4J8UA

X-ray structure of ncp145 with chlorido(eta-6-p-cymene)(n-phenyl-2-pyridinecarbothioamide)osmium(ii)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
doi rcsb
source organism Xenopus laevis
total genus 29
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4j8uA00
5B32D 4Z2MH 5B24C 4UUZA 4CSRA 1BH9B 3REIC 4H9SC 3TU4D 4YM6A 5GT0C 3B6FD 3MGRA 4JJNC 4LD9B 5JRGD 1HQ3D 3REHA 2BYMB 5BT1D 2CV5A 5B24B 3REIB 2NQBC 5FUGA 1F66D 1P3MC 3LELC 5GT0B 4JJNB 5AV8D 4J8WC 4YS3A 1KX4C 1ZLAA 1EQZD 3B0DC 5B33D 4R8PC 3AZFD 2NQBB 1P3MB 3LELB 3MVDD 3AZLD 5B0YD 1P3LA 3WA9D 3KUYC 4J8UD 1AOIA 4J8WB 3W99A 4Z5TA 1KX4B 3NQUA 5GT3A 5B31D 3AZMB 1P3PD 4XZQB 3R45A 4R8PB 1P3AA 5AVCD 3MNND 2YFVA 4YM6C 3KUYB 5B24D 4CAYA 2F8NG 1U35A 3REHC 3AZHA 2YFWA 5DNNB 5GT0D 2CV5C 4JJND 3B0CW 4UUZB 5CPKA 4HGAC 1BFMA 3W97A 3AV1D 4YS3C 3AV2D 2AROA 3REHB 1P3MD 3WAAB 2CV5B 3MGPA 5FUGB 2HIOA 4EO5C 4XUJD 3MGQB 1P3LC 4HGAB 1AOIC 4R8PD 3W99C 4Z5TC 4YS3B 2F8NA 3VH6T 2JSSA 4KGCD 5GT3C 1P34A 3KUYD 3AZEA 1P3AC 3V9RA 4EO5B 3X1TD 1P3LB 3UTAA 3AFAA 1P3KC 1AOIB 3W99B 4Z5TB 1U35C 3NQUB 3B6FA 4YM6D 4G92C 3MGRD 1P3AB 3R45B 5JRGA 1HQ3A 3AZGA 1ID3A 5B31G 3REHD 1WWIA 5CPKC 1P3KB 4CAYB 4H9NA 3W97C 5AV6D 2AROC 5AY8D 2YFWB 4G92B 1B67A 3MGPC 1M18D 3X1SA 2HIOC 1ZLAD 5AV9A 2LY8A 5CPKB 5B33A 1BH8A 2AROB 3MVDA 3AZLA 1P34C 3WA9A 4J8UA 3MGPB 3AZEC 1AOID 1KU5A 2HIOB 5B32C 5GT3D 3AZKD 3NQJB 5B31A 5GXQD 3UTAC 1P3PA 3AFAC 1P3AD 2NZDA 1ULYA 2F8NB 3KWQD 5BNXA 3B6FC 3AZEB 5JRGC 1HQ3C 3AZGC 1U35D 1ID3C 2FJ7A 5B32B 5BT1C 3AZHD 1M19A 4NE6A 3B6FB 5JRGB 1HQ3B 5AV8C 3AZGB 3AV1A 1ID3B 3X1SC 3AV2A 3W97D 2AROD 3VH5T 5AV9C 5B33C 4H9NB 1P3BA 1F66B 2HIOD 4XUJA 5E5AA 3MVDC 3AZLC 5B0YC 3WA9C 5BNVA 4J8UC 5AV8B 5BS7A 4KGCA 5GSUA 4WU8A 1P34D 5AV9B 5B31C 1P3PC 5B1LA 5B33B 5B2JA 3AZED 1BH8B 5AVCC 3MNNC 4DRBA 3MVDB 3AZLB 5B0YB 3WA9B 4J8UB 3UTAD 3AFAD 5B0ZD 2FJ7C 3C1CA 3REKD 5B31B 1P3PB 1M19C 3AZGD 3LZ1A 4H9OA 5G49A 5AVCB 4DRAA 3MNNB 1ID3D 5BNXB 3AV1C 5AV6A 3AV2C 5AY8A 2FJ7B 1M18A 3X1SD 1KX5A 1P3BC 4J8VA 5E5AC 4XUJC 5AV9D 3AZIA 4NFTA 5BS7C 3AV1B 3AV2B 4KGCC 5GSUC 4WU8C 1KX3A 5AV5A 5B2JC 4XUJB 3AZKA 3X1TC 5GXQA 3WKJD 3B0DB 2NZDD 3VH6W 5B1MD 3KWQA 4KGCB 5GSUB 3C1CC 5CPJA 3W96A 3MGRC 3B0BA 3O62A 3LZ1C 5KDMA 3X1TB 2FJ7D 4CSRB 1M19D 4AWLC 5AV6C 5AY8C 4YM6B 3MGRB 3WTPD 1M18C 3LZ1B 4H9OB 2BYKA 1P3FA 1KX5C 4J8VC 1ZLAC 3AZIC 2CWEA 5JA4A 4H9RA 3X1VA 5AV6B 1P3BD 5E5AD 4NE3A 5AY8B 3AZND 4KHAA 1KX3C 5AV5C 1A7WA 3A6NA 1M18B 1KX5B 4J8VB 3X1UA 3AZKC 4ZBJC 5GSUD 4WU8D 1ZLAB 5GXQC 3AZIB 5B1LD 5B2JD 3KWQC 3MGSA 1KX3B 5AV5B 5C3IC 3O62C 5B0ZA 4X23A 3REKA 4ZBJB 5GT3B 3C1CD 3AZHC 3AZKB 5GXQB 1TZYA 5AVBA 3LZ1D 4KUDA 3KWQB 5CP6A 2YFVB 1H3OA 4NE5A 4WV4B 5C3IB 3O62B 1U35B 4WNNA 3AZHB 3VH6A 3W98D 3AYWA 3X1VC 1KX5D 4Z2MG 4J8VD 1N1JA 3AZID 3A6NC 3W97B 3VH5W 2BYKB 4QLCA 4Z66A 3LJAA 4H9PA 1KX3D 5AV5D 1P3GA 5JA4B 4H9RB 3X1VB 3KXBA 1JFIA 4KHAB 3WKJA 4WU9A 3A6NB 5BO0A 5B1MA 5B0ZC 4X23C 3REKC 3AN2A 1P34B 5CPJD 3B6GA 3W96D 1TZYC 5AVBC 3V9RB 3O62D 4KUDC 1TAFA 3C1BA 2F8NH 5CP6C 4J8XA 3UTAB 2L5AA 3AFAB 5CHLB 5B0ZB 3REKB 3AZJD 3WTPA 1TZYB 5AVBB 4KUDB 1BH9A 3AYWC 1P3FD 4WZSB 1R4VA 5CP6B 4E45A 2IO5C 3X1VD 4WNNB 4QLCC 4Z66C 3LJAC 3AZNA 5B40D 3A6ND 3X1SB 3AYWB 3X1UD 1N1JB 3KXBC 3WKJC 4WU9C 2IO5B 4ZUXA 2NZDC 5B1MC 4QLCB 3LJAB 5DNMA 3AN2C 4H9PB 3B6GC 3MGSD 4X23D 3C1BC 3KXBB 3VH5A 4J8XC 3LELA 1JFIB 4WU9B 3WKJB 2NZDB 1TZYD 5BO0B 5AVBD 5B1MB 4J8WA 4KUDD 5CP6D 3B6GB 3WTPC 3AZMA 4XZQA 1P3OA 1F1EA 1TAFB 3W98A 4J8XB 2PYOD 3WTPE 1M19B 3AYWD 3AZNC 3WTPB 5DNNA 1S32D 4QLCD 4Z66D 3LJAD 3LZ0A 1P3GD 5B1LC 3UT9A 4ZUXC 1P3BB 5E5AB 3REJD 3AZNB 5DNMC 3KXBD 5BNVB 3WAAA 4WU9D 4WU8B 3AN2D 1Q9CA 3B6GD 3MGQA 5B1LB 5F99A 5B2JB 4ZUXB 5DNMB 3C1BD 4J8XD 3UTBA 3AZMC 4XZQC 1P3OC 3C1CB 3W98C 3AZJA 5G49B 5DNNC 4AWLB 1M1AA 1P3OB 4LD9D 3W98B 5B40A 3LZ0C 3UT9C 1P3KA 3REID 4G91C 3WAAC 4ZUXD 5B32G 5DNMD 5CPJC 3W96C 5B2IA 3LZ0B 3MGQC 5F99C 3UT9B 1P3IA 4G91B 2NQBD 5CPIA 3LELD 3UTBC 4J8WD 5CPJB 1KX4D 4H9QA 3AZJC 3W96B 3NQJA 5F99B 3AZMD 4XZQD 5KDMB 1P3OD 1P3FC 2PYOA 3UTBB 1M1AC 3RELA 5B40C 5B32A 3AZJB 5DNND 1S32A 1P3FB 3B0CT 3X1UC 3TU4A 2HUEC 3LZ0D 3UT9D 1M1AB 3REJA 5B40B 3MGSC 2RVQC 3WAAD 5B2IC 2CV5D 1P3IC 3X1UB 1F66A 2HUEB 5CPIC 3MGQD 5F99D 5AV8A 4YS3D 3MGSB 2F8NK 5B2IB 3UTBD 1P3IB 1EQZA 4X23B 3AZFA 2PYOC 5CPIB 5B0YA 1P3LD 3RELC 3W99D 4Z5TD 1H3OB 4H9QB 1HTAA 1S32C 1M1AD 4LD9A 5AVCA 1WWSA 3MNNA 2PYOB 2BYMA 3TU4C 1P3GC 4E44A 5B24A 3REIA 1P3KD 3RELB 4H9SA 3REJC 5GT0A 4JJNA 1S32B 4Z66B 1F66C 3TU4B 2RVQD 1P3GB 5B2ID 1P3ID 5CPKD 3REJB 2NQBA 1B6WA 1P3MA 5CPID 1EQZC 3MGPD 3KSYA 3AZFC 3AN2B 1KX4A 4R8PA 3C1BB 2F8ND 1EQZB 3KUYA 3AZFB 4LD9C 3RELD 4M6BA 3X1TA
