4J8UA

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 29
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8uA00
5BNXA 4WV4B 1P3GB 1P3KB 1KX3D 4NE3A 3O62A 3X1TA 3MGPA 3AZIA 1M19C 1P3GD 2BYMB 4R8PA 4WU8B 1H3OA 5KDMA 3AN2A 3B0CW 2L5AA 4WU8D 3WKJA 3B0BA 3R45B 4QLCB 4G91B 5B1LC 3AFAA 3MGSC 4QLCD 4WNNA 1AOID 2YFVB 4KHAB 5AY8D 1F66D 4YM6C 5DNNB 5CPKB 3AZLC 1U35A 3AZMD 5B2IA 3AV2C 2F8NB 1BH9A 3NQJA 5CPKD 3TU4D 5AVBA 1M18C 3W97C 2F8ND 5AVCA 3MGRD 4J8UB 3AZKD 5B32A 4KUDD 5JRGD 4J8UD 3UTAA 1P3GC 1P3KC 5FUGB 3X1UD 4J8VD 4Z5TD 3WTPE 4WU8C 3NQUA 3VH5T 4HGAB 5B1MD 1N1JB 5B0YA 4ZBJB 4YS3A 4KGCB 2CWEA 4QLCC 5DNMA 1AOIC 3B0DB 1Q9CA 3WA9A 2NQBA 3UT9D 3W99B 1P3AA 2F8NH 1P3PA 5DNNC 3WAAA 5CPKC 3W99D 3X1SA 3AZKC 4KUDC 1HQ3B 4J8UC 1HQ3D 1P3BB 5E5AB 1P34B 3AZNB 3X1UC 4J8VC 3REKA 1EQZD 1P34D 5AV8B 3AZND 5B1MC 3C1CA 4LD9A 3AZEA 4HGAC 3MNNB 3W98B 4ZBJC 4XUJB 4KGCC 5B2JB 5CPIA 1ZLAA 3W98D 1BH8A 5B24A 3A6NB 5GSUB 5B2JD 1P3LB 4UUZA 3B0DC 3A6ND 3UT9C 3UTBA 3KUYD 5GSUD 5AV5B 1ID3D 2AROA 4H9SA 3W99C 2HIOB 3AZJB 5AV5D 4H9PB 3VH6A 1P3IA 4AWLB 1M19A 5AV9B 2HIOD 3REJB 3AZJD 1TAFA 1TZYA 4ZUXB 3C1BD 1HQ3C 3VH5W 5AV9D 2CV5A 3W96B 4ZUXD 1P3BC 4H9QB 5E5AC 4Z66B 3W96D 1P34C 3AZNC 5B33B 5B1LA 4Z66D 2IO5B 3MGQB 3MGSA 4H9RA 5AV8C 3LZ1A 2PYOB 5GT3B 5F99B 3V9RB 5JA4B 3KWQB 3MNNC 3W98C 2PYOD 5GT3D 4XUJC 5B2JC 3KWQD 3AV2A 3A6NC 4XZQA 5GSUC 3KXBB 3W97A 1P3LC 1ID3C 3AYWD 3MVDA 5AV5C 3KXBD 1KX5B 1KX3A 2HIOC 3AZJC 3AZHB 1P3GA 1KX5D 1KU5A 5CP6A 5GXQB 3C1BC 4H9OB 5AV6B 5AV9C 3REJC 3WTPB 3AZHD 5GXQD 4ZUXC 4E45A 5AV6D 1P3FA 1P3KD 3WTPD 3W96C 1KX4B 4Z66C 3LJAA 4QLCA 5B33C 1AOIA 2IO5C 5GT0B 3MGQC 1S32A 3B6FA 5AY8A 4Z2MG 1F66A 2PYOC 5GT3C 5F99C 3AZMA 3KWQC 4KHAA 5B32G 3TU4A 1M1AB 2F8NA 5B40B 3MGRA 3AYWC 3AZKA 5BNXB 2FJ7A 4KUDA 1M1AD 3KXBC 5JRGA 5DNND 4H9NA 5B40D 3MGPB 3AZIB 3X1TB 4CSRB 1KX5C 4R8PB 1H3OB 4JJNA 3MGPD 3AZID 4NFTA 3AZHC 3X1UA 5GXQC 4J8VA 3B6GB 4Z5TA 5BNVA 3WKJB 5AV6C 3WTPC 5B1MA 3B6GD 3WKJD 5BO0A 1KX4C 4WNNB 4M6BA 5B0ZA 3LELB 4J8WA 5B2IB 3UT9A 4G91C 1BH9B 4KGCD 3LELD 3REIB 3W99A 4DRBA 5B32B 2LY8A 4NE6A 3REID 5BS7C 1M1AC 2BYKA 3VH6T 3UTAB 3LZ0A 5B40C 3AV1A 3UTAD 4CAYA 3MGPC 3AZIC 4J8XA 3AZGA 1P3MA 1EQZA 1P34A 5B0YB 3AZNA 4X23A 3B6GC 3WKJC 1P3BD 1JFIA 5B0YD 4WU9B 5E5AD 1WWIA 5G49A 4WU9D 3WA9B 5AV8D 2NQBB 5B31G 4Z2MH 3WA9D 3KUYA 3MNND 3WAAB 5GSUA 4EO5B 1ID3A 2YFWB 3LELC 2NQBD 4XUJD 3X1SB 3WAAD 3REIC 1P3LD 3AZFB 1BFMA 5CPJB 5B31A 3C1BA 3UTAC 3AZFD 2F8NK 5CPJD 3REKB 1P3OB 3REJD 1P3OD 4LD9B 4H9QA 3AZEB 5B0YC 1HTAA 5CHLB 4DRAA 3RELB 5CPIB 3AZED 1ZLAB 4LD9D 5B24B 3X1VB 3RELD 4WU9C 5CPID 2PYOA 3V9RA 5JA4A 5B33D 3X1VD 3UTBB 3MGQD 3WA9C 2NZDB 3VH6W 2NQBC 4YM6A 3UTBD 5F99D 3AZLA 3AYWA 2NZDD 3WAAC 4EO5C 3KXBA 1P3IB 1ULYA 1TAFB 1M18A 1TZYB 1KX5A 5C3IB 2CV5B 3AZFC 5GXQA 5CPJC 4NE5A 2CV5D 2RVQD 5AV6A 1P3KA 3WTPA 4AWLC 5B1LB 3REHB 3REKC 1P3OC 3MGSB 4H9RB 2BYMA 3LZ1B 4WU8A 3REHD 4LD9C 3AZEC 3RELC 1KX4D 5CPIC 1B6WA 3R45A 2F8NG 5B24C 3X1VC 4XZQB 3W97B 3UTBC 4XZQD 3MVDB 5GT0D 2YFVA 2NZDC 4H9SC 1KX3B 5DNNA 3MVDD 5CPKA 2HUEB 5CP6B 1P3IC 3AN2B 1TZYC 4CSRA 5CP6D 3O62B 4J8UA 5BT1C 3AN2D 5C3IC 2CV5C 1P3FB 2RVQC 5KDMB 3O62D 3X1TD 3B6GA 1P3FD 4R8PD 3LJAB 5FUGA 3REHC 1AOIB 3LJAD 4E44A 3LZ1C 1S32B 3B6FB 5AY8B 3AFAB 1F66B 1N1JA 3AZMB 1S32D 3B6FD 3AFAD 4KGCA 3TU4B 3LELA 3MGRB 1U35B 2FJ7B 3AZKB 4XZQC 4KUDB 5GT0C 3REIA 5JRGB 3NQJB 4H9NB 1U35D 2FJ7D 5AVBB 3MVDC 5B2ID 5AVCB 1KX3C 4G92B 4JJNB 5AVBD 1B67A 2HUEC 5AVCD 3X1UB 4J8VB 5CP6C 3AN2C 4Z5TB 5BNVB 5B32D 4JJND 1HQ3A 5B1MB 3KSYA 3O62C 3X1TC 5BO0B 1P3FC 1P3BA 4R8PC 3NQUB 5E5AA 4YS3B 5B0ZB 3LJAC 4WU9A 5AV8A 4J8WB 4YS3D 5B0ZD 3UT9B 1S32C 3B6FC 1WWSA 5AY8C 3AFAC 5DNMB 1F66C 3MNNA 3W98A 4J8WD 3AZMC 4WZSB 5DNMD 4XUJA 5B2JA 1P3AB 3TU4C 2YFWA 3A6NA 2BYKB 1P3PB 3LZ0B 3MGRC 1U35C 1P3LA 2FJ7C 1P3AD 5B2IC 3AV1B 1P3PD 5JRGC 4CAYB 3LZ0D 5AV5A 5AVBC 3AZFA 4J8XB 3AV1D 5AVCC 5CPJA 3AZGB 3X1SD 2HIOA 5B32C 4JJNC 4G92C 3AZJA 1P3MB 1EQZB 4H9PA 4J8XD 3AZGD 4X23B 5AV9A 3REJA 4Z5TC 1P3MD 1JFIB 4ZUXA 1P3OA 4X23D 3W96A 5G49B 3VH5A 3C1CB 3REKD 3RELA 4Z66A 1F1EA 1R4VA 3B0CT 5B33A 4YS3C 5B0ZC 3C1CD 3X1VA 3KUYB 3MGQA 1BH8B 1ID3B 4J8WC 5F99A 5GT3A 5DNMC 4UUZB 1ZLAD 3KWQA 2NZDA 5B24D 2AROB 1P3AC 5B31B 1P3PC 3C1BB 2AROD 3LZ0C 5B31D 3AV1C 1M19B 3X1SC 1P3ID 4J8XC 1M19D 3AZGC 1TZYD 3AZHA 1P3MC 1EQZC 5BT1D 4H9OA 4X23C 3REHA 2JSSA 1A7WA 1KX4A 5B1LD 3C1CC 3MGSD 3LZ1D 4YM6B 3AZLB 3AYWB 3KUYC 1ZLAC 5GT0A 3AV2B 4YM6D 3AZLD 1M18B 3AV2D 1M18D 3W97D 2AROC 5BS7A 1M1AA 5B31C 5B40A
