC C;  3AZI D;  4G92 B;  5B1M B;  2BYM B;  3AN2 A;  1H3O A;  1F1E A;  4NE3 A;  3WA9 C;  3A6N D;  5B0Z C;  4J8W B;  2RVQ C;  5DNN A;  3MVD C;  4E45 A;  3X1V D;  3LZ1 A;  4KUD D;  3UT9 B;  5AV5 A;  1P34 A;  4J8V C;  5CPJ A;  5CPI D;  4G91 B;  3AZM D;  1KU5 A;  2HIO B;  4LD9 A;  3AZE C;  3B6G D;  4NE5 A;  5B24 A;  4H9R A;  4WU9 C;  3WA9 D;  1P3G C;  5B0Z D;  2RVQ D;  3MVD D;  5B32 B;  3AZG C;  3C1C B;  4CAY A;  1BH8 A;  3C1B D;  1HTA A;  5AV8 C;  5AV6 C;  3REI A;  4Z66 A;  4J8V D;  3REL D;  1KX4 A;  1ULY A;  5AV9 B;  5GT0 B;  5B31 C;  3UTA A;  3REK A;  4XUJ B;  1WWI A;  4H9S C;  3AZE D;  3AN2 B;  1F66 B;  4NE6 A;  5BNX B;  3KXB B;  3AZK C;  5B40 B;  3B0D B;  5DNN B;  3W99 A;  4DRB A;  3R45 A;  4H9P A;  4WU9 D;  4UUZ B;  1P3G D;  3AZM A;  1EQZ C;  5AY8 B;  4G92 C;  5CPJ B;  5B1M C;  4J8X B;  4QLC A;  5AV6 D;  5AV8 D;  4J8W C;  1P3I A;  5B31 D;  3WA9 A;  5DNM D;  2FJ7 B;  3NQU A;  4G91 C;  3AYW B;  3MGP B;  2HIO C;  2ARO A;  4XZQ C;  1EQZ D;  4YM6 B;  4R8P B;  1N1J B;  5B1M D;  1KX5 B;  4Z5T B;  3X1U B;  5AVC A;  4KHA B;  4J8W D;  4WZS B;  5B32 C;  3C1C C;  1P3P B;  3AZG A;  5AV9 C;  5BT1 C;  5GT0 C;  1B6W A;  3LJA C;  1P3A B;  1AOI B;  3WKJ D;  3REH D;  5B31 A;  2HIO D;  4XZQ D;  3AN2 C;  1F66 C;  3X1T D;  1P3I B;  4H9S A;  3AZF B;  5DNN C;  1ZLA A;  3AZK A;  5GSU A;  5CPJ C;  5B32 D;  3C1C D;  3KUY A;  1EQZ A;  4J8X C;  1P3B B;  1KX3 A;  5B1M A;  2BYM A;  5AV9 D;  5GT0 D;  3LJA D;  4LD9 C;  3AV2 A;  4J8W A;  2FJ7 C;  3W98 B;  3VH5 T;  3AN2 D;  4J8U B;  3UT9 A;  3AYW C;  1M1A B;  5DNN D;  4YM6 C;  3VH6 W;  4R8P C;  5AV5 D;  4Z66 C;  2HIO A;  5CPJ D;  1P34 D;  1KX4 C;  4Z5T C;  4J8X D;  3X1U C;  4LD9 D;  5KDM A;  2CWE A;  1P3P C;  5CP6 A;  5B32 A;  3C1C A;  1AOI C;  3X1S A;  4CSR B;  4YS3 B;  5AV9 A;  5GT0 A;  2NQB B;  3KUY B;  4YM6 D;  3REI D;  1A7W A;  4XUJ A;  4Z66 D;  3UTB B;  3AV1 B;  1P3M B;  1P3I C;  1KX3 B;  1KX4 D;  3AZF C;  3UTA D;  3X1U D;  1F66 A;  5BNX A;  3AV2 B;  3KXB A;  5B31 G;  3REK D;  5B40 A;  2F8N B;  4X23 B;  4UUZ A;  1P3P D;  3MGR B;  1P3B C;  5AY8 A;  1WWS A;  3W99 D;  4J8X A;  1U35 B;  1AOI D;  2ARO C;  3B6F B;  3W98 C;  3AZJ B;  3TU4 A;  4QLC D;  5F99 B;  4J8U C;  2FJ7 A;  5AVC C;  1M1A C;  1P3I D;  3AZF D;  5KDM B;  3AYW A;  5CP6 B;  3MGP A;  4YM6 A;  1P3B D;  5GXQ B;  4R8P A;  3X1S B;  1B67 A;  1N1J A;  1KX5 A;  4Z5T A;  3X1U A;  2ARO D;  5G49 B;  4KHA A;  5B2I B;  3MGQ B;  3W98 D;  5CPK B;  1P3P A;  1ZLA C;  3W96 