3MGQD

Binding of nickel ions to the nucleosome core particle
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
100
structure length
100
Chain Sequence
GKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 34
structure length 100
sequence length 100
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgqD00
1KX4A 3REHC 5BNVA 3AZHC 1P34C 4H9PA 3WAAA 3LELB 3WA9C 4ZUXD 1F66D 2F8ND 3MGSA 3X1TC 3O62A 4J8UB 5AV5C 3MGQC 3KUYD 1P3LB 3REKA 5GXQC 4R8PC 2LY8A 3UTAD 5FUGB 1M18D 2AROD 3X1UA 4EO5C 3X1VB 3REJA 1P3GD 3AZKA 3W98D 1ZLAC 5DNND 5CP6D 3WTPA 3AZNA 2FJ7D 1S32C 1AOIA 3LZ0A 5AV9D 5E5AD 4Z2MH 5B2JD 3AN2A 2HUEB 4YS3D 4J8XB 5B1MB 3AZFB 1N1JB 5CPKD 5B40B 5BO0B 1P3KD 3W96A 5B31G 4G91B 5GT3A 3AZGC 5BNXA 3X1SD 5B1LB 5AY8B 1TZYA 3LELD 4JJNC 3MGPA 3AV2B 3W99A 4XUJB 5B32C 3UTBB 1P3AA 3C1BA 4J8WA 4Z66A 1P3LD 3MNNC 4WU8B 1P3FB 3TU4C 4YM6B 5AV6B 1P3IC 4AWLC 3AZLC 5B0YB 4UUZB 2NZDA 1BH9A 1KX3C 4Z5TA 4M6BA 5B33C 1EQZC 4J8XD 3WKJB 1EQZB 5B1MD 3AZFD 5JA4A 5F99C 3KXBA 3AZJB 3WA9B 5JRGC 3AZKD 5CHLB 4WNNB 5G49A 5BS7C 1M1AA 2PYOD 3REHB 3AZHB 5B24D 3R45A 5AVBA 5DNMC 5KDMB 1P3PC 3KWQC 5B1LD 5AY8D 1U35C 4ZUXA 1F66A 2F8NA 3NQUB 3AV2D 4J8VC 4KGCC 4XZQC 5AV5B 4XUJD 3MGQB 3UTBD 3MGRC 4WU9C 3MVDC 2CV5C 5GXQB 4R8PB 3KUYA 4KUDC 4WU8D 1P3FD 3W96D 1TAFA 4EO5B 3UTAA 3VH5A 1M18A 1M19B 2AROA 1ZLAB 3B6FC 5CPJB 3W98A 5GT0C 5CP6A 5GSUA 1S32B 5AVCC 2JSSA 1KX5C 3O62C 2FJ7A 1Q9CA 1JFIA 5E5AA 4CSRB 5B2JA 3REKC 1ID3D 4YS3A 3WKJD 3AZJD 1P3OA 5CPKA 3NQUA 1P3KA 3AZHD 3AZGB 3AZNC 4JJNB 1BH8B 3LELA 4DRAA 3RELC 5B32B 5AV5D 3B6GC 3MGQD 3W97B 4J8UA 5GXQD 4R8PD 3TU4B 1P3LA 4H9OB 5CPIB 5FUGA 3AYWC 1M19D 3AZIC 4AWLB 3AV1C 3AZLB 1ZLAD 5CPJD 3MGPC 3VH6T 4H9QB 3LJAC 1S32D 1KX3B 2HIOB 2NQBC 3AZEC 3A6NC 5B0ZC 4H9NB 5F99B 4J8XA 5B1MA 3AZFA 1N1JA 5BO0A 2PYOA 5DNMB 1P3PB 5GSUD 5B24A 3LZ1D 3AZGD 3KWQB 4JJND 1U35B 2F8NG 5B1LA 5AY8A 4Z5TC 4J8VB 3AZMB 4KGCB 4XZQB 3AV2A 1B67A 3MVDB 3W97D 4XUJA 1KU5A 3UTBA 2CV5B 2RVQD 3KXBC 1P3OD 1P3MD 4KUDB 3TU4D 1M1AC 4WU8A 1P3FA 5CPID 5AVBC 5B2IC 4H9SA 5AV6A 3B6FB 3B0CW 5GT0B 2BYMB 4NE6A 5AVCB 1KX5B 5B0YA 4UUZA 1KX3D 2HIOD 4J8UD 1A7WA 1ID3A 3VH5T 3WKJA 3UTAC 3C1CB 3AZJA 3X1VD 1M18C 4QLCB 3WA9A 5B31C 1HQ3C 4LD9C 4WNNA 1P3GC 5DNMD 3REHA 3W98C 3AZHA 4Z2MG 3KWQD 5DNNC 4NFTA 5KDMA 4X23B 1U35D 3RELB 4J8VD 3AZMD 4KGCD 4XZQD 3REIC 3B6GB 5AV9C 2BYKB 5E5AC 1ULYA 3MVDD 3AFAC 2L5AA 5AV5A 4YS3C 3UT9B 3MGQA 3V9RB 5B40D 4KUDD 5GXQA 4R8PA 2IO5C 3AYWB 3AZIB 1P3KC 1P34B 3B0DC 3AV1B 4WZSB 1M19A 4H9RB 5AV8C 3LELC 3X1SC 4KHAB 4G92C 1ZLAA 5CPJA 3LJAB 3X1TB 5AVCD 1KX5D 2NQBB 1S32A 3AZEB 3A6NB 5B0ZB 1P3BC 4CSRA 4WV4B 1KX4C 3C1CD 4YM6D 5AV6D 4QLCD 3WAAC 5B0YD 3LZ1A 3AZGA 3MGSC 4JJNA 1BH8A 2YFVB 4X23D 3RELD 3B6GD 2HUEC 1H3OB 3UT9D 3W97A 5B1MC 3X1UC 3WA9D 5BT1D 1P3MA 3REJC 3TU4A 3AZKC 2CWEA 3NQJB 4H9OA 3REHD 3AZID 2PYOC 1P34D 5B2IB 5CPIA 5B24C 3WTPC 3AV1D 4G91C 3B0BA 5B1LC 3AZLA 1AOIC 3LJAD 3LZ0C 3X1TD 1BFMA 4H9QA 3AV2C 2NQBD 3AN2C 1KX3A 2HIOA 4CAYB 3AZED 3A6ND 3MNNB 3UTAB 4H9NA 5F99A 3W96C 5B31B 1HQ3B 3X1VA 1P3IB 1P3GB 5GT3C 4LD9B 5BS7A 1HTAA 1TZYC 5DNNB 2YFWB 5DNMA 3KWQA 3W99C 5B33B 1U35A 1P3AC 3REIB 3C1BC 5AV9B 1WWSA 4J8WC 5E5AB 4J8VA 1R4VA 3AZMA 4NE5A 4XZQA 4Z66C 3AFAB 4YS3B 4KGCA 3MVDA 1ID3C 3WKJC 5JRGB 2CV5A 3AZJC 2IO5B 5B40A 4KUDA 3B0DB 4DRBA 5B2ID 5AV8B 2NZDC 3X1SB 4G92B 3B6FA 5C3IC 5GT0A 2BYMA 5B32D 5AVCA 1KX5A 3MGRB 4WU9B 1P3BB 3MNND 1KX4B 4HGAC 5BNVB 4H9PB 5B31D 1HQ3D 3WAAB 3C1CA 4YM6A 1P3ID 1M19C 4LD9D 4QLCA 3AZLD 3MGSB 4ZUXC 5CPJC 1F66C 1WWIA 3O62B 5B33D 4X23A 3RELA 3REID 1EQZD 5B32G 3REKB 3AFAD 3B6GA 3KUYC 2BYKA 5F99D 3X1UB 3UT9A 5JRGD 3V9RA 3REJB 2AROC 3AZKB 2PYOB 5B24B 3WTPB 3AZNB 3AYWA 1P3PD 3AZIA 5AV8D 1P34A 4ZBJC 5GSUC 5CP6C 3LZ1C 3AV1A 4H9RA 1AOIB 3LZ0B 2FJ7C 4KHAA 3VH6A 3AN2B 3LJAA 3X1TA 3MGRD 4WU9D 2NQBA 5B2JC 2CV5D 1P3BD 3AZEA 3W97C 3WTPE 1P3OC 