3UTAC

Crystal structure of nucleosome core particle assembled with an alpha-satellite sequence containing two ttaaa elements (ncp-ta2)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utaC00
3C1CA 4LD9A 4WU8A 4XZQB 3B0BA 3UT9B 1KX4C 4NE5A 3NQJA 2LY8A 3TU4B 5AV5B 1F66B 3REJC 3WTPC 3X1TC 1Q9CA 3AV2A 3LJAB 3MGRD 3LZ1A 3MVDA 1R4VA 5JRGC 3MGPC 3UT9D 2L5AA 1P3FC 4ZUXC 5B2JA 3VH5A 3AZIA 5E5AC 4WU9C 5AVBA 4WU8B 4LD9B 5CP6B 4Z2MG 5AY8D 3KUYC 1P34A 5B24D 4H9QA 3REIB 5CPJC 3AV1B 1P3KD 2AROA 4WNNB 3B6FA 1P3GA 5DNMB 5B32A 3WA9C 5CPIA 3AZLB 5B33B 5AV9A 5BS7A 3X1SA 4Z5TA 5DNND 3AYWD 3AV2B 2NQBC 3LZ1B 5GT0C 1M19B 1M18D 5B1LB 1ZLAB 3REID 3B0DC 4H9RA 3AZIB 1KX4A 1P3LC 4G92C 3AV1D 1S32C 5GSUC 1P3ID 3MGSD 4H9QB 4YM6D 5AV6C 3O62D 2HIOB 3REJA 3WTPA 3X1TA 3VH5W 3WKJD 3AZKC 3AZHD 5B1MD 1M19D 5B32B 1KU5A 5JRGA 5B1LD 3MGPA 5CPIB 4XUJB 1ZLAD 3B6GD 4UUZB 1P3FA 4ZUXA 3KXBC 5AV9B 2JSSA 4AWLB 3KWQB 3X1VD 5E5AA 4WU9A 1P3MD 1M1AD 1P3BD 1HQ3D 3KUYA 3WAAB 5B31D 5CPJA 1EQZB 1U35B 3UTAC 2CV5C 4J8UC 3UTBD 4JJND 2RVQC 4XUJD 1B67A 3WA9A 3REJB 3WTPB 3LZ0D 2NQBA 4R8PD 5B24C 5BO0A 2NZDD 3MGQD 4G91C 5GT0A 1TZYD 3MGPB 3WAAD 4ZUXB 1P3KC 1JFIB 4KGCB 1P3LA 1S32A 5E5AB 5GSUA 4WU9B 4HGAB 4H9PA 2FJ7C 4J8WD 3AYWC 1ID3C 5AV6A 5AV8D 3X1UD 4KUDB 2IO5B 4Z66D 3AZKA 1WWIA 1M18C 4X23C 3AN2C 2PYOD 1KX3D 4J8XB 5C3IC 1HTAA 4J8VD 5B2IB 3KXBA 1BH9B 3REKD 5BT1C 2BYKA 2YFVA 1P3PD 2NQBB 3MGSC 4KHAA 5GXQC 4YS3C 5B0ZD 3O62C 1BFMA 3A6NB 3AZNC 2F8ND 3AZFC 4KUDD 4G92B 1B6WA 1S32B 3W97C 5GSUB 3RELB 1BH8B 3REHC 3UTAA 2CV5A 3C1BD 4H9NA 1P3AB 4J8UA 2HUEB 5GT3D 3X1VC 1AOID 1P3MC 3W96C 3AZEC 5B31C 3LELC 3AZGC 5B24A 5B40D 3A6ND 3KXBB 5B0YD 1P3KA 2BYKB 3AZMC 3W99C 4KHAB 1P3AD 1KX5C 1H3OB 4XZQD 2FJ7A 3LZ0C 3AYWA 3AFAB 1ID3A 2CWEA 4R8PC 2NZDC 3MGQC 1P3OC 2F8NH 4H9NB 1M18A 4J8UB 2AROB 4QLCB 4X23A 3AN2A 3C1CB 3TU4D 5KDMA 2YFWA 5F99C 5AV5D 1F66D 3MGSA 4J8WC 5GXQA 3LJAD 4YS3A 4G91B 5AV8C 3O62A 3NQJB 4M6BA 3AZNA 4Z66C 3W98C 3AZFA 3NQUA 3W97A 3B0CW 4E45A 3REHA 2AROD 4QLCD 3MVDB 3C1CD 4WU8D 4LD9D 5CP6D 1P3PC 4EO5B 1ID3B 5B2JB 3X1VA 3VH5T 3MNNC 1P3MA 3W96A 3AZEA 4X23B 3AN2B 5B31A 5AVBB 3LELA 3AZGA 5AVCC 3AZJC 5DNMD 5C3IB 5KDMB 1P34B 5CPKC 3C1BC 3AZLD 5B33D 1N1JA 3AZMA 3W99A 5GXQB 3AV2D 4YS3B 1KX5A 3LZ1D 3B6FB 1P3GB 3AZNB 1AOIC 5B2JD 3AZFB 3LZ0A 4R8PA 3W97B 3AZID 5JA4A 5B40C 4CSRA 2NZDA 3MGQA 3X1SB 4Z5TB 3REHB 1P3OA 1P34D 5FUGA 4H9RB 1KX4B 5F99A 2HIOD 3MGRC 3W96B 3R45A 3AZEB 3AZGB 4J8WA 4NE6A 3UT9C 5AV8A 5B32D 5CPID 4Z66A 3W98A 5AV9D 3X1TB 1N1JB 1KX5B 3TU4C 5AY8C 4WV4B 3KWQD 1F1EA 1F66C 5JRGB 4H9SC 1P3PA 1P3FB 4NE3A 1KX4D 1P3OB 1EQZD 4H9OA 3MNNA 1U35D 2F8NA 3V9RA 5AVCA 3AZJA 3KUYB 5F99B 5DNNC 5CPJB 3REJD 3X1TD 3WTPD 3C1BA 5CPKA 5CP6C 5BNVA 3REIC 3MGPD 1AOIA 3AV1C 1P3FD 4ZUXD 3WA9B 4KGCD 1P3IC 5G49A 5B40A 3VH6A 5DNMC 5E5AD 4WU9D 4YM6C 5BO0B 5GT0B 3AZLC 5B33C 3KUYD 4DRBA 5CPJD 3B0DB 3WKJC 4H9OB 3MNNB 3MGRA 1P3LB 3AZHC 5B1MC 1M19C 2F8NK 5B1LC 3B6GC 1ZLAC 5AVCB 4H9PB 3UT9A 4J8XD 3WA9D 5AV6B 5CPKB 5B2ID 5B31G 2NQBD 1M1AC 3AZKB 3TU4A 1WWSA 1HQ3C 5AY8A 1P3BC 2HIOC 1F66A 4H9SA 5G49B 1S32D 2YFVB 4DRAA 5GSUD 3UTBC 4JJNC 3RELD 4XUJC 4ZBJC 5AV6D 4AWLC 5DNNA 3KWQC 5CP6A 3AZKD 4Z2MH 1TZYC 3VH6W 3UTAB 3WAAC 2CV5B 3REIA 1ULYA 1EQZC 3AV1A 3KXBD 1U35C 1P3IA 4WNNA 5AY8B 3B0CT 5DNMA 5B24B 4YM6A 3X1UC 3AZLA 5B33A 1P3KB 3AFAD 3WKJA 3AZHA 5B1MA 3UTAD 1M19A 2PYOC 2CV5D 1KX3C 5B1LA 4J8UD 1ZLAA 3B6GA 4KGCC 4J8VC 2RVQD 3REKC 2FJ7B 1A7WA 5DNNB 3AYWB 4HGAC 5B0ZC 2F8NG 1M1AA 1M18B 1P3BA 1HQ3A 4KUDC 2HIOA 2IO5C 2YFWB 1P3IB 3MGSB 3UTBA 4J8XC 4JJNA 4YM6B 5GT3C 4XUJA 4UUZA 5B2IC 3O62B 3MVDD 2FJ7D 1ID3D 3WKJB 3KWQA 3AZHB 3NQUB 5B1MB 3A6NC 3B6GB 1TZYA 4X23D 3AN2D 3WAAA 5AVBD 5B0YC 1EQZA 3KSYA 3RELC 1U35A 5BNXA 5BT1D 3X1VB 1P3AC 1P3MB 2HUEC 4NFTA 1M1AB 1P3BB 1HQ3B 5GXQD 4CAYA 4YS3D 4XZQC 5B31B 3LELB 3B6FD 1P3GD 3AZND 3X1UA 3AZFD 3W97D 3UTBB 4JJNB 3AZMB 3X1SD 4Z5TD 3REHD 2PYOA 3W99B 1KX3A 4ZBJB 1JFIA 4KGCA 4J8VA 3REKA 5AV5C 3LZ0B 4R8PB 4E44A 5JA4B 3WTPE 3LJAC 4CSRB 3W96D 3MGQB 2NZDB 1TZYB 5B0ZA 3AZED 3AZGD 3LELD 3AFAC 4WZSB 4KUDA 5FUGB 5BNXB 2AROC 3R45B 4QLCC 3AZMD 3W99D 3C1CC 4WU8C 4CAYB 4LD9C 1TAFA 4J8WB 1KX5D 4J8XA 5GT3A 5AV8B 3X1UB 5B2IA 1BH9A 5JRGD 4Z66B 3W98B 1P3OD 2PYOB 1KX3B 3A6NA 4J8VB 3REKB 5B0YA 2BYMA 1P3PB 3RELA 1BH8A 5F99D 3AV2C 1P3AA 3LZ1C 5B0ZB 3MVDC 4EO5C 4XZQA 2F8NB 5CHLB 5B2JC 3V9RB 3AZJB 3AZIC 3W98D 3C1BB 5AVBC 1TAFB 5BNVB 5GT3B 1P34C 1AOIB 5GT0D 5AV5A 5B32G 3B6FC 5B40B 3MNND 3LJAA 1P3GC 1P3LD 1H3OA 5B32C 3VH6T 5CPIC 5B0YB 5AVCD 3AFAA 3AZJD 2BYMB 5AV9C 5BS7C 3X1SC 4Z5TC 5CPKD 3MGRB 4QLCA