A;  4J8U D;  5GSU C;  5AVC D;  2PYO B;  1P3A A;  1AOI A;  2NQB C;  3KUY C;  5B32 G;  3UTB C;  3AZG D;  1KX3 C;  5BS7 A;  5B0Y B;  3AV2 C;  5JA4 B;  3AZH B;  2BYK B;  3AZF A;  1ID3 B;  4X23 C;  3MGR C;  3TU4 B;  3UT9 C;  4AWL B;  5JRG B;  5BNV B;  1ZLA D;  1P3B A;  3WTP B;  3AZK D;  1U35 C;  5GSU D;  3WTP E;  2YFV B;  3B6F C;  1BH9 B;  3AZJ C;  3KUY D;  1S32 B;  1P3F B;  5F99 C;  3W98 A;  3UTB D;  1KX3 D;  4ZUX B;  4J8U A;  4WNN B;  3AV2 D;  1M1A A;  5CP6 C;  3VH6 A;  3V9R B;  3AFA B;  2LY8 A;  3B0B A;  3AZL B;  3MGR D;  3W96 B;  4H9O A;  3UT9 D;  3X1S C;  4H9N B;  1TZY B;  5B2I C;  3B6F D;  3KWQ B;  4JJN B;  4XUJ C;  5AVB A;  3AZJ D;  3B0C W;  2L5A A;  3REJ B;  3KXB C;  5B40 C;  3AZI B;  3WAA B;  3B0D C;  3MNN B;  2PYO C;  3LEL B;  5CP6 D;  4CSR A;  5AY8 C;  4YS3 A;  3A6N B;  2NQB A;  4E44 A;  5E5A B;  3X1V B;  5B0Y C;  3X1S D;  3UTB A;  3AV1 A;  1P3M A;  3AZH C;  1M19 B;  5BT1 D;  1ID3 C;  2F8N H;  2F8N A;  1HQ3 B;  3TU4 C;  5CPI B;  4H9Q B;  4XUJ D;  4X23 A;  3MGR A;  1F66 D;  3WTP C;  3KXB D;  5B40 D;  2HUE B;  3MGP C;  3B6G B;  1U35 A;  1P3O A;  5AY8 D;  4H9O B;  3B6F A;  3O62 B;  5B0Z B;  3AZJ A;  1KX5 C;  5F99 A;  4ZUX C;  3VH5 W;  3C1B B;  2CV5 B;  5AVB B;  4J8V B;  1R4V A;  3REL B;  1ID3 D;  3TU4 D;  3W96 C;  4M6B A;  2FJ7 D;  1P3A C;  4ZBJ B;  3WTP D;  5GXQ A;  3AYW D;  1TZY C;  3MGP D;  3KWQ C;  3AZN B;  2IO5 B;  5G49 A;  5B2I A;  3MGQ A;  3W97 B;  4WU9 B;  4R8P D;  5BS7 C;  3REJ C;  1P3G B;  5CPK A;  3AZI C;  1KX5 D;  3WAA C;  4Z5T D;  3MNN C;  3LEL C;  5AV8 B;  2PYO A;  3A6N C;  5E5A C;  3W96 D;  5B33 B;  5DNM B;  1M19 C;  1P3A D;  3KSY A;  1P3O B;  5B0Y A;  1TZY D;  1P3K A;  1HQ3 C;  5JA4 A;  4WU8 B;  3KWQ D;  2BYK A;  3AZH A;  5B2J A;  1ID3 A;  4KGC B;  3REJ D;  2HUE C;  5JRG A;  2F8N G;  5BNV A;  3MNN D;  5B1L A;  2F8N K;  3LEL D;  3B6G C;  3NQJ B;  3WAA D;  3WTP A;  2YFV A;  3O62 C;  1BH9 A;  5GT3 B;  2NZD B;  1S32 A;  5E5A D;  1P3F A;  1TAF A;  5BO0 B;  3C1B C;  1P3L B;  1M19 D;  2CV5 C;  5AVB C;  4ZUX A;  3REL C;  1JFI B;  4WNN A;  1HQ3 D;  3V9R A;  3AFA A;  3WKJ B;  3REH B;  3AZL A;  4ZBJ C;  4XZQ B;  3MGS A;  1M1A D;  2YFW B;  4YS3 C;  3AZN C;  2IO5 C;  3X1T B;  1M18 A;  4H9N A;  1TZY A;  3W97 C;  3KWQ A;  4JJN A;  3O62 D;  4DRA A;  3AV1 C;  1P3M C;  3LZ0 B;  3REJ A;  1P3K B;  3AZI A;  2JSS A;  3MNN A;  3WAA A;  5B2J B;  5AVB D;  3LEL A;  5FUG B;  2CV5 D;  3LJA B;  1BFM A;  3A6N A;  5DNM C;  5B33 C;  4NFT A;  5B1L