3MGQD

Binding of nickel ions to the nucleosome core particle
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
100
structure length
100
Chain Sequence
GKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 34
structure length 100
sequence length 100
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgqD00
4WZSB 3KWQC 2CWEA 3MNNC 3MNNB 1P3BB 3X1UD 2YFWB 4WU9C 1JFIA 4CAYB 5B32B 3AZNB 5B0YA 1F66D 1N1JB 3X1UC 5B33B 3X1UB 5GT0A 4ZUXA 1F66C 3B0BA 3VH5A 1ZLAD 1TAFA 5CPKD 4XZQA 4JJNB 1ID3D 1HTAA 3X1SA 1ZLAC 4DRAA 1ZLAB 5CPKB 3LELD 5CPKC 3REHD 1AOID 4Z66D 1ID3C 1BH8A 1ID3B 5KDMA 3LELC 1M1AD 3REHB 3REHC 1AOIB 4Z66B 4Z66C 3UTAD 1AOIC 5AV9D 3AZGB 1P3IA 2HIOA 1M1AB 1M1AC 3UTAC 3UTAB 4E44A 3AZHD 5AV9C 1S32B 5E5AD 4H9SC 3MGQA 3AZMA 3MGPA 3AZHC 4J8WD 3WTPA 4YS3B 5JA4B 5E5AC 5B1MD 4Z5TB 4J8WC 3TU4A 1EQZB 3B0CT 5B1MB 5B1MC 3LZ1D 3X1VA 2CV5A 3LZ1B 3LZ1C 1P3OD 2LY8A 5GXQD 5BT1D 1KX3B 2NQBA 5DNNA 4Z2MG 1P3OC 1P3OB 5B2IA 2F8ND 5GXQB 5GXQC 4WV4B 5BT1C 3KUYA 3UTBB 5B31D 5BS7A 5AVBD 2AROA 5CPIB 1HQ3A 4ZBJC 1P3LB 5B31B 5B31C 5BNXA 5CP6A 5AVBC 3W96A 4J8UB 4J8VB 1P3FB 4HGAC 3UT9B 4XUJD 3W98A 5B24B 1BH9A 4YM6D 4H9RA 3AZED 5JRGB 4NE6A 3REJB 4XUJC 2PYOD 2BYMB 3AZFD 3REID 3VH6A 3AZJC 3C1CB 4YM6C 3WA9D 3AZEC 3AN2B 5CPJA 1M18A 2PYOC 2PYOB 3LZ0D 3REKD 3AZFB 3REIC 3WA9C 3MGSB 3WAAA 5GSUA 3AFAD 3LZ0C 3REKC 5AV8A 1KX5D 3RELA 2IO5B 1B67A 4EO5C 1JFIB 4UUZB 3AFAC 5GT0D 4H9NB 1P3MD 1KX5C 5B0YB 5BO0A 3WKJA 3B6FA 3AZLD 4KGCA 3LJAD 4H9QA 3R45A 5GT0B 5GT0C 1P3MC 4E45A 4XZQD 3AZLC 3LJAC 3X1SD 1P3GA 4LD9D 1TAFB 1U35D 5B2JD 4XZQB 4XZQC 3VH5W 1KX4A 5G49B 3KXBA 3X1SB 3C1BA 3X1SC 1P3BD 4LD9C 4WU8A 5AV5A 5B32D 1U35C 2F8NG 3AZND 5B2JC 3W97A 1BH8B 5AV6A 1M19D 1P3BC 5B33D 5B31G 5KDMB 5B32C 5DNMA 3AZNC 3AYWA 3W99A 1M19C 1M19B 3VH5T 5B33C 5B1LA 2HIOB 3MGQD 1P3IB 3O62A 3MGPD 5GT3D 3X1TA 4JJND 3B6GD 4R8PA 3MGQB 3MGQC 5AY8D 3AZMB 3MGPB 3MGPC 5GT3C 5GT3B 3WTPB 4JJNC 3B6GB 3MGRA 3B6GC 2NZDA 1P3PA 3AV1A 5AY8C 5AY8B 4X23A 3AZIA 1P3AA 3TU4B 4QLCA 2CV5D 3AZGD 3X1VB 1P34A 4J8XA 3MVDA 1S32D 2CV5B 3AZGC 2NQBD 5F99A 2FJ7A 3B0CW 1S32C 4YS3D 3AV2A 3A6NA 1R4VA 2NQBC 5DNNB 2NQBB 5B40A 2HUEB 2HUEC 4Z5TD 5B2IB 4YS3C 1TZYA 5AVCA 3B0DB 4M6BA 1EQZD 3KUYB 3KWQA 3KSYA 1ULYA 4DRBA 5FUGB 3MNNA 4Z5TC 2AROB 4WU9A 2F8NK 1EQZC 5BNXB 3AZKD 5CP6B 3W96B 1A7WA 1KX3D 1F66A 5B32G 3W98B 3AZKB 3AZKC 1BH9B 1F1EA 4H9RB 1KX3C 3UTBD 4CSRA 5CPID 2L5AA 5CPJB 3WAAD 1M18B 3UTBC 4AWLB 1P3LD 3VH6W 1ID3A 5CPIC 3NQUA 3LELA 3WAAC 4J8VD 4J8UD 1P3FD 3REHA 3WAAB 3UT9D 4Z66A 1P3LC 4G92B 4G92C 3RELB 5B24D 4KGCD 1M1AA 4J8VC 5JRGD 4J8UC 3NQJA 3REJD 1P3FC 3UT9C 3UTAA 5AV9A 5BO0B 3WKJB 3VH6T 4H9SA 5B24C 3B6FB 4KGCB 4KGCC 3C1CD 4H9QB 1P3KD 3AN2D 5JRGC 3REJC 3AZHA 3V9RA 5E5AA 3C1CC 1P3KB 3AN2C 3KXBD 3C1BD 3MGSD 1H3OA 1P3KC 4J8WA 3AZFC 5BNVA 5AV6D 1KX4B 3KXBB 3KXBC 3MGSC 3C1BB 3C1BC 1WWSA 5AV5B 5B0YD 4G91B 2IO5C 4G91C 3W97B 2JSSA 4NE3A 3LZ1A 5AV6B 5AV6C 3AYWD 4KUDA 4ZUXD 5DNMB 5B0YC 3AYWB 3AYWC 3X1TD 3W99B 4NE5A 4H9OA 5B1LB 4ZUXB 4ZUXC 3O62B 3X1TC 3X1TB 4R8PB 2F8NA 4X23D 5C3IB 5B31A 3MGRB 4NFTA 2NZDB 3AV1B 5AVBA 4X23C 4X23B 3AZIB 1P3AB 1P3ID 2HIOD 3WTPE 2FJ7D 4J8XB 4XUJA 3MVDB 1P3IC 2HIOC 5B40D 3AZJA 5F99B 4YM6A 3AZMD 3AZEA 2FJ7B 2FJ7C 3WTPD 3AV2B 3A6NB 4WNNA 2BYKA 5B40B 3REIA 5B40C 4H9PA 3AZMC 3WA9A 4KHAA 2YFVA 3WTPC 3TU4D 1TZYB 3LZ0A 3REKA 5AVCB 3KWQB 3X1VD 4UUZA 4WU9B 3AFAA 4H9NA 3TU4C 1KX5A 3X1VC 1P3MA 2CV5C 2RVQD 5DNND 1F66B 3AZLA 3LJAA 5B2ID 2RVQC 5B0ZA 5DNNC 3KUYD 5G49A 4CSRB 2AROD 5B2IC 4LD9A 1HQ3D 1U35A 3B0DC 5B2JA 3KUYC 1P3BA 5BS7C 2AROC 2YFWA 5CP6D 1BFMA 3NQUB 4CAYA 3LELB 3W96D 1HQ3C 1HQ3B 5B32A 4Z2MH 3AZNA 3W98D 1M19A 1N1JA 5CP6C 5B33A 3X1UA 3W96C 3NQJB 3W98C 5AV9B 5CPJD 1M18D 5GT3A 3AZHB 4JJNA 3B6GA 3V9RB 5E5AB 5AY8A 1ZLAA 5CPJC 5CPKA 1H3OB 1M18C 5GSUD 4J8WB 4AWLC 5BNVB 5AV8D 3RELD 4KUDD 5GSUB 5GSUC 1AOIA 5AV8B 5AV8C 3AZGA 3RELC 3WKJD 3B6FD 4KUDB 4KUDC 1S32A 3WKJC 3B6FC 4H9OB 3R45B 1P3GD 4YS3A 5JA4A 1KX4D 5FUGA 4Z5TA 1P3GB 4WU8D 1P3GC 2F8NB 5AV5D 1EQZA 4ZBJB 3W97D 5B1MA 1KX4C 5AVBB 4WU8B 4WU8C 5AV5C 5DNMD 4HGAB 3W97C 3W99D 3AZKA 5B1LD 3O62D 3AZJD 5DNMC 1KX3A 4XUJB 3W99C 1P3OA 4R8PD 5B1LC 2F8NH 5GXQA 3O62C 4YM6B 3AZJB 3AZEB 3UTBA 3MGRD 4WNNB 2NZDD 4R8PC 1P3PD 3AV1D 2BYKB 3REIB 5CPIA 4H9PB 3WA9B 1KU5A 3AZID 1P3AD 4KHAB 2YFVB 5C3IC 4QLCD 3LZ0B 3MGRC 3REKB 1B6WA 1P3PB 3AV1C 1P3PC 1P3LA 2NZDC 4EO5B 5CHLB 1P34D 3AZIC 4J8UA 4J8VA 1P3AC 4J8XD 1P3FA 3AFAB 3UT9A 4QLCC 4QLCB 3MVDD 1KX5B 5B24A 1P34B 1P34C 5F99D 5JRGA 3REJA 4J8XC 1P3MB 3MVDC 2BYMA 3AV2D 5B0ZD 3A6ND 3AZLB 3LJAB 5F99C 3C1CA 1P3KA 3AN2A 2PYOA 3AV2C 1TZYD 5B0ZB 5B0ZC 5AVCD 3A6NC 3AZFA 1Q9CA 3KWQD 3MNND 3MGSA 4WU9D 4LD9B 1WWIA 1TZYC 1U35B 5AVCC 5B2JB
chains in the Genus database with same CATH superfamily
4WZSB 3KWQC 2CWEA 3MNNC 3MNNB 1P3BB 3X1UD 2YFWB 4WU9C 1JFIA 4CAYB 5B32B 3AZNB 5B0YA 1F66D 1N1JB 3X1UC 5B33B 3X1UB 3EPLA 5GT0A 4ZUXA 1F66C 3B0BA 3VH5A 1ZLAD 4UPKA 1TAFA 5CPKD 2Y2HA 4XZQA 4JJNB 1ID3D 1HTAA 3X1SA 1ZLAC 4DRAA 1ZLAB 5CPKB 3LELD 5CPKC 3REHD 1AOID 4Z66D 1ID3C 1BH8A 1ID3B 3AL0C 2Y2LA 5KDMA 3LELC 1M1AD 3REHB 3REHC 1AOIB 4Z66B 4Z66C 3UTAD 1AOIC 5AV9D 3AZGB 1P3IA 2HIOA 1M1AB 1M1AC 3UTAC 3UTAB 3F6TA 4E44A 3AZHD 5AV9C 1S32B 3FDDA 5E5AD 4H9SC 3MGQA 1W2EA 3AZMA 3MGPA 3AZHC 4J8WD 3WTPA 4YS3B 5JA4B 5E5AC 2Y2GA 2G5HC 1Z2CB 5B1MD 4Z5TB 4J8WC 3TU4A 1EQZB 3B0CT 5B1MB 5B1MC 3LZ1D 3X1VA 4DQYB 2RIQA 2CV5A 3LZ1B 3LZ1C 2G5IC 2FFFB 1P3OD 2LY8A 5GXQD 2JCHA 5BT1D 2Y2PA 2ZM5A 1KX3B 2NQBA 5DNNA 4Z2MG 1P3OC 1P3OB 5B2IA 2F8ND 5GXQB 5GXQC 4WV4B 5BT1C 3KUYA 3UTBB 5B31D 5BS7A 5AVBD 2AROA 5CPIB 1HQ3A 4ZBJC 1P3LB 5B31B 5B31C 5BNXA 5CP6A 5AVBC 3W96A 2Y2MA 4J8UB 2W8SA 4J8VB 4HGAC 1P3FB 3UT9B 4XUJD 3W98A 5B24B 1BH9A 4YM6D 4H9RA 3AZED 5JRGB 4NE6A 3REJB 4XUJC 2PYOD 2BYMB 3AZFD 3REID 3VH6A 3AZJC 3C1CB 4YM6C 3WA9D 3AZEC 3AN2B 5CPJA 1M18A 2PYOC 2PYOB 3LZ0D 3REKD 3AZFB 3REIC 3WA9C 2JE5A 3MGSB 3WAAA 5GSUA 3AFAD 3LZ0C 2ZY3A 5AV8A 2F2AC 3REKC 1KX5D 3RELA 2IO5B 1B67A 4EO5C 1JFIB 4UUZB 2BG1A 3AFAC 5GT0D 4H9NB 1P3MD 1KX5C 5B0YB 5BO0A 3WKJA 3B6FA 3AZLD 4KGCA 3LJAD 4H9QA 3R45A 5GT0B 5GT0C 1P3MC 4E45A 4XZQD 3AZLC 3LJAC 3X1SD 1P3GA 4LD9D 1TAFB 1U35D 5B2JD 4XZQB 4XZQC 3VH5W 1KX4A 5G49B 3KXBA 3X1SB 3C1BA 3X1SC 1P3BD 4LD9C 4WU8A 5AV5A 5B32D 1U35C 2F8NG 3AZND 5B2JC 3W97A 1BH8B 2XD5A 5AV6A 1M19D 1P3BC 5B33D 2UWXA 5B31G 5KDMB 4WJ3C 5B32C 5DNMA 3AZNC 3AYWA 3W99A 1M19C 1M19B 3VH5T 5B33C 5B1LA 2HIOB 3MGQD 1P3IB 3O62A 3MGPD 5GT3D 3X1TA 4JJND 3B6GD 4R8PA 3MGQB 3MGQC 5AY8D 3AZMB 3MGPB 3MGPC 5GT3C 5GT3B 3WTPB 4JJNC 3B6GB 3MGRA 3B6GC 2DF4C 2NZDA 1P3PA 3AV1A 5AY8C 5AY8B 4X23A 1PZRA 3AZIA 1P3AA 3TU4B 3H0RC 4QLCA 2CV5D 3AZGD 3X1VB 1P34A 4J8XA 3MVDA 1S32D 2CV5B 3AZGC 2NQBD 5F99A 2FJ7A 3B0CW 1S32C 3A1KA 4YS3D 3A6NA 1R4VA 3AV2A 2NQBC 5DNNB 2NQBB 5B40A 2HUEB 2HUEC 4Z5TD 5B2IB 2ZY4A 4YS3C 1TZYA 5AVCA 3B0DB 4M6BA 1EQZD 3KUYB 3KWQA 3KSYA 1ULYA 4DRBA 5FUGB 3MNNA 4Z5TC 2AROB 3H0LC 4WU9A 2F8NK 1EQZC 5BNXB 3AZKD 5CP6B 3W96B 1A7WA 1KX3D 1F66A 5B32G 3W98B 3AZKB 3AZKC 2VQRA 1BH9B 1F1EA 4H9RB 1KX3C 3UTBD 4CSRA 5CPID 2L5AA 5CPJB 3WAAD 1M18B 3UTBC 2ZY5A 4AWLB 1P3LD 3VH6W 1ID3A 5CPIC 3NQUA 3LELA 3WAAC 4J8VD 4J8UD 1P3FD 3REHA 3WAAB 3UT9D 4Z66A 1P3LC 4G92B 4G92C 3RELB 5B24D 4KGCD 1M1AA 4J8VC 5JRGD 4J8UC 3NQJA 3REJD 1P3FC 3UT9C 3UTAA 5AV9A 5BO0B 3WKJB 3VH6T 4H9SA 5B24C 3B6FB 4KGCB 4KGCC 3C1CD 4H9QB 2Y2JA 3AN2D 5JRGC 3REJC 1P3KD 3AZHA 3V9RA 5E5AA 3C1CC 1P3KB 3AN2C 3KXBD 3C1BD 3MGSD 1H3OA 1P3KC 4J8WA 3AZFC 5BNVA 5AV6D 1KX4B 3KXBB 3KXBC 3MGSC 3C1BB 3C1BC 3H0MC 1WWSA 5AV5B 5B0YD 4G91B 2IO5C 4G91C 3W97B 2JSSA 4NE3A 3LZ1A 5AV6B 5AV6C 3AYWD 4KUDA 4ZUXD 5DNMB 5B0YC 3AYWB 3AYWC 3X1TD 3W99B 4NE5A 4H9OA 5B1LB 4ZUXB 4ZUXC 3O62B 3X1TC 3X1TB 3A1IA 4R8PB 2F8NA 4X23D 5C3IB 5B31A 3MGRB 4NFTA 2NZDB 3AV1B 5AVBA 4X23C 4X23B 3AZIB 3IP4C 1P3AB 1P3ID 2HIOD 3WTPE 2FJ7D 4J8XB 4XUJA 3MVDB 1P3IC 2HIOC 5B40D 3AZJA 5F99B 4YM6A 3EPJA 3AZMD 3AZEA 2FJ7B 2FJ7C 3WTPD 3AV2B 3A6NB 4WNNA 2BYKA 5B40B 3REIA 5B40C 4H9PA 3AZMC 3WA9A 4KHAA 2YFVA 3WTPC 3TU4D 1TZYB 3LZ0A 3REKA 5AVCB 3KWQB 3X1VD 4UUZA 4WU9B 3AFAA 4H9NA 3TU4C 1KX5A 3X1VC 2Y2OA 1P3MA 2CV5C 2RVQD 5DNND 3EG5B 1F66B 3AZLA 3LJAA 5B2ID 2RVQC 5B0ZA 5DNNC 3KUYD 3EPHA 5G49A 4CSRB 2AROD 5B2IC 4LD9A 1HQ3D 1U35A 3B0DC 5B2JA 3KUYC 1P3BA 5BS7C 2AROC 2YFWA 5CP6D 1BFMA 3NQUB 4CAYA 3LELB 3W96D 1HQ3C 1HQ3B 5B32A 4Z2MH 3AZNA 3W98D 1M19A 1N1JA 5CP6C 5B33A 3X1UA 3W96C 3NQJB 3W98C 5AV9B 5CPJD 1M18D 5GT3A 3AZHB 4JJNA 3B6GA 3V9RB 5E5AB 3EPKA 2ZY2A 5AY8A 1ZLAA 5CPJC 5CPKA 1H3OB 1M18C 5GSUD 4J8WB 4AWLC 5BNVB 5AV8D 3RELD 4KUDD 2DQNC 5GSUB 2Y2IA 5GSUC 1AOIA 5AV8B 5AV8C 3AZGA 3RELC 3WKJD 3B6FD 4KUDB 4KUDC 1S32A 3WKJC 3B6FC 4H9OB 3R45B 1P3GD 4YS3A 5JA4A 1KX4D 5FUGA 3KFUG 4Z5TA 1P3GB 4WU8D 1P3GC 2F8NB 5AV5D 1EQZA 4ZBJB 3W97D 5B1MA 1KX4C 5AVBB 4WU8B 4WU8C 5AV5C 