chains in the Genus database with same CATH superfamily
3C1CA 4LD9A 4WU8A 4XZQB 3B0BA 3UT9B 3EPJA 1KX4C 2G5IC 4NE5A 3NQJA 2LY8A 3TU4B 5AV5B 1F66B 3REJC 3WTPC 3X1TC 1Q9CA 3AV2A 3LJAB 3MGRD 3LZ1A 3MVDA 1R4VA 5JRGC 3MGPC 3UT9D 2L5AA 1P3FC 4ZUXC 5B2JA 3VH5A 3AZIA 2Y2OA 5E5AC 4WU9C 5AVBA 4WU8B 4LD9B 5CP6B 4Z2MG 5AY8D 3KUYC 1P34A 5B24D 4H9QA 3REIB 5CPJC 3AV1B 1P3KD 2AROA 4WNNB 3B6FA 1P3GA 5DNMB 5B32A 3WA9C 5CPIA 3AZLB 5B33B 5AV9A 5BS7A 3X1SA 4Z5TA 5DNND 3AYWD 3AV2B 2NQBC 3LZ1B 5GT0C 1M19B 1M18D 5B1LB 1ZLAB 3REID 3B0DC 4H9RA 3AZIB 1KX4A 1P3LC 4G92C 3AV1D 1S32C 5GSUC 3A1KA 1P3ID 2XD1A 3MGSD 4H9QB 4YM6D 5AV6C 3O62D 2HIOB 3REJA 3WTPA 3X1TA 3VH5W 2Y2PA 3WKJD 3AZKC 2J8PA 4UPKA 3AZHD 5B1MD 1M19D 5B32B 1KU5A 5JRGA 5B1LD 3MGPA 5CPIB 4XUJB 1ZLAD 3B6GD 4UUZB 1P3FA 4ZUXA 3KXBC 5AV9B 2JSSA 4AWLB 3KWQB 3X1VD 5E5AA 4WU9A 1P3MD 1M1AD 1P3BD 1HQ3D 3KUYA 3WAAB 5B31D 5CPJA 1EQZB 1U35B 3UTAC 2RIQA 2CV5C 4J8UC 3UTBD 3H0LC 2RVQC 4JJND 4XUJD 1B67A 3WA9A 3REJB 3WTPB 3LZ0D 2NQBA 4R8PD 2Y2GA 5B24C 5BO0A 2NZDD 3MGQD 4G91C 5GT0A 1TZYD 3MGPB 3WAAD 4ZUXB 1P3KC 1JFIB 4KGCB 2ZY4A 1P3LA 2DF4C 1S32A 5E5AB 5GSUA 4WU9B 4HGAB 4H9PA 2FJ7C 4J8WD 3AYWC 1ID3C 5AV6A 5AV8D 3X1UD 4KUDB 2IO5B 4Z66D 3AZKA 1WWIA 1M18C 4X23C 3AN2C 2PYOD 1KX3D 4J8XB 5C3IC 1HTAA 4J8VD 5B2IB 3KXBA 1BH9B 3REKD 5BT1C 2BYKA 2YFVA 1P3PD 2NQBB 3MGSC 4KHAA 5GXQC 4YS3C 5B0ZD 3O62C 1BFMA 3A6NB 3AZNC 2F8ND 3AZFC 4KUDD 4G92B 1B6WA 1S32B 3W97C 5GSUB 3RELB 1BH8B 3REHC 3UTAA 2CV5A 3C1BD 4H9NA 1P3AB 4J8UA 3P5JB 2HUEB 5GT3D 3X1VC 1AOID 1P3MC 3W96C 2DQNC 3AZEC 5B31C 3LELC 3AZGC 5B24A 5B40D 3A6ND 3H0MC 3KXBB 5B0YD 1P3KA 2BYKB 3AZMC 3W99C 4KHAB 2F2AC 1P3AD 1KX5C 1H3OB 4XZQD 2FJ7A 3LZ0C 3AYWA 3AFAB 1ID3A 2CWEA 4R8PC 2NZDC 3MGQC 1P3OC 2F8NH 4H9NB 1M18A 4J8UB 2AROB 4QLCB 4X23A 3AN2A 3C1CB 3TU4D 5KDMA 2YFWA 5F99C 5AV5D 1F66D 2Y2NA 3MGSA 4J8WC 5GXQA 3LJAD 4YS3A 4G91B 5AV8C 3O62A 3NQJB 4M6BA 3EPHA 3AZNA 2Y2HA 4Z66C 3FDDA 3W98C 3AZFA 4DQYB 2ZY5A 2XD5A 3NQUA 3W97A 3B0CW 4E45A 3REHA 2AROD 4QLCD 3MVDB 3C1CD 4WU8D 4LD9D 5CP6D 1P3PC 4EO5B 1ID3B 5B2JB 3X1VA 3VH5T 3MNNC 3H0RC 3W96A 1P3MA 3AZEA 4X23B 3AN2B 2Y2MA 5B31A 5AVBB 3LELA 3AZGA 5AVCC 3AZJC 5DNMD 5C3IB 5KDMB 1P34B 5CPKC 3C1BC 3AZLD 5B33D 1N1JA 3AZMA 3W99A 5GXQB 3AV2D 4YS3B 1KX5A 2Y2QA 3LZ1D 3B6FB 1P3GB 3AZNB 1AOIC 5B2JD 3AZFB 3LZ0A 4R8PA 3W97B 3AZID 5JA4A 5B40C 4CSRA 2NZDA 3MGQA 3X1SB 4Z5TB 3REHB 1P3OA 1PZRA 1P34D 5FUGA 4H9RB 1KX4B 5F99A 2HIOD 3MGRC 3W96B 3R45A 3AZEB 3AZGB 4J8WA 4NE6A 3UT9C 5AV8A 5B32D 5CPID 4Z66A 3W98A 5AV9D 3X1TB 1N1JB 1KX5B 3TU4C 5AY8C 3EPKA 4WV4B 3KWQD 1F1EA 1F66C 5JRGB 4H9SC 1P3PA 1P3FB 4NE3A 1KX4D 1P3OB 1EQZD 4H9OA 3MNNA 1U35D 2F8NA 3V9RA 5AVCA 3AZJA 3KUYB 2Y2LA 5F99B 5DNNC 5CPJB 3REJD 3X1TD 3WTPD 1Z2CB 3C1BA 5CPKA 5CP6C 5BNVA 3REIC 3MGPD 1AOIA 3AV1C 1P3FD 4ZUXD 2G5HC 3WA9B 4KGCD 1P3IC 5G49A 5B40A 3VH6A 5DNMC 5E5AD 4WU9D 4YM6C 5BO0B 5GT0B 3AZLC 5B33C 3KUYD 4DRBA 5CPJD 3B0DB 3WKJC 4H9OB 3MNNB 3MGRA 1P3LB 3AZHC 5B1MC 1M19C 2F8NK 5B1LC 3B6GC 1ZLAC 5AVCB 4H9PB 3UT9A 4J8XD 3WA9D 3EPLA 5AV6B 5CPKB 5B2ID 4WJ3C 5B31G 2NQBD 1M1AC 3AZKB 3TU4A 1WWSA 1HQ3C 5AY8A 1P3BC 2HIOC 3AL0C 1F66A 4H9SA 5G49B 1S32D 2YFVB 4DRAA 5GSUD 3UTBC 4JJNC 3RELD 4XUJC 3F6TA 4ZBJC 2W8SA 5AV6D 4AWLC 5DNNA 3KWQC 5CP6A 3AZKD 2Y2JA 4Z2MH 1TZYC 2BG1A 3VH6W 3WAAC 3UTAB 2CV5B 3REIA 1ULYA 1EQZC 3AV1A 3KXBD 1U35C 1P3IA 4WNNA 5AY8B 3B0CT 2Y2KA 5DNMA 5B24B 4YM6A 1W2EA 3X1UC 3AZLA 5B33A 1P3KB 3AFAD 3WKJA 3AZHA 5B1MA 3UTAD 1M19A 2PYOC 2CV5D 1KX3C 5B1LA 4J8UD 1ZLAA 3B6GA 4KGCC 4J8VC 2RVQD 3REKC 2FJ7B 1A7WA 5DNNB 3AYWB 4HGAC 5B0ZC 2F8NG 1M1AA 1M18B 1P3BA 1HQ3A 4KUDC 2HIOA 3EG5B 2IO5C 2YFWB 1P3IB 2ZY3A 3MGSB 3UTBA 4J8XC 4JJNA 2ZY2A 5GT3C 4XUJA 4YM6B 4UUZA 2VQRA 5B2IC 3O62B 3MVDD 2FJ7D 1ID3D 3WKJB 3KWQA 3AZHB 3NQUB 5B1MB 3A6NC 3B6GB 1TZYA 4X23D 3AN2D 2JE5A 5AVBD 3A1IA 3WAAA 5B0YC 1EQZA 3KSYA 3RELC 1U35A 5BNXA 5BT1D 3X1VB 1P3AC 1P3MB 2HUEC 4NFTA 1M1AB 1P3BB 1HQ3B 5GXQD 4CAYA 4YS3D 4XZQC 5B31B 3LELB 3B6FD 1P3GD 3AZND 3X1UA 2Y2IA 3AZFD 3W97D 3UTBB 4JJNB 3AZMB 3X1SD 4Z5TD 3REHD 2PYOA 3W99B 1KX3A 4ZBJB 1JFIA 4KGCA 4J8VA 3REKA 5AV5C 3LZ0B 4R8PB 4E44A 5JA4B 3WTPE 3LJAC 4CSRB 3W96D 3MGQB 2NZDB 1TZYB 5B0ZA 3AZED 2ZM5A 3LELD 3AZGD 3AFAC 4WZSB 4KUDA 5FUGB 5BNXB 2AROC 3R45B 4QLCC 3AZMD 3W99D 3C1CC 4WU8C 4CAYB 4LD9C 1TAFA 4J8WB 1KX5D 4J8XA 5GT3A 5AV8B 3X1UB 5B2IA 1BH9A 5JRGD 4Z66B 3W98B 1P3OD 2PYOB 1KX3B 3A6NA 4J8VB 3REKB 5B0YA 2BYMA 1P3PB 3RELA 1BH8A 2FFFB 5F99D 3AV2C 1P3AA 3LZ1C 5B0ZB 3MVDC 2UWXA 4XZQA 4EO5C 2F8NB 5CHLB 5B2JC 3V9RB 3AZJB 1T3UA 3AZIC 3W98D 3C1BB 5AVBC 1TAFB 5BNVB 5GT3B 1P34C 1AOIB 5GT0D 5AV5A 5B32G 2JCHA 5B40B 3IP4C 3MNND 3LJAA 1P3GC 1P3LD 3B6FC 1H3OA 5B32C 3VH6T 5CPIC 5B0YB 5AVCD 3AFAA 3AZJD 2BYMB 5AV9C 5BS7C 3X1SC 4Z5TC 3KFUG 5CPKD 3MGRB 4QLCA