chains in the Genus database with same CATH superfamily
5B32D 4Z2MH 5B24C 4UUZA 4CSRA 1BH9B 3REIC 2Y2IA 4H9SC 2G5IC 3TU4D 4YM6A 5GT0C 3B6FD 3MGRA 4JJNC 4LD9B 5JRGD 1HQ3D 3REHA 2BYMB 5BT1D 2W8SA 2CV5A 5B24B 3REIB 2NQBC 5FUGA 1F66D 1P3MC 3LELC 3EPHA 5GT0B 4JJNB 5AV8D 4J8WC 3EPJA 4YS3A 1KX4C 1ZLAA 2Y2OA 1EQZD 3B0DC 5B33D 4R8PC 3AZFD 2NQBB 1P3MB 3LELB 3MVDD 3AZLD 5B0YD 1P3LA 3WA9D 3KUYC 4J8UD 1AOIA 4J8WB 3W99A 4Z5TA 1KX4B 4DQYB 3NQUA 5GT3A 5B31D 3AZMB 1P3PD 4XZQB 3R45A 3A1IA 4R8PB 1P3AA 5AVCD 3MNND 2ZY2A 2YFVA 4YM6C 3KUYB 5B24D 4CAYA 2F8NG 1U35A 3REHC 3AZHA 2YFWA 5DNNB 5GT0D 2CV5C 4JJND 3B0CW 4UUZB 2ZM5A 2XD1A 5CPKA 4HGAC 1BFMA 3W97A 3AV1D 4YS3C 3AV2D 2AROA 3REHB 1P3MD 3WAAB 2CV5B 3MGPA 5FUGB 2HIOA 4EO5C 4XUJD 3MGQB 1P3LC 4HGAB 1AOIC 4R8PD 3W99C 4Z5TC 1PZRA 4YS3B 2F8NA 3VH6T 2JSSA 4KGCD 5GT3C 1P34A 3KUYD 3AZEA 1P3AC 3V9RA 3KFUG 4EO5B 3X1TD 2G5HC 1P3LB 3UTAA 3AFAA 1P3KC 1AOIB 3W99B 4Z5TB 1U35C 3NQUB 3B6FA 4YM6D 4G92C 3MGRD 1P3AB 3R45B 5JRGA 1HQ3A 3AZGA 1ID3A 5B31G 3REHD 2Y2NA 1WWIA 5CPKC 1P3KB 4CAYB 4H9NA 3W97C 5AV6D 2AROC 5AY8D 2YFWB 4G92B 1B67A 3MGPC 1M18D 3X1SA 2HIOC 1ZLAD 2Y2KA 2LY8A 5AV9A 5CPKB 2VQRA 5B33A 1BH8A 2AROB 3MVDA 3AZLA 1P34C 3WA9A 4J8UA 3MGPB 3AZEC 1AOID 1KU5A 2HIOB 5B32C 5GT3D 3AZKD 3NQJB 5B31A 5GXQD 3UTAC 1P3PA 3AFAC 1P3AD 2NZDA 1ULYA 2F8NB 3KWQD 5BNXA 3B6FC 3AZEB 5JRGC 1HQ3C 3AZGC 1U35D 1ID3C 2FJ7A 5B32B 5BT1C 3AZHD 2FFFB 1M19A 4NE6A 3B6FB 5JRGB 1HQ3B 5AV8C 3AZGB 3AV1A 1ID3B 3X1SC 3AV2A 3W97D 2AROD 3VH5T 5AV9C 5B33C 4H9NB 1P3BA 1F66B 2HIOD 4XUJA 5E5AA 3MVDC 3AZLC 5B0YC 3WA9C 5BNVA 4J8UC 5AV8B 5BS7A 4KGCA 5GSUA 4WU8A 1P34D 2Y2PA 3A1KA 5AV9B 5B31C 1P3PC 5B1LA 5B33B 5B2JA 3AZED 1BH8B 5AVCC 3MNNC 4DRBA 3MVDB 3AZLB 5B0YB 3WA9B 4J8UB 3UTAD 3AFAD 5B0ZD 2FJ7C 3C1CA 2ZY5A 3REKD 5B31B 1P3PB 1M19C 3AZGD 3LZ1A 4H9OA 5G49A 5AVCB 4DRAA 3MNNB 1ID3D 5BNXB 3IP4C 3AV1C 5AV6A 3AV2C 5AY8A 2Y2HA 2FJ7B 1M18A 1W2EA 3X1SD 1KX5A 1P3BC 4J8VA 5E5AC 4XUJC 5AV9D 3AZIA 4NFTA 5BS7C 3AV1B 3AV2B 4KGCC 5GSUC 4WU8C 1KX3A 5AV5A 5B2JC 4XUJB 3AZKA 3X1TC 5GXQA 3WKJD 3B0DB 3EPLA 2NZDD 3VH6W 5B1MD 3KWQA 4KGCB 5GSUB 3C1CC 5CPJA 3W96A 3MGRC 2Y2JA 3B0BA 3O62A 3F6TA 3LZ1C 5KDMA 3X1TB 2FJ7D 4CSRB 1M19D 4AWLC 2Y2GA 5AV6C 5AY8C 4YM6B 3MGRB 3WTPD 1M18C 3LZ1B 4H9OB 2BYKA 1P3FA 1KX5C 4J8VC 1ZLAC 3AZIC 2CWEA 5JA4A 4H9RA 3X1VA 1Z2CB 5AV6B 1P3BD 5E5AD 4NE3A 5AY8B 3AZND 4KHAA 1KX3C 5AV5C 1A7WA 3A6NA 1M18B 1KX5B 4J8VB 3X1UA 3AZKC 4ZBJC 5GSUD 4WU8D 1ZLAB 5GXQC 3AZIB 5B1LD 5B2JD 2ZY3A 3KWQC 3MGSA 1KX3B 5AV5B 5C3IC 3O62C 5B0ZA 4X23A 3REKA 4ZBJB 5GT3B 3C1CD 3AZHC 3AZKB 5GXQB 1TZYA 5AVBA 3LZ1D 4KUDA 3KWQB 5CP6A 2YFVB 1H3OA 4NE5A 4WV4B 5C3IB 3O62B 1U35B 4WNNA 3AZHB 3VH6A 3W98D 3AYWA 2UWXA 3X1VC 1KX5D 4Z2MG 4J8VD 1N1JA 3AZID 3A6NC 3W97B 2BG1A 3VH5W 2BYKB 2RIQA 4QLCA 4Z66A 3LJAA 4H9PA 2DF4C 1KX3D 5AV5D 1P3GA 5JA4B 4H9RB 3X1VB 3EG5B 3KXBA 1JFIA 4KHAB 3WKJA 4WU9A 3A6NB 5BO0A 5B1MA 5B0ZC 4X23C 3REKC 3AN2A 1P34B 5CPJD 3B6GA 3W96D 1TZYC 5AVBC 3V9RB 3O62D 4KUDC 1TAFA 3C1BA 2F8NH 2XD5A 5CP6C 4J8XA 2L5AA 3UTAB 3AFAB 5CHLB 5B0ZB 3REKB 3AZJD 3WTPA 1TZYB 5AVBB 4KUDB 1BH9A 3AYWC 1P3FD 4WZSB 1R4VA 5CP6B 4E45A 2IO5C 3X1VD 4WNNB 4QLCC 4Z66C 3LJAC 3AZNA 5B40D 3A6ND 3X1SB 3AYWB 3X1UD 1N1JB 3KXBC 3WKJC 4WU9C 2IO5B 4ZUXA 2NZDC 5B1MC 4QLCB 3LJAB 5DNMA 3AN2C 4H9PB 3B6GC 3MGSD 3H0LC 4X23D 3C1BC 3KXBB 3VH5A 4J8XC 3LELA 1JFIB 4WU9B 3WKJB 2NZDB 1TZYD 5BO0B 5AVBD 5B1MB 4J8WA 4KUDD 5CP6D 3B6GB 3WTPC 3AZMA 4XZQA 1P3OA 1F1EA 1TAFB 3W98A 4J8XB 2PYOD 3WTPE 1M19B 3AYWD 3AZNC 3WTPB 5DNNA 1S32D 4QLCD 4Z66D 3LJAD 4WJ3C 3LZ0A 1P3GD 5B1LC 3UT9A 3H0RC 4ZUXC 1P3BB 5E5AB 3REJD 3AZNB 5DNMC 3KXBD 5BNVB 3WAAA 4WU9D 4WU8B 3AN2D 1Q9CA 3B6GD 3MGQA 5B1LB 5F99A 5B2JB 4ZUXB 5DNMB 3C1BD 4J8XD 3UTBA 3AZMC 4XZQC 1P3OC 3C1CB 3W98C 2Y2MA 3AZJA 5G49B 5DNNC 4AWLB 1M1AA 1P3OB 4LD9D 3W98B 5B40A 3LZ0C 3UT9C 1P3KA 3REID 4G91C 3WAAC 4ZUXD 5B32G 5DNMD 5CPJC 3W96C 5B2IA 3LZ0B 3MGQC 5F99C 3UT9B 1P3IA 2DQNC 4G91B 2NQBD 5CPIA 3LELD 3UTBC 3P5JB 4J8WD 4UPKA 5CPJB 1KX4D 3H0MC 4H9QA 3AZJC 3W96B 3NQJA 5F99B 3AZMD 4XZQD 5KDMB 1P3OD 1P3FC 2J8PA 2PYOA 2Y2LA 3UTBB 1M1AC 3RELA 5B40C 5B32A 3AZJB 5DNND 1S32A 2Y2QA 1P3FB 3B0CT 3X1UC 3TU4A 2HUEC 3LZ0D 2ZY4A 3UT9D 1M1AB 3REJA 5B40B 3FDDA 3MGSC 2RVQC 3WAAD 5B2IC 2CV5D 1P3IC 3X1UB 1F66A 2HUEB 5CPIC 3EPKA 3MGQD 5F99D 5AV8A 4YS3D 3MGSB 2F8NK 5B2IB 3UTBD 1P3IB 1EQZA 4X23B 3AZFA 2PYOC 5CPIB 5B0YA 1P3LD 3RELC 3W99D 4Z5TD 1H3OB 4H9QB 1HTAA 1S32C 1M1AD 4LD9A 1T3UA 5AVCA 1WWSA 3MNNA 2PYOB 2BYMA 3TU4C 3AL0C 1P3GC 4E44A 5B24A 3REIA 1P3KD 3RELB 4H9SA 3REJC 2F2AC 5GT0A 4JJNA 1S32B 4Z66B 1F66C 3TU4B 2RVQD 1P3GB 5B2ID 1P3ID 5CPKD 3REJB 2NQBA 1B6WA 2JCHA 1P3MA 5CPID 1EQZC 3MGPD 2JE5A 3KSYA 3AZFC 3AN2B 1KX4A 4R8PA 3C1BB 2F8ND 1EQZB 3KUYA 3AZFB 4LD9C 3RELD 4M6BA 3X1TA