5DNMD 4HGAB 3W97C 3W99D 2XD1A 3AZKA 2J8PA 5B1LD 3O62D 3AZJD 5DNMC 1KX3A 4XUJB 3W99C 1P3OA 4R8PD 5B1LC 2F8NH 5GXQA 3O62C 4YM6B 3AZJB 3AZEB 3UTBA 3MGRD 4WNNB 2NZDD 4R8PC 1P3PD 3AV1D 2BYKB 3REIB 5CPIA 4H9PB 3WA9B 1KU5A 3AZID 1P3AD 4KHAB 2YFVB 5C3IC 4QLCD 3LZ0B 3MGRC 3REKB 1B6WA 1P3PB 3AV1C 1P3PC 1P3LA 2NZDC 3P5JB 4EO5B 5CHLB 1P34D 3AZIC 4J8UA 2Y2QA 4J8VA 4J8XD 1P3AC 3AFAB 3UT9A 1P3FA 4QLCC 4QLCB 3MVDD 1KX5B 5B24A 1P34B 1P34C 5F99D 2Y2KA 5JRGA 3REJA 4J8XC 1P3MB 3MVDC 2BYMA 3AV2D 5B0ZD 3A6ND 1T3UA 3AZLB 3LJAB 5F99C 2Y2NA 3C1CA 1P3KA 3AN2A 2PYOA 3AV2C 1TZYD 5B0ZB 5B0ZC 5AVCD 3A6NC 3AZFA 1Q9CA 3KWQD 3MNND 3MGSA 4WU9D 4LD9B 1WWIA 1TZYC 1U35B 5AVCC 5B2JB
chains in the Genus database with same CATH topology
4WZSB 3KWQC 2CWEA 3MNNC 3MNNB 1P3BB 3X1UD 2YFWB 4WU9C 1JFIA 4CAYB 5B32B 3AZNB 5B0YA 1F66D 1N1JB 3X1UC 5B33B 3X1UB 3EPLA 5GT0A 4ZUXA 1F66C 3B0BA 3VH5A 1ZLAD 4UPKA 1TAFA 5CPKD 2Y2HA 4XZQA 4JJNB 1ID3D 1HTAA 3X1SA 1ZLAC 4DRAA 1ZLAB 5CPKB 3LELD 5CPKC 3REHD 1AOID 4Z66D 1ID3C 1BH8A 1ID3B 3AL0C 2Y2LA 5KDMA 3LELC 1M1AD 3REHB 3REHC 1AOIB 4Z66B 4Z66C 3UTAD 1AOIC 5AV9D 3AZGB 1P3IA 2HIOA 1M1AB 1M1AC 3UTAC 3UTAB 3F6TA 4E44A 3AZHD 5AV9C 1S32B 3FDDA 5E5AD 4H9SC 3MGQA 1W2EA 3AZMA 3MGPA 3AZHC 4J8WD 3WTPA 4YS3B 5JA4B 5E5AC 2Y2GA 2G5HC 1Z2CB 5B1MD 4Z5TB 4J8WC 3TU4A 1EQZB 3B0CT 5B1MB 5B1MC 3LZ1D 3X1VA 4DQYB 2RIQA 2CV5A 3LZ1B 3LZ1C 2G5IC 2FFFB 1P3OD 2LY8A 5GXQD 2JCHA 5BT1D 2Y2PA 2ZM5A 1KX3B 2NQBA 5DNNA 4Z2MG 1P3OC 1P3OB 5B2IA 2F8ND 5GXQB 5GXQC 4WV4B 5BT1C 3KUYA 3UTBB 5B31D 5BS7A 5AVBD 2AROA 5CPIB 1HQ3A 4ZBJC 1P3LB 5B31B 5B31C 5BNXA 5CP6A 5AVBC 3W96A 2Y2MA 4J8UB 2W8SA 4J8VB 4HGAC 1P3FB 3UT9B 4XUJD 3W98A 5B24B 1BH9A 4YM6D 4H9RA 3AZED 5JRGB 4NE6A 3REJB 4XUJC 2PYOD 2BYMB 3AZFD 3REID 3VH6A 3AZJC 3C1CB 4YM6C 3WA9D 3AZEC 3AN2B 5CPJA 1M18A 2PYOC 2PYOB 3LZ0D 3REKD 3AZFB 3REIC 3WA9C 2JE5A 3MGSB 3WAAA 5GSUA 3AFAD 3LZ0C 2ZY3A 5AV8A 2F2AC 3REKC 1KX5D 3RELA 2IO5B 1B67A 4EO5C 1JFIB 4UUZB 2BG1A 3AFAC 5GT0D 4H9NB 1P3MD 1KX5C 5B0YB 5BO0A 3WKJA 3B6FA 3AZLD 4KGCA 3LJAD 4H9QA 3R45A 5GT0B 5GT0C 1P3MC 4E45A 4XZQD 3AZLC 3LJAC 3X1SD 1P3GA 4LD9D 1TAFB 1U35D 5B2JD 4XZQB 4XZQC 3VH5W 1KX4A 5G49B 3KXBA 3X1SB 3C1BA 3X1SC 1P3BD 4LD9C 4WU8A 5AV5A 5B32D 1U35C 2F8NG 3AZND 5B2JC 3W97A 1BH8B 2XD5A 5AV6A 1M19D 1P3BC 5B33D 2UWXA 5B31G 5KDMB 4WJ3C 5B32C 5DNMA 3AZNC 3AYWA 3W99A 1M19C 1M19B 3VH5T 5B33C 5B1LA 2HIOB 3MGQD 1P3IB 3O62A 3MGPD 5GT3D 3X1TA 4JJND 3B6GD 4R8PA 3MGQB 3MGQC 5AY8D 3AZMB 3MGPB 3MGPC 5GT3C 5GT3B 3WTPB 4JJNC 3B6GB 3MGRA 3B6GC 2DF4C 2NZDA 1P3PA 3AV1A 5AY8C 5AY8B 4X23A 1PZRA 3AZIA 1P3AA 3TU4B 3H0RC 4QLCA 2CV5D 3AZGD 3X1VB 1P34A 4J8XA 3MVDA 1S32D 2CV5B 3AZGC 2NQBD 5F99A 2FJ7A 3B0CW 1S32C 3A1KA 4YS3D 3A6NA 1R4VA 3AV2A 2NQBC 5DNNB 2NQBB 5B40A 2HUEB 2HUEC 4Z5TD 5B2IB 2ZY4A 4YS3C 1TZYA 5AVCA 3B0DB 4M6BA 1EQZD 3KUYB 3KWQA 3KSYA 1ULYA 4DRBA 5FUGB 3MNNA 4Z5TC 2AROB 3H0LC 4WU9A 2F8NK 1EQZC 5BNXB 3AZKD 5CP6B 3W96B 1A7WA 1KX3D 1F66A 5B32G 3W98B 3AZKB 3AZKC 2VQRA 1BH9B 1F1EA 4H9RB 1KX3C 3UTBD 4CSRA 5CPID 2L5AA 5CPJB 3WAAD 1M18B 3UTBC 2ZY5A 4AWLB 1P3LD 3VH6W 1ID3A 5CPIC 3NQUA 3LELA 3WAAC 4J8VD 4J8UD 1P3FD 3REHA 3WAAB 3UT9D 4Z66A 1P3LC 4G92B 4G92C 3RELB 5B24D 4KGCD 1M1AA 4J8VC 5JRGD 4J8UC 3NQJA 3REJD 1P3FC 3UT9C 3UTAA 5AV9A 5BO0B 3WKJB 3VH6T 4H9SA 5B24C 3B6FB 4KGCB 4KGCC 3C1CD 4H9QB 2Y2JA 3AN2D 5JRGC 3REJC 1P3KD 3AZHA 3V9RA 5E5AA 3C1CC 1P3KB 3AN2C 3KXBD 3C1BD 3MGSD 1H3OA 1P3KC 4J8WA 3AZFC 5BNVA 5AV6D 1KX4B 3KXBB 3KXBC 3MGSC 3C1BB 3C1BC 3H0MC 1WWSA 5AV5B 5B0YD 4G91B 2IO5C 4G91C 3W97B 2JSSA 4NE3A 3LZ1A 5AV6B 5AV6C 3AYWD 4KUDA 4ZUXD 5DNMB 5B0YC 3AYWB 3AYWC 3X1TD 3W99B 4NE5A 4H9OA 5B1LB 4ZUXB 4ZUXC 3O62B 3X1TC 3X1TB 3A1IA 4R8PB 2F8NA 4X23D 5C3IB 5B31A 3MGRB 4NFTA 2NZDB 3AV1B 5AVBA 4X23C 4X23B 3AZIB 3IP4C 1P3AB 1P3ID 2HIOD 3WTPE 2FJ7D 4J8XB 4XUJA 3MVDB 1P3IC 2HIOC 5B40D 3AZJA 5F99B 4YM6A 3EPJA 3AZMD 3AZEA 2FJ7B 2FJ7C 3WTPD 3AV2B 3A6NB 4WNNA 2BYKA 5B40B 3REIA 5B40C 4H9PA 3AZMC 3WA9A 4KHAA 2YFVA 3WTPC 3TU4D 1TZYB 3LZ0A 3REKA 5AVCB 3KWQB 3X1VD 4UUZA 4WU9B 3AFAA 4H9NA 3TU4C 1KX5A 3X1VC 2Y2OA 1P3MA 2CV5C 2RVQD 5DNND 3EG5B 1F66B 3AZLA 3LJAA 5B2ID 2RVQC 5B0ZA 5DNNC 3KUYD 3EPHA 5G49A 4CSRB 2AROD 5B2IC 4LD9A 1HQ3D 1U35A 3B0DC 5B2JA 3KUYC 1P3BA 5BS7C 2AROC 2YFWA 5CP6D 1BFMA 3NQUB 4CAYA 3LELB 3W96D 1HQ3C 1HQ3B 5B32A 4Z2MH 3AZNA 3W98D 1M19A 1N1JA 5CP6C 5B33A 3X1UA 3W96C 3NQJB 3W98C 5AV9B 5CPJD 1M18D 5GT3A 