chains in the Genus database with same CATH topology
3C1CA 4LD9A 4WU8A 4XZQB 3B0BA 3UT9B 3EPJA 1KX4C 2G5IC 4NE5A 3NQJA 2LY8A 3TU4B 5AV5B 1F66B 3REJC 3WTPC 3X1TC 1Q9CA 3AV2A 3LJAB 3MGRD 3LZ1A 3MVDA 1R4VA 5JRGC 3MGPC 3UT9D 2L5AA 1P3FC 4ZUXC 5B2JA 3VH5A 3AZIA 2Y2OA 5E5AC 4WU9C 5AVBA 4WU8B 4LD9B 5CP6B 4Z2MG 5AY8D 3KUYC 1P34A 5B24D 4H9QA 3REIB 5CPJC 3AV1B 1P3KD 2AROA 4WNNB 3B6FA 1P3GA 5DNMB 5B32A 3WA9C 5CPIA 3AZLB 5B33B 5AV9A 5BS7A 3X1SA 4Z5TA 5DNND 3AYWD 3AV2B 2NQBC 3LZ1B 5GT0C 1M19B 1M18D 5B1LB 1ZLAB 3REID 3B0DC 4H9RA 3AZIB 1KX4A 1P3LC 4G92C 3AV1D 1S32C 5GSUC 3A1KA 1P3ID 2XD1A 3MGSD 4H9QB 4YM6D 5AV6C 3O62D 2HIOB 3REJA 3WTPA 3X1TA 3VH5W 2Y2PA 3WKJD 3AZKC 2J8PA 4UPKA 3AZHD 5B1MD 1M19D 5B32B 1KU5A 5JRGA 5B1LD 3MGPA 5CPIB 4XUJB 1ZLAD 3B6GD 4UUZB 1P3FA 4ZUXA 3KXBC 5AV9B 2JSSA 4AWLB 3KWQB 3X1VD 5E5AA 4WU9A 1P3MD 1M1AD 1P3BD 1HQ3D 3KUYA 3WAAB 5B31D 5CPJA 1EQZB 1U35B 3UTAC 2RIQA 2CV5C 4J8UC 3UTBD 3H0LC 2RVQC 4JJND 4XUJD 1B67A 3WA9A 3REJB 3WTPB 3LZ0D 2NQBA 4R8PD 2Y2GA 5B24C 5BO0A 2NZDD 3MGQD 4G91C 5GT0A 1TZYD 3MGPB 3WAAD 4ZUXB 1P3KC 1JFIB 4KGCB 2ZY4A 1P3LA 2DF4C 1S32A 5E5AB 5GSUA 4WU9B 4HGAB 4H9PA 2FJ7C 4J8WD 3AYWC 1ID3C 5AV6A 5AV8D 3X1UD 4KUDB 2IO5B 4Z66D 3AZKA 1WWIA 1M18C 4X23C 3AN2C 2PYOD 1KX3D 4J8XB 5C3IC 1HTAA 4J8VD 5B2IB 3KXBA 1BH9B 3REKD 5BT1C 2BYKA 2YFVA 1P3PD 2NQBB 3MGSC 4KHAA 5GXQC 4YS3C 5B0ZD 3O62C 1BFMA 3A6NB 3AZNC 2F8ND 3AZFC 4KUDD 4G92B 1B6WA 1S32B 3W97C 5GSUB 3RELB 1BH8B 3REHC 3UTAA 2CV5A 3C1BD 4H9NA 1P3AB 4J8UA 3P5JB 2HUEB 5GT3D 3X1VC 1AOID 1P3MC 3W96C 2DQNC 3AZEC 5B31C 3LELC 3AZGC 5B24A 5B40D 3A6ND 3H0MC 3KXBB 5B0YD 1P3KA 2BYKB 3AZMC 3W99C 4KHAB 2F2AC 1P3AD 1KX5C 1H3OB 4XZQD 2FJ7A 3LZ0C 3AYWA 3AFAB 1ID3A 2CWEA 4R8PC 2NZDC 3MGQC 1P3OC 2F8NH 4H9NB 1M18A 4J8UB 2AROB 4QLCB 4X23A 3AN2A 3C1CB 3TU4D 5KDMA 2YFWA 5F99C 5AV5D 1F66D 2Y2NA 3MGSA 4J8WC 5GXQA 3LJAD 4YS3A 4G91B 5AV8C 3O62A 3NQJB 4M6BA 3EPHA 3AZNA 2Y2HA 4Z66C 3FDDA 3W98C 3AZFA 4DQYB 2ZY5A 2XD5A 3NQUA 3W97A 3B0CW 4E45A 3REHA 2AROD 4QLCD 3MVDB 3C1CD 4WU8D 4LD9D 5CP6D 1P3PC 4EO5B 1ID3B 5B2JB 3X1VA 3VH5T 3MNNC 3H0RC 3W96A 1P3MA 3AZEA 4X23B 3AN2B 2Y2MA 5B31A 5AVBB 3LELA 3AZGA 5AVCC 3AZJC 5DNMD 5C3IB 5KDMB 1P34B 5CPKC 3C1BC 3AZLD 5B33D 1N1JA 3AZMA 3W99A 5GXQB 3AV2D 4YS3B 1KX5A 2Y2QA 3LZ1D 3B6FB 1P3GB 3AZNB 1AOIC 5B2JD 3AZFB 3LZ0A 4R8PA 3W97B 3AZID 5JA4A 5B40C 4CSRA 2NZDA 3MGQA 3X1SB 4Z5TB 3REHB 1P3OA 1PZRA 1P34D 5FUGA 4H9RB 1KX4B 5F99A 2HIOD 3MGRC 3W96B 3R45A 3AZEB 3AZGB 4J8WA 4NE6A 3UT9C 5AV8A 5B32D 5CPID 4Z66A 3W98A 5AV9D 3X1TB 1N1JB 1KX5B 3TU4C 5AY8C 3EPKA 4WV4B 3KWQD 1F1EA 1F66C 5JRGB 4H9SC 1P3PA 1P3FB 4NE3A 1KX4D 1P3OB 1EQZD 4H9OA 3MNNA 1U35D 2F8NA 3V9RA 5AVCA 3AZJA 3KUYB 2Y2LA 5F99B 5DNNC 5CPJB 3REJD 3X1TD 3WTPD 1Z2CB 3C1BA 5CPKA 5CP6C 5BNVA 3REIC 3MGPD 1AOIA 3AV1C 1P3FD 4ZUXD 2G5HC 3WA9B 4KGCD 1P3IC 5G49A 5B40A 3VH6A 5DNMC 5E5AD 4WU9D 4YM6C 5BO0B 5GT0B 3AZLC 5B33C 3KUYD 4DRBA 5CPJD 3B0DB 3WKJC 4H9OB 3MNNB 3MGRA 1P3LB 3AZHC 5B1MC 1M19C 2F8NK 5B1LC 3B6GC 1ZLAC 5AVCB 4H9PB 3UT9A 4J8XD 3WA9D 3EPLA 5AV6B 5CPKB 5B2ID 4WJ3C 5B31G 2NQBD 1M1AC 3AZKB 3TU4A 1WWSA 1HQ3C 5AY8A 1P3BC 2HIOC 3AL0C 1F66A 4H9SA 5G49B 1S32D 2YFVB 4DRAA 5GSUD 3UTBC 4JJNC 3RELD 4XUJC 3F6TA 4ZBJC 2W8SA 5AV6D 4AWLC 5DNNA 3KWQC 5CP6A 3AZKD 2Y2JA 4Z2MH 1TZYC 2BG1A 3VH6W 3WAAC 3UTAB 2CV5B 3REIA 1ULYA 1EQZC 3AV1A 3KXBD 1U35C 1P3IA 4WNNA 5AY8B 3B0CT 2Y2KA 5DNMA 5B24B 4YM6A 1W2EA 3X1UC 3AZLA 5B33A 1P3KB 3AFAD 3WKJA 3AZHA 5B1MA 3UTAD 1M19A 2PYOC 2CV5D 1KX3C 5B1LA 4J8UD 1ZLAA 3B6GA 4KGCC 4J8VC 2RVQD 3REKC 2FJ7B 1A7WA 5DNNB 3AYWB 4HGAC 5B0ZC 2F8NG 1M1AA 1M18B 1P3BA 1HQ3A 4KUDC 2HIOA 3EG5B 2IO5C 2YFWB 1P3IB 2ZY3A 3MGSB 3UTBA 4J8XC 4JJNA 2ZY2A 5GT3C 4XUJA 4YM6B 4UUZA 2VQRA 5B2IC 3O62B 3MVDD 2FJ7D 1ID3D 3WKJB 3KWQA 3AZHB 3NQUB 5B1MB 3A6NC 3B6GB 