4J8UA

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8uA00
4M6BA 3X1TD 3X1VC 1ZLAD 4QLCA 4QLCB 4YS3C 5AY8B 5B2ID 1P3LD 3W96C 5B24A 5B24B 4CSRA 3VH5A 4CSRB 3WKJA 3WKJB 3W98A 3W98B 3VH6T 4Z2MH 4Z66A 3REHC 1P3MA 4NE3A 4Z66B 3A6NC 1P3MB 3MVDA 5B33A 2HUEC 3MVDB 5B33B 3B6FB 3MGQA 3LZ0C 3MGQB 3AV1D 3X1TA 1ZLAA 3X1TB 5B32A 1ZLAB 3WA9C 1TAFA 2HIOC 1TAFB 3W99C 5B2IA 1P3LA 1KX4C 5B2IB 1P3LB 1P3OD 5B1LC 4JJNC 3AZLC 4J8VD 4DRBA 5GXQD 1P3FC 4EO5C 4WU8C 5DNMD 1P3GC 1U35C 4XZQA 3KWQC 1F66C 4R8PD 5JRGC 4J8UD 1HQ3C 3LELD 4G91B 4Z5TC 3AZGD 2BYMA 2BYMB 2L5AA 5AV6D 3AV1A 1P34C 3AV1B 2NZDD 1ULYA 5JA4A 5CPJD 3AZHA 5JA4B 1P3OB 1WWSA 4J8VA 2CV5D 5GXQA 4J8VB 1AOID 5GXQB 4DRAA 5DNMA 3AYWC 1BH9A 5B1MC 5DNMB 1BH9B 4YM6A 4R8PA 3REKC 4R8PB 1KX5D 4J8UA 3TU4D 4J8UB 3LELA 3AZFD 3LELB 3AZGA 1A7WA 5CP6D 4X23C 3AZGB 1M19D 5AV6A 4HGAC 5AVBD 3REJC 5AV6B 4NE6A 4KHAA 5CHLB 4KHAB 2F8NG 3AZMC 3B6GC 4XUJD 2NZDA 4H9RA 2NZDB 4H9RB 5CPJA 5B2JD 5GT0C 4J8XC 2CV5B 3B0CW 2AROA 5BT1C 4CAYB 1AOIB 1S32D 4ZBJC 3LZ1D 5B0YC 3X1SD 3RELD 1KX5A 3TU4A 4KGCC 4QLCC 1KX5B 3TU4B 3AZFA 5AY8C 3AZFB 5CP6A 1M19A 5CP6B 1M19B 5AVBA 5AVBB 4XUJA 3WKJC 4XUJB 1JFIA 2RVQD 4ZUXD 5B2JA 1JFIB 3W98C 5B2JB 4Z66C 5CPID 1P3MC 1S32A 3MVDC 3LZ1A 3NQUA 1H3OA 5B33C 1S32B 3B6FC 3LZ1B 3NQUB 1H3OB 3X1SA 3MGQC 3RELA 3X1SB 3C1BD 3RELB 3X1TC 1P3PD 1ZLAC 4NFTA 1BFMA 5B2IC 1P3LC 3NQJA 3NQJB 3MNND 1TZYD 2CWEA 4ZUXA 5E5AD 1R4VA 3UT9D 4H9OA 3AZJD 5B32D 5DNND 4G91C 5CPIA 5CPIB 5CPKD 1Q9CA 4J8WD 1M18D 3C1BA 1P3PA 3AV1C 4WNNA 3C1BB 1P3PB 4WNNB 4H9PA 4XZQD 4H9PB 1P3OC 1P3AD 3MNNA 4J8VC 5AV8D 3MNNB 5GXQC 1TZYA 5BNVA 5BNXA 5GSUD 1TZYB 5BNVB 5DNMC 5BNXB 5E5AA 5FUGA 5E5AB 5FUGB 3UT9A 3WTPD 4R8PC 3UTBD 5B31D 3UT9B 3AZJA 4J8UC 5DNNA 5B32B 3AZJB 5DNNB 3AZHD 3AZGC 5CPKA 1P3KD 3MGRD 5CPKB 1KX3D 4J8WA 1M18A 1B6WA 5AV6C 4J8WB 5KDMA 1M18B 5KDMB 1EQZD 2NZDC 3LJAD 3WAAD 1M1AD 4XZQB 4YM6D 3MGSD 1P3AA 1P3AB 3X1UD 5AV8A 2CV5C 5AV8B 1AOIC 5GSUA 3KXBD 5GSUB 3WTPE 3AV2D 3WTPA 3UTBA 5B31A 3WTPB 3UTBB 1KX5C 5B31B 3TU4C 3AZFC 2PYOD 3AZHB 1P3KA 1ID3D 3MGRA 1P3KB 1M19C 1KX3A 3MGRB 1KX3B 5AVBC 3AZNC 4H9QA 1EQZA 4H9SA 2AROD 4H9QB 3VH5T 1EQZB 4XUJC 3LJAA 5B0ZD 3C1CD 3WAAA 3LJAB 1M1AA 5B2JC 3WAAB 1M1AB 3MGSA 4YM6B 3W97D 2BYKA 3MGSB 1P3BC 3X1UA 2BYKB 3X1UB 3VH6W 3KXBA 1S32C 3KXBB 3LZ1C 4WV4B 3AV2A 4E45A 3AV2B 3RELC 3X1SC 2NQBD 3REHA 4Z2MG 2PYOA 1HQ3D 5CPJB 1ID3A 2PYOB 1ID3B 3AN2D 2AROB 3C1CA 5B0ZA 2F8NK 5AV9D 3C1CB 2RVQC 5B0ZB 4G92B 2HIOA 3W97A 3UTAD 3W97B 5CPIC 3O62D 2LY8A 5B24C 3MGPD 3AFAD 2NQBA 3C1BC 1P3PC 2NQBB 3B0DB 1BH8A 5JRGA 1BH8B 1HQ3A 1HQ3B 4X23D 3MNNC 5B40D 3KSYA 3REJD 3AN2A 3AN2B 1TZYC 1P34A 5AV9A 5F99D 5E5AC 5AV9B 3UT9C 5B32G 3UTAA 3VH6A 3UTAB 5B32C 3AZJC 5DNNC 3O62A 5CPKC 1N1JA 3O62B 5AV5D 1N1JB 1M18C 3MGPA 3AFAA 2IO5B 3KUYD 3MGPB 3AZKD 3AFAB 4KGCD 4ZUXB 4XZQC 3AZED 4X23A 4H9OB 1P3AC 5B40A 5AV8C 3REJA 4UUZA 5B40B 3REJB 4UUZB 5GSUC 5F99A 3AZID 2FJ7D 5F99B 4WU9D 5B31G 3UTBC 5B31C 1WWIA 4E44A 5GT3D 3AZHC 1P3KC 3MGRC 1KX3C 5AV5A 4LD9D 5AV5B 3KUYA 3AZKA 5B0YA 3KUYB 1EQZC 3AZKB 4H9SC 4KGCA 3LJAC 5AVCD 3WAAC 1M1AC 4KGCB 5AY8A 3AZEA 4YM6C 3MGSC 4AWLB 3AZEB 3X1UC 3LELC 1P3ID 3REID 3KXBC 3AZIA 2FJ7A 3AZIB 4WU9A 2FJ7B 3AV2C 4WU9B 4KUDD 1B67A 2F8NH 3X1VD 5CPJC 5GT3A 2PYOC 1ID3C 5GT3B 4YS3D 4LD9A 3B6FA 3W96D 4LD9B 5C3IB 2AROC 3C1CC 5B0ZC 5AVCA 4G92C 5AVCB 3W97C 3B0CT 5BS7A 3REHD 1P3IA 1P3IB 3A6ND 3REIA 5CP6C 3REIB 4KUDA 3V9RA 4KUDB 3LZ0D 3B0DC 3V9RB 2NQBC 3X1VA 3WA9D 3X1VB 2HIOD 3W99D 4YS3A 1KX4D 4YS3B 3W96A 5B1LD 3W96B 4JJND 3AZLD 3AN2C 3B0BA 1P3FD 4WU8D 5AV9C 1P3GD 1U35D 3KWQD 3UTAC 1F66D 1P3OA 5JRGD 3REHB 3A6NA 3A6NB 3O62C 4Z5TD 5G49A 2HUEB 2IO5C 5G49B 3MGPC 3AFAC 3LZ0A 3LZ0B 1P34D 3WA9A 3R45A 4ZUXC 3WA9B 3R45B 3W99A 2HIOB 1KX4A 3W99B 1KX4B 5B1LA 4JJNA 5B1LB 3AZLA 4JJNB 5B40C 3AZLB 3AZND 1P3FA 4WU8A 1P3FB 5F99C 4EO5B 3AYWD 4WU8B 1P3GA 5B1MD 1U35A 1P3GB 5BO0A 1U35B 1KU5A 3KWQA 5BO0B 1F66A 3KWQB 3REKD 1F66B 2JSSA 1P3BD 5JRGB 2CV5A 4CAYA 4Z5TA 1AOIA 4Z5TB 5AV5C 3KUYC 3AZKC 1P34B 3AZMD 3B6GD 2F8ND 3VH5W 3AZEC 4AWLC 1F1EA 5GT0D 4J8XD 4WZSB 3AZNA 3AZNB 5BT1D 3AYWA 3AZIC 2FJ7C 4J8WC 5B1MA 3AYWB 4WU9C 5B1MB 5B0YD 3REKA 3REKB 4QLCD 1P3BA 1P3BB 5GT3C 5AY8D 4LD9C 4X23B 5C3IC 5B24D 4HGAB 3AZMA 3B6GA 3WKJD 4H9NA 5AVCC 3AZMB 2F8NA 3B6GB 4H9NB 2F8NB 2YFVA 3WTPC 3W98D 2YFVB 5GT0A 4J8XA 4NE5A 5GT0B 5BS7C 4Z66D 4J8XB 1P3IC 1P3MD 3REIC 3MVDD 5B33D 3B6FD 2YFWA 1HTAA 4ZBJB 4KUDC 2YFWB 3MGQD 5B0YB