chains in the Genus database with same CATH superfamily
5BNXA 4WV4B 1P3GB 1P3KB 1KX3D 4NE3A 3O62A 3X1TA 3MGPA 3AZIA 1M19C 1P3GD 3IP4C 2BYMB 4R8PA 4WU8B 1H3OA 5KDMA 3AN2A 3B0CW 2L5AA 4WU8D 3WKJA 3B0BA 3R45B 4QLCB 4G91B 5B1LC 3AFAA 3MGSC 4QLCD 4WNNA 1AOID 2YFVB 4KHAB 5AY8D 1F66D 4YM6C 5DNNB 5CPKB 3AZLC 1U35A 3AZMD 5B2IA 3AV2C 2F8NB 1BH9A 2FFFB 3NQJA 5CPKD 3TU4D 5AVBA 1M18C 3W97C 2F8ND 3KFUG 5AVCA 3MGRD 4J8UB 3AZKD 5B32A 4KUDD 5JRGD 4J8UD 3UTAA 1P3GC 1P3KC 5FUGB 3X1UD 4J8VD 4Z5TD 3WTPE 4WU8C 3NQUA 3VH5T 2Y2JA 2Y2OA 4HGAB 5B1MD 1N1JB 5B0YA 4ZBJB 4YS3A 4KGCB 2CWEA 2G5IC 2G5HC 4QLCC 5DNMA 1AOIC 3B0DB 1Q9CA 3WA9A 2NQBA 3UT9D 3W99B 1P3AA 2F8NH 1P3PA 5DNNC 3WAAA 5CPKC 3W99D 3X1SA 3AZKC 4KUDC 1HQ3B 4J8UC 1HQ3D 1P3BB 3EPKA 5E5AB 1P34B 3AZNB 3X1UC 4J8VC 3REKA 1EQZD 1P34D 5AV8B 3AZND 5B1MC 3C1CA 4LD9A 3AZEA 4HGAC 3MNNB 3W98B 2ZY5A 4ZBJC 4XUJB 4KGCC 5B2JB 5CPIA 1ZLAA 3W98D 1BH8A 5B24A 3A6NB 2Y2HA 5GSUB 5B2JD 1P3LB 4UUZA 3B0DC 3A6ND 3UT9C 3UTBA 3KUYD 2F2AC 5GSUD 5AV5B 1ID3D 2AROA 4H9SA 3W99C 2HIOB 3AZJB 5AV5D 4H9PB 3VH6A 1P3IA 4AWLB 1M19A 5AV9B 2HIOD 3REJB 3AZJD 1TAFA 1TZYA 4ZUXB 3C1BD 1HQ3C 3VH5W 5AV9D 2CV5A 3W96B 2Y2MA 4ZUXD 1P3BC 4H9QB 2BG1A 5E5AC 4Z66B 1P34C 3W96D 3AZNC 5B33B 5B1LA 4Z66D 2IO5B 3MGQB 3MGSA 4H9RA 5AV8C 3LZ1A 2PYOB 5GT3B 5F99B 3V9RB 5JA4B 3KWQB 3MNNC 3W98C 2PYOD 5GT3D 4XUJC 5B2JC 3KWQD 3AV2A 2RIQA 3A6NC 4XZQA 5GSUC 3KXBB 3W97A 1P3LC 1ID3C 2J8PA 3AYWD 3MVDA 5AV5C 3KXBD 1KX5B 1KX3A 2HIOC 3AZJC 3AZHB 1P3GA 1KX5D 1KU5A 5CP6A 5GXQB 2W8SA 4H9OB 3C1BC 2ZY2A 5AV6B 5AV9C 3REJC 3WTPB 3AZHD 5GXQD 4ZUXC 4E45A 5AV6D 1P3FA 1P3KD 3WTPD 3W96C 1KX4B 2ZY4A 4WJ3C 4Z66C 3LJAA 3EPLA 4QLCA 5B33C 1AOIA 2IO5C 5GT0B 3MGQC 4DQYB 1S32A 3B6FA 5AY8A 4Z2MG 1F66A 2PYOC 5GT3C 5F99C 3AZMA 3KWQC 4KHAA 2Y2QA 5B32G 3TU4A 1M1AB 2F8NA 5B40B 3MGRA 3AYWC 3AZKA 5BNXB 2FJ7A 4KUDA 1M1AD 3KXBC 5JRGA 2DQNC 5DNND 4H9NA 5B40D 3MGPB 3AZIB 3X1TB 4UPKA 4CSRB 1KX5C 4R8PB 1H3OB 4JJNA 3A1KA 3MGPD 3AZID 2DF4C 4NFTA 3AZHC 3X1UA 5GXQC 4J8VA 3B6GB 4Z5TA 5BNVA 3WKJB 5AV6C 3WTPC 5B1MA 3B6GD 3WKJD 5BO0A 1KX4C 4WNNB 4M6BA 3EPJA 3EPHA 5B0ZA 2UWXA 3LELB 4J8WA 5B2IB 3UT9A 4G91C 1BH9B 4KGCD 3LELD 3REIB 3W99A 4DRBA 5B32B 2LY8A 4NE6A 3REID 5BS7C 1M1AC 2BYKA 3VH6T 3UTAB 3LZ0A 5B40C 3AV1A 3UTAD 4CAYA 3MGPC 3AZIC 4J8XA 3AZGA 3H0MC 1P3MA 1EQZA 1P34A 5B0YB 3AZNA 4X23A 3B6GC 3WKJC 1P3BD 1JFIA 5B0YD 4WU9B 5E5AD 1WWIA 2Y2PA 3AL0C 5G49A 4WU9D 3WA9B 5AV8D 2NQBB 5B31G 4Z2MH 3WA9D 3KUYA 3MNND 3WAAB 5GSUA 4EO5B 1ID3A 2YFWB 3LELC 2NQBD 4XUJD 3X1SB 3WAAD 3A1IA 3REIC 2XD1A 1P3LD 3AZFB 1BFMA 5CPJB 5B31A 3C1BA 3UTAC 3AZFD 3EG5B 2F8NK 5CPJD 3F6TA 3REKB 1P3OB 3REJD 1P3OD 4LD9B 4H9QA 3AZEB 5B0YC 1HTAA 5CHLB 4DRAA 3RELB 5CPIB 3AZED 1ZLAB 4LD9D 5B24B 3X1VB 3RELD 4WU9C 5CPID 2PYOA 2VQRA 2Y2NA 3V9RA 5JA4A 5B33D 3X1VD 3H0LC 3UTBB 3MGQD 3WA9C 2NZDB 3VH6W 2NQBC 4YM6A 3UTBD 5F99D 3AZLA 3AYWA 2NZDD 3WAAC 4EO5C 3KXBA 1P3IB 3H0RC 1ULYA 1TAFB 1M18A 1TZYB 1KX5A 5C3IB 2CV5B 3AZFC 5GXQA 2ZM5A 5CPJC 4NE5A 2CV5D 2RVQD 5AV6A 1P3KA 3WTPA 4AWLC 3FDDA 5B1LB 3REHB 3REKC 1P3OC 3MGSB 4H9RB 2BYMA 3LZ1B 4WU8A 3REHD 4LD9C 3AZEC 3RELC 1KX4D 5CPIC 1B6WA 3R45A 2F8NG 5B24C 3X1VC 4XZQB 3W97B 3UTBC 4XZQD 3MVDB 5GT0D 1T3UA 2YFVA 2NZDC 4H9SC 1KX3B 5DNNA 3MVDD 5CPKA 2HUEB 5CP6B 1P3IC 3AN2B 2XD5A 1TZYC 4CSRA 5CP6D 3O62B 4J8UA 5BT1C 3AN2D 5C3IC 2CV5C 1P3FB 2RVQC 5KDMB 3O62D 3X1TD 3B6GA 1P3FD 4R8PD 3LJAB 5FUGA 3REHC 1AOIB 3LJAD 4E44A 3LZ1C 1S32B 3B6FB 5AY8B 3AFAB 1F66B 1N1JA 3AZMB 1S32D 3B6FD 3AFAD 4KGCA 3TU4B 3LELA 3MGRB 1U35B 2FJ7B 3AZKB 4XZQC 4KUDB 5GT0C 3REIA 5JRGB 3NQJB 4H9NB 1U35D 2FJ7D 5AVBB 3MVDC 3P5JB 5B2ID 5AVCB 1KX3C 4G92B 4JJNB 5AVBD 1B67A 2HUEC 5AVCD 3X1UB 4J8VB 5CP6C 2Y2KA 4Z5TB 5BNVB 5B32D 4JJND 3AN2C 1HQ3A 5B1MB 3KSYA 3O62C 3X1TC 5BO0B 1P3FC 1P3BA 4R8PC 3NQUB 5E5AA 4YS3B 5B0ZB 3LJAC 4WU9A 5AV8A 4J8WB 4YS3D 5B0ZD 3UT9B 1S32C 3B6FC 1WWSA 5AY8C 3AFAC 5DNMB 1F66C 3MNNA 3W98A 4J8WD 3AZMC 4WZSB 5DNMD 4XUJA 5B2JA 2JCHA 1P3AB 3TU4C 2YFWA 3A6NA 2BYKB 1P3PB 3LZ0B 3MGRC 1U35C 1P3LA 2FJ7C 1P3AD 5B2IC 3AV1B 1P3PD 5JRGC 4CAYB 3LZ0D 5AV5A 5AVBC 3AZFA 4J8XB 3AV1D 5AVCC 5CPJA 3AZGB 3X1SD 2Y2LA 2HIOA 5B32C 4JJNC 4G92C 3AZJA 1P3MB 1EQZB 4H9PA 4J8XD 3AZGD 1Z2CB 5AV9A 4X23B 4Z5TC 3REJA 1P3MD 1JFIB 4ZUXA 1P3OA 4X23D 3W96A 5G49B 2Y2GA 3VH5A 3C1CB 3REKD 3RELA 1PZRA 4Z66A 1F1EA 1R4VA 3B0CT 5B33A 4YS3C 5B0ZC 3C1CD 3X1VA 3KUYB 3MGQA 1BH8B 1ID3B 4J8WC 5F99A 5GT3A 5DNMC 4UUZB 1ZLAD 3KWQA 2NZDA 5B24D 2AROB 1P3AC 5B31B 1P3PC 3C1BB 2Y2IA 2AROD 3LZ0C 5B31D 3AV1C 1M19B 3X1SC 1P3ID 2ZY3A 4J8XC 1M19D 3AZGC 1TZYD 3AZHA 1P3MC 1EQZC 5BT1D 4H9OA 2JE5A 4X23C 3REHA 2JSSA 1A7WA 1W2EA 1KX4A 5B1LD 3C1CC 3MGSD 3LZ1D 4YM6B 3AZLB 3AYWB 3KUYC 1ZLAC 5GT0A 3AV2B 4YM6D 3AZLD 1M18B 3AV2D 1M18D 3W97D 2AROC 5BS7A 1M1AA 5B31C 5B40A