1TZYA 4X23D 3AN2D 2JE5A 5AVBD 3A1IA 3WAAA 5B0YC 1EQZA 3KSYA 3RELC 1U35A 5BNXA 5BT1D 3X1VB 1P3AC 1P3MB 2HUEC 4NFTA 1M1AB 1P3BB 1HQ3B 5GXQD 4CAYA 4YS3D 4XZQC 5B31B 3LELB 3B6FD 1P3GD 3AZND 3X1UA 2Y2IA 3AZFD 3W97D 3UTBB 4JJNB 3AZMB 3X1SD 4Z5TD 3REHD 2PYOA 3W99B 1KX3A 4ZBJB 1JFIA 4KGCA 4J8VA 3REKA 5AV5C 3LZ0B 4R8PB 4E44A 5JA4B 3WTPE 3LJAC 4CSRB 3W96D 3MGQB 2NZDB 1TZYB 5B0ZA 3AZED 2ZM5A 3LELD 3AZGD 3AFAC 4WZSB 4KUDA 5FUGB 5BNXB 2AROC 3R45B 4QLCC 3AZMD 3W99D 3C1CC 4WU8C 4CAYB 4LD9C 1TAFA 4J8WB 1KX5D 4J8XA 5GT3A 5AV8B 3X1UB 5B2IA 1BH9A 5JRGD 4Z66B 3W98B 1P3OD 2PYOB 1KX3B 3A6NA 4J8VB 3REKB 5B0YA 2BYMA 1P3PB 3RELA 1BH8A 2FFFB 5F99D 3AV2C 1P3AA 3LZ1C 5B0ZB 3MVDC 2UWXA 4XZQA 4EO5C 2F8NB 5CHLB 5B2JC 3V9RB 3AZJB 1T3UA 3AZIC 3W98D 3C1BB 5AVBC 1TAFB 5BNVB 5GT3B 1P34C 1AOIB 5GT0D 5AV5A 5B32G 2JCHA 5B40B 3IP4C 3MNND 3LJAA 1P3GC 1P3LD 3B6FC 1H3OA 5B32C 3VH6T 5CPIC 5B0YB 5AVCD 3AFAA 3AZJD 2BYMB 5AV9C 5BS7C 3X1SC 4Z5TC 3KFUG 5CPKD 3MGRB 4QLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1C A;  4LD9 A;  4WU8 A;  4XZQ B;  3B0B A;  3UT9 B;  1KX4 C;  4NE5 A;  3NQJ A;  2LY8 A;  3TU4 B;  5AV5 B;  1F66 B;  3REJ C;  3WTP C;  3X1T C;  1Q9C A;  3AV2 A;  3LJA B;  3MGR D;  3LZ1 A;  3MVD A;  1R4V A;  5JRG C;  3MGP C;  3UT9 D;  2L5A A;  1P3F C;  4ZUX C;  5B2J A;  3VH5 A;  3AZI A;  5E5A C;  4WU9 C;  5AVB A;  4WU8 B;  4LD9 B;  5CP6 B;  4Z2M G;  5AY8 D;  3KUY C;  1P34 A;  5B24 D;  4H9Q A;  3REI B;  5CPJ C;  3AV1 B;  1P3K D;  2ARO A;  4WNN B;  3B6F A;  1P3G A;  5DNM B;  5B32 A;  3WA9 C;  5CPI A;  3AZL B;  5B33 B;  5AV9 A;  5BS7 A;  3X1S A;  4Z5T A;  5DNN D;  3AYW D;  3AV2 B;  2NQB C;  3LZ1 B;  5GT0 C;  1M19 B;  1M18 D;  5B1L B;  1ZLA B;  3REI D;  3B0D C;  4H9R A;  3AZI B;  1KX4 A;  1P3L C;  4G92 C;  3AV1 D;  1S32 C;  5GSU C;  1P3I D;  3MGS D;  4H9Q B;  4YM6 D;  5AV6 C;  3O62 D;  2HIO B;  3REJ A;  3WTP A;  3X1T A;  3VH5 W;  3WKJ D;  3AZK C;  3AZH D;  5B1M D;  1M19 D;  5B32 B;  1KU5 A;  5JRG A;  5B1L D;  3MGP A;  5CPI B;  4XUJ B;  1ZLA D;  3B6G D;  4UUZ B;  1P3F A;  4ZUX A;  3KXB C;  5AV9 B;  2JSS A;  4AWL B;  3KWQ B;  3X1V D;  5E5A A;  4WU9 A;  1P3M D;  1M1A D;  1P3B D;  1HQ3 D;  3KUY A;  3WAA B;  5B31 D;  5CPJ A;  1EQZ B;  1U35 B;  3UTA C;  2CV5 C;  4J8U C;  3UTB D;  4JJN D;  2RVQ C;  4XUJ D;  1B67 A;  3WA9 A;  3REJ B;  3WTP B;  3LZ0 D;  2NQB A;  4R8P D;  5B24 C;  5BO0 A;  2NZD D;  3MGQ D;  4G91 C;  5GT0 A;  1TZY D;  3MGP B;  3WAA D;  4ZUX B;  1P3K C;  1JFI B;  4KGC B;  1P3L A;  1S32 A;  5E5A B;  5GSU A;  4WU9 B;  4HGA B;  4H9P A;  2FJ7 C;  4J8W D;  3AYW C;  1ID3 C;  5AV6 A;  5AV8 D;  3X1U D;  4KUD B;  2IO5 B;  4Z66 D;  3AZK A;  1WWI A;  1M18 C;  4X23 C;  3AN2 C;  2PYO D;  1KX3 D;  4J8X B;  5C3I C;  1HTA A;  4J8V D;  5B2I B;  3KXB A;  1BH9 B;  3REK D;  5BT1 C;  2BYK A;  2YFV A;  1P3P D;  2NQB B;  3MGS C;  4KHA A;  5GXQ C;  4YS3 C;  5B0Z D;  3O62 C;  1BFM A;  3A6N B;  3AZN C;  2F8N D;  3AZF C;  4KUD D;  4G92 B;  1B6W A;  1S32 B;  3W97 C;  5GSU B;  3REL B;  1BH8 B;  3REH C;  3UTA A;  2CV5 A;  3C1B D;  4H9N A;  1P3A B;  4J8U A;  2HUE B;  5GT3 D;  3X1V C;  1AOI D;  1P3M C;  3W96 C;  3AZE C;  5B31 C;  3LEL C;  3AZG C;  5B24 A;  5B40 D;  3A6N D;  3KXB B;  5B0Y D;  1P3K A;  2BYK B;  3AZM C;  3W99 C;  4KHA B;  1P3A D;  1KX5 C;  1H3O B;  4XZQ D;  2FJ7 A;  3LZ0 C;  3AYW A;  3AFA B;  1ID3 A;  2CWE A;  4R8P C;  2NZD C;  3MGQ C;  1P3O C;  2F8N H;  4H9N B;  1M18 A;  4J8U B;  2ARO B;  4QLC B;  4X23 A;  3AN2 A;  3C1C B;  3TU4 D;  5KDM A;  2YFW A;  5F99 C;  5AV5 D;  1F66 D;  3MGS A;  4J8W C;  5GXQ A;  3LJA D;  4YS3 A;  4G91 B;  5AV8 C;  3O62 A;  3NQJ B;  4M6B A;  3AZN A;  4Z66 C;  3W98 C;  3AZF A;  3NQU A;  3W97 A;  3B0C W;  4E45 A;  3REH A;  2ARO D;  4QLC D;  3MVD B;  3C1C D;  4WU8 D;  4LD9 D;  5CP6 D;  1P3P C;  4EO5 B;  1ID3 B;  5B2J B;  3X1V A;  3VH5 T;  3MNN C;  1P3M A;  3W96 A;  3AZE A;  4X23 B;  3AN2 B;  5B31 A;  5AVB B;  3LEL A;  3AZG A;  5AVC C;  3AZJ C;  5DNM D;  5C3I B;  5KDM B;  1P34 B;  5CPK C;  3C1B C;  3AZL D;  5B33 D;  1N1J A;  3AZM A;  3W99 A;  5GXQ B;  3AV2 D;  4YS3 B;  1KX5 A;  3LZ1 D;  3B6F B;  1P3G B;  3AZN B;  1AOI C;  5B2J D;  3AZF B;  3LZ0 A;  4R8P A;  3W97 B;  3AZI D;  5JA4 A;  5B40 C;  4CSR A;  2NZD A;  3MGQ A;  3X1S B;  4Z5T B;  3REH B;  1P3O A;  1P34 D;  5FUG A;  4H9R B;  1KX4 B;  5F99 A;  2HIO D;  3MGR C;  3W96 B;  3R45 A;  