chains in the Genus database with same CATH topology
5B32D 4Z2MH 5B24C 4UUZA 4CSRA 1BH9B 3REIC 2Y2IA 4H9SC 2G5IC 3TU4D 4YM6A 5GT0C 3B6FD 3MGRA 4JJNC 4LD9B 5JRGD 1HQ3D 3REHA 2BYMB 5BT1D 2W8SA 2CV5A 5B24B 3REIB 2NQBC 5FUGA 1F66D 1P3MC 3LELC 3EPHA 5GT0B 4JJNB 5AV8D 4J8WC 3EPJA 4YS3A 1KX4C 1ZLAA 2Y2OA 1EQZD 3B0DC 5B33D 4R8PC 3AZFD 2NQBB 1P3MB 3LELB 3MVDD 3AZLD 5B0YD 1P3LA 3WA9D 3KUYC 4J8UD 1AOIA 4J8WB 3W99A 4Z5TA 1KX4B 4DQYB 3NQUA 5GT3A 5B31D 3AZMB 1P3PD 4XZQB 3R45A 3A1IA 4R8PB 1P3AA 5AVCD 3MNND 2ZY2A 2YFVA 4YM6C 3KUYB 5B24D 4CAYA 2F8NG 1U35A 3REHC 3AZHA 2YFWA 5DNNB 5GT0D 2CV5C 4JJND 3B0CW 4UUZB 2ZM5A 2XD1A 5CPKA 4HGAC 1BFMA 3W97A 3AV1D 4YS3C 3AV2D 2AROA 3REHB 1P3MD 3WAAB 2CV5B 3MGPA 5FUGB 2HIOA 4EO5C 4XUJD 3MGQB 1P3LC 4HGAB 1AOIC 4R8PD 3W99C 4Z5TC 1PZRA 4YS3B 2F8NA 3VH6T 2JSSA 4KGCD 5GT3C 1P34A 3KUYD 3AZEA 1P3AC 3V9RA 3KFUG 4EO5B 3X1TD 2G5HC 1P3LB 3UTAA 3AFAA 1P3KC 1AOIB 3W99B 4Z5TB 1U35C 3NQUB 3B6FA 4YM6D 4G92C 3MGRD 1P3AB 3R45B 5JRGA 1HQ3A 3AZGA 1ID3A 5B31G 3REHD 2Y2NA 1WWIA 5CPKC 1P3KB 4CAYB 4H9NA 3W97C 5AV6D 2AROC 5AY8D 2YFWB 4G92B 1B67A 3MGPC 1M18D 3X1SA 2HIOC 1ZLAD 2Y2KA 2LY8A 5AV9A 5CPKB 2VQRA 5B33A 1BH8A 2AROB 3MVDA 3AZLA 1P34C 3WA9A 4J8UA 3MGPB 3AZEC 1AOID 1KU5A 2HIOB 5B32C 5GT3D 3AZKD 3NQJB 5B31A 5GXQD 3UTAC 1P3PA 3AFAC 1P3AD 2NZDA 1ULYA 2F8NB 3KWQD 5BNXA 3B6FC 3AZEB 5JRGC 1HQ3C 3AZGC 1U35D 1ID3C 2FJ7A 5B32B 5BT1C 3AZHD 2FFFB 1M19A 4NE6A 3B6FB 5JRGB 1HQ3B 5AV8C 3AZGB 3AV1A 1ID3B 3X1SC 3AV2A 3W97D 2AROD 3VH5T 5AV9C 5B33C 4H9NB 1P3BA 1F66B 2HIOD 4XUJA 5E5AA 3MVDC 3AZLC 5B0YC 3WA9C 5BNVA 4J8UC 5AV8B 5BS7A 4KGCA 5GSUA 4WU8A 1P34D 2Y2PA 3A1KA 5AV9B 5B31C 1P3PC 5B1LA 5B33B 5B2JA 3AZED 1BH8B 5AVCC 3MNNC 4DRBA 3MVDB 3AZLB 5B0YB 3WA9B 4J8UB 3UTAD 3AFAD 5B0ZD 2FJ7C 3C1CA 2ZY5A 3REKD 5B31B 1P3PB 1M19C 3AZGD 3LZ1A 4H9OA 5G49A 5AVCB 4DRAA 3MNNB 1ID3D 5BNXB 3IP4C 3AV1C 5AV6A 3AV2C 5AY8A 2Y2HA 2FJ7B 1M18A 1W2EA 3X1SD 1KX5A 1P3BC 4J8VA 5E5AC 4XUJC 5AV9D 3AZIA 4NFTA 5BS7C 3AV1B 3AV2B 4KGCC 5GSUC 4WU8C 1KX3A 5AV5A 5B2JC 4XUJB 3AZKA 3X1TC 5GXQA 3WKJD 3B0DB 3EPLA 2NZDD 3VH6W 5B1MD 3KWQA 4KGCB 5GSUB 3C1CC 5CPJA 3W96A 3MGRC 2Y2JA 3B0BA 3O62A 3F6TA 3LZ1C 5KDMA 3X1TB 2FJ7D 4CSRB 1M19D 4AWLC 2Y2GA 5AV6C 5AY8C 4YM6B 3MGRB 3WTPD 1M18C 3LZ1B 4H9OB 2BYKA 1P3FA 1KX5C 4J8VC 1ZLAC 3AZIC 2CWEA 5JA4A 4H9RA 3X1VA 1Z2CB 5AV6B 1P3BD 5E5AD 4NE3A 5AY8B 3AZND 4KHAA 1KX3C 5AV5C 1A7WA 3A6NA 1M18B 1KX5B 4J8VB 3X1UA 3AZKC 4ZBJC 5GSUD 4WU8D 1ZLAB 5GXQC 3AZIB 5B1LD 5B2JD 2ZY3A 3KWQC 3MGSA 1KX3B 5AV5B 5C3IC 3O62C 5B0ZA 4X23A 3REKA 4ZBJB 5GT3B 3C1CD 3AZHC 3AZKB 5GXQB 1TZYA 5AVBA 3LZ1D 4KUDA 3KWQB 5CP6A 2YFVB 1H3OA 4NE5A 4WV4B 5C3IB 3O62B 1U35B 4WNNA 3AZHB 3VH6A 3W98D 3AYWA 2UWXA 3X1VC 1KX5D 4Z2MG 4J8VD 1N1JA 3AZID 3A6NC 3W97B 2BG1A 3VH5W 2BYKB 2RIQA 4QLCA 4Z66A 3LJAA 4H9PA 2DF4C 1KX3D 5AV5D 1P3GA 5JA4B 4H9RB 3X1VB 3EG5B 3KXBA 1JFIA 4KHAB 3WKJA 4WU9A 3A6NB 5BO0A 5B1MA 5B0ZC 4X23C 3REKC 3AN2A 1P34B 5CPJD 3B6GA 3W96D 1TZYC 5AVBC 3V9RB 3O62D 4KUDC 1TAFA 3C1BA 2F8NH 2XD5A 5CP6C 4J8XA 2L5AA 3UTAB 3AFAB 5CHLB 5B0ZB 3REKB 3AZJD 3WTPA 1TZYB 5AVBB 4KUDB 1BH9A 3AYWC 1P3FD 4WZSB 1R4VA 5CP6B 4E45A 2IO5C 3X1VD 4WNNB 4QLCC 4Z66C 3LJAC 3AZNA 5B40D 3A6ND 3X1SB 3AYWB 3X1UD 1N1JB 3KXBC 3WKJC 4WU9C 2IO5B 4ZUXA 2NZDC 5B1MC 4QLCB 3LJAB 5DNMA 3AN2C 4H9PB 3B6GC 3MGSD 3H0LC 4X23D 3C1BC 3KXBB 3VH5A 4J8XC 3LELA 1JFIB 4WU9B 3WKJB 2NZDB 1TZYD 5BO0B 5AVBD 5B1MB 4J8WA 4KUDD 5CP6D 3B6GB 3WTPC 3AZMA 4XZQA 1P3OA 1F1EA 1TAFB 3W98A 4J8XB 2PYOD 3WTPE 1M19B 3AYWD 3AZNC 3WTPB 5DNNA 1S32D 4QLCD 4Z66D 3LJAD 4WJ3C 3LZ0A 1P3GD 5B1LC 3UT9A 3H0RC 4ZUXC 1P3BB 5E5AB 3REJD 3AZNB 5DNMC 3KXBD 5BNVB 3WAAA 4WU9D 4WU8B 3AN2D 1Q9CA 3B6GD 3MGQA 5B1LB 5F99A 5B2JB 4ZUXB 5DNMB 3C1BD 4J8XD 3UTBA 3AZMC 