3A6NA 2RVQC 5B0ZA 5CPKC 1P3MC 1KX4D 3W96B 5GT3B 5CPIC 3WAAD 5BNXB 3VH6W 1TZYB 3B6FD 3MGPB 5GT0D 3KSYA 3MGSD 3W99B 3O62D 1P3AB 3C1BB 2YFVA 2HIOC 4J8WB 4J8UC 4Z66B 3REKD 4E45A 1ID3B 1P3LC 3X1UD 1H3OA 3REJD 3X1VC 1B6WA 3WTPD 3NQJA 3AZND 2NZDB 1BH9B 5B2IA 5C3IB 4Z5TB 1AOID 3LZ0D 3AN2D 3AZMC 1F1EA 5B32A 5JA4B 3KXBB 4J8XC 4CAYA 3AZFC 3MNNA 5G49B 4HGAB 5B40C 1M1AB 3R45B 5AVBB 4NE3A 3AYWD 5GT3D 5B31A 1HQ3A 1TZYD 1P3IA 1P3GA 4LD9A 3MGPD 4ZUXB 5AY8C 1F66B 2F8NB 4E44A 5DNNA 3W99D 2YFWA 3B0CT 1P3AD 3C1BD 4J8WD 5B33A 4XUJC 3UTBC 3VH5W 5B0ZD 4Z66D 3REIA 1EQZA 5AV9A 3KUYB 3AFAA 1TAFB 1M18B 4WU8C 2AROB 1P3FC 5JRGA 3C1CC 4YM6C 4H9SC 5AV6C 4QLCC 3W98B 4ZBJB 5GSUB 5CP6B 3LZ1B 2NZDD 1P3PA 5AV8A 5B0YC 4Z5TD 3X1SA 2FJ7B 4X23C 1JFIB 2F8NK 5B2JB 3MGRA 3KXBD 4WU9A 2F8NH 1P3OB 5CPKB 3UT9C 1P3BA 1P3MB 1M1AD 5BT1C 1P3KB 5AVBD
chains in the Genus database with same CATH superfamily
1KX4A 4DQYB 3REHC 5BNVA 3AZHC 1P34C 4H9PA 3WAAA 3LELB 2G5HC 3WA9C 1T3UA 4ZUXD 1F66D 2F8ND 3MGSA 3X1TC 3O62A 4J8UB 5AV5C 3MGQC 3KUYD 1P3LB 3REKA 5GXQC 4R8PC 2LY8A 3UTAD 5FUGB 1M18D 2AROD 3X1UA 4EO5C 3X1VB 2UWXA 3REJA 1P3GD 3AZKA 3W98D 1ZLAC 5DNND 5CP6D 3WTPA 3AZNA 2FJ7D 1S32C 1AOIA 3LZ0A 5AV9D 5E5AD 4Z2MH 5B2JD 3AN2A 2HUEB 4YS3D 4J8XB 5B1MB 3AZFB 1N1JB 5CPKD 5B40B 5BO0B 1P3KD 3W96A 5B31G 4G91B 5GT3A 3AZGC 5BNXA 3X1SD 5B1LB 5AY8B 1TZYA 3LELD 4JJNC 3MGPA 3AV2B 3W99A 4XUJB 5B32C 3UTBB 1P3AA 3C1BA 4J8WA 2Y2IA 4Z66A 1P3LD 3MNNC 2Y2KA 4WU8B 1P3FB 3TU4C 4YM6B 5AV6B 2W8SA 1P3IC 4AWLC 3AZLC 5B0YB 4UUZB 2NZDA 1BH9A 1KX3C 4Z5TA 4M6BA 3EPLA 5B33C 1EQZC 4J8XD 3WKJB 1EQZB 5B1MD 3AZFD 5JA4A 5F99C 3KXBA 3AZJB 3WA9B 5JRGC 3AZKD 5CHLB 4WNNB 5G49A 5BS7C 1M1AA 2PYOD 3REHB 3AZHB 5B24D 3R45A 5AVBA 5DNMC 5KDMB 1P3PC 3KWQC 5B1LD 5AY8D 1U35C 4ZUXA 1F66A 2F8NA 3NQUB 3AV2D 4J8VC 4KGCC 4XZQC 5AV5B 4XUJD 3MGQB 3UTBD 3MGRC 4WU9C 3MVDC 2CV5C 5GXQB 4R8PB 3KUYA 4KUDC 4WU8D 1P3FD 3W96D 1TAFA 4EO5B 3UTAA 3VH5A 1M18A 1M19B 2AROA 2DQNC 1ZLAB 3B6FC 5CPJB 3W98A 5GT0C 5CP6A 5GSUA 1S32B 5AVCC 2JSSA 1KX5C 3O62C 2FJ7A 1Q9CA 1JFIA 5E5AA 4CSRB 5B2JA 3REKC 1ID3D 4YS3A 3WKJD 3AZJD 1P3OA 5CPKA 3NQUA 1P3KA 3AZHD 3AZGB 3AZNC 4JJNB 1BH8B 3LELA 2RIQA 4DRAA 3RELC 5B32B 5AV5D 3B6GC 3MGQD 3W97B 4J8UA 5GXQD 4R8PD 3TU4B 1P3LA 4H9OB 5CPIB 5FUGA 3AYWC 1M19D 3AZIC 4AWLB 3AV1C 3AZLB 1ZLAD 5CPJD 3MGPC 3VH6T 4H9QB 3LJAC 1S32D 1KX3B 2HIOB 2NQBC 2JCHA 3AZEC 1Z2CB 3A6NC 5B0ZC 4H9NB 5F99B 4J8XA 5B1MA 3AZFA 1N1JA 5BO0A 2PYOA 5DNMB 1P3PB 5GSUD 5B24A 3LZ1D 3AZGD 3KWQB 2J8PA 4JJND 1U35B 2F8NG 5B1LA 5AY8A 4Z5TC 4J8VB 3AZMB 4KGCB 4XZQB 3AV2A 1B67A 2JE5A 3MVDB 4WJ3C 3W97D 4XUJA 1KU5A 3UTBA 2CV5B 2RVQD 3KXBC 1P3OD 1P3MD 4KUDB 3TU4D 1M1AC 4WU8A 1P3FA 5CPID 5AVBC 2ZM5A 3FDDA 2Y2NA 4H9SA 5B2IC 5AV6A 3B6FB 3B0CW 5GT0B 2BYMB 4NE6A 5AVCB 1KX5B 5B0YA 2Y2LA 4UUZA 1KX3D 2HIOD 4J8UD 1A7WA 1ID3A 3VH5T 3WKJA 3UTAC 3EPKA 3C1CB 3AZJA 3X1VD 1M18C 4QLCB 3WA9A 5B31C 1HQ3C 4LD9C 4WNNA 1P3GC 5DNMD 3REHA 3W98C 3AZHA 4Z2MG 3KWQD 5DNNC 2ZY2A 4NFTA 5KDMA 4X23B 2Y2GA 1U35D 3RELB 4J8VD 3AZMD 4KGCD 4UPKA 4XZQD 2Y2OA 3REIC 5AV9C 3B6GB 2BYKB 5E5AC 1ULYA 3MVDD 3AFAC 2L5AA 5AV5A 4YS3C 3UT9B 3MGQA 3V9RB 5B40D 2XD1A 4KUDD 1PZRA 5GXQA 4R8PA 2IO5C 3AYWB 3AZIB 1P3KC 1P34B 3B0DC 3AV1B 2VQRA 4WZSB 1M19A 3A1KA 4H9RB 5AV8C 2Y2JA 3LELC 3X1SC 4KHAB 4G92C 1ZLAA 5CPJA 3LJAB 3H0RC 3X1TB 5AVCD 1KX5D 2NQBB 1S32A 3F6TA 1W2EA 3AZEB 3A6NB 5B0ZB 1P3BC 3IP4C 2FFFB 4CSRA 2G5IC 4WV4B 1KX4C 3C1CD 4YM6D 5AV6D 4QLCD 3WAAC 5B0YD 3LZ1A 3AZGA 3MGSC 4JJNA 1BH8A 2YFVB 4X23D 3RELD 3B6GD 2HUEC 1H3OB 3UT9D 3W97A 5B1MC 3X1UC 3WA9D 5BT1D 1P3MA 3REJC 3TU4A 3AZKC 2CWEA 3NQJB 4H9OA 3REHD 3AZID 2PYOC 1P34D 5B2IB 5CPIA 5B24C 3WTPC 3AV1D 4G91C 3B0BA 5B1LC 2BG1A 3AZLA 1AOIC 3LJAD 3LZ0C 3X1TD 1BFMA 4H9QA 3AV2C 2NQBD 3AN2C 1KX3A 2HIOA 4CAYB 3AZED 3A6ND 3MNNB 3UTAB 4H9NA 5F99A 3W96C 5B31B 1HQ3B 3X1VA 1P3IB 1P3GB 