3AZE B;  3AZG B;  4J8W A;  4NE6 A;  3UT9 C;  5AV8 A;  5B32 D;  5CPI D;  4Z66 A;  3W98 A;  5AV9 D;  3X1T B;  1N1J B;  1KX5 B;  3TU4 C;  5AY8 C;  4WV4 B;  3KWQ D;  1F1E A;  1F66 C;  5JRG B;  4H9S C;  1P3P A;  1P3F B;  4NE3 A;  1KX4 D;  1P3O B;  1EQZ D;  4H9O A;  3MNN A;  1U35 D;  2F8N A;  3V9R A;  5AVC A;  3AZJ A;  3KUY B;  5F99 B;  5DNN C;  5CPJ B;  3REJ D;  3X1T D;  3WTP D;  3C1B A;  5CPK A;  5CP6 C;  5BNV A;  3REI C;  3MGP D;  1AOI A;  3AV1 C;  1P3F D;  4ZUX D;  3WA9 B;  4KGC D;  1P3I C;  5G49 A;  5B40 A;  3VH6 A;  5DNM C;  5E5A D;  4WU9 D;  4YM6 C;  5BO0 B;  5GT0 B;  3AZL C;  5B33 C;  3KUY D;  4DRB A;  5CPJ D;  3B0D B;  3WKJ C;  4H9O B;  3MNN B;  3MGR A;  1P3L B;  3AZH C;  5B1M C;  1M19 C;  2F8N K;  5B1L C;  3B6G C;  1ZLA C;  5AVC B;  4H9P B;  3UT9 A;  4J8X D;  3WA9 D;  5AV6 B;  5CPK B;  5B2I D;  5B31 G;  2NQB D;  1M1A C;  3AZK B;  3TU4 A;  1WWS A;  1HQ3 C;  5AY8 A;  1P3B C;  2HIO C;  1F66 A;  4H9S A;  5G49 B;  1S32 D;  2YFV B;  4DRA A;  5GSU D;  3UTB C;  4JJN C;  3REL D;  4XUJ C;  4ZBJ C;  5AV6 D;  4AWL C;  5DNN A;  3KWQ C;  5CP6 A;  3AZK D;  4Z2M H;  1TZY C;  3VH6 W;  3UTA B;  3WAA C;  2CV5 B;  3REI A;  1ULY A;  1EQZ C;  3AV1 A;  3KXB D;  1U35 C;  1P3I A;  4WNN A;  5AY8 B;  3B0C T;  5DNM A;  5B24 B;  4YM6 A;  3X1U C;  3AZL A;  5B33 A;  1P3K B;  3AFA D;  3WKJ A;  3AZH A;  5B1M A;  3UTA D;  1M19 A;  2PYO C;  2CV5 D;  1KX3 C;  5B1L A;  4J8U D;  1ZLA A;  3B6G A;  4KGC C;  4J8V C;  2RVQ D;  3REK C;  2FJ7 B;  1A7W A;  5DNN B;  3AYW B;  4HGA C;  5B0Z C;  2F8N G;  1M1A A;  1M18 B;  1P3B A;  1HQ3 A;  4KUD C;  2HIO A;  2IO5 C;  2YFW B;  1P3I B;  3MGS B;  3UTB A;  4J8X C;  4JJN A;  4YM6 B;  5GT3 C;  4XUJ A;  4UUZ A;  5B2I C;  3O62 B;  3MVD D;  2FJ7 D;  1ID3 D;  3WKJ B;  3KWQ A;  3AZH B;  3NQU B;  5B1M B;  3A6N C;  3B6G B;  1TZY A;  4X23 D;  3AN2 D;  3WAA A;  5AVB D;  5B0Y C;  1EQZ A;  3KSY A;  3REL C;  1U35 A;  5BNX A;  5BT1 D;  3X1V B;  1P3A C;  1P3M B;  2HUE C;  4NFT A;  1M1A B;  1P3B B;  1HQ3 B;  5GXQ D;  4CAY A;  4YS3 D;  4XZQ C;  5B31 B;  3LEL B;  3B6F D;  1P3G D;  3AZN D;  3X1U A;  3AZF D;  3W97 D;  3UTB B;  4JJN B;  3AZM B;  3X1S D;  4Z5T D;  3REH D;  2PYO A;  3W99 B;  1KX3 A;  4ZBJ B;  1JFI A;  4KGC A;  4J8V A;  3REK A;  5AV5 C;  3LZ0 B;  4R8P B;  4E44 A;  5JA4 B;  3WTP E;  3LJA C;  4CSR B;  3W96 D;  3MGQ B;  2NZD B;  1TZY B;  5B0Z A;  3AZE D;  3AZG D;  3LEL D;  3AFA C;  4WZS B;  4KUD A;  5FUG B;  5BNX B;  2ARO C;  3R45 B;  4QLC C;  3AZM D;  3W99 D;  3C1C C;  4WU8 C;  4CAY B;  4LD9 C;  1TAF A;  4J8W B;  1KX5 D;  4J8X A;  5GT3 A;  5AV8 B;  3X1U B;  5B2I A;  1BH9 A;  5JRG D;  4Z66 B;  3W98 B;  1P3O D;  2PYO B;  1KX3 B;  3A6N A;  4J8V B;  3REK B;  5B0Y A;  2BYM A;  1P3P B;  3REL A;  1BH8 A;  5F99 D;  3AV2 C;  1P3A A;  3LZ1 C;  5B0Z B;  3MVD C;  4EO5 C;  4XZQ A;  2F8N B;  5CHL B;  5B2J C;  3V9R B;  3AZJ B;  3AZI C;  3W98 D;  3C1B B;  5AVB C;  1TAF B;  5BNV B;  5GT3 B;  1P34 C;  1AOI B;  5GT0 D;  5AV5 A;  5B32 G;  3B6F C;  5B40 B;  3MNN D;  3LJA A;  1P3G C;  1P3L D;  1H3O A;  5B32 C;  3VH6 T;  5CPI C;  5B0Y B;  5AVC D;  3AFA A;  3AZJ D;  2BYM B;  5AV9 C;  5BS7 C;  3X1S C;  4Z5T C;  5CPK D;  3MGR B;  4QLC A; 
#chains in the Genus database with same CATH topology
 3C1C A;  4LD9 A;  4WU8 A;  4XZQ B;  3B0B A;  3UT9 B;  3EPJ A;  1KX4 C;  2G5I C;  4NE5 A;  3NQJ A;  2LY8 A;  3TU4 B;  5AV5 B;  1F66 B;  3REJ C;  3WTP C;  3X1T C;  1Q9C A;  3AV2 A;  3LJA B;  3MGR D;  3LZ1 A;  3MVD A;  1R4V A;  5JRG C;  3MGP C;  3UT9 D;  2L5A A;  1P3F C;  4ZUX C;  5B2J A;  3VH5 A;  3AZI A;  2Y2O A;  5E5A C;  4WU9 C;  5AVB A;  4WU8 B;  4LD9 B;  5CP6 B;  4Z2M G;  5AY8 D;  3KUY C;  1P34 A;  5B24 D;  4H9Q A;  3REI B;  5CPJ C;  3AV1 B;  1P3K D;  2ARO A;  4WNN B;  3B6F A;  1P3G A;  5DNM B;  5B32 A;  3WA9 C;  5CPI A;  3AZL B;  5B33 B;  5AV9 A;  5BS7 A;  3X1S A;  4Z5T A;  5DNN D;  3AYW D;  3AV2 B;  2NQB C;  3LZ1 B;  5GT0 C;  1M19 B;  1M18 D;  5B1L B;  1ZLA B;  3REI D;  3B0D C;  4H9R A;  3AZI B;  1KX4 A;  1P3L C;  4G92 C;  3AV1 D;  1S32 C;  5GSU C;  3A1K A;  1P3I D;  2XD1 A;  3MGS D;  4H9Q B;  4YM6 D;  5AV6 C;  3O62 D;  2HIO B;  3REJ A;  3WTP A;  3X1T A;  3VH5 W;  2Y2P A;  3WKJ D;  3AZK C;  2J8P A;  4UPK A;  3AZH D;  5B1M D;  1M19 D;  5B32 B;  1KU5 A;  5JRG A;  5B1L D;  3MGP A;  5CPI B;  4XUJ B;  1ZLA D;  3B6G D;  4UUZ B;  1P3F A;  4ZUX A;  3KXB