chains in the Genus database with same CATH superfamily
4M6BA 3X1TD 2VQRA 3X1VC 4QLCA 1ZLAD 4QLCB 2DF4C 4YS3C 5AY8B 5B2ID 1P3LD 3W96C 5B24A 5B24B 4CSRA 3VH5A 4CSRB 3WKJA 3WKJB 3W98A 3W98B 3VH6T 2UWXA 4Z2MH 4Z66A 3REHC 1P3MA 4NE3A 4Z66B 3A6NC 1P3MB 3MVDA 5B33A 3EPLA 2HUEC 2Y2PA 5B33B 3MVDB 3B6FB 3MGQA 3LZ0C 3MGQB 3AV1D 3X1TA 1ZLAA 3X1TB 5B32A 1ZLAB 3WA9C 1TAFA 2HIOC 1TAFB 3W99C 5B2IA 1P3LA 1KX4C 5B2IB 1P3LB 1P3OD 5B1LC 4JJNC 3AZLC 4J8VD 4DRBA 5GXQD 1P3FC 4EO5C 3KFUG 4WU8C 5DNMD 1P3GC 1PZRA 1U35C 4XZQA 3KWQC 1F66C 4R8PD 5JRGC 4J8UD 1HQ3C 3LELD 4G91B 4Z5TC 3AZGD 2BYMA 2BYMB 2L5AA 5AV6D 3EPJA 3AV1A 1P34C 3AV1B 2NZDD 1ULYA 5JA4A 5CPJD 3AZHA 5JA4B 1P3OB 1WWSA 4J8VA 2CV5D 5GXQA 4J8VB 1AOID 5GXQB 4DRAA 3H0MC 4UPKA 5DNMA 3AYWC 1BH9A 5B1MC 5DNMB 1BH9B 4YM6A 4R8PA 3REKC 4R8PB 1KX5D 4J8UA 3TU4D 4J8UB 3LELA 3AZFD 3LELB 3AZGA 1A7WA 5CP6D 4X23C 3F6TA 3AZGB 1M19D 5AV6A 4HGAC 5AVBD 3REJC 5AV6B 4NE6A 4KHAA 5CHLB 4KHAB 2F8NG 3AZMC 3B6GC 4XUJD 2NZDA 4H9RA 2NZDB 1T3UA 4H9RB 5CPJA 5B2JD 5GT0C 4J8XC 2CV5B 3B0CW 2AROA 5BT1C 4CAYB 1AOIB 1S32D 4ZBJC 3LZ1D 5B0YC 3X1SD 3RELD 2ZM5A 1KX5A 2XD1A 3TU4A 4QLCC 1KX5B 4KGCC 3TU4B 3AZFA 5AY8C 3AZFB 5CP6A 1M19A 5CP6B 1M19B 5AVBA 2Y2LA 5AVBB 4XUJA 3WKJC 4XUJB 1JFIA 2RVQD 4ZUXD 5B2JA 1JFIB 3W98C 5B2JB 4Z66C 5CPID 1P3MC 1S32A 2ZY2A 3MVDC 3LZ1A 3NQUA 1H3OA 5B33C 1S32B 3B6FC 3LZ1B 3NQUB 1H3OB 3X1SA 3MGQC 3RELA 3X1SB 3C1BD 3RELB 3X1TC 1P3PD 1ZLAC 4NFTA 1BFMA 5B2IC 1P3LC 3NQJA 3NQJB 3MNND 1TZYD 2CWEA 4ZUXA 5E5AD 1R4VA 3UT9D 4H9OA 3AZJD 5B32D 5DNND 4G91C 5CPIA 3A1IA 5CPIB 2JE5A 2JCHA 5CPKD 1Q9CA 4J8WD 1M18D 3C1BA 1P3PA 3AV1C 4WNNA 3C1BB 1P3PB 4WNNB 4H9PA 4XZQD 4H9PB 3A1KA 1P3OC 1P3AD 3MNNA 2DQNC 4J8VC 5AV8D 3MNNB 5GXQC 1TZYA 5BNVA 5BNXA 5GSUD 1TZYB 5BNVB 5DNMC 5BNXB 3EPHA 5E5AA 5FUGA 5E5AB 5FUGB 3UT9A 3WTPD 4R8PC 3UTBD 5B31D 3UT9B 3AZJA 4J8UC 5DNNA 5B32B 3AZJB 5DNNB 3AZHD 3AZGC 5CPKA 1P3KD 3MGRD 5CPKB 1KX3D 4J8WA 1M18A 1B6WA 5AV6C 4J8WB 5KDMA 1M18B 5KDMB 1EQZD 2Y2JA 2Y2OA 2NZDC 3LJAD 3WAAD 1M1AD 4XZQB 4YM6D 3MGSD 1P3AA 1P3AB 3X1UD 5AV8A 2CV5C 5AV8B 1AOIC 5GSUA 3KXBD 5GSUB 3WTPE 3AV2D 3WTPA 3UTBA 5B31A 3WTPB 3FDDA 3UTBB 5B31B 1KX5C 3IP4C 3TU4C 3AZFC 2PYOD 3AZHB 1P3KA 1ID3D 3MGRA 1P3KB 1M19C 1KX3A 3MGRB 1KX3B 5AVBC 3AZNC 4H9QA 1EQZA 4H9SA 2AROD 2ZY5A 4H9QB 3VH5T 4XUJC 1EQZB 3LJAA 5B0ZD 3C1CD 3WAAA 3LJAB 1M1AA 5B2JC 3WAAB 1M1AB 3H0RC 3MGSA 4YM6B 3W97D 2BYKA 3MGSB 1P3BC 3X1UA 2BYKB 3X1UB 3VH6W 3KXBA 1S32C 3KXBB 3LZ1C 4WV4B 3AV2A 2Y2GA 4E45A 3AV2B 1W2EA 3RELC 3X1SC 2NQBD 3REHA 4Z2MG 2PYOA 1HQ3D 2ZY4A 5CPJB 1ID3A 2PYOB 1ID3B 2G5HC 3AN2D 2AROB 3C1CA 5B0ZA 2F8NK 3H0LC 5AV9D 3C1CB 2RVQC 5B0ZB 4G92B 2HIOA 3W97A 3UTAD 3W97B 5CPIC 3O62D 2LY8A 5B24C 3AL0C 3MGPD 3AFAD 2NQBA 3C1BC 1P3PC 2NQBB 3B0DB 1BH8A 5JRGA 1BH8B 1HQ3A 1HQ3B 4X23D 3MNNC 5B40D 3KSYA 3REJD 3AN2A 3AN2B 1TZYC 1P34A 5AV9A 5F99D 5E5AC 5AV9B 3UT9C 5B32G 3UTAA 3VH6A 3UTAB 5B32C 3AZJC 5DNNC 3O62A 5CPKC 1N1JA 3O62B 5AV5D 1N1JB 1M18C 2Y2IA 3MGPA 4WJ3C 3AFAA 2IO5B 3KUYD 3MGPB 3AZKD 3AFAB 4KGCD 4ZUXB 4XZQC 3AZED 4X23A 4H9OB 1P3AC 5B40A 5AV8C 3REJA 4UUZA 5B40B 3REJB 4UUZB 5GSUC 5F99A 3AZID 2FJ7D 5F99B 4WU9D 5B31G 3UTBC 5B31C 2Y2MA 1WWIA 4E44A 5GT3D 3AZHC 1P3KC 3MGRC 1KX3C 5AV5A 4LD9D 5AV5B 3KUYA 3AZKA 5B0YA 3KUYB 1EQZC 3AZKB 4H9SC 4KGCA 3LJAC 5AVCD 3WAAC 1M1AC 4KGCB 5AY8A 3AZEA 4YM6C 3MGSC 4AWLB 3AZEB 3X1UC 3LELC 1P3ID 3REID 3KXBC 3AZIA 2FJ7A 3AZIB 4WU9A 2FJ7B 3AV2C 4WU9B 4KUDD 1B67A 2F8NH 3X1VD 5CPJC 5GT3A 2PYOC 1ID3C 5GT3B 4YS3D 4LD9A 3B6FA 3W96D 4LD9B 5C3IB 2AROC 3C1CC 5AVCA 5B0ZC 4G92C 5AVCB 2Y2HA 3W97C 2XD5A 3B0CT 5BS7A 3REHD 1P3IA 1P3IB 3A6ND 3REIA 5CP6C 3REIB 4KUDA 3V9RA 4KUDB 3LZ0D 3B0DC 3V9RB 2NQBC 2ZY3A 3X1VA 2G5IC 3WA9D 3X1VB 2HIOD 2W8SA 3W99D 4YS3A 1KX4D 4YS3B 3W96A 2Y2QA 5B1LD 3W96B 4JJND 3AZLD 3AN2C 3B0BA 1P3FD 2Y2KA 4WU8D 5AV9C 1P3GD 1U35D 3KWQD 3UTAC 1F66D 1P3OA 5JRGD 3REHB 3A6NA 3A6NB 3O62C 4Z5TD 5G49A 2HUEB 2IO5C 5G49B 3MGPC 3AFAC 3LZ0A 3LZ0B 1P34D 3WA9A 3R45A 4ZUXC 3WA9B 3R45B 3W99A 2HIOB 1KX4A 3W99B 1KX4B 5B1LA 4JJNA 5B1LB 3AZLA 4JJNB 5B40C 2RIQA 3AZLB 3AZND 1P3FA 4WU8A 3EPKA 1P3FB 5F99C 4EO5B 3AYWD 4WU8B 1P3GA 5B1MD 1U35A 1P3GB 5BO0A 1U35B 1KU5A 3KWQA 5BO0B 2BG1A 1F66A 3KWQB 3REKD 1F66B 2JSSA 1P3BD 5JRGB 2CV5A 4CAYA 4Z5TA 3P5JB 1AOIA 4Z5TB 5AV5C 3KUYC 3AZKC 1P34B 3AZMD 3B6GD 2F8ND 3VH5W 3AZEC 4AWLC 1F1EA 5GT0D 4J8XD 4WZSB 3AZNA 3AZNB 5BT1D 3AYWA 3AZIC 2FJ7C 4J8WC 5B1MA 3AYWB 4WU9C 5B1MB 5B0YD 3REKA 3REKB 4QLCD 1P3BA 1P3BB 5GT3C 5AY8D 4LD9C 3EG5B 4X23B 5C3IC 5B24D 2Y2NA 2FFFB 4HGAB 2J8PA 3AZMA 3B6GA 3WKJD 4H9NA 5AVCC 3AZMB 2F8NA 3B6GB 4H9NB 2F8NB 2YFVA 3WTPC 3W98D 2YFVB 1Z2CB 5GT0A 2F2AC 4J8XA 4NE5A 5GT0B 5BS7C 4Z66D 4J8XB 1P3IC 1P3MD 3REIC 3MVDD 5B33D 3B6FD 4DQYB 2YFWA 1HTAA 4ZBJB 4KUDC 2YFWB 3MGQD 5B0YB