5GT3C 4LD9B 5BS7A 1HTAA 1TZYC 5DNNB 2YFWB 5DNMA 3KWQA 3W99C 5B33B 1U35A 1P3AC 3REIB 3C1BC 5AV9B 1WWSA 4J8WC 5E5AB 4J8VA 1R4VA 3AZMA 4NE5A 4XZQA 4Z66C 3AFAB 4YS3B 4KGCA 2Y2QA 3MVDA 2Y2PA 1ID3C 3WKJC 5JRGB 2CV5A 3AZJC 2IO5B 5B40A 4KUDA 3B0DB 4DRBA 5B2ID 5AV8B 2NZDC 3X1SB 4G92B 3B6FA 5C3IC 5GT0A 2BYMA 5B32D 5AVCA 1KX5A 3MGRB 4WU9B 1P3BB 3MNND 1KX4B 4HGAC 5BNVB 4H9PB 5B31D 1HQ3D 3WAAB 3C1CA 4YM6A 1P3ID 1M19C 4LD9D 4QLCA 3AZLD 3MGSB 4ZUXC 5CPJC 1F66C 1WWIA 3EPHA 3O62B 2DF4C 5B33D 3EG5B 4X23A 3RELA 3REID 1EQZD 5B32G 3REKB 3AFAD 3B6GA 3KUYC 2BYKA 5F99D 3X1UB 3UT9A 5JRGD 3V9RA 3REJB 2AROC 3AZKB 2PYOB 5B24B 3WTPB 3AZNB 3AYWA 1P3PD 3AZIA 5AV8D 1P34A 4ZBJC 5GSUC 5CP6C 3LZ1C 3AV1A 4H9RA 1AOIB 3LZ0B 3A1IA 2FJ7C 4KHAA 2Y2HA 3VH6A 3AN2B 3P5JB 3LJAA 3X1TA 3MGRD 4WU9D 2NQBA 5B2JC 2CV5D 1P3BD 3AZEA 3W97C 3AL0C 3WTPE 1P3OC 3A6NA 2RVQC 5B0ZA 5CPKC 1P3MC 2XD5A 1KX4D 3W96B 5GT3B 5CPIC 3WAAD 5BNXB 3VH6W 1TZYB 3B6FD 3MGPB 5GT0D 3KSYA 3MGSD 3W99B 3O62D 1P3AB 3C1BB 2YFVA 2HIOC 4J8WB 4J8UC 4Z66B 3REKD 4E45A 1ID3B 1P3LC 3X1UD 1H3OA 3REJD 3X1VC 3H0LC 1B6WA 2ZY3A 3WTPD 3NQJA 3AZND 3H0MC 2NZDB 1BH9B 5B2IA 5C3IB 4Z5TB 1AOID 3LZ0D 2Y2MA 3AN2D 3AZMC 1F1EA 5B32A 5JA4B 3KXBB 4J8XC 4CAYA 3AZFC 3MNNA 5G49B 4HGAB 5B40C 2ZY5A 1M1AB 3R45B 5AVBB 4NE3A 3AYWD 5GT3D 5B31A 1HQ3A 1TZYD 1P3IA 1P3GA 4LD9A 3MGPD 4ZUXB 5AY8C 1F66B 2F8NB 4E44A 5DNNA 3W99D 2YFWA 3EPJA 3B0CT 1P3AD 3C1BD 4J8WD 5B33A 4XUJC 3UTBC 3VH5W 5B0ZD 4Z66D 3REIA 1EQZA 5AV9A 3KUYB 3AFAA 1TAFB 3KFUG 2ZY4A 1M18B 4WU8C 2AROB 1P3FC 5JRGA 3C1CC 4YM6C 4H9SC 5AV6C 4QLCC 3W98B 4ZBJB 5GSUB 5CP6B 3LZ1B 2NZDD 1P3PA 5AV8A 5B0YC 4Z5TD 3X1SA 2FJ7B 2F2AC 4X23C 1JFIB 2F8NK 5B2JB 3MGRA 3KXBD 4WU9A 2F8NH 1P3OB 5CPKB 3UT9C 1P3BA 1P3MB 1M1AD 5BT1C 1P3KB 5AVBD
chains in the Genus database with same CATH topology
1KX4A 4DQYB 3REHC 5BNVA 3AZHC 1P34C 4H9PA 3WAAA 3LELB 2G5HC 3WA9C 1T3UA 4ZUXD 1F66D 2F8ND 3MGSA 3X1TC 3O62A 4J8UB 5AV5C 3MGQC 3KUYD 1P3LB 3REKA 5GXQC 4R8PC 2LY8A 3UTAD 5FUGB 1M18D 2AROD 3X1UA 4EO5C 3X1VB 2UWXA 3REJA 1P3GD 3AZKA 3W98D 1ZLAC 5DNND 5CP6D 3WTPA 3AZNA 2FJ7D 1S32C 1AOIA 3LZ0A 5AV9D 5E5AD 4Z2MH 5B2JD 3AN2A 2HUEB 4YS3D 4J8XB 5B1MB 3AZFB 1N1JB 5CPKD 5B40B 5BO0B 1P3KD 3W96A 5B31G 4G91B 5GT3A 3AZGC 5BNXA 3X1SD 5B1LB 5AY8B 1TZYA 3LELD 4JJNC 3MGPA 3AV2B 3W99A 4XUJB 5B32C 3UTBB 1P3AA 3C1BA 4J8WA 2Y2IA 4Z66A 1P3LD 3MNNC 2Y2KA 4WU8B 1P3FB 3TU4C 4YM6B 5AV6B 2W8SA 1P3IC 4AWLC 3AZLC 5B0YB 4UUZB 2NZDA 1BH9A 1KX3C 4Z5TA 4M6BA 3EPLA 5B33C 1EQZC 4J8XD 3WKJB 1EQZB 5B1MD 3AZFD 5JA4A 5F99C 3KXBA 3AZJB 3WA9B 5JRGC 3AZKD 5CHLB 4WNNB 5G49A 5BS7C 1M1AA 2PYOD 3REHB 3AZHB 5B24D 3R45A 5AVBA 5DNMC 5KDMB 1P3PC 3KWQC 5B1LD 5AY8D 1U35C 4ZUXA 1F66A 2F8NA 3NQUB 3AV2D 4J8VC 4KGCC 4XZQC 5AV5B 4XUJD 3MGQB 3UTBD 3MGRC 4WU9C 3MVDC 2CV5C 5GXQB 4R8PB 3KUYA 4KUDC 4WU8D 1P3FD 3W96D 1TAFA 4EO5B 3UTAA 3VH5A 1M18A 1M19B 2AROA 2DQNC 1ZLAB 3B6FC 5CPJB 3W98A 5GT0C 5CP6A 5GSUA 1S32B 5AVCC 2JSSA 1KX5C 3O62C 2FJ7A 1Q9CA 1JFIA 5E5AA 4CSRB 5B2JA 3REKC 1ID3D 4YS3A 3WKJD 3AZJD 1P3OA 5CPKA 3NQUA 1P3KA 3AZHD 3AZGB 3AZNC 4JJNB 1BH8B 3LELA 2RIQA 4DRAA 3RELC 5B32B 5AV5D 3B6GC 3MGQD 3W97B 4J8UA 5GXQD 4R8PD 3TU4B 1P3LA 4H9OB 5CPIB 5FUGA 3AYWC 1M19D 3AZIC 4AWLB 3AV1C 3AZLB 1ZLAD 5CPJD 3MGPC 3VH6T 4H9QB 3LJAC 1S32D 1KX3B 2HIOB 2NQBC 2JCHA 3AZEC 1Z2CB 3A6NC 5B0ZC 4H9NB 5F99B 4J8XA 5B1MA 3AZFA 1N1JA 5BO0A 2PYOA 5DNMB 1P3PB 5GSUD 5B24A 3LZ1D 3AZGD 3KWQB 2J8PA 4JJND 1U35B 2F8NG 5B1LA 5AY8A 4Z5TC 4J8VB 3AZMB 4KGCB 4XZQB 3AV2A 1B67A 2JE5A 3MVDB 4WJ3C 3W97D 4XUJA 1KU5A 3UTBA 2CV5B 2RVQD 3KXBC 1P3OD 1P3MD 4KUDB 3TU4D 1M1AC 4WU8A 1P3FA 5CPID 5AVBC 2ZM5A 3FDDA 2Y2NA 4H9SA 5B2IC 5AV6A 3B6FB 3B0CW 5GT0B 2BYMB 4NE6A 5AVCB 1KX5B 5B0YA 2Y2LA 4UUZA 1KX3D 2HIOD 4J8UD 1A7WA 1ID3A 3VH5T 3WKJA 3UTAC 3EPKA 3C1CB 3AZJA 3X1VD 1M18C 4QLCB 3WA9A 5B31C 1HQ3C 4LD9C 4WNNA 1P3GC 5DNMD 