4XZQC 1P3OC 3C1CB 3W98C 2Y2MA 3AZJA 5G49B 5DNNC 4AWLB 1M1AA 1P3OB 4LD9D 3W98B 5B40A 3LZ0C 3UT9C 1P3KA 3REID 4G91C 3WAAC 4ZUXD 5B32G 5DNMD 5CPJC 3W96C 5B2IA 3LZ0B 3MGQC 5F99C 3UT9B 1P3IA 2DQNC 4G91B 2NQBD 5CPIA 3LELD 3UTBC 3P5JB 4J8WD 4UPKA 5CPJB 1KX4D 3H0MC 4H9QA 3AZJC 3W96B 3NQJA 5F99B 3AZMD 4XZQD 5KDMB 1P3OD 1P3FC 2J8PA 2PYOA 2Y2LA 3UTBB 1M1AC 3RELA 5B40C 5B32A 3AZJB 5DNND 1S32A 2Y2QA 1P3FB 3B0CT 3X1UC 3TU4A 2HUEC 3LZ0D 2ZY4A 3UT9D 1M1AB 3REJA 5B40B 3FDDA 3MGSC 2RVQC 3WAAD 5B2IC 2CV5D 1P3IC 3X1UB 1F66A 2HUEB 5CPIC 3EPKA 3MGQD 5F99D 5AV8A 4YS3D 3MGSB 2F8NK 5B2IB 3UTBD 1P3IB 1EQZA 4X23B 3AZFA 2PYOC 5CPIB 5B0YA 1P3LD 3RELC 3W99D 4Z5TD 1H3OB 4H9QB 1HTAA 1S32C 1M1AD 4LD9A 1T3UA 5AVCA 1WWSA 3MNNA 2PYOB 2BYMA 3TU4C 3AL0C 1P3GC 4E44A 5B24A 3REIA 1P3KD 3RELB 4H9SA 3REJC 2F2AC 5GT0A 4JJNA 1S32B 4Z66B 1F66C 3TU4B 2RVQD 1P3GB 5B2ID 1P3ID 5CPKD 3REJB 2NQBA 1B6WA 2JCHA 1P3MA 5CPID 1EQZC 3MGPD 2JE5A 3KSYA 3AZFC 3AN2B 1KX4A 4R8PA 3C1BB 2F8ND 1EQZB 3KUYA 3AZFB 4LD9C 3RELD 4M6BA 3X1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B32 D;  4Z2M H;  5B24 C;  4UUZ A;  4CSR A;  1BH9 B;  3REI C;  4H9S C;  3TU4 D;  4YM6 A;  5GT0 C;  3B6F D;  3MGR A;  4JJN C;  4LD9 B;  5JRG D;  1HQ3 D;  3REH A;  2BYM B;  5BT1 D;  2CV5 A;  5B24 B;  3REI B;  2NQB C;  5FUG A;  1F66 D;  1P3M C;  3LEL C;  5GT0 B;  4JJN B;  5AV8 D;  4J8W C;  4YS3 A;  1KX4 C;  1ZLA A;  1EQZ D;  3B0D C;  5B33 D;  4R8P C;  3AZF D;  2NQB B;  1P3M B;  3LEL B;  3MVD D;  3AZL D;  5B0Y D;  1P3L A;  3WA9 D;  3KUY C;  4J8U D;  1AOI A;  4J8W B;  3W99 A;  4Z5T A;  1KX4 B;  3NQU A;  5GT3 A;  5B31 D;  3AZM B;  1P3P D;  4XZQ B;  3R45 A;  4R8P B;  1P3A A;  5AVC D;  3MNN D;  2YFV A;  4YM6 C;  3KUY B;  5B24 D;  4CAY A;  2F8N G;  1U35 A;  3REH C;  3AZH A;  2YFW A;  5DNN B;  5GT0 D;  2CV5 C;  4JJN D;  3B0C W;  4UUZ B;  5CPK A;  4HGA C;  1BFM A;  3W97 A;  3AV1 D;  4YS3 C;  3AV2 D;  2ARO A;  3REH B;  1P3M D;  3WAA B;  2CV5 B;  3MGP A;  5FUG B;  2HIO A;  4EO5 C;  4XUJ D;  3MGQ B;  1P3L C;  4HGA B;  1AOI C;  4R8P D;  3W99 C;  4Z5T C;  4YS3 B;  2F8N A;  3VH6 T;  2JSS A;  4KGC D;  5GT3 C;  1P34 A;  3KUY D;  3AZE A;  1P3A C;  3V9R A;  4EO5 B;  3X1T D;  1P3L B;  3UTA A;  3AFA A;  1P3K C;  1AOI B;  3W99 B;  4Z5T B;  1U35 C;  3NQU B;  3B6F A;  4YM6 D;  4G92 C;  3MGR D;  1P3A B;  3R45 B;  5JRG A;  1HQ3 A;  3AZG A;  1ID3 A;  5B31 G;  3REH D;  1WWI A;  5CPK C;  1P3K B;  4CAY B;  4H9N A;  3W97 C;  5AV6 D;  2ARO C;  5AY8 D;  2YFW B;  4G92 B;  1B67 A;  3MGP C;  1M18 D;  3X1S A;  2HIO C;  1ZLA D;  5AV9 A;  2LY8 A;  5CPK B;  5B33 A;  1BH8 A;  2ARO B;  3MVD A;  3AZL A;  1P34 C;  3WA9 A;  4J8U A;  3MGP B;  3AZE C;  1AOI D;  1KU5 A;  2HIO B;  5B32 C;  5GT3 D;  3AZK D;  3NQJ B;  5B31 A;  5GXQ D;  3UTA C;  1P3P A;  3AFA C;  1P3A D;  2NZD A;  1ULY A;  2F8N B;  3KWQ D;  5BNX A;  3B6F C;  3AZE B;  5JRG C;  1HQ3 C;  3AZG C;  1U35 D;  1ID3 C;  2FJ7 A;  5B32 B;  5BT1 C;  3AZH D;  1M19 A;  4NE6 A;  3B6F B;  5JRG B;  1HQ3 B;  5AV8 C;  3AZG B;  3AV1 A;  1ID3 B;  3X1S C;  3AV2 A;  3W97 D;  2ARO D;  3VH5 T;  5AV9 C;  5B33 C;  4H9N B;  1P3B A;  1F66 B;  2HIO D;  4XUJ A;  5E5A A;  3MVD C;  3AZL C;  5B0Y C;  3WA9 C;  5BNV A;  4J8U C;  5AV8 B;  5BS7 A;  4KGC A;  5GSU A;  4WU8 A;  1P34 D;  5AV9 B;  5B31 C;  1P3P C;  5B1L A;  5B33 B;  5B2J A;  3AZE D;  1BH8 B;  5AVC C;  3MNN C;  4DRB A;  3MVD B;  3AZL B;  5B0Y B;  3WA9 B;  4J8U B;  3UTA D;  3AFA D;  5B0Z D;  2FJ7 C;  3C1C A;  3REK D;  5B31 B;  1P3P B;  1M19 C;  3AZG D;  3LZ1 A;  4H9O A;  5G49 A;  5AVC B;  4DRA A;  3MNN B;  1ID3 D;  5BNX B;  3AV1 C;  5AV6 A;  3AV2 C;  5AY8 A;  2FJ7 B;  1M18 A;  3X1S D;  1KX5 A;  1P3B C;  4J8V A;  5E5A C;  4XUJ C;  5AV9 D;  3AZI A;  4NFT A;  5BS7 C;  3AV1 B;  3AV2 B;  4KGC C;  5GSU C;  4WU8 C;  1KX3 A;  5AV5 A;  5B2J C;  4XUJ B;  3AZK A;  3X1T C;  5GXQ A;  3WKJ D;  3B0D B;  2NZD D;  3VH6 W;  5B1M D;  3KWQ A;  4KGC B;  5GSU B;  3C1C C;  5CPJ A;  3W96 A;  3MGR C;  3B0B A;  3O62 A;  3LZ1 C;  5KDM A;  3X1T B;  2FJ7 D;  4CSR B;  1M19 D;  4AWL C;  5AV6 C;  5AY8 C;  4YM6 B;  3MGR B;  3WTP D;  1M18 C;  3LZ1 B;  4H9O B;  2BYK A;  1P3F A;  1KX5 C;  4J8V C;  1ZLA C;  3AZI C;  2CWE A;  5JA4 A;  4H9R A;  3X1V A;  5AV6 B;  1P3B D;  5E5A D;  4NE3 A;  5AY8 B;  3AZN D;  4KHA A;  1KX3 C;  5AV5 C;  1A7W A;  3A6N A;  1M18 B;  1KX5 B;  4J8V B;  3X1U A;  3AZK C;  4ZBJ C;  5GSU D;  4WU8 D;  1ZLA B;  5GXQ C;  3AZI B;  5B1L D;  5B2J D;  3KWQ C;  3MGS A;  1KX3 B;  5AV5 B;  5C3I C;  3O62 C;  5B0Z A;  4X23 A;  3REK A;  4ZBJ B;  5GT3 B;  3C1C D;  3AZH C;  3AZK B;  5GXQ B;  1TZY A;  5AVB A;  3LZ1 D;  4KUD A;  3KWQ B;  5CP6 A;  2YFV B;  1H3O A;  4NE5 A;  4WV4 B;  5C3I B;  3O62 B;  1U35 B;  4WNN A;  3AZH B;  3VH6 A;  3W98 D;  3AYW A;  3X1V C;  1KX5 D;  4Z2M G;  4J8V D;  1N1J A;  3AZI D;  3A6N C;  3W97 B;  3VH5 W;  2BYK B;  4QLC A;  4Z66 A;  3LJA A;  4H9P A;  1KX3 D;  5AV5 D;  1P3G A;  5JA4 B;  4H9R B;  3X1V B;  3KXB A;  1JFI A;  4KHA B;  3WKJ A;  4WU9 A;  3A6N B;  5BO0 A;  5B1M A;  5B0Z C;  4X23 C;  3REK C;  3AN2 A;  1P34 B;  5CPJ D;  3B6G A;  3W96 D;  1TZY C;  5AVB C;  3V9R B;  3O62 D;  4KUD C;  1TAF A;  3C1B A;  2F8N H;  5CP6 C;  4J8X A;  3UTA B;  2L5A A;  3AFA B;  5CHL B;  5B0Z B;  3REK B;  3AZJ D;  3WTP A;  1TZY B;  5AVB B;  4KUD B;  1BH9 A;  3AYW C;  1P3F D;  4WZS B;  1R4V A;  5CP6 B;  4E45 A;  2IO5 C;  3X1V D;  4WNN B;  4QLC C;  4Z66 C;  3LJA C;  3AZN A;  5B40 D;  3A6N D;  3X1S B;  3AYW B;  3X1U D;  1N1J B;  3KXB C;  3WKJ C;  4WU9 C;  2IO5 B;  4ZUX A;  2NZD C;  5B1M C;  4QLC B;  3LJA B;  5DNM A;  3AN2 C;  4H9P B;  3B6G C;  3MGS D;  4X23 D;  3C1B C;  3KXB B;  3VH5 A;  4J8X C;  3LEL A;  1JFI B;  4WU9 B;  3WKJ B;  2NZD B;  1TZY D;  5BO0 B;  5AVB D;  5B1M B;  4J8W A;  4KUD D;  5CP6 D;  3B6G B;  3WTP C;  3AZM A;  4XZQ A;  1P3O A;  1F1E A;  1TAF B;  3W98 A;  4J8X B;  2PYO D;  3WTP E;  1M19 B;  3AYW D;  3AZN C;  3WTP B;  5DNN A;  1S32 D;  4QLC D;  4Z66 D;  3LJA D;  3LZ0 A;  1P3G D;  5B1L C;  3UT9 A;  4ZUX C;  1P3B B;  5E5A B;  3REJ D;  3AZN B;  5DNM C;  3KXB D;  5BNV B;  3WAA A;  4WU9 D;  4WU8 B;  3AN2 D;  1Q9C A;  3B6G D;  3MGQ A;  5B1L B;  5F99 A;  5B2J B;  4ZUX B;  5DNM B;  3C1B D;  4J8X D;  3UTB A;  3AZM C;  4XZQ C;  1P3O C;  3C1C B;  3W98 C;  3AZJ A;  5G49 B;  5DNN C;  4AWL B;  1M1A A;  1P3O B;  4LD9 D;  3W98 B;  5B40 A;  3LZ0 C;  3UT9 C;  1P3K A;  3REI D;  4G91 C;  3WAA C;  4ZUX D;  5B32 G;  5DNM D;  5CPJ C;  3W96 C;  5B2I A;  3LZ0 B;  3MGQ C;  5F99 C;  3UT9 B;  1P3I A;  4G91 B;  2NQB D;  5CPI A;  3LEL D;  3UTB C;  4J8W D;  5CPJ B;  1KX4 D;  4H9Q A;  3AZJ C;  3W96 B;  3NQJ A;  5F99 B;  3AZM D;  4XZQ D;  5KDM B;  1P3O D;  1P3F C;  2PYO A;  3UTB B;  1M1A C;  3REL A;  5B40 C;  5B32 A;  3AZJ B;  5DNN D;  1S32 A;  1P3F B;  3B0C T;  3X1U C;  3TU4 A;  2HUE C;  3LZ0 D;  3UT9 D;  1M1A B;  3REJ A;  5B40 B;  3MGS C;  2RVQ C;  3WAA D;  5B2I C;  2CV5 D;  1P3I C;  3X1U B;  1F66 A;  2HUE B;  5CPI C;  3MGQ D;  5F99 D;  5AV8 A;  4YS3 D;  3MGS B;  2F8N K;  5B2I B;  3UTB D;  1P3I B;  1EQZ A;  4X23 B;  3AZF A;  2PYO C;  5CPI B;  5B0Y A;  1P3L D;  3REL C;  3W99 D;  4Z5T D;  1H3O B;  4H9Q B;  1HTA A;  1S32 C;  1M1A D;  4LD9 A;  5AVC A;  1WWS A;  3MNN A;  2PYO B;  2BYM A;  3TU4 C;  1P3G C;  4E44 A;  5B24 A;  3REI A;  1P3K D;  3REL B;  4H9S A;  3REJ C;  5GT0 A;  4JJN A;  1S32 B;  4Z66 B;  1F66 C;  3TU4 B;  2RVQ D;  1P3G B;  5B2I D;  1P3I D;  5CPK D;  3REJ B;  2NQB A;  1B6W A;  1P3M A;  5CPI D;  1EQZ C;  3MGP D;  3KSY A;  3AZF C;  3AN2 B;  1KX4 A;  4R8P A;  3C1B B;  2F8N D;  1EQZ B;  3KUY A;  3AZF B;  4LD9 C;  3REL D;  4M6B A;  3X1T A; 
#chains in the Genus database with same CATH topology
 5B32 D;  4Z2M H;  5B24 C;  4UUZ A;  4CSR A;  1BH9 B;  3REI C;  2Y2I A;  4H9S C;  2G5I C;  3TU4 D;  4YM6 A;  5GT0 C;  3B6F D;  3MGR A;  4JJN C;  4LD9 B;  5JRG D;  1HQ3 D;  3REH A;  2BYM B;  5BT1 D;  2W8S A;  2CV5 A;  5B24 B;  3REI B;  2NQB C;  5FUG A;  1F66 D;  1P3M C;  3LEL C;  3EPH A;  5GT0 B;  4JJN B;  5AV8 D;  4J8W C;  3EPJ A;  4YS3 A;  1KX4 C;  1ZLA A;  2Y2O A;  1EQZ D;  3B0D C;  5B33 D;  4R8P C;  3AZF D;  2NQB B;  1P3M B;  3LEL B;  3MVD D;  3AZL D;  5B0Y D;  1P3L A;  3WA9 D;  3KUY C;  4J8U D;  1AOI A;  4J8W B;  3W99 A;  4Z5T A;  1KX4 B;  4DQY B;  3NQU A;  5GT3 A;  5B31 D;  3AZM B;  1P3P D;  4XZQ B;  3R45 A;  3A1I A;  4R8P B;  1P3A A;  5AVC D;  3MNN D;  2ZY2 A;  2YFV A;  4YM6 C;  3KUY B;  5B24 D;  4CAY A;  2F8N G;  1U35 A;  3REH C;  3AZH A;  2YFW A;  5DNN B;  5GT0 D;  2CV5 C;  4JJN D;  3B0C W;  4UUZ B;  2ZM5 A;  2XD1 A;  5CPK A;  4HGA C;  1BFM A;  3W97 A;  3AV1 D;  4YS3 C;  3AV2 D;  2ARO A;  3REH B;  1P3M D;  3WAA B;  2CV5 B;  3MGP A;  5FUG B;  2HIO A;  4EO5 C;  4XUJ D;  3MGQ B;  1P3L C;  4HGA B;  1AOI C;  4R8P D;  