chains in the Genus database with same CATH topology
4M6BA 3X1TD 2VQRA 3X1VC 4QLCA 1ZLAD 4QLCB 2DF4C 4YS3C 5AY8B 5B2ID 1P3LD 3W96C 5B24A 5B24B 4CSRA 3VH5A 4CSRB 3WKJA 3WKJB 3W98A 3W98B 3VH6T 2UWXA 4Z2MH 4Z66A 3REHC 1P3MA 4NE3A 4Z66B 3A6NC 1P3MB 3MVDA 5B33A 3EPLA 2HUEC 2Y2PA 5B33B 3MVDB 3B6FB 3MGQA 3LZ0C 3MGQB 3AV1D 3X1TA 1ZLAA 3X1TB 5B32A 1ZLAB 3WA9C 1TAFA 2HIOC 1TAFB 3W99C 5B2IA 1P3LA 1KX4C 5B2IB 1P3LB 1P3OD 5B1LC 4JJNC 3AZLC 4J8VD 4DRBA 5GXQD 1P3FC 4EO5C 3KFUG 4WU8C 5DNMD 1P3GC 1PZRA 1U35C 4XZQA 3KWQC 1F66C 4R8PD 5JRGC 4J8UD 1HQ3C 3LELD 4G91B 4Z5TC 3AZGD 2BYMA 2BYMB 2L5AA 5AV6D 3EPJA 3AV1A 1P34C 3AV1B 2NZDD 1ULYA 5JA4A 5CPJD 3AZHA 5JA4B 1P3OB 1WWSA 4J8VA 2CV5D 5GXQA 4J8VB 1AOID 5GXQB 4DRAA 3H0MC 4UPKA 5DNMA 3AYWC 1BH9A 5B1MC 5DNMB 1BH9B 4YM6A 4R8PA 3REKC 4R8PB 1KX5D 4J8UA 3TU4D 4J8UB 3LELA 3AZFD 3LELB 3AZGA 1A7WA 5CP6D 4X23C 3F6TA 3AZGB 1M19D 5AV6A 4HGAC 5AVBD 3REJC 5AV6B 4NE6A 4KHAA 5CHLB 4KHAB 2F8NG 3AZMC 3B6GC 4XUJD 2NZDA 4H9RA 2NZDB 1T3UA 4H9RB 5CPJA 5B2JD 5GT0C 4J8XC 2CV5B 3B0CW 2AROA 5BT1C 4CAYB 1AOIB 1S32D 4ZBJC 3LZ1D 5B0YC 3X1SD 3RELD 2ZM5A 1KX5A 2XD1A 3TU4A 4QLCC 1KX5B 4KGCC 3TU4B 3AZFA 5AY8C 3AZFB 5CP6A 1M19A 5CP6B 1M19B 5AVBA 2Y2LA 5AVBB 4XUJA 3WKJC 4XUJB 1JFIA 2RVQD 4ZUXD 5B2JA 1JFIB 3W98C 5B2JB 4Z66C 5CPID 1P3MC 1S32A 2ZY2A 3MVDC 3LZ1A 3NQUA 1H3OA 5B33C 1S32B 3B6FC 3LZ1B 3NQUB 1H3OB 3X1SA 3MGQC 3RELA 3X1SB 3C1BD 3RELB 3X1TC 1P3PD 1ZLAC 4NFTA 1BFMA 5B2IC 1P3LC 3NQJA 3NQJB 3MNND 1TZYD 2CWEA 4ZUXA 5E5AD 1R4VA 3UT9D 4H9OA 3AZJD 5B32D 5DNND 4G91C 5CPIA 3A1IA 5CPIB 2JE5A 2JCHA 5CPKD 1Q9CA 4J8WD 1M18D 3C1BA 1P3PA 3AV1C 4WNNA 3C1BB 1P3PB 4WNNB 4H9PA 4XZQD 4H9PB 3A1KA 1P3OC 1P3AD 3MNNA 2DQNC 4J8VC 5AV8D 3MNNB 5GXQC 1TZYA 5BNVA 5BNXA 5GSUD 1TZYB 5BNVB 5DNMC 5BNXB 3EPHA 5E5AA 5FUGA 5E5AB 5FUGB 3UT9A 3WTPD 4R8PC 3UTBD 5B31D 3UT9B 3AZJA 4J8UC 5DNNA 5B32B 3AZJB 5DNNB 3AZHD 3AZGC 5CPKA 1P3KD 3MGRD 5CPKB 1KX3D 4J8WA 1M18A 1B6WA 5AV6C 4J8WB 5KDMA 1M18B 5KDMB 1EQZD 2Y2JA 2Y2OA 2NZDC 3LJAD 3WAAD 1M1AD 4XZQB 4YM6D 3MGSD 1P3AA 1P3AB 3X1UD 5AV8A 2CV5C 5AV8B 1AOIC 5GSUA 3KXBD 5GSUB 3WTPE 3AV2D 3WTPA 3UTBA 5B31A 3WTPB 3FDDA 3UTBB 5B31B 1KX5C 3IP4C 3TU4C 3AZFC 2PYOD 3AZHB 1P3KA 1ID3D 3MGRA 1P3KB 1M19C 1KX3A 3MGRB 1KX3B 5AVBC 3AZNC 4H9QA 1EQZA 4H9SA 2AROD 2ZY5A 4H9QB 3VH5T 4XUJC 1EQZB 3LJAA 5B0ZD 3C1CD 3WAAA 3LJAB 1M1AA 5B2JC 3WAAB 1M1AB 3H0RC 3MGSA 4YM6B 3W97D 2BYKA 3MGSB 1P3BC 3X1UA 2BYKB 3X1UB 3VH6W 3KXBA 1S32C 3KXBB 3LZ1C 4WV4B 3AV2A 2Y2GA 4E45A 3AV2B 1W2EA 3RELC 3X1SC 2NQBD 3REHA 4Z2MG 2PYOA 1HQ3D 2ZY4A 5CPJB 1ID3A 2PYOB 1ID3B 2G5HC 3AN2D 2AROB 3C1CA 5B0ZA 2F8NK 3H0LC 5AV9D 3C1CB 2RVQC 5B0ZB 4G92B 2HIOA 3W97A 3UTAD 3W97B 5CPIC 3O62D 2LY8A 5B24C 3AL0C 3MGPD 3AFAD 2NQBA 3C1BC 1P3PC 2NQBB 3B0DB 1BH8A 5JRGA 1BH8B 1HQ3A 1HQ3B 4X23D 3MNNC 5B40D 3KSYA 3REJD 3AN2A 3AN2B 1TZYC 1P34A 5AV9A 5F99D 5E5AC 5AV9B 3UT9C 5B32G 3UTAA 3VH6A 3UTAB 5B32C 3AZJC 5DNNC 3O62A 5CPKC 1N1JA 3O62B 5AV5D 1N1JB 1M18C 2Y2IA 3MGPA 4WJ3C 3AFAA 2IO5B 3KUYD 3MGPB 3AZKD 3AFAB 4KGCD 4ZUXB 4XZQC 3AZED 4X23A 4H9OB 1P3AC 5B40A 5AV8C 3REJA 4UUZA 5B40B 3REJB 4UUZB 5GSUC 5F99A 3AZID 2FJ7D 5F99B 4WU9D 5B31G 3UTBC 5B31C 2Y2MA 1WWIA 4E44A 5GT3D 3AZHC 1P3KC 3MGRC 1KX3C 5AV5A 4LD9D 5AV5B 3KUYA 3AZKA 5B0YA 3KUYB 1EQZC 3AZKB 4H9SC 4KGCA 3LJAC 5AVCD 3WAAC 1M1AC 4KGCB 5AY8A 3AZEA 4YM6C 3MGSC 4AWLB 3AZEB 3X1UC 3LELC 1P3ID 3REID 3KXBC 3AZIA 2FJ7A 3AZIB 4WU9A 2FJ7B 3AV2C 4WU9B 4KUDD 1B67A 2F8NH 3X1VD 5CPJC 5GT3A 2PYOC 1ID3C 5GT3B 4YS3D 4LD9A 3B6FA 3W96D 4LD9B 5C3IB 2AROC 3C1CC 5AVCA 5B0ZC 4G92C 5AVCB 2Y2HA 3W97C 2XD5A 3B0CT 5BS7A 3REHD 1P3IA 1P3IB 3A6ND 3REIA 5CP6C 3REIB 4KUDA 3V9RA 4KUDB 3LZ0D 3B0DC 3V9RB 2NQBC 2ZY3A 3X1VA 2G5IC 3WA9D 3X1VB 2HIOD 2W8SA 3W99D 4YS3A 1KX4D 4YS3B 3W96A 2Y2QA 5B1LD 3W96B 4JJND 3AZLD 3AN2C 3B0BA 1P3FD 2Y2KA 4WU8D 5AV9C 1P3GD 1U35D 3KWQD 3UTAC 1F66D 1P3OA 5JRGD 3REHB 