3AZHB 4JJNA 3B6GA 3V9RB 5E5AB 3EPKA 2ZY2A 5AY8A 1ZLAA 5CPJC 5CPKA 1H3OB 1M18C 5GSUD 4J8WB 4AWLC 5BNVB 5AV8D 3RELD 4KUDD 2DQNC 5GSUB 2Y2IA 5GSUC 1AOIA 5AV8B 5AV8C 3AZGA 3RELC 3WKJD 3B6FD 4KUDB 4KUDC 1S32A 3WKJC 3B6FC 4H9OB 3R45B 1P3GD 4YS3A 5JA4A 1KX4D 5FUGA 3KFUG 4Z5TA 1P3GB 4WU8D 1P3GC 2F8NB 5AV5D 1EQZA 4ZBJB 3W97D 5B1MA 1KX4C 5AVBB 4WU8B 4WU8C 5AV5C 5DNMD 4HGAB 3W97C 3W99D 2XD1A 3AZKA 2J8PA 5B1LD 3O62D 3AZJD 5DNMC 1KX3A 4XUJB 3W99C 1P3OA 4R8PD 5B1LC 2F8NH 5GXQA 3O62C 4YM6B 3AZJB 3AZEB 3UTBA 3MGRD 4WNNB 2NZDD 4R8PC 1P3PD 3AV1D 2BYKB 3REIB 5CPIA 4H9PB 3WA9B 1KU5A 3AZID 1P3AD 4KHAB 2YFVB 5C3IC 4QLCD 3LZ0B 3MGRC 3REKB 1B6WA 1P3PB 3AV1C 1P3PC 1P3LA 2NZDC 3P5JB 4EO5B 5CHLB 1P34D 3AZIC 4J8UA 2Y2QA 4J8VA 4J8XD 1P3AC 3AFAB 3UT9A 1P3FA 4QLCC 4QLCB 3MVDD 1KX5B 5B24A 1P34B 1P34C 5F99D 2Y2KA 5JRGA 3REJA 4J8XC 1P3MB 3MVDC 2BYMA 3AV2D 5B0ZD 3A6ND 1T3UA 3AZLB 3LJAB 5F99C 2Y2NA 3C1CA 1P3KA 3AN2A 2PYOA 3AV2C 1TZYD 5B0ZB 5B0ZC 5AVCD 3A6NC 3AZFA 1Q9CA 3KWQD 3MNND 3MGSA 4WU9D 4LD9B 1WWIA 1TZYC 1U35B 5AVCC 5B2JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZS B;  3KWQ C;  2CWE A;  3MNN C;  3MNN B;  1P3B B;  3X1U D;  2YFW B;  4WU9 C;  1JFI A;  4CAY B;  5B32 B;  3AZN B;  5B0Y A;  1F66 D;  1N1J B;  3X1U C;  5B33 B;  3X1U B;  5GT0 A;  4ZUX A;  1F66 C;  3B0B A;  3VH5 A;  1ZLA D;  1TAF A;  5CPK D;  4XZQ A;  4JJN B;  1ID3 D;  1HTA A;  3X1S A;  1ZLA C;  4DRA A;  1ZLA B;  5CPK B;  3LEL D;  5CPK C;  3REH D;  1AOI D;  4Z66 D;  1ID3 C;  1BH8 A;  1ID3 B;  5KDM A;  3LEL C;  1M1A D;  3REH B;  3REH C;  1AOI B;  4Z66 B;  4Z66 C;  3UTA D;  1AOI C;  5AV9 D;  3AZG B;  1P3I A;  2HIO A;  1M1A B;  1M1A C;  3UTA C;  3UTA B;  4E44 A;  3AZH D;  5AV9 C;  1S32 B;  5E5A D;  4H9S C;  3MGQ A;  3AZM A;  3MGP A;  3AZH C;  4J8W D;  3WTP A;  4YS3 B;  5JA4 B;  5E5A C;  5B1M D;  4Z5T B;  4J8W C;  3TU4 A;  1EQZ B;  3B0C T;  5B1M B;  5B1M C;  3LZ1 D;  3X1V A;  2CV5 A;  3LZ1 B;  3LZ1 C;  1P3O D;  2LY8 A;  5GXQ D;  5BT1 D;  1KX3 B;  2NQB A;  5DNN A;  4Z2M G;  1P3O C;  1P3O B;  5B2I A;  2F8N D;  5GXQ B;  5GXQ C;  4WV4 B;  5BT1 C;  3KUY A;  3UTB B;  5B31 D;  5BS7 A;  5AVB D;  2ARO A;  5CPI B;  1HQ3 A;  4ZBJ C;  1P3L B;  5B31 B;  5B31 C;  5BNX A;  5CP6 A;  5AVB C;  3W96 A;  4J8U B;  4J8V B;  1P3F B;  4HGA C;  3UT9 B;  4XUJ D;  3W98 A;  5B24 B;  1BH9 A;  4YM6 D;  4H9R A;  3AZE D;  5JRG B;  4NE6 A;  3REJ B;  4XUJ C;  2PYO D;  2BYM B;  3AZF D;  3REI D;  3VH6 A;  3AZJ C;  3C1C B;  4YM6 C;  3WA9 D;  3AZE C;  3AN2 B;  5CPJ A;  1M18 A;  2PYO C;  2PYO B;  3LZ0 D;  3REK D;  3AZF B;  3REI C;  3WA9 C;  3MGS B;  3WAA A;  5GSU A;  3AFA D;  3LZ0 C;  3REK C;  5AV8 A;  1KX5 D;  3REL A;  2IO5 B;  1B67 A;  4EO5 C;  1JFI B;  4UUZ B;  3AFA C;  5GT0 D;  4H9N B;  1P3M D;  1KX5 C;  5B0Y B;  5BO0 A;  3WKJ A;  3B6F A;  3AZL D;  4KGC A;  3LJA D;  4H9Q A;  3R45 A;  5GT0 B;  5GT0 C;  1P3M C;  4E45 A;  4XZQ D;  3AZL C;  3LJA C;  3X1S D;  1P3G A;  4LD9 D;  1TAF B;  1U35 D;  5B2J D;  4XZQ B;  4XZQ C;  3VH5 W;  1KX4 A;  5G49 B;  3KXB A;  3X1S B;  3C1B A;  3X1S C;  1P3B D;  4LD9 C;  4WU8 A;  5AV5 A;  5B32 D;  1U35 C;  2F8N G;  3AZN D;  5B2J C;  3W97 A;  1BH8 B;  5AV6 A;  1M19 D;  1P3B C;  5B33 D;  5B31 G;  5KDM B;  5B32 C;  5DNM A;  3AZN C;  3AYW A;  3W99 A;  1M19 C;  1M19 B;  3VH5 T;  5B33 C;  5B1L A;  2HIO B;  3MGQ D;  1P3I B;  3O62 A;  3MGP D;  5GT3 D;  3X1T A;  4JJN D;  3B6G D;  4R8P A;  3MGQ B;  3MGQ C;  5AY8 D;  3AZM B;  3MGP B;  3MGP C;  5GT3 C;  5GT3 B;  3WTP B;  4JJN C;  3B6G B;  3MGR A;  3B6G C;  2NZD A;  1P3P A;  3AV1 A;  5AY8 C;  5AY8 B;  4X23 A;  3AZI A;  1P3A A;  3TU4 B;  4QLC A;  2CV5 D;  3AZG D;  3X1V B;  1P34 A;  4J8X A;  3MVD A;  1S32 D;  2CV5 B;  3AZG C;  2NQB D;  5F99 A;  2FJ7 A;  3B0C W;  1S32 C;  4YS3 D;  3AV2 A;  3A6N A;  1R4V A;  2NQB C;  5DNN B;  2NQB B;  5B40 A;  2HUE B;  2HUE C;  4Z5T D;  5B2I B;  4YS3 C;  1TZY A;  5AVC A;  3B0D B;  4M6B A;  1EQZ D;  3KUY B;  3KWQ A;  3KSY A;  1ULY A;  4DRB A;  5FUG B;  3MNN A;  4Z5T C;  2ARO B;  4WU9 A;  2F8N K;  1EQZ C;  5BNX B;  3AZK D;  5CP6 B;  3W96 B;  1A7W A;  1KX3 D;  1F66 A;  5B32 G;  3W98 B;  3AZK B;  3AZK C;  1BH9 B;  1F1E A;  4H9R B;  1KX3 C;  3UTB D;  4CSR A;  5CPI D;  2L5A A;  5CPJ B;  3WAA D;  1M18 B;  3UTB C;  4AWL B;  1P3L D;  3VH6 W;  1ID3 A;  5CPI C;  3NQU A;  3LEL A;  3WAA C;  4J8V D;  4J8U D;  1P3F D;  3REH A;  3WAA B;  3UT9 