B;  5E5A A;  3X1V A;  1P3O C;  4KUD A;  1H3O B;  4WU8 C;  4YS3 D;  3AZN D;  1M19 A;  4EO5 B;  4Z2M H;  2NQB D;  3W97 D;  1HQ3 A;  4KGC C;  3LZ1 B;  1TAF B;  4H9Q A;  5CPI A;  3AV1 D;  1P3M D;  5AV5 B;  1P34 B;  4WV4 B;  2F8N D;  5CHL B;  3B6G A;  4X23 D;  5GT3 C;  2NZD C;  4HGA B;  4LD9 B;  3VH5 A;  5GXQ C;  5B0Z A;  5B33 D;  3O62 A;  3MGS B;  1P3L C;  3MVD A;  1U35 D;  1P3O D;  1M18 B;  5B24 B;  4H9R B;  3MGQ C;  3C1B A;  4WU8 D;  2CV5 A;  4J8V A;  3REL A;  5CPK C;  3WKJ C;  3REH C;  4KGC D;  5F99 D;  4CAY B;  1BH8 B;  3REI B;  4Z66 B;  3X1T C;  1KX4 B;  3AZE A;  3UTA B;  3AZN A;  3REK B; 
#chains in the Genus database with same CATH topology
 5GT3 D;  3LZ0 C;  2NZD D;  3B0C T;  3W97 A;  4WU9 A;  2Y2L A;  5GXQ D;  1P3G A;  4KUD B;  1P3K C;  1P3L D;  5B2J C;  3W99 B;  5B2I D;  3MGQ D;  3R45 B;  4H9P B;  5AV6 A;  5AV8 A;  3AZM B;  5CPK D;  4AWL C;  5JRG C;  5B1L C;  5C3I B;  5B33 A;  5DNM A;  4QLC B;  2PYO D;  4EO5 C;  3WAA A;  1S32 C;  4WU8 A;  1P3F C;  3LZ1 C;  3WA9 B;  3LZ0 D;  5AV5 C;  3MVD B;  1P34 C;  4KGC A;  2ZY5 A;  5B0Y D;  1P3K D;  3NQU B;  3AZH D;  5B2J D;  4Z2M G;  3AFA C;  3NQJ A;  3AZL C;  4HGA C;  2ARO B;  3VH6 T;  3MGS C;  5GT3 A;  5JRG D;  1Q9C A;  2NZD A;  5B1L D;  1M18 C;  5BO0 A;  5B24 C;  3AZE B;  1P3L A;  4JJN C;  5AVC B;  1JFI A;  1S32 D;  3FDD A;  1P3F D;  3LZ1 D;  3WKJ A;  3REI C;  3REH A;  4ZUX D;  4DQY B;  3AZG B;  4XZQ A;  2YFW A;  3UTA C;  5AV6 B;  3AFA D;  3REK C;  3X1T A;  3AZL D;  5B31 B;  3X1V C;  4KUD C;  3MGS D;  3LZ0 A;  1M18 D;  5B24 D;  3W99 C;  1ZLA B;  5CPI C;  4JJN D;  3AZK B;  5GSU B;  3AZM C;  5FUG A;  3LJA A;  5C3I C;  1EQZ B;  4QLC C;  3AZI D;  4G92 B;  5B1M B;  2BYM B;  3EPH A;  3AN2 A;  1H3O A;  1F1E A;  4NE3 A;  3WA9 C;  3A6N D;  5B0Z C;  4J8W B;  2RVQ C;  5DNN A;  3MVD C;  4E45 A;  3X1V D;  3LZ1 A;  4KUD D;  3UT9 B;  5AV5 A;  1P34 A;  4J8V C;  5CPJ A;  5CPI D;  4G91 B;  3AZM D;  1KU5 A;  2HIO B;  4LD9 A;  3AZE C;  3B6G D;  4NE5 A;  5B24 A;  4H9R A;  4WU9 C;  3WA9 D;  1P3G C;  5B0Z D;  2RVQ D;  3MVD D;  5B32 B;  3AZG C;  3C1C B;  4CAY A;  1BH8 A;  3C1B D;  1HTA A;  5AV8 C;  5AV6 C;  3REI A;  4Z66 A;  4J8V D;  3REL D;  1KX4 A;  1ULY A;  5AV9 B;  5GT0 B;  5B31 C;  3UTA A;  3REK A;  4XUJ B;  1WWI A;  2Y2N A;  4H9S C;  3AZE D;  3AN2 B;  1F66 B;  4NE6 A;  5BNX B;  3KXB B;  3AZK C;  5B40 B;  3B0D B;  5DNN B;  2Y2I A;  4DRB A;  3W99 A;  3R45 A;  4H9P A;  4WU9 D;  3A1K A;  4UUZ B;  1P3G D;  3AZM