3A6NA 3A6NB 3O62C 4Z5TD 5G49A 2HUEB 2IO5C 5G49B 3MGPC 3AFAC 3LZ0A 3LZ0B 1P34D 3WA9A 3R45A 4ZUXC 3WA9B 3R45B 3W99A 2HIOB 1KX4A 3W99B 1KX4B 5B1LA 4JJNA 5B1LB 3AZLA 4JJNB 5B40C 2RIQA 3AZLB 3AZND 1P3FA 4WU8A 3EPKA 1P3FB 5F99C 4EO5B 3AYWD 4WU8B 1P3GA 5B1MD 1U35A 1P3GB 5BO0A 1U35B 1KU5A 3KWQA 5BO0B 2BG1A 1F66A 3KWQB 3REKD 1F66B 2JSSA 1P3BD 5JRGB 2CV5A 4CAYA 4Z5TA 3P5JB 1AOIA 4Z5TB 5AV5C 3KUYC 3AZKC 1P34B 3AZMD 3B6GD 2F8ND 3VH5W 3AZEC 4AWLC 1F1EA 5GT0D 4J8XD 4WZSB 3AZNA 3AZNB 5BT1D 3AYWA 3AZIC 2FJ7C 4J8WC 5B1MA 3AYWB 4WU9C 5B1MB 5B0YD 3REKA 3REKB 4QLCD 1P3BA 1P3BB 5GT3C 5AY8D 4LD9C 3EG5B 4X23B 5C3IC 5B24D 2Y2NA 2FFFB 4HGAB 2J8PA 3AZMA 3B6GA 3WKJD 4H9NA 5AVCC 3AZMB 2F8NA 3B6GB 4H9NB 2F8NB 2YFVA 3WTPC 3W98D 2YFVB 1Z2CB 5GT0A 2F2AC 4J8XA 4NE5A 5GT0B 5BS7C 4Z66D 4J8XB 1P3IC 1P3MD 3REIC 3MVDD 5B33D 3B6FD 4DQYB 2YFWA 1HTAA 4ZBJB 4KUDC 2YFWB 3MGQD 5B0YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M6B A;  3X1T D;  3X1V C;  1ZLA D;  4QLC A;  4QLC B;  4YS3 C;  5AY8 B;  5B2I D;  1P3L D;  3W96 C;  5B24 A;  5B24 B;  4CSR A;  3VH5 A;  4CSR B;  3WKJ A;  3WKJ B;  3W98 A;  3W98 B;  3VH6 T;  4Z2M H;  4Z66 A;  3REH C;  1P3M A;  4NE3 A;  4Z66 B;  3A6N C;  1P3M B;  3MVD A;  5B33 A;  2HUE C;  3MVD B;  5B33 B;  3B6F B;  3MGQ A;  3LZ0 C;  3MGQ B;  3AV1 D;  3X1T A;  1ZLA A;  3X1T B;  5B32 A;  1ZLA B;  3WA9 C;  1TAF A;  2HIO C;  1TAF B;  3W99 C;  5B2I A;  1P3L A;  1KX4 C;  5B2I B;  1P3L B;  1P3O D;  5B1L C;  4JJN C;  3AZL C;  4J8V D;  4DRB A;  5GXQ D;  1P3F C;  4EO5 C;  4WU8 C;  5DNM D;  1P3G C;  1U35 C;  4XZQ A;  3KWQ C;  1F66 C;  4R8P D;  5JRG C;  4J8U D;  1HQ3 C;  3LEL D;  4G91 B;  4Z5T C;  3AZG D;  2BYM A;  2BYM B;  2L5A A;  5AV6 D;  3AV1 A;  1P34 C;  3AV1 B;  2NZD D;  1ULY A;  5JA4 A;  5CPJ D;  3AZH A;  5JA4 B;  1P3O B;  1WWS A;  4J8V A;  2CV5 D;  5GXQ A;  4J8V B;  1AOI D;  5GXQ B;  4DRA A;  5DNM A;  3AYW C;  1BH9 A;  5B1M C;  5DNM B;  1BH9 B;  4YM6 A;  4R8P A;  3REK C;  4R8P B;  1KX5 D;  4J8U A;  3TU4 D;  4J8U B;  3LEL A;  3AZF D;  3LEL B;  3AZG A;  1A7W A;  5CP6 D;  4X23 C;  3AZG B;  1M19 D;  5AV6 A;  4HGA C;  5AVB D;  3REJ C;  5AV6 B;  4NE6 A;  4KHA A;  5CHL B;  4KHA B;  2F8N G;  3AZM C;  3B6G C;  4XUJ D;  2NZD A;  4H9R A;  2NZD B;  4H9R B;  5CPJ A;  5B2J D;  5GT0 C;  4J8X C;  2CV5 B;  3B0C W;  2ARO A;  5BT1 C;  4CAY B;  1AOI B;  1S32 D;  4ZBJ C;  3LZ1 D;  5B0Y C;  3X1S D;  3REL D;  1KX5 A;  3TU4 A;  4KGC C;  4QLC C;  1KX5 B;  3TU4 B;  3AZF A;  5AY8 C;  3AZF B;  5CP6 A;  1M19 A;  5CP6 B;  1M19 B;  5AVB A;  5AVB B;  4XUJ A;  3WKJ C;  4XUJ B;  1JFI A;  2RVQ D;  4ZUX D;  5B2J A;  1JFI B;  3W98 C;  5B2J B;  4Z66 C;  5CPI D;  1P3M C;  1S32 A;  3MVD C;  3LZ1 A;  3NQU A;  1H3O A;  5B33 C;  1S32 B;  3B6F C;  3LZ1 B;  3NQU B;  1H3O B;  3X1S A;  3MGQ C;  3REL A;  3X1S B;  3C1B D;  3REL B;  3X1T C;  1P3P D;  1ZLA C;  4NFT A;  1BFM A;  5B2I C;  1P3L C;  3NQJ A;  3NQJ B;  3MNN D;  1TZY D;  2CWE A;  4ZUX A;  5E5A D;  1R4V A;  3UT9 D;  4H9O A;  3AZJ D;  5B32 D;  5DNN D;  4G91 C;  5CPI A;  5CPI B;  5CPK D;  1Q9C A;  4J8W D;  1M18 D;  3C1B A;  1P3P A;  3AV1 C;  4WNN A;  3C1B B;  1P3P B;  4WNN B;  4H9P A;  4XZQ D;  4H9P B;  1P3O C;  1P3A D;  3MNN A;  4J8V C;  5AV8 D;  3MNN B;  5GXQ C;  1TZY A;  5BNV A;  5BNX A;  5GSU D;  1TZY B;  5BNV B;  5DNM C;  5BNX B;  5E5A A;  5FUG A;  5E5A B;  5FUG B;  3UT9 A;  3WTP D;  4R8P C;  3UTB D;  5B31 D;  3UT9 B;  3AZJ A;  4J8U C;  5DNN A;  5B32 B;  3AZJ B;  5DNN B;  3AZH D;  3AZG C;  5CPK A;  1P3K D;  3MGR D;  5CPK B;  1KX3 D;  4J8W A;  1M18 A;  1B6W A;  5AV6 C;  4J8W B;  5KDM A;  1M18 B;  5KDM B;  1EQZ D;  2NZD C;  3LJA D;  3WAA D;  1M1A D;  4XZQ B;  4YM6 D;  3MGS D;  1P3A A;  1P3A B;  3X1U D;  5AV8 A;  2CV5 C;  5AV8 B;  1AOI C;  5GSU A;  3KXB D;  5GSU B;  3WTP E;  3AV2 D;  3WTP A;  3UTB A;  5B31 A;  3WTP B;  3UTB B;  1KX5 C;  5B31 B;  3TU4 C;  3AZF C;  2PYO D;  3AZH B;  1P3K A;  1ID3 D;  3MGR A;  1P3K B;  1M19 C;  1KX3 A;  3MGR B;  1KX3 B;  5AVB C;  3AZN C;  4H9Q A;  1EQZ A;  4H9S A;  2ARO D;  4H9Q B;  3VH5 T;  1EQZ B;  4XUJ C;  3LJA A;  5B0Z D;  3C1C D;  3WAA A;  3LJA B;  1M1A A;  5B2J C;  3WAA B;  1M1A B;  3MGS A;  4YM6 B;  3W97 D;  2BYK A;  3MGS B;  1P3B C;  3X1U A;  2BYK B;  3X1U B;  3VH6 W;  3KXB A;  1S32 C;  3KXB B;  3LZ1 C;  4WV4 B;  3AV2 A;  4E45 A;  3AV2 B;  3REL C;  3X1S C;  