D;  4Z66 A;  1P3L C;  4G92 B;  4G92 C;  3REL B;  5B24 D;  4KGC D;  1M1A A;  4J8V C;  5JRG D;  4J8U C;  3NQJ A;  3REJ D;  1P3F C;  3UT9 C;  3UTA A;  5AV9 A;  5BO0 B;  3WKJ B;  3VH6 T;  4H9S A;  5B24 C;  3B6F B;  4KGC B;  4KGC C;  3C1C D;  4H9Q B;  1P3K D;  3AN2 D;  5JRG C;  3REJ C;  3AZH A;  3V9R A;  5E5A A;  3C1C C;  1P3K B;  3AN2 C;  3KXB D;  3C1B D;  3MGS D;  1H3O A;  1P3K C;  4J8W A;  3AZF C;  5BNV A;  5AV6 D;  1KX4 B;  3KXB B;  3KXB C;  3MGS C;  3C1B B;  3C1B C;  1WWS A;  5AV5 B;  5B0Y D;  4G91 B;  2IO5 C;  4G91 C;  3W97 B;  2JSS A;  4NE3 A;  3LZ1 A;  5AV6 B;  5AV6 C;  3AYW D;  4KUD A;  4ZUX D;  5DNM B;  5B0Y C;  3AYW B;  3AYW C;  3X1T D;  3W99 B;  4NE5 A;  4H9O A;  5B1L B;  4ZUX B;  4ZUX C;  3O62 B;  3X1T C;  3X1T B;  4R8P B;  2F8N A;  4X23 D;  5C3I B;  5B31 A;  3MGR B;  4NFT A;  2NZD B;  3AV1 B;  5AVB A;  4X23 C;  4X23 B;  3AZI B;  1P3A B;  1P3I D;  2HIO D;  3WTP E;  2FJ7 D;  4J8X B;  4XUJ A;  3MVD B;  1P3I C;  2HIO C;  5B40 D;  3AZJ A;  5F99 B;  4YM6 A;  3AZM D;  3AZE A;  2FJ7 B;  2FJ7 C;  3WTP D;  3AV2 B;  3A6N B;  4WNN A;  2BYK A;  5B40 B;  3REI A;  5B40 C;  4H9P A;  3AZM C;  3WA9 A;  4KHA A;  2YFV A;  3WTP C;  3TU4 D;  1TZY B;  3LZ0 A;  3REK A;  5AVC B;  3KWQ B;  3X1V D;  4UUZ A;  4WU9 B;  3AFA A;  4H9N A;  3TU4 C;  1KX5 A;  3X1V C;  1P3M A;  2CV5 C;  2RVQ D;  5DNN D;  1F66 B;  3AZL A;  3LJA A;  5B2I D;  2RVQ C;  5B0Z A;  5DNN C;  3KUY D;  5G49 A;  4CSR B;  2ARO D;  5B2I C;  4LD9 A;  1HQ3 D;  1U35 A;  3B0D C;  5B2J A;  3KUY C;  1P3B A;  5BS7 C;  2ARO C;  2YFW A;  5CP6 D;  1BFM A;  3NQU B;  4CAY A;  3LEL B;  3W96 D;  1HQ3 C;  1HQ3 B;  5B32 A;  4Z2M H;  3AZN A;  3W98 D;  1M19 A;  1N1J A;  5CP6 C;  5B33 A;  3X1U A;  3W96 C;  3NQJ B;  3W98 C;  5AV9 B;  5CPJ D;  1M18 D;  5GT3 A;  3AZH B;  4JJN A;  3B6G A;  3V9R B;  5E5A B;  5AY8 A;  1ZLA A;  5CPJ C;  5CPK A;  1H3O B;  1M18 C;  5GSU D;  4J8W B;  4AWL C;  5BNV B;  5AV8 D;  3REL D;  4KUD D;  5GSU B;  5GSU C;  1AOI A;  5AV8 B;  5AV8 C;  3AZG A;  3REL C;  3WKJ D;  3B6F D;  4KUD B;  4KUD C;  1S32 A;  3WKJ C;  3B6F C;  4H9O B;  3R45 B;  1P3G D;  4YS3 A;  5JA4 A;  1KX4 D;  5FUG A;  4Z5T A;  1P3G B;  4WU8 D;  1P3G C;  2F8N B;  5AV5 D;  1EQZ A;  4ZBJ B;  3W97 D;  5B1M A;  1KX4 C;  5AVB B;  4WU8 B;  4WU8 C;  5AV5 C;  5DNM D;  4HGA B;  3W97 C;  3W99 D;  3AZK A;  5B1L D;  3O62 D;  3AZJ D;  5DNM C;  1KX3 A;  4XUJ B;  3W99 C;  1P3O A;  4R8P D;  5B1L C;  2F8N H;  5GXQ A;  3O62 C;  4YM6 B;  3AZJ B;  3AZE B;  3UTB A;  3MGR D;  4WNN B;  2NZD D;  4R8P C;  1P3P D;  3AV1 D;  2BYK B;  3REI B;  5CPI A;  4H9P B;  3WA9 B;  1KU5 A;  3AZI D;  1P3A D;  4KHA B;  2YFV B;  5C3I C;  4QLC D;  3LZ0 B;  3MGR C;  3REK B;  1B6W A;  1P3P B;  3AV1 C;  1P3P C;  1P3L A;  2NZD C;  4EO5 B;  5CHL B;  1P34 D;  3AZI C;  4J8U A;  4J8V A;  1P3A C;  4J8X D;  1P3F A;  3AFA B;  3UT9 A;  4QLC C;  4QLC B;  3MVD D;  1KX5 B;  5B24 A;  1P34 B;  1P34 C;  5F99 D;  5JRG A;  3REJ A;  4J8X C;  1P3M B;  3MVD C;  2BYM A;  3AV2 D;  5B0Z D;  3A6N D;  3AZL B;  3LJA B;  5F99 C;  3C1C A;  1P3K A;  3AN2 A;  2PYO A;  3AV2 C;  1TZY D;  5B0Z B;  5B0Z C;  5AVC D;  3A6N C;  3AZF A;  1Q9C A;  3KWQ D;  3MNN D;  3MGS A;  4WU9 D;  4LD9 B;  1WWI A;  1TZY C;  1U35 B;  5AVC C;  5B2J B; 
#chains in the Genus database with same CATH topology
 4WZS B;  3KWQ C;  2CWE A;  3MNN C;  3MNN B;  1P3B B;  3X1U D;  2YFW B;  4WU9 C;  1JFI A;  4CAY B;  5B32 B;  3AZN B;  5B0Y A;  1F66 D;  1N1J B;  3X1U C;  5B33 B;  3X1U B;  3EPL A;  5GT0 A;  4ZUX A;  1F66 C;  3B0B A;  3VH5 A;  1ZLA D;  4UPK A;  1TAF A;  5CPK D;  2Y2H A;  4XZQ A;  4JJN B;  1ID3 D;  1HTA A;  3X1S A;  1ZLA C;  4DRA A;  1ZLA B;  5CPK B;  3LEL D;  5CPK C;  3REH D;  1AOI D;  4Z66 D;  1ID3 C;  1BH8 A;  1ID3 B;  3AL0 C;  2Y2L A;  5KDM A;  3LEL C;  1M1A D;  3REH B;  3REH C;  1AOI B;  4Z66 B;  4Z66 C;  3UTA D;  1AOI C;  5AV9 D;  3AZG B;  1P3I A;  2HIO A;  1M1A B;  1M1A C;  3UTA C;  3UTA B;  3F6T A;  4E44 A;  3AZH D;  5AV9 C;  1S32 B;  3FDD A;  5E5A D;  4H9S C;  3MGQ A;  1W2E A;  3AZM A;  3MGP A;  3AZH C;  4J8W D;  3WTP A;  4YS3 B;  5JA4 B;  5E5A C;  2Y2G A;  2G5H C;  1Z2C B;  5B1M D;  4Z5T B;  4J8W C;  3TU4 A;  1EQZ B;  3B0C T;  5B1M B;  5B1M C;  3LZ1 D;  3X1V A;  4DQY B;  2RIQ A;  2CV5 A;  3LZ1 B;  3LZ1 C;  2G5I C;  2FFF B;  1P3O D;  2LY8 A;  5GXQ D;  2JCH A;  5BT1 D;  2Y2P A;  2ZM5 A;  1KX3 B;  2NQB