A;  1EQZ C;  5AY8 B;  4G92 C;  5CPJ B;  5B1M C;  4J8X B;  4QLC A;  5AV6 D;  5AV8 D;  4J8W C;  1P3I A;  5B31 D;  3WA9 A;  5DNM D;  2FJ7 B;  3NQU A;  4G91 C;  3AYW B;  3MGP B;  2HIO C;  2ARO A;  4XZQ C;  1EQZ D;  4YM6 B;  4R8P B;  1N1J B;  3H0M C;  5B1M D;  1KX5 B;  4Z5T B;  3X1U B;  5AVC A;  4KHA B;  2G5H C;  4J8W D;  4WZS B;  5B32 C;  3C1C C;  1P3P B;  2Y2Q A;  3AZG A;  5AV9 C;  5BT1 C;  5GT0 C;  1B6W A;  3LJA C;  1P3A B;  1AOI B;  3WKJ D;  3REH D;  5B31 A;  2HIO D;  4XZQ D;  3AN2 C;  1F66 C;  3X1T D;  1P3I B;  4H9S A;  3AZF B;  5DNN C;  1ZLA A;  3AZK A;  5GSU A;  5CPJ C;  5B32 D;  3C1C D;  3KUY A;  1EQZ A;  4J8X C;  1P3B B;  1KX3 A;  5B1M A;  2BYM A;  5AV9 D;  5GT0 D;  3LJA D;  2F2A C;  4UPK A;  3AV2 A;  4LD9 C;  4J8W A;  2FJ7 C;  3W98 B;  3VH5 T;  2ZM5 A;  3AN2 D;  4J8U B;  3UT9 A;  3AYW C;  1M1A B;  5DNN D;  4YM6 C;  3VH6 W;  4R8P C;  5AV5 D;  4Z66 C;  2HIO A;  5CPJ D;  1P34 D;  1KX4 C;  4Z5T C;  4J8X D;  3X1U C;  4LD9 D;  5KDM A;  2CWE A;  1P3P C;  5CP6 A;  5B32 A;  3C1C A;  1AOI C;  3X1S A;  4CSR B;  4YS3 B;  5AV9 A;  5GT0 A;  2NQB B;  3KUY B;  4YM6 D;  3REI D;  1A7W A;  4XUJ A;  4Z66 D;  3UTB B;  3AV1 B;  1P3M B;  2FFF B;  1P3I C;  1KX3 B;  3AZF C;  1KX4 D;  2Y2M A;  3X1U D;  3UTA D;  1F66 A;  5BNX A;  3AV2 B;  3KXB A;  5B31 G;  3REK D;  5B40 A;  2F8N B;  4X23 B;  3AL0 C;  3EPJ A;  4UUZ A;  1P3P D;  3MGR B;  1P3B C;  5AY8 A;  2JE5 A;  1WWS A;  3W99 D;  4J8X A;  2UWX A;  1U35 B;  1AOI D;  2ARO C;  1W2E A;  3B6F B;  3W98 C;  3AZJ B;  3TU4 A;  4QLC D;  5F99 B;  4J8U C;  2FJ7 A;  5AVC C;  1M1A C;  1P3I D;  3AZF D;  5KDM B;  3AYW A;  2DF4 C;  5CP6 B;  3MGP A;  4YM6 A;  1P3B D;  2Y2P A;  5GXQ B;  4R8P A;  3X1S B;  1B67 A;  1N1J A;  1KX5 A;  4Z5T A;  3X1U A;  2ARO D;  5G49 B;  4KHA A;  5B2I B;  3MGQ B;  3W98 D;  1T3U A;  5CPK B;  1P3P A;  1ZLA C;  3W96 A;  4J8U D;  5GSU C;  5AVC D;  2PYO B;  1P3A A;  1AOI A;  2NQB C;  3KUY C;  2Y2J A;  5B32 G;  3UTB C;  3AZG D;  1KX3 C;  5BS7 A;  5B0Y B;  3AV2 C;  5JA4 B;  3AZH B;  2BYK B;  3AZF A;  1ID3 B;  4X23 C;  3MGR C;  3TU4 B;  3UT9 C;  4AWL B;  5JRG B;  4WJ3 C;  5BNV B;  1ZLA D;  1P3B A;  3WTP B;  3AZK D;  1U35 C;  5GSU D;  3WTP E;  2YFV B;  3B6F C;  1BH9 B;  3AZJ C;  3KUY D;  1S32 B;  1P3F B;  5F99 C;  3W98 A;  3UTB D;  1KX3 D;  4ZUX B;  4J8U A;  4WNN B;  3AV2 D;  1M1A A;  5CP6 C;  3VH6 A;  3V9R B;  3AFA B;  2LY8 A;  3B0B A;  3EPK A;  3MGR D;  3AZL B;  3W96 B;  4H9O A;  3UT9 D;  3X1S C;  2RIQ A;  4H9N B;  1TZY B;  5B2I C;  3B6F D;  3KWQ B;  4JJN B;  4XUJ C;  5AVB A;  3AZJ D;  3P5J B;  3B0C W;  2L5A A;  3REJ B;  3KXB C;  5B40 C;  3AZI B;  3WAA B;  3B0D C;  3MNN B;  2PYO C;  3LEL B;  5CP6 D;  4CSR A;  5AY8 C;  4YS3 A;  3A6N B;  2NQB A;  4E44 A;  5E5A B;  3X1V B;  5B0Y C;  3X1S D;  3UTB A;  3AV1 A;  1P3M A;  3AZH C;  1M19 B;  2W8S A;  5BT1 D;  1ID3 C;  2F8N H;  2F8N A;  1HQ3 B;  3TU4 C;  5CPI B;  4H9Q B;  4XUJ D;  2Y2G A;  4X23 A;  3MGR A;  1F66 D;  3WTP C;  3KXB D;  5B40 D;  2HUE B;  3MGP C;  2ZY2 A;  3B6G B;  2VQR A;  1U35 A;  1P3O A;  2BG1 A;  5AY8 D;  4H9O B;  3B6F A;  3O62 B;  5B0Z B;  3AZJ A;  2Y2K A;  1KX5 C;  5F99 A;  4ZUX C;  3VH5 W;  3C1B B;  2CV5 B;  5AVB B;  4J8V B;  1R4V A;  3REL B;  1ID3 D;  2DQN C;  3TU4 D;  2Y2O A;  3W96 C;  4M6B A;  2FJ7 D;  1P3A C;  4ZBJ B;  3WTP D;  5GXQ A;  3AYW D;  1TZY C;  3MGP D;  3F6T A;  3KWQ C;  3AZN B;  2IO5 B;  3H0R C;  5G49 A;  5B2I A;  3MGQ A;  3W97 B;  4WU9 B;  4R8P D;  5BS7 C;  3REJ C;  1P3G B;  5CPK A;  3AZI C;  1KX5 D;  3WAA C;  4Z5T D;  3MNN C;  3LEL C;  5AV8 B;  3EPL A;  2PYO A;  3A6N C;  5E5A C;  3W96 D;  3A1I A;  5B33 B;  5DNM B;  1M19 C;  1P3A D;  3KSY A;  1P3O B;  5B0Y A;  1TZY D;  1P3K A;  1HQ3 C;  5JA4 A;  4WU8 B;  3KWQ D;  2BYK A;  3H0L C;  5B2J A;  3AZH A;  1ID3 A;  2ZY3 A;  4KGC B;  3REJ D;  2HUE C;  5JRG A;  2F8N G;  5BNV A;  3MNN D;  5B1L A;  2F8N K;  3LEL D;  3B6G C;  3NQJ B;  2JCH A;  3WTP A;  3WAA D;  2YFV A;  3O62 C;  1BH9 A;  5GT3 B;  2NZD B;  1S32 A;  5E5A D;  1P3F A;  1TAF A;  5BO0 B;  3C1B C;  1P3L B;  1M19 D;  2CV5 C;  5AVB C;  4ZUX A;  3REL C;  1JFI B;  4WNN A;  1HQ3 D;  3V9R A;  3AFA A;  2XD5 A;  3WKJ B;  3REH B;  3AZL A;  4ZBJ C;  4XZQ B;  3MGS A;  1M1A D;  2YFW B;  4YS3 C;  3AZN C;  2IO5 C;  3X1T B;  1M18 A;  3EG5 B;  4H9N A;  1TZY A;  3W97 C;  3KWQ A;  4JJN A;  3O62 D;  4DRA A;  3AV1 C;  1P3M C;  3LZ0 B;  3REJ A;  1P3K B;  3AZI A;  2G5I C;  2JSS A;  3MNN A;  5B2J B;  5AVB D;  2J8P A;  5FUG B;  3LEL A;  1PZR A;  2CV5 D;  3LJA B;  1BFM A;  3A6N A;  5DNM C;  5B33 C;  4NFT A;  5B1L B;  5E5A A;  3IP4 C;  3X1V A;  3KFU G;  1P3O C;  4KUD A;  1H3O B;  1Z2C B;  4YS3 D;  4WU8 C;  3AZN D;  1M19 A;  2Y2H A;  4EO5 B;  4Z2M H;  2NQB D;  3W97 D;  1HQ3 A;  4KGC C;  3LZ1 B;  1TAF B;  4H9Q A;  5CPI A;  3AV1 D;  1P3M D;  5AV5 B;  1P34 B;  4WV4 B;  2F8N D;  5CHL B;  3B6G A;  4X23 D;  5GT3 C;  2NZD C;  4HGA B;  4LD9 B;  3VH5 A;  5GXQ C;  5B0Z A;  5B33 D;  3O62 A;  3MGS B;  1P3L C;  3MVD A;  1U35 D;  1P3O D;  1M18 B;  5B24 B;  4H9R B;  3MGQ C;  3C1B A;  4WU8 D;  2CV5 A;  4J8V A;  3REL A;  2XD1 A;  5CPK C;  3WKJ C;  3REH C;  2ZY4 A;  4KGC D;  5F99 D;  4CAY B;  1BH8 B;  3REI B;  4Z66 B;  3X1T C;  1KX4 B;  3AZE A;  3UTA B;  3AZN A;  3REK B; 
#chains in the Genus database with same CATH homology
 5GT3 D;  3LZ0 C;  2NZD D;  3B0C T;  3W97 A;  4WU9 A;  2Y2L A;  5GXQ D;  1P3G A;  4KUD B;  1P3K C;  1P3L D;  5B2J C;  3W99 B;  5B2I D;  3MGQ D;  3R45 B;  4H9P B;  5AV6 A;  5AV8 A;  3AZM B;  5CPK D;  4AWL C;  5JRG C;  5B1L C;  5C3I B;  5B33 A;  5DNM A;  4QLC B;  2PYO D;  4EO5 C;  3WAA A;  1S32 C;  4WU8 A;  1P3F C;  3LZ1 C;  3WA9 B;  3LZ0 D;  5AV5 C;  3MVD B;  1P34 C;  4KGC A;  2ZY5 A;  5B0Y D;  1P3K D;  3NQU B;  3AZH D;  5B2J D;  4Z2M G;  3AFA C;  3NQJ A;  3AZL C;  4HGA C;  2ARO B;  3VH6 T;  3MGS C;  5GT3 A;  5JRG D;  1Q9C A;  2NZD A;  5B1L D;  1M18 C;  5BO0 A;  5B24 C;  3AZE B;  1P3L A;  4JJN C;  5AVC B;  1JFI A;  1S32 D;  3FDD A;  1P3F D;  3LZ1 D;  3WKJ A;  3REI C;  3REH A;  4ZUX D;  4DQY B;  3AZG B;  4XZQ A;  2YFW A;  3UTA C;  5AV6 B;  3AFA D;  3REK C;  3X1T A;  3AZL D;  5B31 B;  3X1V C;  4KUD C;  3MGS D;  3LZ0 A;  1M18 D;  5B24 D;  3W99 C;  1ZLA B;  5CPI C;  4JJN D;  3AZK B;  5GSU B;  3AZM C;  5FUG A;  3LJA A;  5C3I C;  1EQZ B;  4QLC C;  3AZI D;  4G92 B;  5B1M B;  2BYM B;  3EPH A;  3AN2 A;  1H3O A;  1F1E A;  4NE3 A;  3WA9 C;  3A6N D;  5B0Z C;  4J8W B;  2RVQ C;  5DNN A;  3MVD C;  4E45 A;  3X1V D;  3LZ1 A;  4KUD D;  3UT9 B;  5AV5 A;  1P34 A;  4J8V C;  5CPJ A;  5CPI D;  4G91 B;  3AZM D;  1KU5 A;  2HIO B;  4LD9 A;  3AZE C;  3B6G D;  4NE5 A;  5B24 A;  4H9R A;  4WU9 C;  3WA9 D;  1P3G C;  5B0Z D;  2RVQ D;  3MVD D;  5B32 B;  3AZG C;  3C1C B;  4CAY A;  1BH8 A;  3C1B D;  1HTA A;  5AV8 C;  5AV6 C;  3REI A;  4Z66 A;  4J8V D;  3REL D;  1KX4 A;  1ULY A;  5AV9 B;  5GT0 B;  5B31 C;  3UTA A;  3REK A;  4XUJ B;  1WWI A;  2Y2N A;  4H9S C;  3AZE D;  3AN2 B;  1F66 B;  4NE6 A;  5BNX B;  3KXB B;  3AZK C;  5B40 B;  3B0D B;  5DNN B;  2Y2I A;  4DRB A;  3W99 A;  3R45 A;  4H9P A;  4WU9 D;  3A1K A;  4UUZ B;  1P3G D;  3AZM A;  1EQZ C;  5AY8 B;  4G92 C;  5CPJ B;  5B1M C;  4J8X B;  4QLC A;  5AV6 D;  5AV8 D;  4J8W C;  1P3I A;  5B31 D;  3WA9 A;  5DNM D;  2FJ7 B;  3NQU A;  4G91 C;  3AYW B;  3MGP B;  2HIO C;  2ARO A;  4XZQ C;  1EQZ D;  4YM6 B;  4R8P B;  1N1J B;  3H0M C;  5B1M D;  1KX5 B;  4Z5T B;  3X1U B;  5AVC A;  4KHA B;  2G5H C;  4J8W D;  4WZS