chains in the Genus database with same CATH topology
5BNXA 4WV4B 1P3GB 1P3KB 1KX3D 4NE3A 3O62A 3X1TA 3MGPA 3AZIA 1M19C 1P3GD 3IP4C 2BYMB 4R8PA 4WU8B 1H3OA 5KDMA 3AN2A 3B0CW 2L5AA 4WU8D 3WKJA 3B0BA 3R45B 4QLCB 4G91B 5B1LC 3AFAA 3MGSC 4QLCD 4WNNA 1AOID 2YFVB 4KHAB 5AY8D 1F66D 4YM6C 5DNNB 5CPKB 3AZLC 1U35A 3AZMD 5B2IA 3AV2C 2F8NB 1BH9A 2FFFB 3NQJA 5CPKD 3TU4D 5AVBA 1M18C 3W97C 2F8ND 3KFUG 5AVCA 3MGRD 4J8UB 3AZKD 5B32A 4KUDD 5JRGD 4J8UD 3UTAA 1P3GC 1P3KC 5FUGB 3X1UD 4J8VD 4Z5TD 3WTPE 4WU8C 3NQUA 3VH5T 2Y2JA 2Y2OA 4HGAB 5B1MD 1N1JB 5B0YA 4ZBJB 4YS3A 4KGCB 2CWEA 2G5IC 2G5HC 4QLCC 5DNMA 1AOIC 3B0DB 1Q9CA 3WA9A 2NQBA 3UT9D 3W99B 1P3AA 2F8NH 1P3PA 5DNNC 3WAAA 5CPKC 3W99D 3X1SA 3AZKC 4KUDC 1HQ3B 4J8UC 1HQ3D 1P3BB 3EPKA 5E5AB 1P34B 3AZNB 3X1UC 4J8VC 3REKA 1EQZD 1P34D 5AV8B 3AZND 5B1MC 3C1CA 4LD9A 3AZEA 4HGAC 3MNNB 3W98B 2ZY5A 4ZBJC 4XUJB 4KGCC 5B2JB 5CPIA 1ZLAA 3W98D 1BH8A 5B24A 3A6NB 2Y2HA 5GSUB 5B2JD 1P3LB 4UUZA 3B0DC 3A6ND 3UT9C 3UTBA 3KUYD 2F2AC 5GSUD 5AV5B 1ID3D 2AROA 4H9SA 3W99C 2HIOB 3AZJB 5AV5D 4H9PB 3VH6A 1P3IA 4AWLB 1M19A 5AV9B 2HIOD 3REJB 3AZJD 1TAFA 1TZYA 4ZUXB 3C1BD 1HQ3C 3VH5W 5AV9D 2CV5A 3W96B 2Y2MA 4ZUXD 1P3BC 4H9QB 2BG1A 5E5AC 4Z66B 1P34C 3W96D 3AZNC 5B33B 5B1LA 4Z66D 2IO5B 3MGQB 3MGSA 4H9RA 5AV8C 3LZ1A 2PYOB 5GT3B 5F99B 3V9RB 5JA4B 3KWQB 3MNNC 3W98C 2PYOD 5GT3D 4XUJC 5B2JC 3KWQD 3AV2A 2RIQA 3A6NC 4XZQA 5GSUC 3KXBB 3W97A 1P3LC 1ID3C 2J8PA 3AYWD 3MVDA 5AV5C 3KXBD 1KX5B 1KX3A 2HIOC 3AZJC 3AZHB 1P3GA 1KX5D 1KU5A 5CP6A 5GXQB 2W8SA 4H9OB 3C1BC 2ZY2A 5AV6B 5AV9C 3REJC 3WTPB 3AZHD 5GXQD 4ZUXC 4E45A 5AV6D 1P3FA 1P3KD 3WTPD 3W96C 1KX4B 2ZY4A 4WJ3C 4Z66C 3LJAA 3EPLA 4QLCA 5B33C 1AOIA 2IO5C 5GT0B 3MGQC 4DQYB 1S32A 3B6FA 5AY8A 4Z2MG 1F66A 2PYOC 5GT3C 5F99C 3AZMA 3KWQC 4KHAA 2Y2QA 5B32G 3TU4A 1M1AB 2F8NA 5B40B 3MGRA 3AYWC 3AZKA 5BNXB 2FJ7A 4KUDA 1M1AD 3KXBC 5JRGA 2DQNC 5DNND 4H9NA 5B40D 3MGPB 3AZIB 3X1TB 4UPKA 4CSRB 1KX5C 4R8PB 1H3OB 4JJNA 3A1KA 3MGPD 3AZID 2DF4C 4NFTA 3AZHC 3X1UA 5GXQC 4J8VA 3B6GB 4Z5TA 5BNVA 3WKJB 5AV6C 3WTPC 5B1MA 3B6GD 3WKJD 5BO0A 1KX4C 4WNNB 4M6BA 3EPJA 3EPHA 5B0ZA 2UWXA 3LELB 4J8WA 5B2IB 3UT9A 4G91C 1BH9B 4KGCD 3LELD 3REIB 3W99A 4DRBA 5B32B 2LY8A 4NE6A 3REID 5BS7C 1M1AC 2BYKA 3VH6T 3UTAB 3LZ0A 5B40C 3AV1A 3UTAD 4CAYA 3MGPC 3AZIC 4J8XA 3AZGA 3H0MC 1P3MA 1EQZA 1P34A 5B0YB 3AZNA 4X23A 3B6GC 3WKJC 1P3BD 1JFIA 5B0YD 4WU9B 5E5AD 1WWIA 2Y2PA 3AL0C 5G49A 4WU9D 3WA9B 5AV8D 2NQBB 5B31G 4Z2MH 3WA9D 3KUYA 3MNND 3WAAB 5GSUA 4EO5B 1ID3A 2YFWB 3LELC 2NQBD 4XUJD 3X1SB 3WAAD 3A1IA 3REIC 2XD1A 1P3LD 3AZFB 1BFMA 5CPJB 5B31A 3C1BA 3UTAC 3AZFD 3EG5B 2F8NK 5CPJD 3F6TA 3REKB 1P3OB 3REJD 1P3OD 4LD9B 4H9QA 3AZEB 5B0YC 1HTAA 5CHLB 4DRAA 3RELB 5CPIB 3AZED 1ZLAB 4LD9D 5B24B 3X1VB 3RELD 4WU9C 5CPID 2PYOA 2VQRA 2Y2NA 3V9RA 5JA4A 5B33D 3X1VD 3H0LC 3UTBB 3MGQD 3WA9C 2NZDB 3VH6W 2NQBC 4YM6A 3UTBD 5F99D 3AZLA 3AYWA 2NZDD 3WAAC 4EO5C 3KXBA 1P3IB 3H0RC 1ULYA 1TAFB 1M18A 1TZYB 1KX5A 5C3IB 2CV5B 3AZFC 5GXQA 2ZM5A 5CPJC 4NE5A 2CV5D 2RVQD 5AV6A 1P3KA 3WTPA 4AWLC 3FDDA 5B1LB 3REHB 3REKC 1P3OC 3MGSB 4H9RB 2BYMA 3LZ1B 4WU8A 3REHD 4LD9C 3AZEC 3RELC 1KX4D 5CPIC 1B6WA 3R45A 2F8NG 5B24C 3X1VC 4XZQB 3W97B 3UTBC 4XZQD 3MVDB 5GT0D 1T3UA 2YFVA 2NZDC 4H9SC 1KX3B 5DNNA 3MVDD 5CPKA 2HUEB 5CP6B 1P3IC 3AN2B 2XD5A 1TZYC 4CSRA 5CP6D 3O62B 4J8UA 5BT1C 3AN2D 5C3IC 2CV5C 1P3FB 2RVQC 5KDMB 3O62D 3X1TD 3B6GA 1P3FD 4R8PD 3LJAB 5FUGA 3REHC 1AOIB 3LJAD 4E44A 3LZ1C 1S32B 3B6FB 5AY8B 3AFAB 1F66B 1N1JA 3AZMB 1S32D 3B6FD 3AFAD 4KGCA 3TU4B 3LELA 3MGRB 1U35B 2FJ7B 3AZKB 4XZQC 4KUDB 5GT0C 3REIA 5JRGB 3NQJB 4H9NB 1U35D 2FJ7D 5AVBB 3MVDC 3P5JB 5B2ID 5AVCB 1KX3C 4G92B 4JJNB 5AVBD 1B67A 2HUEC 5AVCD 3X1UB 4J8VB 5CP6C 2Y2KA 4Z5TB 5BNVB 5B32D 4JJND 3AN2C 1HQ3A 5B1MB 3KSYA 3O62C 3X1TC 5BO0B 1P3FC 1P3BA 4R8PC 3NQUB 5E5AA 4YS3B 5B0ZB 3LJAC 4WU9A 5AV8A 4J8WB 4YS3D 