2NQB D;  3REH A;  4Z2M G;  2PYO A;  1HQ3 D;  5CPJ B;  1ID3 A;  2PYO B;  1ID3 B;  3AN2 D;  2ARO B;  3C1C A;  5B0Z A;  2F8N K;  5AV9 D;  3C1C B;  2RVQ C;  5B0Z B;  4G92 B;  2HIO A;  3W97 A;  3UTA D;  3W97 B;  5CPI C;  3O62 D;  2LY8 A;  5B24 C;  3MGP D;  3AFA D;  2NQB A;  3C1B C;  1P3P C;  2NQB B;  3B0D B;  1BH8 A;  5JRG A;  1BH8 B;  1HQ3 A;  1HQ3 B;  4X23 D;  3MNN C;  5B40 D;  3KSY A;  3REJ D;  3AN2 A;  3AN2 B;  1TZY C;  1P34 A;  5AV9 A;  5F99 D;  5E5A C;  5AV9 B;  3UT9 C;  5B32 G;  3UTA A;  3VH6 A;  3UTA B;  5B32 C;  3AZJ C;  5DNN C;  3O62 A;  5CPK C;  1N1J A;  3O62 B;  5AV5 D;  1N1J B;  1M18 C;  3MGP A;  3AFA A;  2IO5 B;  3KUY D;  3MGP B;  3AZK D;  3AFA B;  4KGC D;  4ZUX B;  4XZQ C;  3AZE D;  4X23 A;  4H9O B;  1P3A C;  5B40 A;  5AV8 C;  3REJ A;  4UUZ A;  5B40 B;  3REJ B;  4UUZ B;  5GSU C;  5F99 A;  3AZI D;  2FJ7 D;  5F99 B;  4WU9 D;  5B31 G;  3UTB C;  5B31 C;  1WWI A;  4E44 A;  5GT3 D;  3AZH C;  1P3K C;  3MGR C;  1KX3 C;  5AV5 A;  4LD9 D;  5AV5 B;  3KUY A;  3AZK A;  5B0Y A;  3KUY B;  1EQZ C;  3AZK B;  4H9S C;  4KGC A;  3LJA C;  5AVC D;  3WAA C;  1M1A C;  4KGC B;  5AY8 A;  3AZE A;  4YM6 C;  3MGS C;  4AWL B;  3AZE B;  3X1U C;  3LEL C;  1P3I D;  3REI D;  3KXB C;  3AZI A;  2FJ7 A;  3AZI B;  4WU9 A;  2FJ7 B;  3AV2 C;  4WU9 B;  4KUD D;  1B67 A;  2F8N H;  3X1V D;  5CPJ C;  5GT3 A;  2PYO C;  1ID3 C;  5GT3 B;  4YS3 D;  4LD9 A;  3B6F A;  3W96 D;  4LD9 B;  5C3I B;  2ARO C;  3C1C C;  5B0Z C;  5AVC A;  4G92 C;  5AVC B;  3W97 C;  3B0C T;  5BS7 A;  3REH D;  1P3I A;  1P3I B;  3A6N D;  3REI A;  5CP6 C;  3REI B;  4KUD A;  3V9R A;  4KUD B;  3LZ0 D;  3B0D C;  3V9R B;  2NQB C;  3X1V A;  3WA9 D;  3X1V B;  2HIO D;  3W99 D;  4YS3 A;  1KX4 D;  4YS3 B;  3W96 A;  5B1L D;  3W96 B;  4JJN D;  3AZL D;  3AN2 C;  3B0B A;  1P3F D;  4WU8 D;  5AV9 C;  1P3G D;  1U35 D;  3KWQ D;  3UTA C;  1F66 D;  1P3O A;  5JRG D;  3REH B;  3A6N A;  3A6N B;  3O62 C;  4Z5T D;  5G49 A;  2HUE B;  2IO5 C;  5G49 B;  3MGP C;  3AFA C;  3LZ0 A;  3LZ0 B;  1P34 D;  3WA9 A;  3R45 A;  4ZUX C;  3WA9 B;  3R45 B;  3W99 A;  2HIO B;  1KX4 A;  3W99 B;  1KX4 B;  5B1L A;  4JJN A;  5B1L B;  3AZL A;  4JJN B;  5B40 C;  3AZL B;  3AZN D;  1P3F A;  4WU8 A;  1P3F B;  5F99 C;  4EO5 B;  3AYW D;  4WU8 B;  1P3G A;  5B1M D;  1U35 A;  1P3G B;  5BO0 A;  1U35 B;  1KU5 A;  3KWQ A;  5BO0 B;  1F66 A;  3KWQ B;  3REK D;  1F66 B;  2JSS A;  1P3B D;  5JRG B;  2CV5 A;  4CAY A;  4Z5T A;  1AOI A;  4Z5T B;  5AV5 C;  3KUY C;  3AZK C;  1P34 B;  3AZM D;  3B6G D;  2F8N D;  3VH5 W;  3AZE C;  4AWL C;  1F1E A;  5GT0 D;  4J8X D;  4WZS B;  3AZN A;  3AZN B;  5BT1 D;  3AYW A;  3AZI C;  2FJ7 C;  4J8W C;  5B1M A;  3AYW B;  4WU9 C;  5B1M B;  5B0Y D;  3REK A;  3REK B;  4QLC D;  1P3B A;  1P3B B;  5GT3 C;  5AY8 D;  4LD9 C;  4X23 B;  5C3I C;  5B24 D;  4HGA B;  3AZM A;  3B6G A;  3WKJ D;  4H9N A;  5AVC C;  3AZM B;  2F8N A;  3B6G B;  4H9N B;  2F8N B;  2YFV A;  3WTP C;  3W98 D;  2YFV B;  5GT0 A;  4J8X A;  4NE5 A;  5GT0 B;  5BS7 C;  4Z66 D;  4J8X B;  1P3I C;  1P3M D;  3REI C;  3MVD D;  5B33 D;  3B6F D;  2YFW A;  1HTA A;  4ZBJ B;  4KUD C;  2YFW B;  3MGQ D;  5B0Y B; 
#chains in the Genus database with same CATH topology
 4M6B A;  3X1T D;  2VQR A;  3X1V C;  4QLC A;  1ZLA D;  4QLC B;  2DF4 C;  4YS3 C;  5AY8 B;  5B2I D;  1P3L D;  3W96 C;  5B24 A;  5B24 B;  4CSR A;  3VH5 A;  4CSR B;  3WKJ A;  3WKJ B;  3W98 A;  3W98 B;  3VH6 T;  2UWX A;  4Z2M H;  4Z66 A;  3REH C;  1P3M A;  4NE3 A;  4Z66 B;  3A6N C;  1P3M B;  3MVD A;  5B33 A;  3EPL A;  2HUE C;  2Y2P A;  5B33 B;  3MVD B;  3B6F B;  3MGQ A;  3LZ0 C;  3MGQ B;  3AV1 D;  3X1T A;  1ZLA A;  3X1T B;  5B32 A;  1ZLA B;  3WA9 C;  1TAF A;  2HIO C;  1TAF B;  3W99 C;  5B2I A;  1P3L A;  1KX4 C;  5B2I B;  1P3L B;  1P3O D;  5B1L C;  4JJN C;  3AZL C;  4J8V D;  4DRB A;  5GXQ D;  1P3F C;  4EO5 C;  3KFU G;  4WU8 C;  5DNM D;  1P3G C;  1PZR A;  1U35 C;  4XZQ A;  3KWQ C;  1F66 C;  4R8P D;  5JRG C;  4J8U D;  1HQ3 C;  3LEL D;  4G91 B;  4Z5T C;  3AZG D;  2BYM A;  2BYM B;  2L5A A;  5AV6 D;  3EPJ A;  3AV1 A;  1P34 C;  3AV1 B;  2NZD D;  1ULY A;  5JA4 A;  5CPJ D;  3AZH A;  5JA4 B;  1P3O B;  1WWS A;  4J8V A;  2CV5 D;  5GXQ A;  4J8V B;  1AOI D;  5GXQ B;  4DRA A;  3H0M C;  4UPK A;  5DNM A;  3AYW C;  1BH9 A;  5B1M C;  5DNM B;  1BH9 B;  4YM6 A;  4R8P A;  3REK C;  4R8P B;  1KX5 D;  4J8U A;  3TU4 D;  4J8U