3W99 C;  4Z5T C;  1PZR A;  4YS3 B;  2F8N A;  3VH6 T;  2JSS A;  4KGC D;  5GT3 C;  1P34 A;  3KUY D;  3AZE A;  1P3A C;  3V9R A;  3KFU G;  4EO5 B;  3X1T D;  2G5H C;  1P3L B;  3UTA A;  3AFA A;  1P3K C;  1AOI B;  3W99 B;  4Z5T B;  1U35 C;  3NQU B;  3B6F A;  4YM6 D;  4G92 C;  3MGR D;  1P3A B;  3R45 B;  5JRG A;  1HQ3 A;  3AZG A;  1ID3 A;  5B31 G;  3REH D;  2Y2N A;  1WWI A;  5CPK C;  1P3K B;  4CAY B;  4H9N A;  3W97 C;  5AV6 D;  2ARO C;  5AY8 D;  2YFW B;  4G92 B;  1B67 A;  3MGP C;  1M18 D;  3X1S A;  2HIO C;  1ZLA D;  2Y2K A;  2LY8 A;  5AV9 A;  5CPK B;  2VQR A;  5B33 A;  1BH8 A;  2ARO B;  3MVD A;  3AZL A;  1P34 C;  3WA9 A;  4J8U A;  3MGP B;  3AZE C;  1AOI D;  1KU5 A;  2HIO B;  5B32 C;  5GT3 D;  3AZK D;  3NQJ B;  5B31 A;  5GXQ D;  3UTA C;  1P3P A;  3AFA C;  1P3A D;  2NZD A;  1ULY A;  2F8N B;  3KWQ D;  5BNX A;  3B6F C;  3AZE B;  5JRG C;  1HQ3 C;  3AZG C;  1U35 D;  1ID3 C;  2FJ7 A;  5B32 B;  5BT1 C;  3AZH D;  2FFF B;  1M19 A;  4NE6 A;  3B6F B;  5JRG B;  1HQ3 B;  5AV8 C;  3AZG B;  3AV1 A;  1ID3 B;  3X1S C;  3AV2 A;  3W97 D;  2ARO D;  3VH5 T;  5AV9 C;  5B33 C;  4H9N B;  1P3B A;  1F66 B;  2HIO D;  4XUJ A;  5E5A A;  3MVD C;  3AZL C;  5B0Y C;  3WA9 C;  5BNV A;  4J8U C;  5AV8 B;  5BS7 A;  4KGC A;  5GSU A;  4WU8 A;  1P34 D;  2Y2P A;  3A1K A;  5AV9 B;  5B31 C;  1P3P C;  5B1L A;  5B33 B;  5B2J A;  3AZE D;  1BH8 B;  5AVC C;  3MNN C;  4DRB A;  3MVD B;  3AZL B;  5B0Y B;  3WA9 B;  4J8U B;  3UTA D;  3AFA D;  5B0Z D;  2FJ7 C;  3C1C A;  2ZY5 A;  3REK D;  5B31 B;  1P3P B;  1M19 C;  3AZG D;  3LZ1 A;  4H9O A;  5G49 A;  5AVC B;  4DRA A;  3MNN B;  1ID3 D;  5BNX B;  3IP4 C;  3AV1 C;  5AV6 A;  3AV2 C;  5AY8 A;  2Y2H A;  2FJ7 B;  1M18 A;  1W2E A;  3X1S D;  1KX5 A;  1P3B C;  4J8V A;  5E5A C;  4XUJ C;  5AV9 D;  3AZI A;  4NFT A;  5BS7 C;  3AV1 B;  3AV2 B;  4KGC C;  5GSU C;  4WU8 C;  1KX3 A;  5AV5 A;  5B2J C;  4XUJ B;  3AZK A;  3X1T C;  5GXQ A;  3WKJ D;  3B0D B;  3EPL A;  2NZD D;  3VH6 W;  5B1M D;  3KWQ A;  4KGC B;  5GSU B;  3C1C C;  5CPJ A;  3W96 A;  3MGR C;  2Y2J A;  3B0B A;  3O62 A;  3F6T A;  3LZ1 C;  5KDM A;  3X1T B;  2FJ7 D;  4CSR B;  1M19 D;  4AWL C;  2Y2G A;  5AV6 C;  5AY8 C;  4YM6 B;  3MGR B;  3WTP D;  1M18 C;  3LZ1 B;  4H9O B;  2BYK A;  1P3F A;  1KX5 C;  4J8V C;  1ZLA C;  3AZI C;  2CWE A;  5JA4 A;  4H9R A;  3X1V A;  1Z2C B;  5AV6 B;  1P3B D;  5E5A D;  4NE3 A;  5AY8 B;  3AZN D;  4KHA A;  1KX3 C;  5AV5 C;  1A7W A;  3A6N A;  1M18 B;  1KX5 B;  4J8V B;  3X1U A;  3AZK C;  4ZBJ C;  5GSU D;  4WU8 D;  1ZLA B;  5GXQ C;  3AZI B;  5B1L D;  5B2J D;  2ZY3 A;  3KWQ C;  3MGS A;  1KX3 B;  5AV5 B;  5C3I C;  3O62 C;  5B0Z A;  4X23 A;  3REK A;  4ZBJ B;  5GT3 B;  3C1C D;  3AZH C;  3AZK B;  5GXQ B;  1TZY A;  5AVB A;  3LZ1 D;  4KUD A;  3KWQ B;  5CP6 A;  2YFV B;  1H3O A;  4NE5 A;  4WV4 B;  5C3I B;  3O62 B;  1U35 B;  4WNN A;  3AZH B;  3VH6 A;  3W98 D;  3AYW A;  2UWX A;  3X1V C;  1KX5 D;  4Z2M G;  4J8V D;  1N1J A;  3AZI D;  3A6N C;  3W97 B;  2BG1 A;  3VH5 W;  2BYK B;  2RIQ A;  4QLC A;  4Z66 A;  3LJA A;  4H9P A;  2DF4 C;  1KX3 D;  5AV5 D;  1P3G A;  5JA4 B;  4H9R B;  3X1V B;  3EG5 B;  3KXB A;  1JFI A;  4KHA B;  3WKJ A;  4WU9 A;  3A6N B;  5BO0 A;  5B1M A;  5B0Z C;  4X23 C;  3REK C;  3AN2 A;  1P34 B;  5CPJ D;  3B6G A;  3W96 D;  1TZY C;  5AVB C;  3V9R B;  3O62 D;  4KUD C;  1TAF A;  3C1B A;  2F8N H;  2XD5 A;  5CP6 C;  4J8X A;  2L5A A;  3UTA B;  3AFA B;  5CHL B;  5B0Z B;  3REK B;  3AZJ D;  3WTP A;  1TZY B;  5AVB B;  4KUD B;  1BH9 A;  3AYW C;  1P3F D;  4WZS B;  1R4V A;  5CP6 B;  4E45 A;  2IO5 C;  3X1V D;  4WNN B;  4QLC C;  4Z66 C;  3LJA C;  3AZN A;  5B40 D;  3A6N D;  3X1S B;  3AYW B;  3X1U D;  1N1J B;  3KXB C;  3WKJ C;  4WU9 C;  2IO5 B;  4ZUX A;  2NZD C;  5B1M C;  4QLC B;  3LJA B;  5DNM A;  3AN2 C;  4H9P B;  3B6G C;  3MGS D;  3H0L C;  4X23 D;  3C1B C;  3KXB B;  3VH5 A;  4J8X C;  3LEL A;  1JFI B;  4WU9 B;  3WKJ B;  2NZD B;  1TZY D;  5BO0 B;  5AVB D;  5B1M B;  4J8W A;  4KUD D;  5CP6 D;  3B6G B;  3WTP C;  3AZM A;  4XZQ A;  1P3O A;  1F1E A;  1TAF B;  3W98 A;  4J8X B;  2PYO D;  3WTP E;  1M19 B;  3AYW D;  3AZN C;  3WTP B;  5DNN A;  1S32 D;  4QLC D;  4Z66 D;  3LJA D;  4WJ3 C;  3LZ0 A;  1P3G D;  5B1L C;  3UT9 A;  3H0R C;  4ZUX C;  1P3B B;  5E5A B;  3REJ D;  3AZN B;  5DNM C;  3KXB D;  5BNV B;  3WAA A;  4WU9 D;  4WU8 B;  3AN2 D;  1Q9C A;  3B6G D;  3MGQ A;  5B1L B;  5F99 A;  5B2J B;  4ZUX