5B0ZD 3UT9B 1S32C 3B6FC 1WWSA 5AY8C 3AFAC 5DNMB 1F66C 3MNNA 3W98A 4J8WD 3AZMC 4WZSB 5DNMD 4XUJA 5B2JA 2JCHA 1P3AB 3TU4C 2YFWA 3A6NA 2BYKB 1P3PB 3LZ0B 3MGRC 1U35C 1P3LA 2FJ7C 1P3AD 5B2IC 3AV1B 1P3PD 5JRGC 4CAYB 3LZ0D 5AV5A 5AVBC 3AZFA 4J8XB 3AV1D 5AVCC 5CPJA 3AZGB 3X1SD 2Y2LA 2HIOA 5B32C 4JJNC 4G92C 3AZJA 1P3MB 1EQZB 4H9PA 4J8XD 3AZGD 1Z2CB 5AV9A 4X23B 4Z5TC 3REJA 1P3MD 1JFIB 4ZUXA 1P3OA 4X23D 3W96A 5G49B 2Y2GA 3VH5A 3C1CB 3REKD 3RELA 1PZRA 4Z66A 1F1EA 1R4VA 3B0CT 5B33A 4YS3C 5B0ZC 3C1CD 3X1VA 3KUYB 3MGQA 1BH8B 1ID3B 4J8WC 5F99A 5GT3A 5DNMC 4UUZB 1ZLAD 3KWQA 2NZDA 5B24D 2AROB 1P3AC 5B31B 1P3PC 3C1BB 2Y2IA 2AROD 3LZ0C 5B31D 3AV1C 1M19B 3X1SC 1P3ID 2ZY3A 4J8XC 1M19D 3AZGC 1TZYD 3AZHA 1P3MC 1EQZC 5BT1D 4H9OA 2JE5A 4X23C 3REHA 2JSSA 1A7WA 1W2EA 1KX4A 5B1LD 3C1CC 3MGSD 3LZ1D 4YM6B 3AZLB 3AYWB 3KUYC 1ZLAC 5GT0A 3AV2B 4YM6D 3AZLD 1M18B 3AV2D 1M18D 3W97D 2AROC 5BS7A 1M1AA 5B31C 5B40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNX A;  4WV4 B;  1P3G B;  1P3K B;  1KX3 D;  4NE3 A;  3O62 A;  3X1T A;  3MGP A;  3AZI A;  1M19 C;  1P3G D;  2BYM B;  4R8P A;  4WU8 B;  1H3O A;  5KDM A;  3AN2 A;  3B0C W;  2L5A A;  4WU8 D;  3WKJ A;  3B0B A;  3R45 B;  4QLC B;  4G91 B;  5B1L C;  3AFA A;  3MGS C;  4QLC D;  4WNN A;  1AOI D;  2YFV B;  4KHA B;  5AY8 D;  1F66 D;  4YM6 C;  5DNN B;  5CPK B;  3AZL C;  1U35 A;  3AZM D;  5B2I A;  3AV2 C;  2F8N B;  1BH9 A;  3NQJ A;  5CPK D;  3TU4 D;  5AVB A;  1M18 C;  3W97 C;  2F8N D;  5AVC A;  3MGR D;  4J8U B;  3AZK D;  5B32 A;  4KUD D;  5JRG D;  4J8U D;  3UTA A;  1P3G C;  1P3K C;  5FUG B;  3X1U D;  4J8V D;  4Z5T D;  3WTP E;  4WU8 C;  3NQU A;  3VH5 T;  4HGA B;  5B1M D;  1N1J B;  5B0Y A;  4ZBJ B;  4YS3 A;  4KGC B;  2CWE A;  4QLC C;  5DNM A;  1AOI C;  3B0D B;  1Q9C A;  3WA9 A;  2NQB A;  3UT9 D;  3W99 B;  1P3A A;  2F8N H;  1P3P A;  5DNN C;  3WAA A;  5CPK C;  3W99 D;  3X1S A;  3AZK C;  4KUD C;  1HQ3 B;  4J8U C;  1HQ3 D;  1P3B B;  5E5A B;  1P34 B;  3AZN B;  3X1U C;  4J8V C;  3REK A;  1EQZ D;  1P34 D;  5AV8 B;  3AZN D;  5B1M C;  3C1C A;  4LD9 A;  3AZE A;  4HGA C;  3MNN B;  3W98 B;  4ZBJ C;  4XUJ B;  4KGC C;  5B2J B;  5CPI A;  1ZLA A;  3W98 D;  1BH8 A;  5B24 A;  3A6N B;  5GSU B;  5B2J D;  1P3L B;  4UUZ A;  3B0D C;  3A6N D;  3UT9 C;  3UTB A;  3KUY D;  5GSU D;  5AV5 B;  1ID3 D;  2ARO A;  4H9S A;  3W99 C;  2HIO B;  3AZJ B;  5AV5 D;  4H9P B;  3VH6 A;  1P3I A;  4AWL B;  1M19 A;  5AV9 B;  2HIO D;  3REJ B;  3AZJ D;  1TAF A;  1TZY A;  4ZUX B;  3C1B D;  1HQ3 C;  3VH5 W;  5AV9 D;  2CV5 A;  3W96 B;  4ZUX D;  1P3B C;  4H9Q B;  5E5A C;  4Z66 B;  3W96 D;  1P34 C;  3AZN C;  5B33 B;  5B1L A;  4Z66 D;  2IO5 B;  3MGQ B;  3MGS A;  4H9R A;  5AV8 C;  3LZ1 A;  2PYO B;  5GT3 B;  5F99 B;  3V9R B;  5JA4 B;  3KWQ B;  3MNN C;  3W98 C;  2PYO D;  5GT3 D;  4XUJ C;  5B2J C;  3KWQ D;  3AV2 A;  3A6N C;  4XZQ A;  5GSU C;  3KXB B;  3W97 A;  1P3L C;  1ID3 C;  3AYW D;  3MVD A;  5AV5 C;  3KXB D;  1KX5 B;  1KX3 A;  2HIO C;  3AZJ C;  3AZH B;  1P3G A;  1KX5 D;  1KU5 A;  5CP6 A;  5GXQ B;  3C1B C;  4H9O B;  5AV6 B;  5AV9 C;  3REJ C;  3WTP B;  3AZH D;  5GXQ D;  4ZUX C;  4E45 A;  5AV6 D;  1P3F A;  1P3K D;  3WTP D;  3W96 C;  1KX4 B;  4Z66 C;  3LJA A;  4QLC A;  5B33 C;  1AOI A;  2IO5 C;  5GT0 B;  3MGQ C;  1S32 A;  3B6F A;  5AY8 A;  4Z2M G;  1F66 A;  2PYO C;  5GT3 C;  5F99 C;  3AZM A;  3KWQ C;  4KHA A;  5B32 G;  3TU4 A;  1M1A B;  2F8N A;  5B40 B;  3MGR A;  3AYW C;  3AZK A;  5BNX B;  2FJ7 A;  4KUD A;  1M1A D;  3KXB C;  5JRG A;  5DNN D;  4H9N A;  5B40 D;  3MGP B;  3AZI B;  3X1T B;  4CSR B;  1KX5 C;  4R8P B;  1H3O B;  4JJN A;  3MGP D;  3AZI D;  4NFT A;  3AZH C;  3X1U A;  5GXQ C;  4J8V A;  3B6G B;  4Z5T A;  5BNV A;  3WKJ B;  5AV6 C;  3WTP C;  5B1M A;  3B6G D;  3WKJ D;  5BO0 A;  1KX4 C;  4WNN B;  4M6B A;  5B0Z A;  3LEL B;  4J8W A;  5B2I B;  3UT9 A;  4G91 C;  1BH9 B;  4KGC D;  3LEL D;  3REI B;  3W99 A;  4DRB A;  5B32 B;  2LY8 A;  4NE6 A;  3REI D;  5BS7 C;  1M1A C;  2BYK A;  3VH6 T;  3UTA B;  3LZ0 A;  5B40 C;  3AV1 A;  3UTA D;  4CAY A;  3MGP C;  3AZI C;  4J8X A;  3AZG A;  1P3M A;  1EQZ A;  1P34 A;  5B0Y B;  3AZN A;  4X23 A;  3B6G C;  3WKJ C;  1P3B D;  1JFI A;  5B0Y D;  4WU9 B;  5E5A D;  1WWI A;  5G49 A;  4WU9 D;  3WA9 B;  5AV8 D;  2NQB B;  5B31 G;  4Z2M H;  3WA9 D;  3KUY A;  3MNN D;  3WAA B;  5GSU A;  4EO5 B;  1ID3 A;  2YFW B;  3LEL C;  2NQB D;  