C;  5AV9 B;  2JSS A;  4AWL B;  3KWQ B;  3X1V D;  5E5A A;  4WU9 A;  1P3M D;  1M1A D;  1P3B D;  1HQ3 D;  3KUY A;  3WAA B;  5B31 D;  5CPJ A;  1EQZ B;  1U35 B;  3UTA C;  2RIQ A;  2CV5 C;  4J8U C;  3UTB D;  3H0L C;  2RVQ C;  4JJN D;  4XUJ D;  1B67 A;  3WA9 A;  3REJ B;  3WTP B;  3LZ0 D;  2NQB A;  4R8P D;  2Y2G A;  5B24 C;  5BO0 A;  2NZD D;  3MGQ D;  4G91 C;  5GT0 A;  1TZY D;  3MGP B;  3WAA D;  4ZUX B;  1P3K C;  1JFI B;  4KGC B;  2ZY4 A;  1P3L A;  2DF4 C;  1S32 A;  5E5A B;  5GSU A;  4WU9 B;  4HGA B;  4H9P A;  2FJ7 C;  4J8W D;  3AYW C;  1ID3 C;  5AV6 A;  5AV8 D;  3X1U D;  4KUD B;  2IO5 B;  4Z66 D;  3AZK A;  1WWI A;  1M18 C;  4X23 C;  3AN2 C;  2PYO D;  1KX3 D;  4J8X B;  5C3I C;  1HTA A;  4J8V D;  5B2I B;  3KXB A;  1BH9 B;  3REK D;  5BT1 C;  2BYK A;  2YFV A;  1P3P D;  2NQB B;  3MGS C;  4KHA A;  5GXQ C;  4YS3 C;  5B0Z D;  3O62 C;  1BFM A;  3A6N B;  3AZN C;  2F8N D;  3AZF C;  4KUD D;  4G92 B;  1B6W A;  1S32 B;  3W97 C;  5GSU B;  3REL B;  1BH8 B;  3REH C;  3UTA A;  2CV5 A;  3C1B D;  4H9N A;  1P3A B;  4J8U A;  3P5J B;  2HUE B;  5GT3 D;  3X1V C;  1AOI D;  1P3M C;  3W96 C;  2DQN C;  3AZE C;  5B31 C;  3LEL C;  3AZG C;  5B24 A;  5B40 D;  3A6N D;  3H0M C;  3KXB B;  5B0Y D;  1P3K A;  2BYK B;  3AZM C;  3W99 C;  4KHA B;  2F2A C;  1P3A D;  1KX5 C;  1H3O B;  4XZQ D;  2FJ7 A;  3LZ0 C;  3AYW A;  3AFA B;  1ID3 A;  2CWE A;  4R8P C;  2NZD C;  3MGQ C;  1P3O C;  2F8N H;  4H9N B;  1M18 A;  4J8U B;  2ARO B;  4QLC B;  4X23 A;  3AN2 A;  3C1C B;  3TU4 D;  5KDM A;  2YFW A;  5F99 C;  5AV5 D;  1F66 D;  2Y2N A;  3MGS A;  4J8W C;  5GXQ A;  3LJA D;  4YS3 A;  4G91 B;  5AV8 C;  3O62 A;  3NQJ B;  4M6B A;  3EPH A;  3AZN A;  2Y2H A;  4Z66 C;  3FDD A;  3W98 C;  3AZF A;  4DQY B;  2ZY5 A;  2XD5 A;  3NQU A;  3W97 A;  3B0C W;  4E45 A;  3REH A;  2ARO D;  4QLC D;  3MVD B;  3C1C D;  4WU8 D;  4LD9 D;  5CP6 D;  1P3P C;  4EO5 B;  1ID3 B;  5B2J B;  3X1V A;  3VH5 T;  3MNN C;  3H0R C;  3W96 A;  1P3M A;  3AZE A;  4X23 B;  3AN2 B;  2Y2M A;  5B31 A;  5AVB B;  3LEL A;  3AZG A;  5AVC C;  3AZJ C;  5DNM D;  5C3I B;  5KDM B;  1P34 B;  5CPK C;  3C1B C;  3AZL D;  5B33 D;  1N1J A;  3AZM A;  3W99 A;  5GXQ B;  3AV2 D;  4YS3 B;  1KX5 A;  2Y2Q A;  3LZ1 D;  3B6F B;  1P3G B;  3AZN B;  1AOI C;  5B2J D;  3AZF B;  3LZ0 A;  4R8P A;  3W97 B;  3AZI D;  5JA4 A;  5B40 C;  4CSR A;  2NZD A;  3MGQ A;  3X1S B;  4Z5T B;  3REH B;  1P3O A;  1PZR A;  1P34 D;  5FUG A;  4H9R B;  1KX4 B;  5F99 A;  2HIO D;  3MGR C;  3W96 B;  3R45 A;  3AZE B;  3AZG B;  4J8W A;  4NE6 A;  3UT9 C;  5AV8 A;  5B32 D;  5CPI D;  4Z66 A;  3W98 A;  5AV9 D;  3X1T B;  1N1J B;  1KX5 B;  3TU4 C;  5AY8 C;  3EPK A;  4WV4 B;  3KWQ D;  1F1E A;  1F66 C;  5JRG B;  4H9S C;  1P3P A;  1P3F B;  4NE3 A;  1KX4 D;  1P3O B;  1EQZ D;  4H9O A;  3MNN A;  1U35 D;  2F8N A;  3V9R A;  5AVC A;  3AZJ A;  3KUY B;  2Y2L A;  5F99 B;  5DNN C;  5CPJ B;  3REJ D;  3X1T D;  3WTP D;  1Z2C B;  3C1B A;  5CPK A;  5CP6 C;  5BNV A;  3REI C;  3MGP D;  1AOI A;  3AV1 C;  1P3F D;  4ZUX D;  2G5H C;  3WA9 B;  4KGC D;  1P3I C;  5G49 A;  5B40 A;  3VH6 A;  5DNM C;  5E5A D;  4WU9 D;  4YM6 C;  5BO0 B;  5GT0 B;  3AZL C;  5B33 C;  3KUY D;  4DRB A;  5CPJ D;  3B0D B;  3WKJ C;  4H9O B;  3MNN B;  3MGR A;  1P3L B;  3AZH C;  5B1M C;  1M19 C;  2F8N K;  5B1L C;  3B6G C;  1ZLA C;  5AVC B;  4H9P B;  3UT9 A;  4J8X D;  3WA9 D;  3EPL A;  5AV6 B;  5CPK B;  5B2I D;  4WJ3 C;  5B31 G;  2NQB D;  1M1A C;  3AZK B;  3TU4 A;  1WWS A;  1HQ3 C;  5AY8 A;  1P3B C;  2HIO C;  3AL0 C;  1F66 A;  4H9S A;  5G49 B;  1S32 D;  2YFV B;  4DRA A;  5GSU D;  3UTB C;  4JJN C;  3REL D;  4XUJ C;  3F6T A;  4ZBJ C;  2W8S A;  5AV6 D;  4AWL C;  5DNN A;  3KWQ C;  5CP6 A;  3AZK D;  2Y2J A;  4Z2M H;  1TZY C;  2BG1 A;  3VH6 W;  3WAA C;  3UTA B;  2CV5 B;  3REI A;  1ULY A;  1EQZ C;  3AV1 A;  3KXB D;  1U35 C;  1P3I A;  4WNN A;  5AY8 B;  3B0C T;  2Y2K A;  5DNM A;  5B24 B;  4YM6 A;  1W2E A;  3X1U C;  3AZL A;  5B33 A;  1P3K B;  3AFA D;  3WKJ A;  3AZH A;  5B1M A;  3UTA D;  1M19 A;  2PYO C;  2CV5 D;  1KX3 C;  5B1L A;  4J8U D;  1ZLA A;  3B6G A;  4KGC C;  4J8V C;  2RVQ D;  3REK C;  2FJ7 B;  1A7W A;  5DNN B;  3AYW B;  4HGA C;  5B0Z C;  2F8N G;  1M1A A;  1M18 B;  1P3B A;  1HQ3 A;  4KUD C;  2HIO A;  3EG5 B;  2IO5 C;  2YFW B;  1P3I B;  2ZY3 A;  3MGS B;  3UTB A;  4J8X C;  4JJN A;  2ZY2 A;  5GT3 C;  4XUJ A;  4YM6 B;  4UUZ A;  2VQR A;  5B2I C;  