3REHA 3W98C 3AZHA 4Z2MG 3KWQD 5DNNC 2ZY2A 4NFTA 5KDMA 4X23B 2Y2GA 1U35D 3RELB 4J8VD 3AZMD 4KGCD 4UPKA 4XZQD 2Y2OA 3REIC 5AV9C 3B6GB 2BYKB 5E5AC 1ULYA 3MVDD 3AFAC 2L5AA 5AV5A 4YS3C 3UT9B 3MGQA 3V9RB 5B40D 2XD1A 4KUDD 1PZRA 5GXQA 4R8PA 2IO5C 3AYWB 3AZIB 1P3KC 1P34B 3B0DC 3AV1B 2VQRA 4WZSB 1M19A 3A1KA 4H9RB 5AV8C 2Y2JA 3LELC 3X1SC 4KHAB 4G92C 1ZLAA 5CPJA 3LJAB 3H0RC 3X1TB 5AVCD 1KX5D 2NQBB 1S32A 3F6TA 1W2EA 3AZEB 3A6NB 5B0ZB 1P3BC 3IP4C 2FFFB 4CSRA 2G5IC 4WV4B 1KX4C 3C1CD 4YM6D 5AV6D 4QLCD 3WAAC 5B0YD 3LZ1A 3AZGA 3MGSC 4JJNA 1BH8A 2YFVB 4X23D 3RELD 3B6GD 2HUEC 1H3OB 3UT9D 3W97A 5B1MC 3X1UC 3WA9D 5BT1D 1P3MA 3REJC 3TU4A 3AZKC 2CWEA 3NQJB 4H9OA 3REHD 3AZID 2PYOC 1P34D 5B2IB 5CPIA 5B24C 3WTPC 3AV1D 4G91C 3B0BA 5B1LC 2BG1A 3AZLA 1AOIC 3LJAD 3LZ0C 3X1TD 1BFMA 4H9QA 3AV2C 2NQBD 3AN2C 1KX3A 2HIOA 4CAYB 3AZED 3A6ND 3MNNB 3UTAB 4H9NA 5F99A 3W96C 5B31B 1HQ3B 3X1VA 1P3IB 1P3GB 5GT3C 4LD9B 5BS7A 1HTAA 1TZYC 5DNNB 2YFWB 5DNMA 3KWQA 3W99C 5B33B 1U35A 1P3AC 3REIB 3C1BC 5AV9B 1WWSA 4J8WC 5E5AB 4J8VA 1R4VA 3AZMA 4NE5A 4XZQA 4Z66C 3AFAB 4YS3B 4KGCA 2Y2QA 3MVDA 2Y2PA 1ID3C 3WKJC 5JRGB 2CV5A 3AZJC 2IO5B 5B40A 4KUDA 3B0DB 4DRBA 5B2ID 5AV8B 2NZDC 3X1SB 4G92B 3B6FA 5C3IC 5GT0A 2BYMA 5B32D 5AVCA 1KX5A 3MGRB 4WU9B 1P3BB 3MNND 1KX4B 4HGAC 5BNVB 4H9PB 5B31D 1HQ3D 3WAAB 3C1CA 4YM6A 1P3ID 1M19C 4LD9D 4QLCA 3AZLD 3MGSB 4ZUXC 5CPJC 1F66C 1WWIA 3EPHA 3O62B 2DF4C 5B33D 3EG5B 4X23A 3RELA 3REID 1EQZD 5B32G 3REKB 3AFAD 3B6GA 3KUYC 2BYKA 5F99D 3X1UB 3UT9A 5JRGD 3V9RA 3REJB 2AROC 3AZKB 2PYOB 5B24B 3WTPB 3AZNB 3AYWA 1P3PD 3AZIA 5AV8D 1P34A 4ZBJC 5GSUC 5CP6C 3LZ1C 3AV1A 4H9RA 1AOIB 3LZ0B 3A1IA 2FJ7C 4KHAA 2Y2HA 3VH6A 3AN2B 3P5JB 3LJAA 3X1TA 3MGRD 4WU9D 2NQBA 5B2JC 2CV5D 1P3BD 3AZEA 3W97C 3AL0C 3WTPE 1P3OC 3A6NA 2RVQC 5B0ZA 5CPKC 1P3MC 2XD5A 1KX4D 3W96B 5GT3B 5CPIC 3WAAD 5BNXB 3VH6W 1TZYB 3B6FD 3MGPB 5GT0D 3KSYA 3MGSD 3W99B 3O62D 1P3AB 3C1BB 2YFVA 2HIOC 4J8WB 4J8UC 4Z66B 3REKD 4E45A 1ID3B 1P3LC 3X1UD 1H3OA 3REJD 3X1VC 3H0LC 1B6WA 2ZY3A 3WTPD 3NQJA 3AZND 3H0MC 2NZDB 1BH9B 5B2IA 5C3IB 4Z5TB 1AOID 3LZ0D 2Y2MA 3AN2D 3AZMC 1F1EA 5B32A 5JA4B 3KXBB 4J8XC 4CAYA 3AZFC 3MNNA 5G49B 4HGAB 5B40C 2ZY5A 1M1AB 3R45B 5AVBB 4NE3A 3AYWD 5GT3D 5B31A 1HQ3A 1TZYD 1P3IA 1P3GA 4LD9A 3MGPD 4ZUXB 5AY8C 1F66B 2F8NB 4E44A 5DNNA 3W99D 2YFWA 3EPJA 3B0CT 1P3AD 3C1BD 4J8WD 5B33A 4XUJC 3UTBC 3VH5W 5B0ZD 4Z66D 3REIA 1EQZA 5AV9A 3KUYB 3AFAA 1TAFB 3KFUG 2ZY4A 1M18B 4WU8C 2AROB 1P3FC 5JRGA 3C1CC 4YM6C 4H9SC 5AV6C 4QLCC 3W98B 4ZBJB 5GSUB 5CP6B 3LZ1B 2NZDD 1P3PA 5AV8A 5B0YC 4Z5TD 3X1SA 2FJ7B 2F2AC 4X23C 1JFIB 2F8NK 5B2JB 3MGRA 3KXBD 4WU9A 2F8NH 1P3OB 5CPKB 3UT9C 1P3BA 1P3MB 1M1AD 5BT1C 1P3KB 5AVBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX4 A;  3REH C;  5BNV A;  3AZH C;  1P34 C;  4H9P A;  3WAA A;  3LEL B;  3WA9 C;  4ZUX D;  1F66 D;  2F8N D;  3MGS A;  3X1T C;  3O62 A;  4J8U B;  5AV5 C;  3MGQ C;  3KUY D;  1P3L B;  3REK A;  5GXQ C;  4R8P C;  2LY8 A;  3UTA D;  5FUG B;  1M18 D;  2ARO D;  3X1U A;  4EO5 C;  3X1V B;  3REJ A;  1P3G D;  3AZK A;  3W98 D;  1ZLA C;  5DNN D;  5CP6 D;  3WTP A;  3AZN A;  2FJ7 D;  1S32 C;  1AOI A;  3LZ0 A;  5AV9 D;  5E5A D;  4Z2M H;  5B2J D;  3AN2 A;  2HUE B;  4YS3 D;  4J8X B;  5B1M B;  3AZF B;  1N1J B;  5CPK D;  5B40 B;  5BO0 B;  1P3K D;  3W96 A;  5B31 G;  4G91 B;  5GT3 A;  3AZG C;  5BNX A;  3X1S D;  5B1L B;  5AY8 B;  1TZY A;  3LEL D;  4JJN C;  3MGP A;  3AV2 B;  3W99 A;  4XUJ B;  5B32 C;  3UTB B;  1P3A A;  3C1B A;  4J8W A;  4Z66 A;  1P3L D;  3MNN C;  4WU8 B;  1P3F B;  3TU4 C;  4YM6 B;  5AV6 B;  1P3I C;  4AWL C;  3AZL C;  5B0Y B;  4UUZ B;  2NZD A;  1BH9 A;  1KX3 C;  4Z5T A;  4M6B A;  5B33 C;  1EQZ C;  4J8X D;  3WKJ B;  1EQZ B;  5B1M D;  3AZF D;  5JA4 A;  5F99 C;  3KXB A;  3AZJ B;  3WA9 B;  5JRG C;  3AZK D;  5CHL B;  4WNN B;  5G49 A;  5BS7 C;  1M1A A;  2PYO D;  3REH B;  3AZH B;  5B24 D;  3R45 A;  5AVB A;  5DNM C;  5KDM B;  1P3P C;  3KWQ C;  5B1L D;  5AY8 D;  1U35 C;  4ZUX A;  1F66 A;  2F8N A;  3NQU B;  3AV2 D;  4J8V C;  4KGC C;  4XZQ C;  5AV5 B;  4XUJ D;  3MGQ B;  3UTB D;  3MGR C;  4WU9 C;  3MVD C;  2CV5 C;  5GXQ B;  4R8P B;  3KUY A;  4KUD C;  4WU8 D;  1P3F D;  3W96 D;  1TAF A;  4EO5 B;  3UTA A;  3VH5 A;  1M18 A;  1M19 B;  2ARO A;  1ZLA B;  3B6F C;  5CPJ B;  3W98 A;  5GT0 C;  5CP6 A;  5GSU A;  1S32 B;  5AVC C;  2JSS A;  1KX5 C;  3O62 C;  2FJ7 A;  1Q9C A;  1JFI A;  5E5A A;  4CSR B;  5B2J A;  3REK C;  1ID3 D;  4YS3 A;  3WKJ D;  3AZJ D;  1P3O A;  5CPK A;  3NQU A;  1P3K A;  3AZH D;  3AZG B;  3AZN C;  4JJN B;  1BH8 B;  3LEL A;  4DRA A;  3REL C;  5B32 B;  5AV5 D;  3B6G C;  3MGQ D;  3W97 B;  4J8U A;  5GXQ D;  4R8P D;  3TU4 B;  1P3L A;  4H9O B;  5CPI B;  5FUG A;  3AYW C;  1M19 D;  3AZI C;  4AWL B;  3AV1 C;  3AZL B;  1ZLA D;  5CPJ D;  3MGP C;  3VH6 T;  4H9Q B;  3LJA C;  1S32 D;  1KX3 B;  2HIO B;  2NQB C;  3AZE C;  3A6N C;  5B0Z C;  4H9N B;  5F99 B;  4J8X A;  5B1M A;  3AZF A;  1N1J A;  5BO0 A;  2PYO A;  5DNM B;  1P3P B;  5GSU D;  5B24 A;  3LZ1 D;  3AZG D;  3KWQ B;  4JJN D;  1U35 B;  2F8N G;  5B1L A;  5AY8 A;  4Z5T C;  4J8V B;  3AZM B;  4KGC B;  4XZQ B;  3AV2 A;  1B67 A;  3MVD B;  3W97 D;  4XUJ A;  1KU5 A;  3UTB A;  2CV5 B;  2RVQ D;  3KXB C;  1P3O D;  1P3M D;  4KUD B;  3TU4 D;  1M1A C;  4WU8 A;  1P3F A;  5CPI D;  5AVB C;  5B2I C;  4H9S A;  5AV6 A;  3B6F B;  3B0C W;  5GT0 B;  2BYM B;  4NE6 A;  5AVC B;  1KX5 B;  5B0Y A;  4UUZ A;  1KX3 D;  2HIO D;  4J8U D;  1A7W A;  1ID3 A;  3VH5 T;  3WKJ A;  3UTA C;  3C1C B;  3AZJ A;  3X1V D;  1M18 C;  4QLC B;  3WA9 A;  5B31 C;  1HQ3 C;  4LD9 C;  4WNN A;  1P3G C;  5DNM D;  3REH A;  3W98 C;  3AZH A;  4Z2M G;  3KWQ D;  5DNN C;  4NFT A;  5KDM A;  4X23 B;  1U35 D;  3REL B;  4J8V D;  3AZM D;  4KGC D;  4XZQ D;  3REI C;  3B6G B;  5AV9 C;  2BYK B;  5E5A C;  1ULY A;  3MVD D;  3AFA C;  2L5A A;  5AV5 A;  4YS3 C;  3UT9 B;  3MGQ A;  3V9R B;  5B40 D;  4KUD D;  5GXQ A;  4R8P A;  2IO5 C;  3AYW B;  3AZI B;  1P3K C;  1P34 B;  3B0D C;  3AV1 B;  4WZS B;  1M19 A;  4H9R B;  5AV8 C;  3LEL C;  3X1S C;  4KHA B;  4G92 C;  1ZLA A;  5CPJ A;  3LJA B;  3X1T B;  5AVC D;  1KX5 D;  2NQB B;  1S32 A;  3AZE B;  3A6N B;  5B0Z B;  1P3B C;  4CSR A;  4WV4 B;  1KX4 C;  3C1C D;  4YM6 D;  5AV6 D;  4QLC D;  3WAA C;  5B0Y D;  3LZ1 A;  3AZG A;  3MGS C;  4JJN A;  1BH8 A;  2YFV B;  4X23 D;  3REL D;  3B6G D;  2HUE C;  1H3O B;  3UT9 D;  3W97 A;  5B1M C;  3X1U C;  3WA9 D;  5BT1 D;  1P3M A;  3REJ C;  3TU4 A;  3AZK C;  2CWE A;  3NQJ B;  4H9O A;  3REH D;  3AZI D;  2PYO C;  1P34 D;  5B2I B;  5CPI A;  5B24 C;  3WTP C;  3AV1 D;  4G91 C;  3B0B A;  5B1L C;  3AZL A;  1AOI C;  3LJA D;  3LZ0 C;  3X1T D;  1BFM A;  4H9Q A;  3AV2 C;  2NQB D;  3AN2 C;  1KX3 A;  2HIO A;  4CAY B;  3AZE D;  3A6N D;  3MNN B;  3UTA B;  4H9N A;  5F99 A;  3W96 C;  5B31 B;  1HQ3 B;  3X1V A;  1P3I B;  1P3G B;  5GT3 C;  4LD9 B;  5BS7 A;  1HTA A;  1TZY C;  5DNN B;  2YFW B;  5DNM A;  3KWQ A;  3W99 C;  5B33 B;  1U35 A;  1P3A C;  3REI B;  3C1B C;  5AV9 B;  1WWS A;  4J8W C;  5E5A B;  4J8V A;  1R4V A;  3AZM A;  4NE5 A;  4XZQ A;  4Z66 C;  3AFA B;  4YS3 B;  4KGC A;  3MVD A;  1ID3 C;  3WKJ C;  5JRG B;  2CV5 A;  3AZJ C;  2IO5 B;  5B40 A;  4KUD A;  3B0D B;  4DRB A;  5B2I D;  5AV8 B;  2NZD C;  3X1S B;  4G92 B;  3B6F A;  5C3I C;  5GT0 A;  2BYM A;  5B32 D;  5AVC A;  1KX5 A;  3MGR B;  4WU9 B;  1P3B B;  3MNN D;  1KX4 B;  4HGA C;  5BNV B;  4H9P B;  5B31 D;  1HQ3 D;  3WAA B;  3C1C A;  4YM6 A;  1P3I D;  1M19 C;  4LD9 D;  4QLC A;  3AZL D;  3MGS B;  4ZUX C;  5CPJ C;  1F66 C;  1WWI A;  3O62 B;  5B33 D;  4X23 A;  3REL A;  3REI D;  1EQZ D;  5B32 G;  3REK B;  3AFA D;  3B6G A;  3KUY C;  2BYK A;  5F99 D;  3X1U B;  3UT9 A;  5JRG D;  3V9R A;  3REJ B;  2ARO C;  3AZK B;  2PYO