4XUJ D;  3X1S B;  3WAA D;  3REI C;  1P3L D;  3AZF B;  1BFM A;  5CPJ B;  5B31 A;  3C1B A;  3UTA C;  3AZF D;  2F8N K;  5CPJ D;  3REK B;  1P3O B;  3REJ D;  1P3O D;  4LD9 B;  4H9Q A;  3AZE B;  5B0Y C;  1HTA A;  5CHL B;  4DRA A;  3REL B;  5CPI B;  3AZE D;  1ZLA B;  4LD9 D;  5B24 B;  3X1V B;  3REL D;  4WU9 C;  5CPI D;  2PYO A;  3V9R A;  5JA4 A;  5B33 D;  3X1V D;  3UTB B;  3MGQ D;  3WA9 C;  2NZD B;  3VH6 W;  2NQB C;  4YM6 A;  3UTB D;  5F99 D;  3AZL A;  3AYW A;  2NZD D;  3WAA C;  4EO5 C;  3KXB A;  1P3I B;  1ULY A;  1TAF B;  1M18 A;  1TZY B;  1KX5 A;  5C3I B;  2CV5 B;  3AZF C;  5GXQ A;  5CPJ C;  4NE5 A;  2CV5 D;  2RVQ D;  5AV6 A;  1P3K A;  3WTP A;  4AWL C;  5B1L B;  3REH B;  3REK C;  1P3O C;  3MGS B;  4H9R B;  2BYM A;  3LZ1 B;  4WU8 A;  3REH D;  4LD9 C;  3AZE C;  3REL C;  1KX4 D;  5CPI C;  1B6W A;  3R45 A;  2F8N G;  5B24 C;  3X1V C;  4XZQ B;  3W97 B;  3UTB C;  4XZQ D;  3MVD B;  5GT0 D;  2YFV A;  2NZD C;  4H9S C;  1KX3 B;  5DNN A;  3MVD D;  5CPK A;  2HUE B;  5CP6 B;  1P3I C;  3AN2 B;  1TZY C;  4CSR A;  5CP6 D;  3O62 B;  4J8U A;  5BT1 C;  3AN2 D;  5C3I C;  2CV5 C;  1P3F B;  2RVQ C;  5KDM B;  3O62 D;  3X1T D;  3B6G A;  1P3F D;  4R8P D;  3LJA B;  5FUG A;  3REH C;  1AOI B;  3LJA D;  4E44 A;  3LZ1 C;  1S32 B;  3B6F B;  5AY8 B;  3AFA B;  1F66 B;  1N1J A;  3AZM B;  1S32 D;  3B6F D;  3AFA D;  4KGC A;  3TU4 B;  3LEL A;  3MGR B;  1U35 B;  2FJ7 B;  3AZK B;  4XZQ C;  4KUD B;  5GT0 C;  3REI A;  5JRG B;  3NQJ B;  4H9N B;  1U35 D;  2FJ7 D;  5AVB B;  3MVD C;  5B2I D;  5AVC B;  1KX3 C;  4G92 B;  4JJN B;  5AVB D;  1B67 A;  2HUE C;  5AVC D;  3X1U B;  4J8V B;  5CP6 C;  3AN2 C;  4Z5T B;  5BNV B;  5B32 D;  4JJN D;  1HQ3 A;  5B1M B;  3KSY A;  3O62 C;  3X1T C;  5BO0 B;  1P3F C;  1P3B A;  4R8P C;  3NQU B;  5E5A A;  4YS3 B;  5B0Z B;  3LJA C;  4WU9 A;  5AV8 A;  4J8W B;  4YS3 D;  5B0Z D;  3UT9 B;  1S32 C;  3B6F C;  1WWS A;  5AY8 C;  3AFA C;  5DNM B;  1F66 C;  3MNN A;  3W98 A;  4J8W D;  3AZM C;  4WZS B;  5DNM D;  4XUJ A;  5B2J A;  1P3A B;  3TU4 C;  2YFW A;  3A6N A;  2BYK B;  1P3P B;  3LZ0 B;  3MGR C;  1U35 C;  1P3L A;  2FJ7 C;  1P3A D;  5B2I C;  3AV1 B;  1P3P D;  5JRG C;  4CAY B;  3LZ0 D;  5AV5 A;  5AVB C;  3AZF A;  4J8X B;  3AV1 D;  5AVC C;  5CPJ A;  3AZG B;  3X1S D;  2HIO A;  5B32 C;  4JJN C;  4G92 C;  3AZJ A;  1P3M B;  1EQZ B;  4H9P A;  4J8X D;  3AZG D;  4X23 B;  5AV9 A;  3REJ A;  4Z5T C;  1P3M D;  1JFI B;  4ZUX A;  1P3O A;  4X23 D;  3W96 A;  5G49 B;  3VH5 A;  3C1C B;  3REK D;  3REL A;  4Z66 A;  1F1E A;  1R4V A;  3B0C T;  5B33 A;  4YS3 C;  5B0Z C;  3C1C D;  3X1V A;  3KUY B;  3MGQ A;  1BH8 B;  1ID3 B;  4J8W C;  5F99 A;  5GT3 A;  5DNM C;  4UUZ B;  1ZLA D;  3KWQ A;  2NZD A;  5B24 D;  2ARO B;  1P3A C;  5B31 B;  1P3P C;  3C1B B;  2ARO D;  3LZ0 C;  5B31 D;  3AV1 C;  1M19 B;  3X1S C;  1P3I D;  4J8X C;  1M19 D;  3AZG C;  1TZY D;  3AZH A;  1P3M C;  1EQZ C;  5BT1 D;  4H9O A;  4X23 C;  3REH A;  2JSS A;  1A7W A;  1KX4 A;  5B1L D;  3C1C C;  3MGS D;  3LZ1 D;  4YM6 B;  3AZL B;  3AYW B;  3KUY C;  1ZLA C;  5GT0 A;  3AV2 B;  4YM6 D;  3AZL D;  1M18 B;  3AV2 D;  1M18 D;  3W97 D;  2ARO C;  5BS7 A;  1M1A A;  5B31 C;  5B40 A; 
#chains in the Genus database with same CATH topology
 5BNX A;  4WV4 B;  1P3G B;  1P3K B;  1KX3 D;  4NE3 A;  3O62 A;  3X1T A;  3MGP A;  3AZI A;  1M19 C;  1P3G D;  3IP4 C;  2BYM B;  4R8P A;  4WU8 B;  1H3O A;  5KDM A;  3AN2 A;  3B0C W;  2L5A A;  4WU8 D;  3WKJ A;  3B0B A;  3R45 B;  4QLC B;  4G91 B;  5B1L C;  3AFA A;  3MGS C;  4QLC D;  4WNN A;  1AOI D;  2YFV B;  4KHA B;  5AY8 D;  1F66 D;  4YM6 C;  5DNN B;  5CPK B;  3AZL C;  1U35 A;  3AZM D;  5B2I A;  3AV2 C;  2F8N B;  1BH9 A;  2FFF B;  3NQJ A;  5CPK D;  3TU4 D;  5AVB A;  1M18 C;  3W97 C;  2F8N D;  3KFU G;  5AVC A;  3MGR D;  4J8U B;  3AZK D;  5B32 A;  4KUD D;  5JRG D;  4J8U D;  3UTA A;  1P3G C;  1P3K C;  5FUG B;  3X1U D;  4J8V D;  4Z5T D;  3WTP E;  4WU8 C;  3NQU A;  3VH5 T;  2Y2J A;  2Y2O A;  4HGA B;  5B1M D;  1N1J B;  5B0Y A;  4ZBJ B;  4YS3 A;  4KGC B;  2CWE A;  2G5I C;  2G5H C;  4QLC C;  5DNM A;  1AOI C;  3B0D B;  1Q9C A;  3WA9 A;  2NQB A;  3UT9 D;  3W99 B;  1P3A A;  2F8N H;  1P3P A;  5DNN C;  3WAA A;  5CPK C;  3W99 D;  3X1S A;  3AZK C;  4KUD C;  1HQ3 B;  4J8U C;  1HQ3 D;  1P3B B;  3EPK A;  5E5A B;  1P34 B;  3AZN B;  3X1U C;  4J8V C;  3REK A;  1EQZ D;  1P34 D;  5AV8 B;  3AZN D;  5B1M