3O62 B;  3MVD D;  2FJ7 D;  1ID3 D;  3WKJ B;  3KWQ A;  3AZH B;  3NQU B;  5B1M B;  3A6N C;  3B6G B;  1TZY A;  4X23 D;  3AN2 D;  2JE5 A;  5AVB D;  3A1I A;  3WAA A;  5B0Y C;  1EQZ A;  3KSY A;  3REL C;  1U35 A;  5BNX A;  5BT1 D;  3X1V B;  1P3A C;  1P3M B;  2HUE C;  4NFT A;  1M1A B;  1P3B B;  1HQ3 B;  5GXQ D;  4CAY A;  4YS3 D;  4XZQ C;  5B31 B;  3LEL B;  3B6F D;  1P3G D;  3AZN D;  3X1U A;  2Y2I A;  3AZF D;  3W97 D;  3UTB B;  4JJN B;  3AZM B;  3X1S D;  4Z5T D;  3REH D;  2PYO A;  3W99 B;  1KX3 A;  4ZBJ B;  1JFI A;  4KGC A;  4J8V A;  3REK A;  5AV5 C;  3LZ0 B;  4R8P B;  4E44 A;  5JA4 B;  3WTP E;  3LJA C;  4CSR B;  3W96 D;  3MGQ B;  2NZD B;  1TZY B;  5B0Z A;  3AZE D;  2ZM5 A;  3LEL D;  3AZG D;  3AFA C;  4WZS B;  4KUD A;  5FUG B;  5BNX B;  2ARO C;  3R45 B;  4QLC C;  3AZM D;  3W99 D;  3C1C C;  4WU8 C;  4CAY B;  4LD9 C;  1TAF A;  4J8W B;  1KX5 D;  4J8X A;  5GT3 A;  5AV8 B;  3X1U B;  5B2I A;  1BH9 A;  5JRG D;  4Z66 B;  3W98 B;  1P3O D;  2PYO B;  1KX3 B;  3A6N A;  4J8V B;  3REK B;  5B0Y A;  2BYM A;  1P3P B;  3REL A;  1BH8 A;  2FFF B;  5F99 D;  3AV2 C;  1P3A A;  3LZ1 C;  5B0Z B;  3MVD C;  2UWX A;  4XZQ A;  4EO5 C;  2F8N B;  5CHL B;  5B2J C;  3V9R B;  3AZJ B;  1T3U A;  3AZI C;  3W98 D;  3C1B B;  5AVB C;  1TAF B;  5BNV B;  5GT3 B;  1P34 C;  1AOI B;  5GT0 D;  5AV5 A;  5B32 G;  2JCH A;  5B40 B;  3IP4 C;  3MNN D;  3LJA A;  1P3G C;  1P3L D;  3B6F C;  1H3O A;  5B32 C;  3VH6 T;  5CPI C;  5B0Y B;  5AVC D;  3AFA A;  3AZJ D;  2BYM B;  5AV9 C;  5BS7 C;  3X1S C;  4Z5T C;  3KFU G;  5CPK D;  3MGR B;  4QLC A; 
#chains in the Genus database with same CATH homology
 3C1C A;  4LD9 A;  4WU8 A;  4XZQ B;  3B0B A;  3UT9 B;  3EPJ A;  1KX4 C;  2G5I C;  4NE5 A;  3NQJ A;  2LY8 A;  3TU4 B;  5AV5 B;  1F66 B;  3REJ C;  3WTP C;  3X1T C;  1Q9C A;  3AV2 A;  3LJA B;  3MGR D;  3LZ1 A;  3MVD A;  1R4V A;  5JRG C;  3MGP C;  3UT9 D;  2L5A A;  1P3F C;  4ZUX C;  5B2J A;  3VH5 A;  3AZI A;  2Y2O A;  5E5A C;  4WU9 C;  5AVB A;  4WU8 B;  4LD9 B;  5CP6 B;  4Z2M G;  5AY8 D;  3KUY C;  1P34 A;  5B24 D;  4H9Q A;  3REI B;  5CPJ C;  3AV1 B;  1P3K D;  2ARO A;  4WNN B;  3B6F A;  1P3G A;  5DNM B;  5B32 A;  3WA9 C;  5CPI A;  3AZL B;  5B33 B;  5AV9 A;  5BS7 A;  3X1S A;  4Z5T A;  5DNN D;  3AYW D;  3AV2 B;  2NQB C;  3LZ1 B;  5GT0 C;  1M19 B;  1M18 D;  5B1L B;  1ZLA B;  3REI D;  3B0D C;  4H9R A;  3AZI B;  1KX4 A;  1P3L C;  4G92 C;  3AV1 D;  1S32 C;  5GSU C;  3A1K A;  1P3I D;  2XD1 A;  3MGS D;  4H9Q B;  4YM6 D;  5AV6 C;  3O62 D;  2HIO B;  3REJ A;  3WTP A;  3X1T A;  3VH5 W;  2Y2P A;  3WKJ D;  3AZK C;  2J8P A;  4UPK A;  3AZH D;  5B1M D;  1M19 D;  5B32 B;  1KU5 A;  5JRG A;  5B1L D;  3MGP A;  5CPI B;  4XUJ B;  1ZLA D;  3B6G D;  4UUZ B;  1P3F A;  4ZUX A;  3KXB C;  5AV9 B;  2JSS A;  4AWL B;  3KWQ B;  3X1V D;  5E5A A;  4WU9 A;  1P3M D;  1M1A D;  1P3B D;  1HQ3 D;  3KUY A;  3WAA B;  5B31 D;  5CPJ A;  1EQZ B;  1U35 B;  3UTA C;  2RIQ A;  2CV5 C;  4J8U C;  3UTB D;  3H0L C;  2RVQ C;  4JJN D;  4XUJ D;  1B67 A;  3WA9 A;  3REJ B;  3WTP B;  3LZ0 D;  2NQB A;  4R8P D;  2Y2G A;  5B24 C;  5BO0 A;  2NZD D;  3MGQ D;  4G91 C;  5GT0 A;  1TZY D;  3MGP B;  3WAA D;  4ZUX B;  1P3K C;  1JFI B;  4KGC B;  2ZY4 A;  1P3L A;  2DF4 C;  1S32 A;  5E5A B;  5GSU A;  4WU9 B;  4HGA B;  4H9P A;  2FJ7 C;  4J8W D;  3AYW C;  1ID3 C;  5AV6 A;  5AV8 D;  3X1U D;  4KUD B;  2IO5 B;  4Z66 D;  3AZK A;  1WWI A;  1M18 C;  4X23 C;  3AN2 C;  2PYO D;  1KX3 D;  4J8X B;  5C3I C;  1HTA A;  4J8V D;  5B2I B;  3KXB A;  1BH9 B;  3REK D;  5BT1 C;  2BYK A;  2YFV A;  1P3P D;  2NQB B;  3MGS C;  4KHA A;  5GXQ C;  4YS3 C;  5B0Z D;  3O62 C;  1BFM A;  3A6N B;  3AZN C;  2F8N D;  3AZF C;  4KUD D;  4G92 B;  1B6W A;  1S32 B;  3W97 C;  5GSU B;  3REL B;  1BH8 B;  3REH C;  3UTA A;  2CV5 A;  3C1B D;  4H9N A;  1P3A B;  4J8U A;  3P5J B;  2HUE B;  5GT3 D;  3X1V C;  1AOI D;  1P3M C;  3W96 C;  2DQN C;  3AZE C;  5B31 C;  3LEL C;  3AZG C;  5B24 A;  5B40 D;  3A6N D;  3H0M C;  3KXB B;  5B0Y D;  1P3K A;  2BYK B;  3AZM C;  3W99 C;  4KHA B;  2F2A C;  1P3A D;  1KX5 C;  1H3O B;  4XZQ D;  2FJ7 A;  3LZ0 C;  3AYW A;  3AFA B;  1ID3 A;  2CWE A;  4R8P C;  2NZD C;  3MGQ C;  1P3O C;  2F8N H;  4H9N B;  1M18 A;  4J8U B;  2ARO B;  4QLC B;  4X23 A;  3AN2 A;  3C1C B;  3TU4 D;  5KDM A;  2YFW A;  5F99 C;  5AV5 D;  1F66 D;  2Y2N A;  3MGS A;  4J8W C;  5GXQ A;  3LJA D;  4YS3 A;  4G91 B;  