B;  5B24 B;  3WTP B;  3AZN B;  3AYW A;  1P3P D;  3AZI A;  5AV8 D;  1P34 A;  4ZBJ C;  5GSU C;  5CP6 C;  3LZ1 C;  3AV1 A;  4H9R A;  1AOI B;  3LZ0 B;  2FJ7 C;  4KHA A;  3VH6 A;  3AN2 B;  3LJA A;  3X1T A;  3MGR D;  4WU9 D;  2NQB A;  5B2J C;  2CV5 D;  1P3B D;  3AZE A;  3W97 C;  3WTP E;  1P3O C;  3A6N A;  2RVQ C;  5B0Z A;  5CPK C;  1P3M C;  1KX4 D;  3W96 B;  5GT3 B;  5CPI C;  3WAA D;  5BNX B;  3VH6 W;  1TZY B;  3B6F D;  3MGP B;  5GT0 D;  3KSY A;  3MGS D;  3W99 B;  3O62 D;  1P3A B;  3C1B B;  2YFV A;  2HIO C;  4J8W B;  4J8U C;  4Z66 B;  3REK D;  4E45 A;  1ID3 B;  1P3L C;  3X1U D;  1H3O A;  3REJ D;  3X1V C;  1B6W A;  3WTP D;  3NQJ A;  3AZN D;  2NZD B;  1BH9 B;  5B2I A;  5C3I B;  4Z5T B;  1AOI D;  3LZ0 D;  3AN2 D;  3AZM C;  1F1E A;  5B32 A;  5JA4 B;  3KXB B;  4J8X C;  4CAY A;  3AZF C;  3MNN A;  5G49 B;  4HGA B;  5B40 C;  1M1A B;  3R45 B;  5AVB B;  4NE3 A;  3AYW D;  5GT3 D;  5B31 A;  1HQ3 A;  1TZY D;  1P3I A;  1P3G A;  4LD9 A;  3MGP D;  4ZUX B;  5AY8 C;  1F66 B;  2F8N B;  4E44 A;  5DNN A;  3W99 D;  2YFW A;  3B0C T;  1P3A D;  3C1B D;  4J8W D;  5B33 A;  4XUJ C;  3UTB C;  3VH5 W;  5B0Z D;  4Z66 D;  3REI A;  1EQZ A;  5AV9 A;  3KUY B;  3AFA A;  1TAF B;  1M18 B;  4WU8 C;  2ARO B;  1P3F C;  5JRG A;  3C1C C;  4YM6 C;  4H9S C;  5AV6 C;  4QLC C;  3W98 B;  4ZBJ B;  5GSU B;  5CP6 B;  3LZ1 B;  2NZD D;  1P3P A;  5AV8 A;  5B0Y C;  4Z5T D;  3X1S A;  2FJ7 B;  4X23 C;  1JFI B;  2F8N K;  5B2J B;  3MGR A;  3KXB D;  4WU9 A;  2F8N H;  1P3O B;  5CPK B;  3UT9 C;  1P3B A;  1P3M B;  1M1A D;  5BT1 C;  1P3K B;  5AVB D; 
#chains in the Genus database with same CATH topology
 1KX4 A;  4DQY B;  3REH C;  5BNV A;  3AZH C;  1P34 C;  4H9P A;  3WAA A;  3LEL B;  2G5H C;  3WA9 C;  1T3U A;  4ZUX D;  1F66 D;  2F8N D;  3MGS A;  3X1T C;  3O62 A;  4J8U B;  5AV5 C;  3MGQ C;  3KUY D;  1P3L B;  3REK A;  5GXQ C;  4R8P C;  2LY8 A;  3UTA D;  5FUG B;  1M18 D;  2ARO D;  3X1U A;  4EO5 C;  3X1V B;  2UWX A;  3REJ A;  1P3G D;  3AZK A;  3W98 D;  1ZLA C;  5DNN D;  5CP6 D;  3WTP A;  3AZN A;  2FJ7 D;  1S32 C;  1AOI A;  3LZ0 A;  5AV9 D;  5E5A D;  4Z2M H;  5B2J D;  3AN2 A;  2HUE B;  4YS3 D;  4J8X B;  5B1M B;  3AZF B;  1N1J B;  5CPK D;  5B40 B;  5BO0 B;  1P3K D;  3W96 A;  5B31 G;  4G91 B;  5GT3 A;  3AZG C;  5BNX A;  3X1S D;  5B1L B;  5AY8 B;  1TZY A;  3LEL D;  4JJN C;  3MGP A;  3AV2 B;  3W99 A;  4XUJ B;  5B32 C;  3UTB B;  1P3A A;  3C1B A;  4J8W A;  2Y2I A;  4Z66 A;  1P3L D;  3MNN C;  2Y2K A;  4WU8 B;  1P3F B;  3TU4 C;  4YM6 B;  5AV6 B;  2W8S A;  1P3I C;  4AWL C;  3AZL C;  5B0Y B;  4UUZ B;  2NZD A;  1BH9 A;  1KX3 C;  4Z5T A;  4M6B A;  3EPL A;  5B33 C;  1EQZ C;  4J8X D;  3WKJ B;  1EQZ B;  5B1M D;  3AZF D;  5JA4 A;  5F99 C;  3KXB A;  3AZJ B;  3WA9 B;  5JRG C;  3AZK D;  5CHL B;  4WNN B;  5G49 A;  5BS7 C;  1M1A A;  2PYO D;  3REH B;  3AZH B;  5B24 D;  3R45 A;  5AVB A;  5DNM C;  5KDM B;  1P3P C;  3KWQ C;  5B1L D;  5AY8 D;  1U35 C;  4ZUX A;  1F66 A;  2F8N A;  3NQU B;  3AV2 D;  4J8V C;  4KGC C;  4XZQ C;  5AV5 B;  4XUJ D;  3MGQ B;  3UTB D;  3MGR C;  4WU9 C;  3MVD C;  2CV5 C;  5GXQ B;  4R8P B;  3KUY A;  4KUD C;  4WU8 D;  1P3F D;  3W96 D;  1TAF A;  4EO5 B;  3UTA A;  3VH5 A;  1M18 A;  1M19 B;  2ARO A;  2DQN C;  1ZLA B;  3B6F C;  5CPJ B;  3W98 A;  5GT0 C;  5CP6 A;  5GSU A;  1S32 B;  5AVC C;  2JSS A;  1KX5 C;  3O62 C;  2FJ7 A;  1Q9C A;  1JFI A;  5E5A A;  4CSR B;  5B2J A;  3REK C;  1ID3 D;  4YS3 A;  3WKJ D;  3AZJ D;  1P3O A;  5CPK A;  3NQU A;  1P3K A;  3AZH D;  3AZG B;  3AZN C;  4JJN B;  1BH8 B;  3LEL A;  2RIQ A;  4DRA A;  3REL C;  5B32 B;  5AV5 D;  3B6G C;  3MGQ D;  3W97 B;  4J8U A;  5GXQ D;  4R8P D;  3TU4 B;  1P3L A;  4H9O B;  5CPI B;  5FUG A;  3AYW C;  1M19 D;  3AZI C;  4AWL B;  3AV1 C;  3AZL B;  1ZLA D;  5CPJ D;  3MGP C;  3VH6 T;  4H9Q B;  3LJA C;  1S32 D;  1KX3 B;  2HIO B;  2NQB C;  2JCH A;  