B;  3LEL A;  3AZF D;  3LEL B;  3AZG A;  1A7W A;  5CP6 D;  4X23 C;  3F6T A;  3AZG B;  1M19 D;  5AV6 A;  4HGA C;  5AVB D;  3REJ C;  5AV6 B;  4NE6 A;  4KHA A;  5CHL B;  4KHA B;  2F8N G;  3AZM C;  3B6G C;  4XUJ D;  2NZD A;  4H9R A;  2NZD B;  1T3U A;  4H9R B;  5CPJ A;  5B2J D;  5GT0 C;  4J8X C;  2CV5 B;  3B0C W;  2ARO A;  5BT1 C;  4CAY B;  1AOI B;  1S32 D;  4ZBJ C;  3LZ1 D;  5B0Y C;  3X1S D;  3REL D;  2ZM5 A;  1KX5 A;  2XD1 A;  3TU4 A;  4QLC C;  1KX5 B;  4KGC C;  3TU4 B;  3AZF A;  5AY8 C;  3AZF B;  5CP6 A;  1M19 A;  5CP6 B;  1M19 B;  5AVB A;  2Y2L A;  5AVB B;  4XUJ A;  3WKJ C;  4XUJ B;  1JFI A;  2RVQ D;  4ZUX D;  5B2J A;  1JFI B;  3W98 C;  5B2J B;  4Z66 C;  5CPI D;  1P3M C;  1S32 A;  2ZY2 A;  3MVD C;  3LZ1 A;  3NQU A;  1H3O A;  5B33 C;  1S32 B;  3B6F C;  3LZ1 B;  3NQU B;  1H3O B;  3X1S A;  3MGQ C;  3REL A;  3X1S B;  3C1B D;  3REL B;  3X1T C;  1P3P D;  1ZLA C;  4NFT A;  1BFM A;  5B2I C;  1P3L C;  3NQJ A;  3NQJ B;  3MNN D;  1TZY D;  2CWE A;  4ZUX A;  5E5A D;  1R4V A;  3UT9 D;  4H9O A;  3AZJ D;  5B32 D;  5DNN D;  4G91 C;  5CPI A;  3A1I A;  5CPI B;  2JE5 A;  2JCH A;  5CPK D;  1Q9C A;  4J8W D;  1M18 D;  3C1B A;  1P3P A;  3AV1 C;  4WNN A;  3C1B B;  1P3P B;  4WNN B;  4H9P A;  4XZQ D;  4H9P B;  3A1K A;  1P3O C;  1P3A D;  3MNN A;  2DQN C;  4J8V C;  5AV8 D;  3MNN B;  5GXQ C;  1TZY A;  5BNV A;  5BNX A;  5GSU D;  1TZY B;  5BNV B;  5DNM C;  5BNX B;  3EPH A;  5E5A A;  5FUG A;  5E5A B;  5FUG B;  3UT9 A;  3WTP D;  4R8P C;  3UTB D;  5B31 D;  3UT9 B;  3AZJ A;  4J8U C;  5DNN A;  5B32 B;  3AZJ B;  5DNN B;  3AZH D;  3AZG C;  5CPK A;  1P3K D;  3MGR D;  5CPK B;  1KX3 D;  4J8W A;  1M18 A;  1B6W A;  5AV6 C;  4J8W B;  5KDM A;  1M18 B;  5KDM B;  1EQZ D;  2Y2J A;  2Y2O A;  2NZD C;  3LJA D;  3WAA D;  1M1A D;  4XZQ B;  4YM6 D;  3MGS D;  1P3A A;  1P3A B;  3X1U D;  5AV8 A;  2CV5 C;  5AV8 B;  1AOI C;  5GSU A;  3KXB D;  5GSU B;  3WTP E;  3AV2 D;  3WTP A;  3UTB A;  5B31 A;  3WTP B;  3FDD A;  3UTB B;  5B31 B;  1KX5 C;  3IP4 C;  3TU4 C;  3AZF C;  2PYO D;  3AZH B;  1P3K A;  1ID3 D;  3MGR A;  1P3K B;  1M19 C;  1KX3 A;  3MGR B;  1KX3 B;  5AVB C;  3AZN C;  4H9Q A;  1EQZ A;  4H9S A;  2ARO D;  2ZY5 A;  4H9Q B;  3VH5 T;  4XUJ C;  1EQZ B;  3LJA A;  5B0Z D;  3C1C D;  3WAA A;  3LJA B;  1M1A A;  5B2J C;  3WAA B;  1M1A B;  3H0R C;  3MGS A;  4YM6 B;  3W97 D;  2BYK A;  3MGS B;  1P3B C;  3X1U A;  2BYK B;  3X1U B;  3VH6 W;  3KXB A;  1S32 C;  3KXB B;  3LZ1 C;  4WV4 B;  3AV2 A;  2Y2G A;  4E45 A;  3AV2 B;  1W2E A;  3REL C;  3X1S C;  2NQB D;  3REH A;  4Z2M G;  2PYO A;  1HQ3 D;  2ZY4 A;  5CPJ B;  1ID3 A;  2PYO B;  1ID3 B;  2G5H C;  3AN2 D;  2ARO B;  3C1C A;  5B0Z A;  2F8N K;  3H0L C;  5AV9 D;  3C1C B;  2RVQ C;  5B0Z B;  4G92 B;  2HIO A;  3W97 A;  3UTA D;  3W97 B;  5CPI C;  3O62 D;  2LY8 A;  5B24 C;  3AL0 C;  3MGP D;  3AFA D;  2NQB A;  3C1B C;  1P3P C;  2NQB B;  3B0D B;  1BH8 A;  5JRG A;  1BH8 B;  1HQ3 A;  1HQ3 B;  4X23 D;  3MNN C;  5B40 D;  3KSY A;  3REJ D;  3AN2 A;  3AN2 B;  1TZY C;  1P34 A;  5AV9 A;  5F99 D;  5E5A C;  5AV9 B;  3UT9 C;  5B32 G;  3UTA A;  3VH6 A;  3UTA B;  5B32 C;  3AZJ C;  5DNN C;  3O62 A;  5CPK C;  1N1J A;  3O62 B;  5AV5 D;  1N1J B;  1M18 C;  2Y2I A;  3MGP A;  4WJ3 C;  3AFA A;  2IO5 B;  3KUY D;  3MGP B;  3AZK D;  3AFA B;  4KGC D;  4ZUX B;  4XZQ C;  3AZE D;  4X23 A;  4H9O B;  1P3A C;  5B40 A;  5AV8 C;  3REJ A;  4UUZ A;  5B40 B;  3REJ B;  4UUZ B;  5GSU C;  5F99 A;  3AZI D;  2FJ7 D;  5F99 B;  4WU9 D;  5B31 G;  3UTB C;  5B31 C;  2Y2M A;  1WWI A;  4E44 A;  5GT3 D;  3AZH C;  1P3K C;  3MGR C;  1KX3 C;  5AV5 A;  4LD9 D;  5AV5 B;  3KUY A;  3AZK A;  5B0Y A;  3KUY B;  1EQZ C;  3AZK B;  4H9S C;  4KGC A;  3LJA C;  5AVC D;  3WAA C;  1M1A C;  4KGC B;  5AY8 A;  3AZE A;  4YM6 C;  3MGS C;  4AWL B;  3AZE B;  3X1U C;  3LEL C;  1P3I D;  3REI D;  3KXB C;  3AZI A;  2FJ7 A;  3AZI B;  4WU9 A;  2FJ7 B;  3AV2 C;  4WU9 B;  4KUD D;  1B67 A;  2F8N H;  3X1V D;  5CPJ C;  5GT3 A;  2PYO C;  1ID3 C;  5GT3 B;  4YS3 D;  4LD9 A;  3B6F A;  3W96 D;  4LD9 B;  5C3I B;  2ARO C;  3C1C C;  5AVC A;  5B0Z C;  4G92 C;  5AVC B;  2Y2H A;  3W97 C;  2XD5 A;  3B0C T;  5BS7 A;  3REH D;  1P3I A;  1P3I B;  3A6N D;  3REI A;  5CP6 C;  3REI B;  4KUD A;  3V9R A;  4KUD B;  3LZ0 D;  3B0D C;  3V9R B;  2NQB C;  2ZY3 A;  3X1V A;  2G5I C;  3WA9 D;  3X1V B;  2HIO D;  2W8S A;  3W99 D;  4YS3 A;  1KX4 