B;  5B32 C;  3C1C C;  1P3P B;  2Y2Q A;  3AZG A;  5AV9 C;  5BT1 C;  5GT0 C;  1B6W A;  3LJA C;  1P3A B;  1AOI B;  3WKJ D;  3REH D;  5B31 A;  2HIO D;  4XZQ D;  3AN2 C;  1F66 C;  3X1T D;  1P3I B;  4H9S A;  3AZF B;  5DNN C;  1ZLA A;  3AZK A;  5GSU A;  5CPJ C;  5B32 D;  3C1C D;  3KUY A;  1EQZ A;  4J8X C;  1P3B B;  1KX3 A;  5B1M A;  2BYM A;  5AV9 D;  5GT0 D;  3LJA D;  2F2A C;  4UPK A;  3AV2 A;  4LD9 C;  4J8W A;  2FJ7 C;  3W98 B;  3VH5 T;  2ZM5 A;  3AN2 D;  4J8U B;  3UT9 A;  3AYW C;  1M1A B;  5DNN D;  4YM6 C;  3VH6 W;  4R8P C;  5AV5 D;  4Z66 C;  2HIO A;  5CPJ D;  1P34 D;  1KX4 C;  4Z5T C;  4J8X D;  3X1U C;  4LD9 D;  5KDM A;  2CWE A;  1P3P C;  5CP6 A;  5B32 A;  3C1C A;  1AOI C;  3X1S A;  4CSR B;  4YS3 B;  5AV9 A;  5GT0 A;  2NQB B;  3KUY B;  4YM6 D;  3REI D;  1A7W A;  4XUJ A;  4Z66 D;  3UTB B;  3AV1 B;  1P3M B;  2FFF B;  1P3I C;  1KX3 B;  3AZF C;  1KX4 D;  2Y2M A;  3X1U D;  3UTA D;  1F66 A;  5BNX A;  3AV2 B;  3KXB A;  5B31 G;  3REK D;  5B40 A;  2F8N B;  4X23 B;  3AL0 C;  3EPJ A;  4UUZ A;  1P3P D;  3MGR B;  1P3B C;  5AY8 A;  2JE5 A;  1WWS A;  3W99 D;  4J8X A;  2UWX A;  1U35 B;  1AOI D;  2ARO C;  1W2E A;  3B6F B;  3W98 C;  3AZJ B;  3TU4 A;  4QLC D;  5F99 B;  4J8U C;  2FJ7 A;  5AVC C;  1M1A C;  1P3I D;  3AZF D;  5KDM B;  3AYW A;  2DF4 C;  5CP6 B;  3MGP A;  4YM6 A;  1P3B D;  2Y2P A;  5GXQ B;  4R8P A;  3X1S B;  1B67 A;  1N1J A;  1KX5 A;  4Z5T A;  3X1U A;  2ARO D;  5G49 B;  4KHA A;  5B2I B;  3MGQ B;  3W98 D;  1T3U A;  5CPK B;  1P3P A;  1ZLA C;  3W96 A;  4J8U D;  5GSU C;  5AVC D;  2PYO B;  1P3A A;  1AOI A;  2NQB C;  3KUY C;  2Y2J A;  5B32 G;  3UTB C;  3AZG D;  1KX3 C;  5BS7 A;  5B0Y B;  3AV2 C;  5JA4 B;  3AZH B;  2BYK B;  3AZF A;  1ID3 B;  4X23 C;  3MGR C;  3TU4 B;  3UT9 C;  4AWL B;  5JRG B;  4WJ3 C;  5BNV B;  1ZLA D;  1P3B A;  3WTP B;  3AZK D;  1U35 C;  5GSU D;  3WTP E;  2YFV B;  3B6F C;  1BH9 B;  3AZJ C;  3KUY D;  1S32 B;  1P3F B;  5F99 C;  3W98 A;  3UTB D;  1KX3 D;  4ZUX B;  4J8U A;  4WNN B;  3AV2 D;  1M1A A;  5CP6 C;  3VH6 A;  3V9R B;  3AFA B;  2LY8 A;  3B0B A;  3EPK A;  3MGR D;  3AZL B;  3W96 B;  4H9O A;  3UT9 D;  3X1S C;  2RIQ A;  4H9N B;  1TZY B;  5B2I C;  3B6F D;  3KWQ B;  4JJN B;  4XUJ C;  5AVB A;  3AZJ D;  3P5J B;  3B0C W;  2L5A A;  3REJ B;  3KXB C;  5B40 C;  3AZI B;  3WAA B;  3B0D C;  3MNN B;  2PYO C;  3LEL B;  5CP6 D;  4CSR A;  5AY8 C;  4YS3 A;  3A6N B;  2NQB A;  4E44 A;  5E5A B;  3X1V B;  5B0Y C;  3X1S D;  3UTB A;  3AV1 A;  1P3M A;  3AZH