3AZE C;  1Z2C B;  3A6N C;  5B0Z C;  4H9N B;  5F99 B;  4J8X A;  5B1M A;  3AZF A;  1N1J A;  5BO0 A;  2PYO A;  5DNM B;  1P3P B;  5GSU D;  5B24 A;  3LZ1 D;  3AZG D;  3KWQ B;  2J8P A;  4JJN D;  1U35 B;  2F8N G;  5B1L A;  5AY8 A;  4Z5T C;  4J8V B;  3AZM B;  4KGC B;  4XZQ B;  3AV2 A;  1B67 A;  2JE5 A;  3MVD B;  4WJ3 C;  3W97 D;  4XUJ A;  1KU5 A;  3UTB A;  2CV5 B;  2RVQ D;  3KXB C;  1P3O D;  1P3M D;  4KUD B;  3TU4 D;  1M1A C;  4WU8 A;  1P3F A;  5CPI D;  5AVB C;  2ZM5 A;  3FDD A;  2Y2N A;  4H9S A;  5B2I C;  5AV6 A;  3B6F B;  3B0C W;  5GT0 B;  2BYM B;  4NE6 A;  5AVC B;  1KX5 B;  5B0Y A;  2Y2L A;  4UUZ A;  1KX3 D;  2HIO D;  4J8U D;  1A7W A;  1ID3 A;  3VH5 T;  3WKJ A;  3UTA C;  3EPK A;  3C1C B;  3AZJ A;  3X1V D;  1M18 C;  4QLC B;  3WA9 A;  5B31 C;  1HQ3 C;  4LD9 C;  4WNN A;  1P3G C;  5DNM D;  3REH A;  3W98 C;  3AZH A;  4Z2M G;  3KWQ D;  5DNN C;  2ZY2 A;  4NFT A;  5KDM A;  4X23 B;  2Y2G A;  1U35 D;  3REL B;  4J8V D;  3AZM D;  4KGC D;  4UPK A;  4XZQ D;  2Y2O A;  3REI C;  5AV9 C;  3B6G B;  2BYK B;  5E5A C;  1ULY A;  3MVD D;  3AFA C;  2L5A A;  5AV5 A;  4YS3 C;  3UT9 B;  3MGQ A;  3V9R B;  5B40 D;  2XD1 A;  4KUD D;  1PZR A;  5GXQ A;  4R8P A;  2IO5 C;  3AYW B;  3AZI B;  1P3K C;  1P34 B;  3B0D C;  3AV1 B;  2VQR A;  4WZS B;  1M19 A;  3A1K A;  4H9R B;  5AV8 C;  2Y2J A;  3LEL C;  3X1S C;  4KHA B;  4G92 C;  1ZLA A;  5CPJ A;  3LJA B;  3H0R C;  3X1T B;  5AVC D;  1KX5 D;  2NQB B;  1S32 A;  3F6T A;  1W2E A;  3AZE B;  3A6N B;  5B0Z B;  1P3B C;  3IP4 C;  2FFF B;  4CSR A;  2G5I C;  4WV4 B;  1KX4 C;  3C1C D;  4YM6 D;  5AV6 D;  4QLC D;  3WAA C;  5B0Y D;  3LZ1 A;  3AZG A;  3MGS C;  4JJN A;  1BH8 A;  2YFV B;  4X23 D;  3REL D;  3B6G D;  2HUE C;  1H3O B;  3UT9 D;  3W97 A;  5B1M C;  3X1U C;  3WA9 D;  5BT1 D;  1P3M A;  3REJ C;  3TU4 A;  3AZK C;  2CWE A;  3NQJ B;  4H9O A;  3REH D;  3AZI D;  2PYO C;  1P34 D;  5B2I B;  5CPI A;  5B24 C;  3WTP C;  3AV1 D;  4G91 C;  3B0B A;  5B1L C;  2BG1 A;  3AZL A;  1AOI C;  3LJA D;  3LZ0 C;  3X1T D;  1BFM A;  4H9Q A;  3AV2 C;  2NQB D;  3AN2 C;  1KX3 A;  2HIO A;  4CAY B;  3AZE D;  3A6N D;  3MNN B;  3UTA B;  4H9N A;  5F99 A;  3W96 C;  5B31 B;  1HQ3 B;  3X1V A;  1P3I B;  1P3G B;  5GT3 C;  4LD9 B;  5BS7 A;  1HTA A;  1TZY C;  5DNN B;  2YFW B;  5DNM A;  3KWQ A;  3W99 C;  5B33 B;  1U35 A;  1P3A C;  3REI B;  3C1B C;  5AV9 B;  1WWS A;  4J8W C;  5E5A B;  4J8V A;  1R4V A;  3AZM A;  4NE5 A;  4XZQ A;  4Z66 C;  3AFA B;  4YS3 B;  4KGC A;  2Y2Q A;  3MVD A;  2Y2P A;  1ID3 C;  3WKJ C;  5JRG B;  2CV5 A;  3AZJ C;  2IO5 B;  5B40 A;  4KUD A;  3B0D B;  4DRB A;  5B2I D;  5AV8 B;  2NZD C;  3X1S B;  4G92 B;  3B6F A;  5C3I C;  5GT0 A;  2BYM A;  5B32 D;  5AVC A;  1KX5 A;  3MGR B;  4WU9 B;  1P3B B;  3MNN D;  1KX4 B;  4HGA C;  5BNV B;  4H9P B;  5B31 D;  1HQ3 D;  3WAA B;  3C1C A;  4YM6 A;  1P3I D;  1M19 C;  4LD9 D;  4QLC A;  3AZL D;  3MGS B;  4ZUX C;  5CPJ C;  1F66 C;  1WWI A;  3EPH A;  3O62 B;  2DF4 C;  5B33 D;  3EG5 B;  4X23 A;  3REL A;  3REI D;  1EQZ D;  5B32 G;  3REK B;  3AFA D;  3B6G A;  3KUY C;  2BYK A;  5F99 D;  3X1U B;  3UT9 A;  5JRG D;  3V9R A;  3REJ B;  2ARO C;  3AZK B;  2PYO B;  5B24 B;  3WTP B;  3AZN B;  3AYW A;  1P3P D;  3AZI A;  5AV8 D;  1P34 A;  4ZBJ C;  5GSU C;  5CP6 C;  3LZ1 C;  3AV1 A;  4H9R A;  1AOI B;  3LZ0 B;  3A1I A;  2FJ7 C;  4KHA A;  2Y2H A;  3VH6 A;  3AN2 B;  3P5J B;  3LJA A;  3X1T A;  3MGR D;  4WU9 D;  2NQB A;  5B2J C;  2CV5 D;  1P3B D;  3AZE A;  3W97 C;  3AL0 C;  3WTP E;  1P3O C;  3A6N A;  2RVQ C;  5B0Z A;  5CPK C;  1P3M C;  2XD5 A;  1KX4 D;  3W96 B;  5GT3 B;  5CPI C;  3WAA D;  5BNX B;  3VH6 W;  1TZY B;  3B6F D;  3MGP B;  5GT0 D;  3KSY A;  3MGS D;  3W99 B;  3O62 D;  1P3A B;  3C1B B;  2YFV A;  2HIO C;  4J8W B;  4J8U C;  4Z66 B;  3REK D;  4E45 A;  1ID3 B;  1P3L C;  3X1U D;  1H3O A;  3REJ D;  3X1V C;  3H0L C;  1B6W A;  2ZY3 