C;  3C1C A;  4LD9 A;  3AZE A;  4HGA C;  3MNN B;  3W98 B;  2ZY5 A;  4ZBJ C;  4XUJ B;  4KGC C;  5B2J B;  5CPI A;  1ZLA A;  3W98 D;  1BH8 A;  5B24 A;  3A6N B;  2Y2H A;  5GSU B;  5B2J D;  1P3L B;  4UUZ A;  3B0D C;  3A6N D;  3UT9 C;  3UTB A;  3KUY D;  2F2A C;  5GSU D;  5AV5 B;  1ID3 D;  2ARO A;  4H9S A;  3W99 C;  2HIO B;  3AZJ B;  5AV5 D;  4H9P B;  3VH6 A;  1P3I A;  4AWL B;  1M19 A;  5AV9 B;  2HIO D;  3REJ B;  3AZJ D;  1TAF A;  1TZY A;  4ZUX B;  3C1B D;  1HQ3 C;  3VH5 W;  5AV9 D;  2CV5 A;  3W96 B;  2Y2M A;  4ZUX D;  1P3B C;  4H9Q B;  2BG1 A;  5E5A C;  4Z66 B;  1P34 C;  3W96 D;  3AZN C;  5B33 B;  5B1L A;  4Z66 D;  2IO5 B;  3MGQ B;  3MGS A;  4H9R A;  5AV8 C;  3LZ1 A;  2PYO B;  5GT3 B;  5F99 B;  3V9R B;  5JA4 B;  3KWQ B;  3MNN C;  3W98 C;  2PYO D;  5GT3 D;  4XUJ C;  5B2J C;  3KWQ D;  3AV2 A;  2RIQ A;  3A6N C;  4XZQ A;  5GSU C;  3KXB B;  3W97 A;  1P3L C;  1ID3 C;  2J8P A;  3AYW D;  3MVD A;  5AV5 C;  3KXB D;  1KX5 B;  1KX3 A;  2HIO C;  3AZJ C;  3AZH B;  1P3G A;  1KX5 D;  1KU5 A;  5CP6 A;  5GXQ B;  2W8S A;  4H9O B;  3C1B C;  2ZY2 A;  5AV6 B;  5AV9 C;  3REJ C;  3WTP B;  3AZH D;  5GXQ D;  4ZUX C;  4E45 A;  5AV6 D;  1P3F A;  1P3K D;  3WTP D;  3W96 C;  1KX4 B;  2ZY4 A;  4WJ3 C;  4Z66 C;  3LJA A;  3EPL A;  4QLC A;  5B33 C;  1AOI A;  2IO5 C;  5GT0 B;  3MGQ C;  4DQY B;  1S32 A;  3B6F A;  5AY8 A;  4Z2M G;  1F66 A;  2PYO C;  5GT3 C;  5F99 C;  3AZM A;  3KWQ C;  4KHA A;  2Y2Q A;  5B32 G;  3TU4 A;  1M1A B;  2F8N A;  5B40 B;  3MGR A;  3AYW C;  3AZK A;  5BNX B;  2FJ7 A;  4KUD A;  1M1A D;  3KXB C;  5JRG A;  2DQN C;  5DNN D;  4H9N A;  5B40 D;  3MGP B;  3AZI B;  3X1T B;  4UPK A;  4CSR B;  1KX5 C;  4R8P B;  1H3O B;  4JJN A;  3A1K A;  3MGP D;  3AZI D;  2DF4 C;  4NFT A;  3AZH C;  3X1U A;  5GXQ C;  4J8V A;  3B6G B;  4Z5T A;  5BNV A;  3WKJ B;  5AV6 C;  3WTP C;  5B1M A;  3B6G D;  3WKJ D;  5BO0 A;  1KX4 C;  4WNN B;  4M6B A;  3EPJ A;  3EPH A;  5B0Z A;  2UWX A;  3LEL B;  4J8W A;  5B2I B;  3UT9 A;  4G91 C;  1BH9 B;  4KGC D;  3LEL D;  3REI B;  3W99 A;  4DRB A;  5B32 B;  2LY8 A;  4NE6 A;  3REI D;  5BS7 C;  1M1A C;  2BYK A;  3VH6 T;  3UTA B;  3LZ0 A;  5B40 C;  3AV1 A;  3UTA D;  4CAY A;  3MGP C;  3AZI C;  4J8X A;  3AZG A;  3H0M C;  1P3M A;  1EQZ A;  1P34 A;  5B0Y B;  3AZN A;  4X23 A;  3B6G C;  3WKJ C;  1P3B D;  1JFI A;  5B0Y D;  4WU9 B;  5E5A D;  1WWI A;  2Y2P A;  3AL0 C;  5G49 A;  4WU9 D;  3WA9 B;  5AV8 D;  2NQB B;  5B31 G;  4Z2M H;  3WA9 D;  3KUY A;  3MNN D;  3WAA B;  5GSU A;  4EO5 B;  1ID3 A;  2YFW B;  3LEL C;  2NQB D;  4XUJ D;  3X1S B;  3WAA D;  3A1I A;  3REI C;  2XD1 A;  1P3L D;  3AZF B;  1BFM A;  5CPJ B;  5B31 A;  3C1B A;  3UTA C;  3AZF D;  3EG5 B;  2F8N K;  5CPJ D;  3F6T A;  3REK B;  1P3O B;  3REJ D;  1P3O D;  4LD9 B;  4H9Q A;  3AZE B;  5B0Y C;  1HTA A;  5CHL B;  4DRA A;  3REL B;  5CPI B;  3AZE D;  1ZLA B;  4LD9 D;  5B24 B;  3X1V B;  3REL D;  4WU9 C;  5CPI D;  2PYO A;  2VQR A;  2Y2N A;  3V9R A;  5JA4 A;  5B33 D;  3X1V D;  3H0L C;  3UTB B;  3MGQ D;  3WA9 C;  2NZD B;  3VH6 W;  2NQB C;  4YM6 A;  3UTB D;  5F99 D;  3AZL A;  3AYW A;  2NZD D;  3WAA C;  4EO5 C;  3KXB A;  1P3I B;  3H0R C;  1ULY A;  1TAF B;  1M18 A;  1TZY B;  1KX5 A;  5C3I B;  2CV5 B;  3AZF C;  5GXQ A;  2ZM5 A;  5CPJ C;  4NE5 A;  2CV5 D;  2RVQ D;  5AV6 A;  1P3K A;  3WTP A;  4AWL C;  3FDD A;  5B1L B;  3REH B;  3REK C;  1P3O C;  3MGS B;  4H9R B;  2BYM A;  3LZ1 B;  4WU8 A;  3REH D;  4LD9 C;  3AZE C;  3REL C;  1KX4 D;  5CPI C;  1B6W A;  3R45 A;  2F8N G;  5B24 C;  3X1V C;  4XZQ B;  3W97 B;  3UTB C;  4XZQ D;  3MVD B;  5GT0 D;  1T3U A;  2YFV A;  2NZD C;  4H9S C;  1KX3 B;  5DNN A;  3MVD D;  5CPK A;  2HUE B;  5CP6 B;  1P3I C;  3AN2 B;  2XD5 A;  1TZY C;  4CSR A;  5CP6 D;  3O62 B;  4J8U A;  5BT1 C;  3AN2 D;  5C3I C;  2CV5 C;  1P3F B;  2RVQ C;  5KDM B;  3O62 D;  3X1T D;  3B6G A;  1P3F D;  4R8P D;  3LJA B;  5FUG A;  3REH C;  1AOI B;  3LJA D;  4E44 A;  3LZ1 C;  1S32 B;  3B6F B;  5AY8 B;  3AFA B;  1F66 B;  1N1J A;  3AZM B;  1S32 D;  3B6F D;  3AFA D;  4KGC A;  3TU4 B;  3LEL A;  3MGR B;  1U35 B;  2FJ7 B;  3AZK B;  4XZQ C;  4KUD B;  5GT0 C;  3REI A;  5JRG B;  3NQJ B;  4H9N B;  1U35 D;  2FJ7 D;  5AVB B;  3MVD C;  3P5J B;  5B2I D;  5AVC B;  1KX3 C;  4G92 B;  4JJN B;  5AVB D;  1B67 A;  2HUE C;  5AVC D;  3X1U B;  4J8V B;  5CP6 C;  2Y2K A;  4Z5T B;  5BNV B;  5B32 D;  4JJN D;  3AN2 C;  1HQ3 A;  