A;  5DNN A;  4Z2M G;  1P3O C;  1P3O B;  5B2I A;  2F8N D;  5GXQ B;  5GXQ C;  4WV4 B;  5BT1 C;  3KUY A;  3UTB B;  5B31 D;  5BS7 A;  5AVB D;  2ARO A;  5CPI B;  1HQ3 A;  4ZBJ C;  1P3L B;  5B31 B;  5B31 C;  5BNX A;  5CP6 A;  5AVB C;  3W96 A;  2Y2M A;  4J8U B;  2W8S A;  4J8V B;  4HGA C;  1P3F B;  3UT9 B;  4XUJ D;  3W98 A;  5B24 B;  1BH9 A;  4YM6 D;  4H9R A;  3AZE D;  5JRG B;  4NE6 A;  3REJ B;  4XUJ C;  2PYO D;  2BYM B;  3AZF D;  3REI D;  3VH6 A;  3AZJ C;  3C1C B;  4YM6 C;  3WA9 D;  3AZE C;  3AN2 B;  5CPJ A;  1M18 A;  2PYO C;  2PYO B;  3LZ0 D;  3REK D;  3AZF B;  3REI C;  3WA9 C;  2JE5 A;  3MGS B;  3WAA A;  5GSU A;  3AFA D;  3LZ0 C;  2ZY3 A;  5AV8 A;  2F2A C;  3REK C;  1KX5 D;  3REL A;  2IO5 B;  1B67 A;  4EO5 C;  1JFI B;  4UUZ B;  2BG1 A;  3AFA C;  5GT0 D;  4H9N B;  1P3M D;  1KX5 C;  5B0Y B;  5BO0 A;  3WKJ A;  3B6F A;  3AZL D;  4KGC A;  3LJA D;  4H9Q A;  3R45 A;  5GT0 B;  5GT0 C;  1P3M C;  4E45 A;  4XZQ D;  3AZL C;  3LJA C;  3X1S D;  1P3G A;  4LD9 D;  1TAF B;  1U35 D;  5B2J D;  4XZQ B;  4XZQ C;  3VH5 W;  1KX4 A;  5G49 B;  3KXB A;  3X1S B;  3C1B A;  3X1S C;  1P3B D;  4LD9 C;  4WU8 A;  5AV5 A;  5B32 D;  1U35 C;  2F8N G;  3AZN D;  5B2J C;  3W97 A;  1BH8 B;  2XD5 A;  5AV6 A;  1M19 D;  1P3B C;  5B33 D;  2UWX A;  5B31 G;  5KDM B;  4WJ3 C;  5B32 C;  5DNM A;  3AZN C;  3AYW A;  3W99 A;  1M19 C;  1M19 B;  3VH5 T;  5B33 C;  5B1L A;  2HIO B;  3MGQ D;  1P3I B;  3O62 A;  3MGP D;  5GT3 D;  3X1T A;  4JJN D;  3B6G D;  4R8P A;  3MGQ B;  3MGQ C;  5AY8 D;  3AZM B;  3MGP B;  3MGP C;  5GT3 C;  5GT3 B;  3WTP B;  4JJN C;  3B6G B;  3MGR A;  3B6G C;  2DF4 C;  2NZD A;  1P3P A;  3AV1 A;  5AY8 C;  5AY8 B;  4X23 A;  1PZR A;  3AZI A;  1P3A A;  3TU4 B;  3H0R C;  4QLC A;  2CV5 D;  3AZG D;  3X1V B;  1P34 A;  4J8X A;  3MVD A;  1S32 D;  2CV5 B;  3AZG C;  2NQB D;  5F99 A;  2FJ7 A;  3B0C W;  1S32 C;  3A1K A;  4YS3 D;  3A6N A;  1R4V A;  3AV2 A;  2NQB C;  5DNN B;  2NQB B;  5B40 A;  2HUE B;  2HUE C;  4Z5T D;  5B2I B;  2ZY4 A;  4YS3 C;  1TZY A;  5AVC A;  3B0D B;  4M6B A;  1EQZ D;  3KUY B;  3KWQ A;  3KSY A;  1ULY A;  4DRB A;  5FUG B;  3MNN A;  4Z5T C;  2ARO B;  3H0L C;  4WU9 A;  2F8N K;  1EQZ C;  5BNX B;  3AZK D;  5CP6 B;  3W96 B;  1A7W A;  1KX3 D;  1F66 A;  5B32 G;  3W98 B;  3AZK B;  3AZK C;  2VQR A;  1BH9 B;  1F1E A;  4H9R B;  1KX3 C;  3UTB D;  4CSR A;  5CPI D;  2L5A A;  5CPJ B;  3WAA D;  1M18 B;  3UTB C;  2ZY5 A;  4AWL B;  1P3L D;  3VH6 W;  1ID3 A;  5CPI C;  3NQU A;  3LEL A;  3WAA C;  4J8V D;  4J8U D;  1P3F D;  3REH A;  3WAA B;  3UT9 D;  4Z66 A;  1P3L C;  4G92 B;  4G92 C;  3REL B;  5B24 D;  4KGC D;  1M1A A;  4J8V C;  5JRG D;  4J8U C;  3NQJ A;  3REJ D;  1P3F C;  3UT9 C;  3UTA A;  5AV9 A;  5BO0 B;  3WKJ B;  3VH6 T;  4H9S A;  5B24 C;  3B6F B;  4KGC B;  4KGC C;  3C1C D;  4H9Q B;  2Y2J A;  3AN2 D;  5JRG C;  3REJ C;  1P3K D;  3AZH A;  3V9R A;  5E5A A;  3C1C C;  1P3K B;  3AN2 C;  3KXB D;  3C1B D;  3MGS D;  1H3O A;  1P3K C;  4J8W A;  3AZF C;  5BNV A;  5AV6 D;  1KX4 B;  3KXB B;  3KXB C;  3MGS C;  3C1B B;  3C1B C;  3H0M C;  1WWS A;  5AV5 B;  5B0Y D;  4G91 B;  2IO5 C;  4G91 C;  3W97 B;  2JSS A;  4NE3 A;  3LZ1 A;  5AV6 B;  5AV6 C;  3AYW D;  4KUD A;  4ZUX D;  5DNM B;  5B0Y C;  3AYW B;  3AYW C;  3X1T D;  3W99 B;  4NE5 A;  4H9O A;  5B1L B;  4ZUX B;  4ZUX C;  3O62 B;  3X1T C;  3X1T B;  3A1I A;  4R8P B;  2F8N A;  4X23 D;  5C3I B;  5B31 A;  3MGR B;  4NFT A;  2NZD B;  3AV1 B;  5AVB A;  4X23 C;  4X23 B;  3AZI B;  3IP4 C;  1P3A B;  1P3I D;  2HIO D;  3WTP E;  2FJ7 D;  4J8X B;  4XUJ A;  3MVD B;  1P3I C;  2HIO C;  5B40 D;  3AZJ A;  5F99 B;  4YM6 A;  3EPJ A;  3AZM D;  3AZE A;  2FJ7 B;  2FJ7 C;  3WTP D;  3AV2 B;  3A6N B;  4WNN A;  2BYK A;  5B40 B;  3REI A;  5B40 C;  4H9P A;  3AZM C;  3WA9 A;  4KHA A;  2YFV A;  3WTP C;  3TU4 D;  1TZY B;  3LZ0 A;  3REK A;  5AVC B;  3KWQ B;  3X1V D;  4UUZ A;  4WU9 B;  3AFA A;  4H9N A;  3TU4 C;  1KX5 A;  3X1V C;  2Y2O A;  1P3M A;  2CV5 C;  2RVQ D;  5DNN D;  3EG5 B;  1F66 B;  3AZL A;  3LJA A;  5B2I D;  2RVQ C;  5B0Z A;  5DNN C;  3KUY D;  3EPH A;  5G49 A;  4CSR B;  2ARO D;  5B2I C;  4LD9 A;  1HQ3 D;  1U35 A;  3B0D C;  5B2J A;  3KUY C;  1P3B A;  5BS7 C;  2ARO C;  2YFW A;  5CP6 D;  1BFM A;  3NQU B;  4CAY A;  3LEL B;  3W96 D;  1HQ3 C;  1HQ3 B;  5B32 A;  4Z2M H;  3AZN A;  3W98 D;  1M19 A;  1N1J A;  5CP6 C;  5B33 A;  3X1U A;  3W96 C;  3NQJ B;  3W98 C;  5AV9 B;  5CPJ D;  1M18 D;  5GT3 A;  3AZH B;  4JJN A;  3B6G A;  3V9R B;  5E5A B;  3EPK A;  2ZY2 A;  5AY8 A;  1ZLA A;  5CPJ C;  5CPK A;  1H3O B;  1M18 C;  5GSU D;  4J8W B;  4AWL C;  5BNV B;  5AV8 D;  3REL D;  4KUD D;  2DQN C;  5GSU B;  2Y2I A;  5GSU C;  1AOI A;  5AV8 B;  5AV8 C;  3AZG A;  3REL C;  3WKJ D;  3B6F D;  4KUD B;  4KUD C;  1S32 A;  3WKJ C;  3B6F C;  4H9O B;  3R45 B;  1P3G D;  4YS3 A;  5JA4 A;  1KX4 D;  5FUG A;  3KFU G;  4Z5T A;  1P3G B;  4WU8 D;  1P3G C;  2F8N B;  5AV5 D;  1EQZ A;  4ZBJ B;  3W97 D;  5B1M A;  1KX4 C;  5AVB B;  4WU8 B;  4WU8 C;  5AV5 C;  5DNM D;  4HGA B;  3W97 C;  3W99 D;  2XD1 A;  3AZK A;  2J8P A;  5B1L D;  3O62 D;  3AZJ D;  5DNM C;  1KX3 A;  4XUJ B;  3W99 C;  1P3O A;  4R8P D;  5B1L C;  2F8N H;  5GXQ A;  3O62 C;  4YM6 B;  3AZJ B;  3AZE B;  3UTB A;  3MGR D;  4WNN B;  2NZD D;  4R8P C;  1P3P D;  3AV1 D;  2BYK B;  3REI B;  5CPI A;  4H9P B;  3WA9 B;  1KU5 A;  3AZI D;  1P3A D;  4KHA B;  2YFV B;  5C3I C;  4QLC D;  3LZ0 B;  3MGR C;  3REK B;  1B6W A;  1P3P B;  3AV1 C;  1P3P C;  1P3L A;  2NZD C;  3P5J B;  4EO5 B;  5CHL B;  1P34 D;  3AZI C;  4J8U A;  2Y2Q A;  4J8V A;  4J8X D;  1P3A C;  3AFA B;  3UT9 A;  1P3F A;  4QLC C;  4QLC B;  3MVD D;  1KX5 B;  5B24 A;  1P34 B;  1P34 C;  5F99 D;  2Y2K A;  5JRG A;  3REJ A;  4J8X C;  1P3M B;  3MVD C;  2BYM A;  3AV2 D;  5B0Z D;  3A6N D;  1T3U A;  3AZL B;  3LJA B;  5F99 C;  2Y2N A;  3C1C A;  1P3K A;  3AN2 A;  2PYO A;  3AV2 C;  1TZY D;  5B0Z B;  5B0Z C;  5AVC D;  3A6N C;  3AZF A;  1Q9C A;  3KWQ D;  3MNN D;  3MGS A;  4WU9 D;  4LD9 B;  1WWI A;  1TZY C;  1U35 B;  5AVC C;  5B2J B; 
#chains in the Genus database with same CATH homology
 4WZS B;  3KWQ C;  2CWE A;  3MNN C;  3MNN B;  1P3B B;  3X1U D;  2YFW B;  4WU9 C;  1JFI A;  4CAY B;  5B32 B;  3AZN B;  5B0Y A;  1F66 D;  1N1J B;  3X1U C;  5B33 B;  3X1U B;  3EPL A;  5GT0 A;  4ZUX A;  1F66 C;  3B0B A;  3VH5 A;  1ZLA D;  4UPK A;  1TAF A;  5CPK D;  2Y2H A;  4XZQ A;  4JJN B;  1ID3 D;  1HTA A;  3X1S A;  1ZLA C;  4DRA A;  1ZLA B;  5CPK B;  3LEL D;  5CPK C;  3REH D;  1AOI D;  4Z66 D;  1ID3 C;  1BH8 A;  1ID3 B;  3AL0 C;  2Y2L A;  5KDM A;  3LEL C;  1M1A D;  3REH B;  3REH C;  1AOI B;  4Z66 B;  4Z66 C;  3UTA D;  1AOI C;  5AV9 D;  3AZG B;  1P3I A;  2HIO A;  1M1A B;  1M1A C;  3UTA C;  3UTA B;  3F6T A;  4E44 A;  3AZH D;  5AV9 C;  1S32 B;  3FDD A;  5E5A D;  4H9S C;  3MGQ A;  1W2E A;  3AZM A;  3MGP A;  3AZH C;  4J8W D;  3WTP A;  4YS3 B;  5JA4 B;  5E5A C;  2Y2G A;  2G5H C;  1Z2C B;  5B1M D;  4Z5T B;  4J8W C;  3TU4 A;  1EQZ B;  3B0C T;  5B1M B;  5B1M C;  3LZ1 D;  3X1V A;  4DQY B;  2RIQ A;  2CV5 A;  3LZ1 B;  3LZ1 C;  2G5I C;  2FFF B;  1P3O D;  2LY8 A;  5GXQ D;  2JCH A;  5BT1 D;  2Y2P A;  2ZM5 A;  1KX3 B;  2NQB A;  5DNN A;  4Z2M G;  1P3O C;  1P3O B;  5B2I A;  2F8N D;  5GXQ B;  5GXQ C;  4WV4 B;  5BT1 C;  3KUY A;  3UTB B;  5B31 D;  5BS7 A;  5AVB D;  2ARO A;  5CPI B;  1HQ3 A;  4ZBJ C;  1P3L B;  5B31 B;  5B31 C;  5BNX A;  5CP6 A;  5AVB C;  3W96 A;  2Y2M A;  4J8U B;  2W8S A;  4J8V B;  4HGA C;  1P3F B;  3UT9 B;  4XUJ D;  3W98 A;  5B24 B;  1BH9 A;  4YM6 D;  4H9R A;  3AZE D;  5JRG B;  4NE6 A;  3REJ B;  4XUJ C;  2PYO D;  2BYM B;  3AZF D;  3REI D;  3VH6 A;  3AZJ C;  3C1C B;  4YM6 C;  3WA9 D;  3AZE C;  3AN2 B;  5CPJ A;  1M18 A;  2PYO C;  2PYO B;  3LZ0 D;  3REK D;  3AZF B;  3REI C;  3WA9 C;  2JE5 A;  3MGS B;  3WAA A;  5GSU A;  3AFA D;  3LZ0 C;  2ZY3 A;  5AV8 A;  2F2A C;  3REK C;  1KX5 D;  3REL A;  2IO5 B;  1B67 A;  4EO5 C;  1JFI B;  4UUZ B;  2BG1 A;  3AFA C;  5GT0 D;  4H9N B;  1P3M D;  1KX5 C;  5B0Y B;  5BO0 A;  3WKJ A;  3B6F A;  3AZL D;  4KGC A;  3LJA D;  4H9Q A;  3R45 A;  5GT0 B;  5GT0 C;  1P3M C;  4E45 A;  4XZQ D;  3AZL C;  3LJA C;  3X1S D;  1P3G A;  4LD9 D;  1TAF B;  1U35 D;  5B2J D;  4XZQ B;  4XZQ C;  3VH5 W;  1KX4 A;  5G49 B;  3KXB A;  3X1S B;  3C1B A;  3X1S C;  1P3B D;  4LD9 C;  4WU8 A;  5AV5 A;  5B32 D;  1U35 C;  2F8N G;  3AZN D;  5B2J C;  3W97 A;  1BH8 B;  2XD5 A;  5AV6 A;  1M19 D;  1P3B C;  5B33 D;  2UWX A;  5B31 G;  5KDM B;  4WJ3 C;  5B32 C;  5DNM A;  3AZN C;  3AYW A;  3W99 A;  1M19 C;  1M19 B;  3VH5 T;  5B33 C;  5B1L A;  2HIO B;  3MGQ D;  1P3I B;  3O62 A;  3MGP D;  5GT3 D;  3X1T A;  4JJN D;  3B6G D;  4R8P A;  3MGQ B;  3MGQ C;  5AY8 D;  3AZM B;  3MGP B;  3MGP C;  5GT3 C;  5GT3 B;  3WTP B;  4JJN C;  3B6G B;  3MGR A;  3B6G C;  2DF4 C;  2NZD A;  1P3P A;  3AV1 A;  5AY8 