D;  4YS3 B;  3W96 A;  2Y2Q A;  5B1L D;  3W96 B;  4JJN D;  3AZL D;  3AN2 C;  3B0B A;  1P3F D;  2Y2K A;  4WU8 D;  5AV9 C;  1P3G D;  1U35 D;  3KWQ D;  3UTA C;  1F66 D;  1P3O A;  5JRG D;  3REH B;  3A6N A;  3A6N B;  3O62 C;  4Z5T D;  5G49 A;  2HUE B;  2IO5 C;  5G49 B;  3MGP C;  3AFA C;  3LZ0 A;  3LZ0 B;  1P34 D;  3WA9 A;  3R45 A;  4ZUX C;  3WA9 B;  3R45 B;  3W99 A;  2HIO B;  1KX4 A;  3W99 B;  1KX4 B;  5B1L A;  4JJN A;  5B1L B;  3AZL A;  4JJN B;  5B40 C;  2RIQ A;  3AZL B;  3AZN D;  1P3F A;  4WU8 A;  3EPK A;  1P3F B;  5F99 C;  4EO5 B;  3AYW D;  4WU8 B;  1P3G A;  5B1M D;  1U35 A;  1P3G B;  5BO0 A;  1U35 B;  1KU5 A;  3KWQ A;  5BO0 B;  2BG1 A;  1F66 A;  3KWQ B;  3REK D;  1F66 B;  2JSS A;  1P3B D;  5JRG B;  2CV5 A;  4CAY A;  4Z5T A;  3P5J B;  1AOI A;  4Z5T B;  5AV5 C;  3KUY C;  3AZK C;  1P34 B;  3AZM D;  3B6G D;  2F8N D;  3VH5 W;  3AZE C;  4AWL C;  1F1E A;  5GT0 D;  4J8X D;  4WZS B;  3AZN A;  3AZN B;  5BT1 D;  3AYW A;  3AZI C;  2FJ7 C;  4J8W C;  5B1M A;  3AYW B;  4WU9 C;  5B1M B;  5B0Y D;  3REK A;  3REK B;  4QLC D;  1P3B A;  1P3B B;  5GT3 C;  5AY8 D;  4LD9 C;  3EG5 B;  4X23 B;  5C3I C;  5B24 D;  2Y2N A;  2FFF B;  4HGA B;  2J8P A;  3AZM A;  3B6G A;  3WKJ D;  4H9N A;  5AVC C;  3AZM B;  2F8N A;  3B6G B;  4H9N B;  2F8N B;  2YFV A;  3WTP C;  3W98 D;  2YFV B;  1Z2C B;  5GT0 A;  2F2A C;  4J8X A;  4NE5 A;  5GT0 B;  5BS7 C;  4Z66 D;  4J8X B;  1P3I C;  1P3M D;  3REI C;  3MVD D;  5B33 D;  3B6F D;  4DQY B;  2YFW A;  1HTA A;  4ZBJ B;  4KUD C;  2YFW B;  3MGQ D;  5B0Y B; 
#chains in the Genus database with same CATH homology
 4M6B A;  3X1T D;  2VQR A;  3X1V C;  4QLC A;  1ZLA D;  4QLC B;  2DF4 C;  4YS3 C;  5AY8 B;  5B2I D;  1P3L D;  3W96 C;  5B24 A;  5B24 B;  4CSR A;  3VH5 A;  4CSR B;  3WKJ A;  3WKJ B;  3W98 A;  3W98 B;  3VH6 T;  2UWX A;  4Z2M H;  4Z66 A;  3REH C;  1P3M A;  4NE3 A;  4Z66 B;  3A6N C;  1P3M B;  3MVD A;  5B33 A;  3EPL A;  2HUE C;  2Y2P A;  5B33 B;  3MVD B;  3B6F B;  3MGQ A;  3LZ0 C;  3MGQ B;  3AV1 D;  3X1T A;  1ZLA A;  3X1T B;  5B32 A;  1ZLA B;  3WA9 C;  1TAF A;  2HIO C;  1TAF B;  3W99 C;  5B2I A;  1P3L A;  1KX4 C;  5B2I B;  1P3L B;  1P3O D;  5B1L C;  4JJN C;  3AZL C;  4J8V D;  4DRB A;  5GXQ D;  1P3F C;  4EO5 C;  3KFU G;  4WU8 C;  5DNM D;  1P3G C;  1PZR A;  1U35 C;  4XZQ A;  3KWQ C;  1F66 C;  4R8P D;  5JRG C;  4J8U D;  1HQ3 C;  3LEL D;  4G91 B;  4Z5T C;  3AZG D;  2BYM A;  2BYM B;  2L5A A;  5AV6 D;  3EPJ A;  3AV1 A;  1P34 C;  3AV1 B;  2NZD D;  1ULY A;  5JA4 A;  5CPJ D;  3AZH A;  5JA4 B;  1P3O B;  1WWS A;  4J8V A;  2CV5 D;  5GXQ A;  4J8V B;  1AOI D;  5GXQ B;  4DRA A;  3H0M C;  4UPK A;  5DNM A;  3AYW C;  1BH9 A;  5B1M C;  5DNM B;  1BH9 B;  4YM6 A;  4R8P A;  3REK C;  4R8P B;  1KX5 D;  4J8U A;  3TU4 D;  4J8U B;  3LEL A;  3AZF D;  3LEL B;  3AZG A;  1A7W A;  5CP6 D;  4X23 C;  3F6T A;  3AZG B;  1M19 D;  5AV6 A;  4HGA C;  5AVB D;  3REJ C;  5AV6 B;  4NE6 A;  4KHA A;  5CHL B;  4KHA B;  2F8N G;  3AZM C;  3B6G C;  4XUJ D;  2NZD A;  4H9R A;  2NZD B;  1T3U A;  4H9R B;  5CPJ A;  5B2J D;  5GT0 C;  4J8X C;  2CV5 B;  3B0C W;  2ARO A;  5BT1 C;  4CAY B;  1AOI B;  1S32 D;  4ZBJ C;  3LZ1 D;  5B0Y C;  3X1S D;  3REL D;  2ZM5 A;  1KX5 A;  2XD1 A;  3TU4 A;  4QLC C;  1KX5 B;  4KGC C;  3TU4 B;  3AZF A;  5AY8 C;  3AZF B;  5CP6 A;  1M19 A;  5CP6 B;  1M19 B;  5AVB A;  2Y2L A;  5AVB B;  4XUJ A;  3WKJ C;  4XUJ B;  1JFI A;  2RVQ D;  4ZUX D;  5B2J A;  1JFI B;  3W98 C;  5B2J B;  4Z66 C;  5CPI D;  1P3M C;  1S32 A;  2ZY2 A;  3MVD C;  3LZ1 A;  3NQU A;  1H3O A;  5B33 C;  1S32 B;  3B6F C;  3LZ1 B;  3NQU B;  1H3O B;  3X1S A;  3MGQ C;  3REL A;  3X1S B;  3C1B D;  3REL B;  3X1T C;  1P3P D;  1ZLA C;  4NFT A;  1BFM A;  5B2I C;  1P3L C;  3NQJ A;  3NQJ B;  3MNN D;  1TZY D;  2CWE A;  4ZUX A;  5E5A D;  1R4V A;  3UT9 D;  4H9O A;  3AZJ D;  5B32 D;  5DNN D;  4G91 C;  5CPI A;  3A1I A;  5CPI B;  2JE5 A;  2JCH A;  5CPK D;  1Q9C A;  4J8W D;  1M18 D;  3C1B A;  1P3P A;  3AV1 C;  4WNN A;  3C1B B;  1P3P B;  4WNN B;  4H9P A;  4XZQ D;  4H9P B;  3A1K A;  1P3O C;  1P3A D;  3MNN A;  2DQN C;  4J8V C;  5AV8 D;  3MNN B;  5GXQ C;  1TZY A;  5BNV A;  5BNX A;  5GSU D;  1TZY B;  5BNV B;  5DNM C;  5BNX B;  3EPH A;  5E5A A;  5FUG A;  5E5A B;  5FUG B;  3UT9 A;  3WTP D;  4R8P C;  3UTB D;  5B31 D;  3UT9 B;  3AZJ A;  4J8U C;  5DNN A;  5B32 B;  3AZJ B;  5DNN B;  3AZH D;  3AZG C;  