5B1M B;  3KSY A;  3O62 C;  3X1T C;  5BO0 B;  1P3F C;  1P3B A;  4R8P C;  3NQU B;  5E5A A;  4YS3 B;  5B0Z B;  3LJA C;  4WU9 A;  5AV8 A;  4J8W B;  4YS3 D;  5B0Z D;  3UT9 B;  1S32 C;  3B6F C;  1WWS A;  5AY8 C;  3AFA C;  5DNM B;  1F66 C;  3MNN A;  3W98 A;  4J8W D;  3AZM C;  4WZS B;  5DNM D;  4XUJ A;  5B2J A;  2JCH A;  1P3A B;  3TU4 C;  2YFW A;  3A6N A;  2BYK B;  1P3P B;  3LZ0 B;  3MGR C;  1U35 C;  1P3L A;  2FJ7 C;  1P3A D;  5B2I C;  3AV1 B;  1P3P D;  5JRG C;  4CAY B;  3LZ0 D;  5AV5 A;  5AVB C;  3AZF A;  4J8X B;  3AV1 D;  5AVC C;  5CPJ A;  3AZG B;  3X1S D;  2Y2L A;  2HIO A;  5B32 C;  4JJN C;  4G92 C;  3AZJ A;  1P3M B;  1EQZ B;  4H9P A;  4J8X D;  3AZG D;  1Z2C B;  5AV9 A;  4X23 B;  4Z5T C;  3REJ A;  1P3M D;  1JFI B;  4ZUX A;  1P3O A;  4X23 D;  3W96 A;  5G49 B;  2Y2G A;  3VH5 A;  3C1C B;  3REK D;  3REL A;  1PZR A;  4Z66 A;  1F1E A;  1R4V A;  3B0C T;  5B33 A;  4YS3 C;  5B0Z C;  3C1C D;  3X1V A;  3KUY B;  3MGQ A;  1BH8 B;  1ID3 B;  4J8W C;  5F99 A;  5GT3 A;  5DNM C;  4UUZ B;  1ZLA D;  3KWQ A;  2NZD A;  5B24 D;  2ARO B;  1P3A C;  5B31 B;  1P3P C;  3C1B B;  2Y2I A;  2ARO D;  3LZ0 C;  5B31 D;  3AV1 C;  1M19 B;  3X1S C;  1P3I D;  2ZY3 A;  4J8X C;  1M19 D;  3AZG C;  1TZY D;  3AZH A;  1P3M C;  1EQZ C;  5BT1 D;  4H9O A;  2JE5 A;  4X23 C;  3REH A;  2JSS A;  1A7W A;  1W2E A;  1KX4 A;  5B1L D;  3C1C C;  3MGS D;  3LZ1 D;  4YM6 B;  3AZL B;  3AYW B;  3KUY C;  1ZLA C;  5GT0 A;  3AV2 B;  4YM6 D;  3AZL D;  1M18 B;  3AV2 D;  1M18 D;  3W97 D;  2ARO C;  5BS7 A;  1M1A A;  5B31 C;  5B40 A; 
#chains in the Genus database with same CATH homology
 5BNX A;  4WV4 B;  1P3G B;  1P3K B;  1KX3 D;  4NE3 A;  3O62 A;  3X1T A;  3MGP A;  3AZI A;  1M19 C;  1P3G D;  3IP4 C;  2BYM B;  4R8P A;  4WU8 B;  1H3O A;  5KDM A;  3AN2 A;  3B0C W;  2L5A A;  4WU8 D;  3WKJ A;  3B0B A;  3R45 B;  4QLC B;  4G91 B;  5B1L C;  3AFA A;  3MGS C;  4QLC D;  4WNN A;  1AOI D;  2YFV B;  4KHA B;  5AY8 D;  1F66 D;  4YM6 C;  5DNN B;  5CPK B;  3AZL C;  1U35 A;  3AZM D;  5B2I A;  3AV2 C;  2F8N B;  1BH9 A;  2FFF B;  3NQJ A;  5CPK D;  3TU4 D;  5AVB A;  1M18 C;  3W97 C;  2F8N D;  3KFU G;  5AVC A;  3MGR D;  4J8U B;  3AZK D;  5B32 A;  4KUD D;  5JRG D;  4J8U D;  3UTA A;  1P3G C;  1P3K C;  5FUG B;  3X1U D;  4J8V D;  4Z5T D;  3WTP E;  4WU8 C;  3NQU A;  3VH5 T;  2Y2J A;  2Y2O A;  4HGA B;  5B1M D;  1N1J B;  5B0Y A;  4ZBJ B;  4YS3 A;  4KGC B;  2CWE A;  2G5I C;  2G5H C;  4QLC C;  5DNM A;  1AOI C;  3B0D B;  1Q9C A;  3WA9 A;  2NQB A;  3UT9 D;  3W99 B;  1P3A A;  2F8N H;  1P3P A;  5DNN C;  3WAA A;  5CPK C;  3W99 D;  3X1S A;  3AZK C;  4KUD C;  1HQ3 B;  4J8U C;  1HQ3 D;  1P3B B;  3EPK A;  5E5A B;  1P34 B;  3AZN B;  3X1U C;  4J8V C;  3REK A;  1EQZ D;  1P34 D;  5AV8 B;  3AZN D;  5B1M C;  3C1C A;  4LD9 A;  3AZE A;  4HGA C;  3MNN B;  3W98 B;  2ZY5 A;  4ZBJ C;  4XUJ B;  4KGC C;  5B2J B;  5CPI A;  1ZLA A;  3W98 D;  1BH8 A;  5B24 A;  3A6N B;  2Y2H A;  5GSU B;  5B2J D;  1P3L B;  4UUZ A;  3B0D C;  3A6N D;  3UT9 C;  3UTB A;  3KUY D;  2F2A C;  5GSU D;  5AV5 B;  1ID3 D;  2ARO A;  4H9S A;  3W99 C;  2HIO B;  3AZJ B;  5AV5 D;  4H9P B;  3VH6 A;  1P3I A;  4AWL B;  1M19 A;  5AV9 B;  2HIO D;  3REJ B;  3AZJ D;  1TAF A;  1TZY A;  4ZUX B;  3C1B D;  1HQ3 C;  3VH5 W;  5AV9 D;  2CV5 A;  3W96 B;  2Y2M A;  4ZUX D;  1P3B C;  4H9Q B;  2BG1 A;  5E5A C;  4Z66 B;  1P34 C;  3W96 D;  3AZN C;  5B33 B;  5B1L A;  4Z66 D;  2IO5 B;  3MGQ B;  3MGS A;  4H9R A;  5AV8 C;  3LZ1 A;  2PYO B;  5GT3 B;  5F99 B;  3V9R B;  5JA4 B;  3KWQ B;  3MNN C;  3W98 C;  2PYO D;  5GT3 D;  4XUJ C;  5B2J C;  3KWQ D;  3AV2 A;  2RIQ A;  3A6N C;  4XZQ A;  5GSU C;  3KXB B;  3W97 A;  1P3L C;  1ID3 C;  2J8P A;  3AYW D;  3MVD A;  5AV5 C;  3KXB D;  1KX5 B;  1KX3 A;  2HIO C;  3AZJ C;  3AZH B;  1P3G A;  1KX5 D;  1KU5 A;  5CP6 A;  5GXQ B;  2W8S A;  4H9O B;  3C1B C;  2ZY2 A;  5AV6 B;  5AV9 C;  3REJ C;  3WTP B;  3AZH D;  5GXQ D;  4ZUX C;  4E45 A;  5AV6 D;  1P3F A;  1P3K D;  3WTP D;  3W96 C;  1KX4 B;  2ZY4 A;  4WJ3 C;  4Z66 C;  3LJA A;  3EPL A;  4QLC A;  5B33 C;  1AOI A;  2IO5 C;  5GT0 B;  3MGQ C;  4DQY B;  1S32 A;  3B6F A;  5AY8 A;  4Z2M G;  1F66 A;  2PYO C;  5GT3 C;  5F99 C;  3AZM A;  3KWQ C;  4KHA A;  2Y2Q A;  5B32 G;  3TU4 A;  1M1A B;  2F8N A;  5B40 B;  3MGR A;  3AYW C;  3AZK A;  5BNX B;  2FJ7 A;  4KUD A;  1M1A D;  3KXB C;  5JRG A;  2DQN C;  5DNN D;  4H9N A;  