B;  5DNM B;  3C1B D;  4J8X D;  3UTB A;  3AZM C;  4XZQ C;  1P3O C;  3C1C B;  3W98 C;  2Y2M A;  3AZJ A;  5G49 B;  5DNN C;  4AWL B;  1M1A A;  1P3O B;  4LD9 D;  3W98 B;  5B40 A;  3LZ0 C;  3UT9 C;  1P3K A;  3REI D;  4G91 C;  3WAA C;  4ZUX D;  5B32 G;  5DNM D;  5CPJ C;  3W96 C;  5B2I A;  3LZ0 B;  3MGQ C;  5F99 C;  3UT9 B;  1P3I A;  2DQN C;  4G91 B;  2NQB D;  5CPI A;  3LEL D;  3UTB C;  3P5J B;  4J8W D;  4UPK A;  5CPJ B;  1KX4 D;  3H0M C;  4H9Q A;  3AZJ C;  3W96 B;  3NQJ A;  5F99 B;  3AZM D;  4XZQ D;  5KDM B;  1P3O D;  1P3F C;  2J8P A;  2PYO A;  2Y2L A;  3UTB B;  1M1A C;  3REL A;  5B40 C;  5B32 A;  3AZJ B;  5DNN D;  1S32 A;  2Y2Q A;  1P3F B;  3B0C T;  3X1U C;  3TU4 A;  2HUE C;  3LZ0 D;  2ZY4 A;  3UT9 D;  1M1A B;  3REJ A;  5B40 B;  3FDD A;  3MGS C;  2RVQ C;  3WAA D;  5B2I C;  2CV5 D;  1P3I C;  3X1U B;  1F66 A;  2HUE B;  5CPI C;  3EPK A;  3MGQ D;  5F99 D;  5AV8 A;  4YS3 D;  3MGS B;  2F8N K;  5B2I B;  3UTB D;  1P3I B;  1EQZ A;  4X23 B;  3AZF A;  2PYO C;  5CPI B;  5B0Y A;  1P3L D;  3REL C;  3W99 D;  4Z5T D;  1H3O B;  4H9Q B;  1HTA A;  1S32 C;  1M1A D;  4LD9 A;  1T3U A;  5AVC A;  1WWS A;  3MNN A;  2PYO B;  2BYM A;  3TU4 C;  3AL0 C;  1P3G C;  4E44 A;  5B24 A;  3REI A;  1P3K D;  3REL B;  4H9S A;  3REJ C;  2F2A C;  5GT0 A;  4JJN A;  1S32 B;  4Z66 B;  1F66 C;  3TU4 B;  2RVQ D;  1P3G B;  5B2I D;  1P3I D;  5CPK D;  3REJ B;  2NQB A;  1B6W A;  2JCH A;  1P3M A;  5CPI D;  1EQZ C;  3MGP D;  2JE5 A;  3KSY A;  3AZF C;  3AN2 B;  1KX4 A;  4R8P A;  3C1B B;  2F8N D;  1EQZ B;  3KUY A;  3AZF B;  4LD9 C;  3REL D;  4M6B A;  3X1T A; 
#chains in the Genus database with same CATH homology
 5B32 D;  4Z2M H;  5B24 C;  4UUZ A;  4CSR A;  1BH9 B;  3REI C;  2Y2I A;  4H9S C;  2G5I C;  3TU4 D;  4YM6 A;  5GT0 C;  3B6F D;  3MGR A;  4JJN C;  4LD9 B;  5JRG D;  1HQ3 D;  3REH A;  2BYM B;  5BT1 D;  2W8S A;  2CV5 A;  5B24 B;  3REI B;  2NQB C;  5FUG A;  1F66 D;  1P3M C;  3LEL C;  3EPH A;  5GT0 B;  4JJN B;  5AV8 D;  4J8W C;  3EPJ A;  4YS3 A;  1KX4 C;  1ZLA A;  2Y2O A;  1EQZ D;  3B0D C;  5B33 D;  4R8P C;  3AZF D;  2NQB B;  1P3M B;  3LEL B;  3MVD D;  3AZL D;  5B0Y D;  1P3L A;  3WA9 D;  3KUY C;  4J8U D;  1AOI A;  4J8W B;  3W99 A;  4Z5T A;  1KX4 B;  4DQY B;  3NQU A;  5GT3 A;  5B31 D;  3AZM B;  1P3P D;  4XZQ B;  3R45 A;  3A1I A;  4R8P B;  1P3A A;  5AVC D;  3MNN D;  2ZY2 A;  2YFV A;  4YM6 C;  3KUY B;  5B24 D;  4CAY A;  2F8N G;  1U35 A;  3REH C;  3AZH A;  2YFW A;  5DNN B;  5GT0 D;  2CV5 C;  4JJN D;  3B0C W;  4UUZ B;  2ZM5 A;  2XD1 A;  5CPK A;  4HGA C;  1BFM A;  3W97 A;  3AV1 D;  4YS3 C;  3AV2 D;  2ARO A;  3REH B;  1P3M D;  3WAA B;  2CV5 B;  3MGP A;  5FUG B;  2HIO A;  4EO5 C;  4XUJ D;  3MGQ B;  1P3L C;  4HGA B;  1AOI C;  4R8P D;  3W99 C;  4Z5T C;  1PZR A;  4YS3 B;  2F8N A;  3VH6 T;  2JSS A;  4KGC D;  5GT3 C;  1P34 A;  3KUY D;  3AZE A;  1P3A C;  3V9R A;  3KFU G;  4EO5 B;  3X1T D;  2G5H C;  1P3L B;  3UTA A;  3AFA A;  1P3K C;  1AOI B;  3W99 B;  4Z5T B;  1U35 C;  3NQU B;  3B6F A;  4YM6 D;  4G92 C;  3MGR D;  1P3A B;  3R45 B;  5JRG A;  1HQ3 A;  3AZG A;  1ID3 A;  5B31 G;  3REH D;  2Y2N A;  1WWI A;  5CPK C;  1P3K B;  4CAY B;  4H9N A;  3W97 C;  5AV6 D;  2ARO C;  5AY8 D;  2YFW B;  4G92 B;  1B67 A;  3MGP C;  1M18 D;  3X1S A;  2HIO C;  1ZLA D;  2Y2K A;  2LY8 A;  5AV9 A;  5CPK B;  2VQR A;  5B33 A;  1BH8 A;  2ARO B;  3MVD A;  3AZL A;  1P34 C;  3WA9 A;  4J8U A;  3MGP B;  3AZE C;  1AOI D;  1KU5 A;  2HIO B;  5B32 C;  5GT3 D;  3AZK D;  3NQJ B;  5B31 A;  5GXQ D;  3UTA C;  1P3P A;  3AFA C;  1P3A D;  2NZD A;  1ULY A;  2F8N B;  3KWQ D;  5BNX A;  3B6F C;  3AZE B;  5JRG C;  1HQ3 C;  3AZG C;  1U35 D;  1ID3 C;  2FJ7 A;  5B32 B;  5BT1 C;  3AZH D;  2FFF B;  1M19 A;  4NE6 A;  3B6F B;  5JRG B;  1HQ3 B;  5AV8 C;  3AZG B;  3AV1 A;  1ID3 B;  3X1S C;  3AV2 A;  3W97 D;  2ARO D;  3VH5 T;  5AV9 C;  5B33 C;  4H9N B;  1P3B A;  1F66 B;  2HIO D;  4XUJ A;  5E5A A;  3MVD C;  3AZL C;  5B0Y C;  3WA9 C;  5BNV A;  4J8U C;  5AV8 B;  5BS7 A;  4KGC A;  5GSU A;  4WU8 A;  1P34 D;  2Y2P A;  3A1K A;  5AV9 B;  5B31 C;  1P3P C;  5B1L A;  5B33 B;  5B2J A;  3AZE D;  1BH8 B;  5AVC C;  3MNN C;  4DRB A;  3MVD B;  3AZL B;  5B0Y B;  3WA9 B;  4J8U B;  3UTA D;  3AFA D;  5B0Z D;  2FJ7 C;  3C1C A;  2ZY5 A;  3REK D;  5B31 B;  1P3P B;  1M19 C;  3AZG D;  3LZ1 A;  4H9O A;  5G49 A;  5AVC B;  4DRA A;  3MNN B;  1ID3 D;  5BNX B;  3IP4 C;  3AV1 C;  