5CPK A;  1P3K D;  3MGR D;  5CPK B;  1KX3 D;  4J8W A;  1M18 A;  1B6W A;  5AV6 C;  4J8W B;  5KDM A;  1M18 B;  5KDM B;  1EQZ D;  2Y2J A;  2Y2O A;  2NZD C;  3LJA D;  3WAA D;  1M1A D;  4XZQ B;  4YM6 D;  3MGS D;  1P3A A;  1P3A B;  3X1U D;  5AV8 A;  2CV5 C;  5AV8 B;  1AOI C;  5GSU A;  3KXB D;  5GSU B;  3WTP E;  3AV2 D;  3WTP A;  3UTB A;  5B31 A;  3WTP B;  3FDD A;  3UTB B;  5B31 B;  1KX5 C;  3IP4 C;  3TU4 C;  3AZF C;  2PYO D;  3AZH B;  1P3K A;  1ID3 D;  3MGR A;  1P3K B;  1M19 C;  1KX3 A;  3MGR B;  1KX3 B;  5AVB C;  3AZN C;  4H9Q A;  1EQZ A;  4H9S A;  2ARO D;  2ZY5 A;  4H9Q B;  3VH5 T;  4XUJ C;  1EQZ B;  3LJA A;  5B0Z D;  3C1C D;  3WAA A;  3LJA B;  1M1A A;  5B2J C;  3WAA B;  1M1A B;  3H0R C;  3MGS A;  4YM6 B;  3W97 D;  2BYK A;  3MGS B;  1P3B C;  3X1U A;  2BYK B;  3X1U B;  3VH6 W;  3KXB A;  1S32 C;  3KXB B;  3LZ1 C;  4WV4 B;  3AV2 A;  2Y2G A;  4E45 A;  3AV2 B;  1W2E A;  3REL C;  3X1S C;  2NQB D;  3REH A;  4Z2M G;  2PYO A;  1HQ3 D;  2ZY4 A;  5CPJ B;  1ID3 A;  2PYO B;  1ID3 B;  2G5H C;  3AN2 D;  2ARO B;  3C1C A;  5B0Z A;  2F8N K;  3H0L C;  5AV9 D;  3C1C B;  2RVQ C;  5B0Z B;  4G92 B;  2HIO A;  3W97 A;  3UTA D;  3W97 B;  5CPI C;  3O62 D;  2LY8 A;  5B24 C;  3AL0 C;  3MGP D;  3AFA D;  2NQB A;  3C1B C;  1P3P C;  2NQB B;  3B0D B;  1BH8 A;  5JRG A;  1BH8 B;  1HQ3 A;  1HQ3 B;  4X23 D;  3MNN C;  5B40 D;  3KSY A;  3REJ D;  3AN2 A;  3AN2 B;  1TZY C;  1P34 A;  5AV9 A;  5F99 D;  5E5A C;  5AV9 B;  3UT9 C;  5B32 G;  3UTA A;  3VH6 A;  3UTA B;  5B32 C;  3AZJ C;  5DNN C;  3O62 A;  5CPK C;  1N1J A;  3O62 B;  5AV5 D;  1N1J B;  1M18 C;  2Y2I A;  3MGP A;  4WJ3 C;  3AFA A;  2IO5 B;  3KUY D;  3MGP B;  3AZK D;  3AFA B;  4KGC D;  4ZUX B;  4XZQ C;  3AZE D;  4X23 A;  4H9O B;  1P3A C;  5B40 A;  5AV8 C;  3REJ A;  4UUZ A;  5B40 B;  3REJ B;  4UUZ B;  5GSU C;  5F99 A;  3AZI D;  2FJ7 D;  5F99 B;  4WU9 D;  5B31 G;  3UTB C;  5B31 C;  2Y2M A;  1WWI A;  4E44 A;  5GT3 D;  3AZH C;  1P3K C;  3MGR C;  1KX3 C;  5AV5 A;  4LD9 D;  5AV5 B;  3KUY A;  3AZK A;  5B0Y A;  3KUY B;  1EQZ C;  3AZK B;  4H9S C;  4KGC A;  3LJA C;  5AVC D;  3WAA C;  1M1A C;  4KGC B;  5AY8 A;  3AZE A;  4YM6 C;  3MGS C;  4AWL B;  3AZE B;  3X1U C;  3LEL C;  1P3I D;  3REI D;  3KXB C;  3AZI A;  2FJ7 A;  3AZI B;  4WU9 A;  2FJ7 B;  3AV2 C;  4WU9 B;  4KUD D;  1B67 A;  2F8N H;  3X1V D;  5CPJ C;  5GT3 A;  2PYO C;  1ID3 C;  5GT3 B;  4YS3 D;  4LD9 A;  3B6F A;  3W96 D;  4LD9 B;  5C3I B;  2ARO C;  3C1C C;  5AVC A;  5B0Z C;  4G92 C;  5AVC B;  2Y2H A;  3W97 C;  2XD5 A;  3B0C T;  5BS7 A;  3REH D;  1P3I A;  1P3I B;  3A6N D;  3REI A;  5CP6 C;  3REI B;  4KUD A;  3V9R A;  4KUD B;  3LZ0 D;  3B0D C;  3V9R B;  2NQB C;  2ZY3 A;  3X1V A;  2G5I C;  3WA9 D;  3X1V B;  2HIO D;  2W8S A;  3W99 D;  4YS3 A;  1KX4 D;  4YS3 B;  3W96 A;  2Y2Q A;  5B1L D;  3W96 B;  4JJN D;  3AZL D;  3AN2 C;  3B0B A;  1P3F D;  2Y2K A;  4WU8 D;  5AV9 C;  1P3G D;  1U35 D;  3KWQ D;  3UTA C;  1F66 D;  1P3O A;  5JRG D;  3REH B;  3A6N A;  3A6N B;  3O62 C;  4Z5T D;  5G49 A;  2HUE B;  2IO5 C;  5G49 B;  3MGP C;  3AFA C;  3LZ0 A;  3LZ0 B;  1P34 D;  3WA9 A;  3R45 A;  4ZUX C;  3WA9 B;  3R45 B;  3W99 A;  2HIO B;  1KX4 A;  3W99 B;  1KX4 B;  5B1L A;  4JJN A;  5B1L B;  3AZL A;  4JJN B;  5B40 C;  2RIQ A;  3AZL B;  3AZN D;  1P3F A;  4WU8 A;  3EPK A;  1P3F B;  5F99 C;  4EO5 B;  3AYW D;  4WU8 B;  1P3G A;  5B1M D;  1U35 A;  1P3G B;  5BO0 A;  1U35 B;  1KU5 A;  3KWQ A;  5BO0 B;  2BG1 A;  1F66 A;  3KWQ B;  3REK D;  1F66 B;  2JSS A;  1P3B D;  5JRG B;  2CV5 A;  4CAY A;  4Z5T A;  3P5J B;  1AOI A;  4Z5T B;  5AV5 C;  3KUY C;  3AZK C;  1P34 B;  3AZM D;  3B6G D;  2F8N D;  3VH5 W;  3AZE C;  4AWL C;  1F1E A;  5GT0 D;  4J8X D;  4WZS B;  3AZN A;  3AZN B;  5BT1 D;  3AYW A;  3AZI C;  2FJ7 C;  4J8W C;  5B1M A;  3AYW B;  4WU9 C;  5B1M B;  5B0Y D;  3REK A;  3REK B;  4QLC D;  1P3B A;  1P3B B;  5GT3 C;  5AY8 D;  4LD9 C;  3EG5 B;  4X23 B;  5C3I C;  5B24 D;  2Y2N A;  2FFF B;  4HGA B;  2J8P A;  3AZM A;  3B6G A;  3WKJ D;  4H9N A;  5AVC C;  3AZM B;  2F8N A;  3B6G B;  4H9N B;  2F8N B;  2YFV A;  3WTP C;  3W98 D;  2YFV B;  1Z2C B;  5GT0 A;  2F2A C;  4J8X A;  4NE5 A;  5GT0 B;  5BS7 C;  4Z66 D;  4J8X B;  1P3I C;  1P3M D;  3REI C;  3MVD D;  5B33 D;  3B6F D;  4DQY B;  2YFW A;  1HTA A;  4ZBJ B;  4KUD C;  2YFW B;  3MGQ D;  5B0Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...