5AV8 C;  3O62 A;  3NQJ B;  4M6B A;  3EPH A;  3AZN A;  2Y2H A;  4Z66 C;  3FDD A;  3W98 C;  3AZF A;  4DQY B;  2ZY5 A;  2XD5 A;  3NQU A;  3W97 A;  3B0C W;  4E45 A;  3REH A;  2ARO D;  4QLC D;  3MVD B;  3C1C D;  4WU8 D;  4LD9 D;  5CP6 D;  1P3P C;  4EO5 B;  1ID3 B;  5B2J B;  3X1V A;  3VH5 T;  3MNN C;  3H0R C;  3W96 A;  1P3M A;  3AZE A;  4X23 B;  3AN2 B;  2Y2M A;  5B31 A;  5AVB B;  3LEL A;  3AZG A;  5AVC C;  3AZJ C;  5DNM D;  5C3I B;  5KDM B;  1P34 B;  5CPK C;  3C1B C;  3AZL D;  5B33 D;  1N1J A;  3AZM A;  3W99 A;  5GXQ B;  3AV2 D;  4YS3 B;  1KX5 A;  2Y2Q A;  3LZ1 D;  3B6F B;  1P3G B;  3AZN B;  1AOI C;  5B2J D;  3AZF B;  3LZ0 A;  4R8P A;  3W97 B;  3AZI D;  5JA4 A;  5B40 C;  4CSR A;  2NZD A;  3MGQ A;  3X1S B;  4Z5T B;  3REH B;  1P3O A;  1PZR A;  1P34 D;  5FUG A;  4H9R B;  1KX4 B;  5F99 A;  2HIO D;  3MGR C;  3W96 B;  3R45 A;  3AZE B;  3AZG B;  4J8W A;  4NE6 A;  3UT9 C;  5AV8 A;  5B32 D;  5CPI D;  4Z66 A;  3W98 A;  5AV9 D;  3X1T B;  1N1J B;  1KX5 B;  3TU4 C;  5AY8 C;  3EPK A;  4WV4 B;  3KWQ D;  1F1E A;  1F66 C;  5JRG B;  4H9S C;  1P3P A;  1P3F B;  4NE3 A;  1KX4 D;  1P3O B;  1EQZ D;  4H9O A;  3MNN A;  1U35 D;  2F8N A;  3V9R A;  5AVC A;  3AZJ A;  3KUY B;  2Y2L A;  5F99 B;  5DNN C;  5CPJ B;  3REJ D;  3X1T D;  3WTP D;  1Z2C B;  3C1B A;  5CPK A;  5CP6 C;  5BNV A;  3REI C;  3MGP D;  1AOI A;  3AV1 C;  1P3F D;  4ZUX D;  2G5H C;  3WA9 B;  4KGC D;  1P3I C;  5G49 A;  5B40 A;  3VH6 A;  5DNM C;  5E5A D;  4WU9 D;  4YM6 C;  5BO0 B;  5GT0 B;  3AZL C;  5B33 C;  3KUY D;  4DRB A;  5CPJ D;  3B0D B;  3WKJ C;  4H9O B;  3MNN B;  3MGR A;  1P3L B;  3AZH C;  5B1M C;  1M19 C;  2F8N K;  5B1L C;  3B6G C;  1ZLA C;  5AVC B;  4H9P B;  3UT9 A;  4J8X D;  3WA9 D;  3EPL A;  5AV6 B;  5CPK B;  5B2I D;  4WJ3 C;  5B31 G;  2NQB D;  1M1A C;  3AZK B;  3TU4 A;  1WWS A;  1HQ3 C;  5AY8 A;  1P3B C;  2HIO C;  3AL0 C;  1F66 A;  4H9S A;  5G49 B;  1S32 D;  2YFV B;  4DRA A;  5GSU D;  3UTB C;  4JJN C;  3REL D;  4XUJ C;  3F6T A;  4ZBJ C;  2W8S A;  5AV6 D;  4AWL C;  5DNN A;  3KWQ C;  5CP6 A;  3AZK D;  2Y2J A;  4Z2M H;  1TZY C;  2BG1 A;  3VH6 W;  3WAA C;  3UTA B;  2CV5 B;  3REI A;  1ULY A;  1EQZ C;  3AV1 A;  3KXB D;  1U35 C;  1P3I A;  4WNN A;  5AY8 B;  3B0C T;  2Y2K A;  5DNM A;  5B24 B;  4YM6 A;  1W2E A;  3X1U C;  3AZL A;  5B33 A;  1P3K B;  3AFA D;  3WKJ A;  3AZH A;  5B1M A;  3UTA D;  1M19 A;  2PYO C;  2CV5 D;  1KX3 C;  5B1L A;  4J8U D;  1ZLA A;  3B6G A;  4KGC C;  4J8V C;  2RVQ D;  3REK C;  2FJ7 B;  1A7W A;  5DNN B;  3AYW B;  4HGA C;  5B0Z C;  2F8N G;  1M1A A;  1M18 B;  1P3B A;  1HQ3 A;  4KUD C;  2HIO A;  3EG5 B;  2IO5 C;  2YFW B;  1P3I B;  2ZY3 A;  3MGS B;  3UTB A;  4J8X C;  4JJN A;  2ZY2 A;  5GT3 C;  4XUJ A;  4YM6 B;  4UUZ A;  2VQR A;  5B2I C;  3O62 B;  3MVD D;  2FJ7 D;  1ID3 D;  3WKJ B;  3KWQ A;  3AZH B;  3NQU B;  5B1M B;  3A6N C;  3B6G B;  1TZY A;  4X23 D;  3AN2 D;  2JE5 A;  5AVB D;  3A1I A;  3WAA A;  5B0Y C;  1EQZ A;  3KSY A;  3REL C;  1U35 A;  5BNX A;  5BT1 D;  3X1V B;  1P3A C;  1P3M B;  2HUE C;  4NFT A;  1M1A B;  1P3B B;  1HQ3 B;  5GXQ D;  4CAY A;  4YS3 D;  4XZQ C;  5B31 B;  3LEL B;  3B6F D;  1P3G D;  3AZN D;  3X1U A;  2Y2I A;  3AZF D;  3W97 D;  3UTB B;  4JJN B;  3AZM B;  3X1S D;  4Z5T D;  3REH D;  2PYO A;  3W99 B;  1KX3 A;  4ZBJ B;  1JFI A;  4KGC A;  4J8V A;  3REK A;  5AV5 C;  3LZ0 B;  4R8P B;  4E44 A;  5JA4 B;  3WTP E;  3LJA C;  4CSR B;  3W96 D;  3MGQ B;  2NZD B;  1TZY B;  5B0Z A;  3AZE D;  2ZM5 A;  3LEL D;  3AZG D;  3AFA C;  4WZS B;  4KUD A;  5FUG B;  5BNX B;  2ARO C;  3R45 B;  4QLC C;  3AZM D;  3W99 D;  3C1C C;  4WU8 C;  4CAY B;  4LD9 C;  1TAF A;  4J8W B;  1KX5 D;  4J8X A;  5GT3 A;  5AV8 B;  3X1U B;  5B2I A;  1BH9 A;  5JRG D;  4Z66 B;  3W98 B;  1P3O D;  2PYO B;  1KX3 B;  3A6N A;  4J8V B;  3REK B;  5B0Y A;  2BYM A;  1P3P B;  3REL A;  1BH8 A;  2FFF B;  5F99 D;  3AV2 C;  1P3A A;  3LZ1 C;  5B0Z B;  3MVD C;  2UWX A;  4XZQ A;  4EO5 C;  2F8N B;  5CHL B;  5B2J C;  3V9R B;  3AZJ B;  1T3U A;  3AZI C;  3W98 D;  3C1B B;  5AVB C;  1TAF B;  5BNV B;  5GT3 B;  1P34 C;  1AOI B;  5GT0 D;  5AV5 A;  5B32 G;  2JCH A;  5B40 B;  3IP4 C;  3MNN D;  3LJA A;  1P3G C;  1P3L D;  3B6F C;  1H3O A;  5B32 C;  3VH6 T;  5CPI C;  5B0Y B;  5AVC D;  3AFA A;  3AZJ D;  2BYM B;  5AV9 C;  5BS7 C;  3X1S C;  4Z5T C;  3KFU G;  5CPK D;  3MGR B;  4QLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...