C;  5AY8 B;  4X23 A;  1PZR A;  3AZI A;  1P3A A;  3TU4 B;  3H0R C;  4QLC A;  2CV5 D;  3AZG D;  3X1V B;  1P34 A;  4J8X A;  3MVD A;  1S32 D;  2CV5 B;  3AZG C;  2NQB D;  5F99 A;  2FJ7 A;  3B0C W;  1S32 C;  3A1K A;  4YS3 D;  3A6N A;  1R4V A;  3AV2 A;  2NQB C;  5DNN B;  2NQB B;  5B40 A;  2HUE B;  2HUE C;  4Z5T D;  5B2I B;  2ZY4 A;  4YS3 C;  1TZY A;  5AVC A;  3B0D B;  4M6B A;  1EQZ D;  3KUY B;  3KWQ A;  3KSY A;  1ULY A;  4DRB A;  5FUG B;  3MNN A;  4Z5T C;  2ARO B;  3H0L C;  4WU9 A;  2F8N K;  1EQZ C;  5BNX B;  3AZK D;  5CP6 B;  3W96 B;  1A7W A;  1KX3 D;  1F66 A;  5B32 G;  3W98 B;  3AZK B;  3AZK C;  2VQR A;  1BH9 B;  1F1E A;  4H9R B;  1KX3 C;  3UTB D;  4CSR A;  5CPI D;  2L5A A;  5CPJ B;  3WAA D;  1M18 B;  3UTB C;  2ZY5 A;  4AWL B;  1P3L D;  3VH6 W;  1ID3 A;  5CPI C;  3NQU A;  3LEL A;  3WAA C;  4J8V D;  4J8U D;  1P3F D;  3REH A;  3WAA B;  3UT9 D;  4Z66 A;  1P3L C;  4G92 B;  4G92 C;  3REL B;  5B24 D;  4KGC D;  1M1A A;  4J8V C;  5JRG D;  4J8U C;  3NQJ A;  3REJ D;  1P3F C;  3UT9 C;  3UTA A;  5AV9 A;  5BO0 B;  3WKJ B;  3VH6 T;  4H9S A;  5B24 C;  3B6F B;  4KGC B;  4KGC C;  3C1C D;  4H9Q B;  2Y2J A;  3AN2 D;  5JRG C;  3REJ C;  1P3K D;  3AZH A;  3V9R A;  5E5A A;  3C1C C;  1P3K B;  3AN2 C;  3KXB D;  3C1B D;  3MGS D;  1H3O A;  1P3K C;  4J8W A;  3AZF C;  5BNV A;  5AV6 D;  1KX4 B;  3KXB B;  3KXB C;  3MGS C;  3C1B B;  3C1B C;  3H0M C;  1WWS A;  5AV5 B;  5B0Y D;  4G91 B;  2IO5 C;  4G91 C;  3W97 B;  2JSS A;  4NE3 A;  3LZ1 A;  5AV6 B;  5AV6 C;  3AYW D;  4KUD A;  4ZUX D;  5DNM B;  5B0Y C;  3AYW B;  3AYW C;  3X1T D;  3W99 B;  4NE5 A;  4H9O A;  5B1L B;  4ZUX B;  4ZUX C;  3O62 B;  3X1T C;  3X1T B;  3A1I A;  4R8P B;  2F8N A;  4X23 D;  5C3I B;  5B31 A;  3MGR B;  4NFT A;  2NZD B;  3AV1 B;  5AVB A;  4X23 C;  4X23 B;  3AZI B;  3IP4 C;  1P3A B;  1P3I D;  2HIO D;  3WTP E;  2FJ7 D;  4J8X B;  4XUJ A;  3MVD B;  1P3I C;  2HIO C;  5B40 D;  3AZJ A;  5F99 B;  4YM6 A;  3EPJ A;  3AZM D;  3AZE A;  2FJ7 B;  2FJ7 C;  3WTP D;  3AV2 B;  3A6N B;  4WNN A;  2BYK A;  5B40 B;  3REI A;  5B40 C;  4H9P A;  3AZM C;  3WA9 A;  4KHA A;  2YFV A;  3WTP C;  3TU4 D;  1TZY B;  3LZ0 A;  3REK A;  5AVC B;  3KWQ B;  3X1V D;  4UUZ A;  4WU9 B;  3AFA A;  4H9N A;  3TU4 C;  1KX5 A;  3X1V C;  2Y2O A;  1P3M A;  2CV5 C;  2RVQ D;  5DNN D;  3EG5 B;  1F66 B;  3AZL A;  3LJA A;  5B2I D;  2RVQ C;  5B0Z A;  5DNN C;  3KUY D;  3EPH A;  5G49 A;  4CSR B;  2ARO D;  5B2I C;  4LD9 A;  1HQ3 D;  1U35 A;  3B0D C;  5B2J A;  3KUY C;  1P3B A;  5BS7 C;  2ARO C;  2YFW A;  5CP6 D;  1BFM A;  3NQU B;  4CAY A;  3LEL B;  3W96 D;  1HQ3 C;  1HQ3 B;  5B32 A;  4Z2M H;  3AZN A;  3W98 D;  1M19 A;  1N1J A;  5CP6 C;  5B33 A;  3X1U A;  3W96 C;  3NQJ B;  3W98 C;  5AV9 B;  5CPJ D;  1M18 D;  5GT3 A;  3AZH B;  4JJN A;  3B6G A;  3V9R B;  5E5A B;  3EPK A;  2ZY2 A;  5AY8 A;  1ZLA A;  5CPJ C;  5CPK A;  1H3O B;  1M18 C;  5GSU D;  4J8W B;  4AWL C;  5BNV B;  5AV8 D;  3REL D;  4KUD D;  2DQN C;  5GSU B;  2Y2I A;  5GSU C;  1AOI A;  5AV8 B;  5AV8 C;  3AZG A;  3REL C;  3WKJ D;  3B6F D;  4KUD B;  4KUD C;  1S32 A;  3WKJ C;  3B6F C;  4H9O B;  3R45 B;  1P3G D;  4YS3 A;  5JA4 A;  1KX4 D;  5FUG A;  3KFU G;  4Z5T A;  1P3G B;  4WU8 D;  1P3G C;  2F8N B;  5AV5 D;  1EQZ A;  4ZBJ B;  3W97 D;  5B1M A;  1KX4 C;  5AVB B;  4WU8 B;  4WU8 C;  5AV5 C;  5DNM D;  4HGA B;  3W97 C;  3W99 D;  2XD1 A;  3AZK A;  2J8P A;  5B1L D;  3O62 D;  3AZJ D;  5DNM C;  1KX3 A;  4XUJ B;  3W99 C;  1P3O A;  4R8P D;  5B1L C;  2F8N H;  5GXQ A;  3O62 C;  4YM6 B;  3AZJ B;  3AZE B;  3UTB A;  3MGR D;  4WNN B;  2NZD D;  4R8P C;  1P3P D;  3AV1 D;  2BYK B;  3REI B;  5CPI A;  4H9P B;  3WA9 B;  1KU5 A;  3AZI D;  1P3A D;  4KHA B;  2YFV B;  5C3I C;  4QLC D;  3LZ0 B;  3MGR C;  3REK B;  1B6W A;  1P3P B;  3AV1 C;  1P3P C;  1P3L A;  2NZD C;  3P5J B;  4EO5 B;  5CHL B;  1P34 D;  3AZI C;  4J8U A;  2Y2Q A;  4J8V A;  4J8X D;  1P3A C;  3AFA B;  3UT9 A;  1P3F A;  4QLC C;  4QLC B;  3MVD D;  1KX5 B;  5B24 A;  1P34 B;  1P34 C;  5F99 D;  2Y2K A;  5JRG A;  3REJ A;  4J8X C;  1P3M B;  3MVD C;  2BYM A;  3AV2 D;  5B0Z D;  3A6N D;  1T3U A;  3AZL B;  3LJA B;  5F99 C;  2Y2N A;  3C1C A;  1P3K A;  3AN2 A;  2PYO A;  3AV2 C;  1TZY D;  5B0Z B;  5B0Z C;  5AVC D;  3A6N C;  3AZF A;  1Q9C A;  3KWQ D;  3MNN D;  3MGS A;  4WU9 D;  4LD9 B;  1WWI A;  1TZY C;  1U35 B;  5AVC C;  5B2J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...