C;  1M19 B;  2W8S A;  5BT1 D;  1ID3 C;  2F8N H;  2F8N A;  1HQ3 B;  3TU4 C;  5CPI B;  4H9Q B;  4XUJ D;  2Y2G A;  4X23 A;  3MGR A;  1F66 D;  3WTP C;  3KXB D;  5B40 D;  2HUE B;  3MGP C;  2ZY2 A;  3B6G B;  2VQR A;  1U35 A;  1P3O A;  2BG1 A;  5AY8 D;  4H9O B;  3B6F A;  3O62 B;  5B0Z B;  3AZJ A;  2Y2K A;  1KX5 C;  5F99 A;  4ZUX C;  3VH5 W;  3C1B B;  2CV5 B;  5AVB B;  4J8V B;  1R4V A;  3REL B;  1ID3 D;  2DQN C;  3TU4 D;  2Y2O A;  3W96 C;  4M6B A;  2FJ7 D;  1P3A C;  4ZBJ B;  3WTP D;  5GXQ A;  3AYW D;  1TZY C;  3MGP D;  3F6T A;  3KWQ C;  3AZN B;  2IO5 B;  3H0R C;  5G49 A;  5B2I A;  3MGQ A;  3W97 B;  4WU9 B;  4R8P D;  5BS7 C;  3REJ C;  1P3G B;  5CPK A;  3AZI C;  1KX5 D;  3WAA C;  4Z5T D;  3MNN C;  3LEL C;  5AV8 B;  3EPL A;  2PYO A;  3A6N C;  5E5A C;  3W96 D;  3A1I A;  5B33 B;  5DNM B;  1M19 C;  1P3A D;  3KSY A;  1P3O B;  5B0Y A;  1TZY D;  1P3K A;  1HQ3 C;  5JA4 A;  4WU8 B;  3KWQ D;  2BYK A;  3H0L C;  5B2J A;  3AZH A;  1ID3 A;  2ZY3 A;  4KGC B;  3REJ D;  2HUE C;  5JRG A;  2F8N G;  5BNV A;  3MNN D;  5B1L A;  2F8N K;  3LEL D;  3B6G C;  3NQJ B;  2JCH A;  3WTP A;  3WAA D;  2YFV A;  3O62 C;  1BH9 A;  5GT3 B;  2NZD B;  1S32 A;  5E5A D;  1P3F A;  1TAF A;  5BO0 B;  3C1B C;  1P3L B;  1M19 D;  2CV5 C;  5AVB C;  4ZUX A;  3REL C;  1JFI B;  4WNN A;  1HQ3 D;  3V9R A;  3AFA A;  2XD5 A;  3WKJ B;  3REH B;  3AZL A;  4ZBJ C;  4XZQ B;  3MGS A;  1M1A D;  2YFW B;  4YS3 C;  3AZN C;  2IO5 C;  3X1T B;  1M18 A;  3EG5 B;  4H9N A;  1TZY A;  3W97 C;  3KWQ A;  4JJN A;  3O62 D;  4DRA A;  3AV1 C;  1P3M C;  3LZ0 B;  3REJ A;  1P3K B;  3AZI A;  2G5I C;  2JSS A;  3MNN A;  5B2J B;  5AVB D;  2J8P A;  5FUG B;  3LEL A;  1PZR A;  2CV5 D;  3LJA B;  1BFM A;  3A6N A;  5DNM C;  5B33 C;  4NFT A;  5B1L B;  5E5A A;  3IP4 C;  3X1V A;  3KFU G;  1P3O C;  4KUD A;  1H3O B;  1Z2C B;  4YS3 D;  4WU8 C;  3AZN D;  1M19 A;  2Y2H A;  4EO5 B;  4Z2M H;  2NQB D;  3W97 D;  1HQ3 A;  4KGC C;  3LZ1 B;  1TAF B;  4H9Q A;  5CPI A;  3AV1 D;  1P3M D;  5AV5 B;  1P34 B;  4WV4 B;  2F8N D;  5CHL B;  3B6G A;  4X23 D;  5GT3 C;  2NZD C;  4HGA B;  4LD9 B;  3VH5 A;  5GXQ C;  5B0Z A;  5B33 D;  3O62 A;  3MGS B;  1P3L C;  3MVD A;  1U35 D;  1P3O D;  1M18 B;  5B24 B;  4H9R B;  3MGQ C;  3C1B A;  4WU8 D;  2CV5 A;  4J8V A;  3REL A;  2XD1 A;  5CPK C;  3WKJ C;  3REH C;  2ZY4 A;  4KGC D;  5F99 D;  4CAY B;  1BH8 B;  3REI B;  4Z66 B;  3X1T C;  1KX4 B;  3AZE A;  3UTA B;  3AZN A;  3REK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...