5AV6 A;  3AV2 C;  5AY8 A;  2Y2H A;  2FJ7 B;  1M18 A;  1W2E A;  3X1S D;  1KX5 A;  1P3B C;  4J8V A;  5E5A C;  4XUJ C;  5AV9 D;  3AZI A;  4NFT A;  5BS7 C;  3AV1 B;  3AV2 B;  4KGC C;  5GSU C;  4WU8 C;  1KX3 A;  5AV5 A;  5B2J C;  4XUJ B;  3AZK A;  3X1T C;  5GXQ A;  3WKJ D;  3B0D B;  3EPL A;  2NZD D;  3VH6 W;  5B1M D;  3KWQ A;  4KGC B;  5GSU B;  3C1C C;  5CPJ A;  3W96 A;  3MGR C;  2Y2J A;  3B0B A;  3O62 A;  3F6T A;  3LZ1 C;  5KDM A;  3X1T B;  2FJ7 D;  4CSR B;  1M19 D;  4AWL C;  2Y2G A;  5AV6 C;  5AY8 C;  4YM6 B;  3MGR B;  3WTP D;  1M18 C;  3LZ1 B;  4H9O B;  2BYK A;  1P3F A;  1KX5 C;  4J8V C;  1ZLA C;  3AZI C;  2CWE A;  5JA4 A;  4H9R A;  3X1V A;  1Z2C B;  5AV6 B;  1P3B D;  5E5A D;  4NE3 A;  5AY8 B;  3AZN D;  4KHA A;  1KX3 C;  5AV5 C;  1A7W A;  3A6N A;  1M18 B;  1KX5 B;  4J8V B;  3X1U A;  3AZK C;  4ZBJ C;  5GSU D;  4WU8 D;  1ZLA B;  5GXQ C;  3AZI B;  5B1L D;  5B2J D;  2ZY3 A;  3KWQ C;  3MGS A;  1KX3 B;  5AV5 B;  5C3I C;  3O62 C;  5B0Z A;  4X23 A;  3REK A;  4ZBJ B;  5GT3 B;  3C1C D;  3AZH C;  3AZK B;  5GXQ B;  1TZY A;  5AVB A;  3LZ1 D;  4KUD A;  3KWQ B;  5CP6 A;  2YFV B;  1H3O A;  4NE5 A;  4WV4 B;  5C3I B;  3O62 B;  1U35 B;  4WNN A;  3AZH B;  3VH6 A;  3W98 D;  3AYW A;  2UWX A;  3X1V C;  1KX5 D;  4Z2M G;  4J8V D;  1N1J A;  3AZI D;  3A6N C;  3W97 B;  2BG1 A;  3VH5 W;  2BYK B;  2RIQ A;  4QLC A;  4Z66 A;  3LJA A;  4H9P A;  2DF4 C;  1KX3 D;  5AV5 D;  1P3G A;  5JA4 B;  4H9R B;  3X1V B;  3EG5 B;  3KXB A;  1JFI A;  4KHA B;  3WKJ A;  4WU9 A;  3A6N B;  5BO0 A;  5B1M A;  5B0Z C;  4X23 C;  3REK C;  3AN2 A;  1P34 B;  5CPJ D;  3B6G A;  3W96 D;  1TZY C;  5AVB C;  3V9R B;  3O62 D;  4KUD C;  1TAF A;  3C1B A;  2F8N H;  2XD5 A;  5CP6 C;  4J8X A;  2L5A A;  3UTA B;  3AFA B;  5CHL B;  5B0Z B;  3REK B;  3AZJ D;  3WTP A;  1TZY B;  5AVB B;  4KUD B;  1BH9 A;  3AYW C;  1P3F D;  4WZS B;  1R4V A;  5CP6 B;  4E45 A;  2IO5 C;  3X1V D;  4WNN B;  4QLC C;  4Z66 C;  3LJA C;  3AZN A;  5B40 D;  3A6N D;  3X1S B;  3AYW B;  3X1U D;  1N1J B;  3KXB C;  3WKJ C;  4WU9 C;  2IO5 B;  4ZUX A;  2NZD C;  5B1M C;  4QLC B;  3LJA B;  5DNM A;  3AN2 C;  4H9P B;  3B6G C;  3MGS D;  3H0L C;  4X23 D;  3C1B C;  3KXB B;  3VH5 A;  4J8X C;  3LEL A;  1JFI B;  4WU9 B;  3WKJ B;  2NZD B;  1TZY D;  5BO0 B;  5AVB D;  5B1M B;  4J8W A;  4KUD D;  5CP6 D;  3B6G B;  3WTP C;  3AZM A;  4XZQ A;  1P3O A;  1F1E A;  1TAF B;  3W98 A;  4J8X B;  2PYO D;  3WTP E;  1M19 B;  3AYW D;  3AZN C;  3WTP B;  5DNN A;  1S32 D;  4QLC D;  4Z66 D;  3LJA D;  4WJ3 C;  3LZ0 A;  1P3G D;  5B1L C;  3UT9 A;  3H0R C;  4ZUX C;  1P3B B;  5E5A B;  3REJ D;  3AZN B;  5DNM C;  3KXB D;  5BNV B;  3WAA A;  4WU9 D;  4WU8 B;  3AN2 D;  1Q9C A;  3B6G D;  3MGQ A;  5B1L B;  5F99 A;  5B2J B;  4ZUX B;  5DNM B;  3C1B D;  4J8X D;  3UTB A;  3AZM C;  4XZQ C;  1P3O C;  3C1C B;  3W98 C;  2Y2M A;  3AZJ A;  5G49 B;  5DNN C;  4AWL B;  1M1A A;  1P3O B;  4LD9 D;  3W98 B;  5B40 A;  3LZ0 C;  3UT9 C;  1P3K A;  3REI D;  4G91 C;  3WAA C;  4ZUX D;  5B32 G;  5DNM D;  5CPJ C;  3W96 C;  5B2I A;  3LZ0 B;  3MGQ C;  5F99 C;  3UT9 B;  1P3I A;  2DQN C;  4G91 B;  2NQB D;  5CPI A;  3LEL D;  3UTB C;  3P5J B;  4J8W D;  4UPK A;  5CPJ B;  1KX4 D;  3H0M C;  4H9Q A;  3AZJ C;  3W96 B;  3NQJ A;  5F99 B;  3AZM D;  4XZQ D;  5KDM B;  1P3O D;  1P3F C;  2J8P A;  2PYO A;  2Y2L A;  3UTB B;  1M1A C;  3REL A;  5B40 C;  5B32 A;  3AZJ B;  5DNN D;  1S32 A;  2Y2Q A;  1P3F B;  3B0C T;  3X1U C;  3TU4 A;  2HUE C;  3LZ0 D;  2ZY4 A;  3UT9 D;  1M1A B;  3REJ A;  5B40 B;  3FDD A;  3MGS C;  2RVQ C;  3WAA D;  5B2I C;  2CV5 D;  1P3I C;  3X1U B;  1F66 A;  2HUE B;  5CPI C;  3EPK A;  3MGQ D;  5F99 D;  5AV8 A;  4YS3 D;  3MGS B;  2F8N K;  5B2I B;  3UTB D;  1P3I B;  1EQZ A;  4X23 B;  3AZF A;  2PYO C;  5CPI B;  5B0Y A;  1P3L D;  3REL C;  3W99 D;  4Z5T D;  1H3O B;  4H9Q B;  1HTA A;  1S32 C;  1M1A D;  4LD9 A;  1T3U A;  5AVC A;  1WWS A;  3MNN A;  2PYO B;  2BYM A;  3TU4 C;  3AL0 C;  1P3G C;  4E44 A;  5B24 A;  3REI A;  1P3K D;  3REL B;  4H9S A;  3REJ C;  2F2A C;  5GT0 A;  4JJN A;  1S32 B;  4Z66 B;  1F66 C;  3TU4 B;  2RVQ D;  1P3G B;  5B2I D;  1P3I D;  5CPK D;  3REJ B;  2NQB A;  1B6W A;  2JCH A;  1P3M A;  5CPI D;  1EQZ C;  3MGP D;  2JE5 A;  3KSY A;  3AZF C;  3AN2 B;  1KX4 A;  4R8P A;  3C1B B;  2F8N D;  1EQZ B;  3KUY A;  3AZF B;  4LD9 C;  3REL D;  4M6B A;  3X1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...