5B40 D;  3MGP B;  3AZI B;  3X1T B;  4UPK A;  4CSR B;  1KX5 C;  4R8P B;  1H3O B;  4JJN A;  3A1K A;  3MGP D;  3AZI D;  2DF4 C;  4NFT A;  3AZH C;  3X1U A;  5GXQ C;  4J8V A;  3B6G B;  4Z5T A;  5BNV A;  3WKJ B;  5AV6 C;  3WTP C;  5B1M A;  3B6G D;  3WKJ D;  5BO0 A;  1KX4 C;  4WNN B;  4M6B A;  3EPJ A;  3EPH A;  5B0Z A;  2UWX A;  3LEL B;  4J8W A;  5B2I B;  3UT9 A;  4G91 C;  1BH9 B;  4KGC D;  3LEL D;  3REI B;  3W99 A;  4DRB A;  5B32 B;  2LY8 A;  4NE6 A;  3REI D;  5BS7 C;  1M1A C;  2BYK A;  3VH6 T;  3UTA B;  3LZ0 A;  5B40 C;  3AV1 A;  3UTA D;  4CAY A;  3MGP C;  3AZI C;  4J8X A;  3AZG A;  3H0M C;  1P3M A;  1EQZ A;  1P34 A;  5B0Y B;  3AZN A;  4X23 A;  3B6G C;  3WKJ C;  1P3B D;  1JFI A;  5B0Y D;  4WU9 B;  5E5A D;  1WWI A;  2Y2P A;  3AL0 C;  5G49 A;  4WU9 D;  3WA9 B;  5AV8 D;  2NQB B;  5B31 G;  4Z2M H;  3WA9 D;  3KUY A;  3MNN D;  3WAA B;  5GSU A;  4EO5 B;  1ID3 A;  2YFW B;  3LEL C;  2NQB D;  4XUJ D;  3X1S B;  3WAA D;  3A1I A;  3REI C;  2XD1 A;  1P3L D;  3AZF B;  1BFM A;  5CPJ B;  5B31 A;  3C1B A;  3UTA C;  3AZF D;  3EG5 B;  2F8N K;  5CPJ D;  3F6T A;  3REK B;  1P3O B;  3REJ D;  1P3O D;  4LD9 B;  4H9Q A;  3AZE B;  5B0Y C;  1HTA A;  5CHL B;  4DRA A;  3REL B;  5CPI B;  3AZE D;  1ZLA B;  4LD9 D;  5B24 B;  3X1V B;  3REL D;  4WU9 C;  5CPI D;  2PYO A;  2VQR A;  2Y2N A;  3V9R A;  5JA4 A;  5B33 D;  3X1V D;  3H0L C;  3UTB B;  3MGQ D;  3WA9 C;  2NZD B;  3VH6 W;  2NQB C;  4YM6 A;  3UTB D;  5F99 D;  3AZL A;  3AYW A;  2NZD D;  3WAA C;  4EO5 C;  3KXB A;  1P3I B;  3H0R C;  1ULY A;  1TAF B;  1M18 A;  1TZY B;  1KX5 A;  5C3I B;  2CV5 B;  3AZF C;  5GXQ A;  2ZM5 A;  5CPJ C;  4NE5 A;  2CV5 D;  2RVQ D;  5AV6 A;  1P3K A;  3WTP A;  4AWL C;  3FDD A;  5B1L B;  3REH B;  3REK C;  1P3O C;  3MGS B;  4H9R B;  2BYM A;  3LZ1 B;  4WU8 A;  3REH D;  4LD9 C;  3AZE C;  3REL C;  1KX4 D;  5CPI C;  1B6W A;  3R45 A;  2F8N G;  5B24 C;  3X1V C;  4XZQ B;  3W97 B;  3UTB C;  4XZQ D;  3MVD B;  5GT0 D;  1T3U A;  2YFV A;  2NZD C;  4H9S C;  1KX3 B;  5DNN A;  3MVD D;  5CPK A;  2HUE B;  5CP6 B;  1P3I C;  3AN2 B;  2XD5 A;  1TZY C;  4CSR A;  5CP6 D;  3O62 B;  4J8U A;  5BT1 C;  3AN2 D;  5C3I C;  2CV5 C;  1P3F B;  2RVQ C;  5KDM B;  3O62 D;  3X1T D;  3B6G A;  1P3F D;  4R8P D;  3LJA B;  5FUG A;  3REH C;  1AOI B;  3LJA D;  4E44 A;  3LZ1 C;  1S32 B;  3B6F B;  5AY8 B;  3AFA B;  1F66 B;  1N1J A;  3AZM B;  1S32 D;  3B6F D;  3AFA D;  4KGC A;  3TU4 B;  3LEL A;  3MGR B;  1U35 B;  2FJ7 B;  3AZK B;  4XZQ C;  4KUD B;  5GT0 C;  3REI A;  5JRG B;  3NQJ B;  4H9N B;  1U35 D;  2FJ7 D;  5AVB B;  3MVD C;  3P5J B;  5B2I D;  5AVC B;  1KX3 C;  4G92 B;  4JJN B;  5AVB D;  1B67 A;  2HUE C;  5AVC D;  3X1U B;  4J8V B;  5CP6 C;  2Y2K A;  4Z5T B;  5BNV B;  5B32 D;  4JJN D;  3AN2 C;  1HQ3 A;  5B1M B;  3KSY A;  3O62 C;  3X1T C;  5BO0 B;  1P3F C;  1P3B A;  4R8P C;  3NQU B;  5E5A A;  4YS3 B;  5B0Z B;  3LJA C;  4WU9 A;  5AV8 A;  4J8W B;  4YS3 D;  5B0Z D;  3UT9 B;  1S32 C;  3B6F C;  1WWS A;  5AY8 C;  3AFA C;  5DNM B;  1F66 C;  3MNN A;  3W98 A;  4J8W D;  3AZM C;  4WZS B;  5DNM D;  4XUJ A;  5B2J A;  2JCH A;  1P3A B;  3TU4 C;  2YFW A;  3A6N A;  2BYK B;  1P3P B;  3LZ0 B;  3MGR C;  1U35 C;  1P3L A;  2FJ7 C;  1P3A D;  5B2I C;  3AV1 B;  1P3P D;  5JRG C;  4CAY B;  3LZ0 D;  5AV5 A;  5AVB C;  3AZF A;  4J8X B;  3AV1 D;  5AVC C;  5CPJ A;  3AZG B;  3X1S D;  2Y2L A;  2HIO A;  5B32 C;  4JJN C;  4G92 C;  3AZJ A;  1P3M B;  1EQZ B;  4H9P A;  4J8X D;  3AZG D;  1Z2C B;  5AV9 A;  4X23 B;  4Z5T C;  3REJ A;  1P3M D;  1JFI B;  4ZUX A;  1P3O A;  4X23 D;  3W96 A;  5G49 B;  2Y2G A;  3VH5 A;  3C1C B;  3REK D;  3REL A;  1PZR A;  4Z66 A;  1F1E A;  1R4V A;  3B0C T;  5B33 A;  4YS3 C;  5B0Z C;  3C1C D;  3X1V A;  3KUY B;  3MGQ A;  1BH8 B;  1ID3 B;  4J8W C;  5F99 A;  5GT3 A;  5DNM C;  4UUZ B;  1ZLA D;  3KWQ A;  2NZD A;  5B24 D;  2ARO B;  1P3A C;  5B31 B;  1P3P C;  3C1B B;  2Y2I A;  2ARO D;  3LZ0 C;  5B31 D;  3AV1 C;  1M19 B;  3X1S C;  1P3I D;  2ZY3 A;  4J8X C;  1M19 D;  3AZG C;  1TZY D;  3AZH A;  1P3M C;  1EQZ C;  5BT1 D;  4H9O A;  2JE5 A;  4X23 C;  3REH A;  2JSS A;  1A7W A;  1W2E A;  1KX4 A;  5B1L D;  3C1C C;  3MGS D;  3LZ1 D;  4YM6 B;  3AZL B;  3AYW B;  3KUY C;  1ZLA C;  5GT0 A;  3AV2 B;  4YM6 D;  3AZL D;  1M18 B;  3AV2 D;  1M18 D;  3W97 D;  2ARO C;  5BS7 A;  1M1A A;  5B31 C;  5B40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...