A;  3WTP D;  3NQJ A;  3AZN D;  3H0M C;  2NZD B;  1BH9 B;  5B2I A;  5C3I B;  4Z5T B;  1AOI D;  3LZ0 D;  2Y2M A;  3AN2 D;  3AZM C;  1F1E A;  5B32 A;  5JA4 B;  3KXB B;  4J8X C;  4CAY A;  3AZF C;  3MNN A;  5G49 B;  4HGA B;  5B40 C;  2ZY5 A;  1M1A B;  3R45 B;  5AVB B;  4NE3 A;  3AYW D;  5GT3 D;  5B31 A;  1HQ3 A;  1TZY D;  1P3I A;  1P3G A;  4LD9 A;  3MGP D;  4ZUX B;  5AY8 C;  1F66 B;  2F8N B;  4E44 A;  5DNN A;  3W99 D;  2YFW A;  3EPJ A;  3B0C T;  1P3A D;  3C1B D;  4J8W D;  5B33 A;  4XUJ C;  3UTB C;  3VH5 W;  5B0Z D;  4Z66 D;  3REI A;  1EQZ A;  5AV9 A;  3KUY B;  3AFA A;  1TAF B;  3KFU G;  2ZY4 A;  1M18 B;  4WU8 C;  2ARO B;  1P3F C;  5JRG A;  3C1C C;  4YM6 C;  4H9S C;  5AV6 C;  4QLC C;  3W98 B;  4ZBJ B;  5GSU B;  5CP6 B;  3LZ1 B;  2NZD D;  1P3P A;  5AV8 A;  5B0Y C;  4Z5T D;  3X1S A;  2FJ7 B;  2F2A C;  4X23 C;  1JFI B;  2F8N K;  5B2J B;  3MGR A;  3KXB D;  4WU9 A;  2F8N H;  1P3O B;  5CPK B;  3UT9 C;  1P3B A;  1P3M B;  1M1A D;  5BT1 C;  1P3K B;  5AVB D; 
#chains in the Genus database with same CATH homology
 1KX4 A;  4DQY B;  3REH C;  5BNV A;  3AZH C;  1P34 C;  4H9P A;  3WAA A;  3LEL B;  2G5H C;  3WA9 C;  1T3U A;  4ZUX D;  1F66 D;  2F8N D;  3MGS A;  3X1T C;  3O62 A;  4J8U B;  5AV5 C;  3MGQ C;  3KUY D;  1P3L B;  3REK A;  5GXQ C;  4R8P C;  2LY8 A;  3UTA D;  5FUG B;  1M18 D;  2ARO D;  3X1U A;  4EO5 C;  3X1V B;  2UWX A;  3REJ A;  1P3G D;  3AZK A;  3W98 D;  1ZLA C;  5DNN D;  5CP6 D;  3WTP A;  3AZN A;  2FJ7 D;  1S32 C;  1AOI A;  3LZ0 A;  5AV9 D;  5E5A D;  4Z2M H;  5B2J D;  3AN2 A;  2HUE B;  4YS3 D;  4J8X B;  5B1M B;  3AZF B;  1N1J B;  5CPK D;  5B40 B;  5BO0 B;  1P3K D;  3W96 A;  5B31 G;  4G91 B;  5GT3 A;  3AZG C;  5BNX A;  3X1S D;  5B1L B;  5AY8 B;  1TZY A;  3LEL D;  4JJN C;  3MGP A;  3AV2 B;  3W99 A;  4XUJ B;  5B32 C;  3UTB B;  1P3A A;  3C1B A;  4J8W A;  2Y2I A;  4Z66 A;  1P3L D;  3MNN C;  2Y2K A;  4WU8 B;  1P3F B;  3TU4 C;  4YM6 B;  5AV6 B;  2W8S A;  1P3I C;  4AWL C;  3AZL C;  5B0Y B;  4UUZ B;  2NZD A;  1BH9 A;  1KX3 C;  4Z5T A;  4M6B A;  3EPL A;  5B33 C;  1EQZ C;  4J8X D;  3WKJ B;  1EQZ B;  5B1M D;  3AZF D;  5JA4 A;  5F99 C;  3KXB A;  3AZJ B;  3WA9 B;  5JRG C;  3AZK D;  5CHL B;  4WNN B;  5G49 A;  5BS7 C;  1M1A A;  2PYO D;  3REH B;  3AZH B;  5B24 D;  3R45 A;  5AVB A;  5DNM C;  5KDM B;  1P3P C;  3KWQ C;  5B1L D;  5AY8 D;  1U35 C;  4ZUX A;  1F66 A;  2F8N A;  3NQU B;  3AV2 D;  4J8V C;  4KGC C;  4XZQ C;  5AV5 B;  4XUJ D;  3MGQ B;  3UTB D;  3MGR C;  4WU9 C;  3MVD C;  2CV5 C;  5GXQ B;  4R8P B;  3KUY A;  4KUD C;  4WU8 D;  1P3F D;  3W96 D;  1TAF A;  4EO5 B;  3UTA A;  3VH5 A;  1M18 A;  1M19 B;  2ARO A;  2DQN C;  1ZLA B;  3B6F C;  5CPJ B;  3W98 A;  5GT0 C;  5CP6 A;  5GSU A;  1S32 B;  5AVC C;  2JSS A;  1KX5 C;  3O62 C;  2FJ7 A;  1Q9C A;  1JFI A;  5E5A A;  4CSR B;  5B2J A;  3REK C;  1ID3 D;  4YS3 A;  3WKJ D;  3AZJ D;  1P3O A;  5CPK A;  3NQU A;  1P3K A;  3AZH D;  3AZG B;  3AZN C;  4JJN B;  1BH8 B;  3LEL A;  2RIQ A;  4DRA A;  3REL C;  5B32 B;  5AV5 D;  3B6G C;  3MGQ D;  3W97 B;  4J8U A;  5GXQ D;  4R8P D;  3TU4 B;  1P3L A;  4H9O B;  5CPI B;  5FUG A;  3AYW C;  1M19 D;  3AZI C;  4AWL B;  3AV1 C;  3AZL B;  1ZLA D;  5CPJ D;  3MGP C;  3VH6 T;  4H9Q B;  3LJA C;  1S32 D;  1KX3 B;  2HIO B;  2NQB C;  2JCH A;  3AZE C;  1Z2C B;  3A6N C;  5B0Z C;  4H9N B;  5F99 B;  4J8X A;  5B1M A;  3AZF A;  1N1J A;  5BO0 A;  2PYO A;  5DNM B;  1P3P B;  5GSU D;  5B24 A;  3LZ1 D;  3AZG D;  3KWQ B;  2J8P A;  4JJN D;  1U35 B;  2F8N G;  5B1L A;  5AY8 A;  4Z5T C;  4J8V B;  3AZM B;  4KGC B;  4XZQ B;  3AV2 A;  1B67 A;  2JE5 A;  3MVD B;  4WJ3 C;  3W97 D;  4XUJ A;  1KU5 A;  3UTB A;  2CV5 B;  2RVQ D;  3KXB C;  1P3O D;  1P3M D;  4KUD B;  3TU4 D;  1M1A C;  4WU8 A;  1P3F A;  5CPI D;  5AVB C;  2ZM5 A;  3FDD A;  2Y2N A;  4H9S A;  5B2I C;  5AV6 A;  3B6F B;  3B0C W;  5GT0 B;  2BYM B;  4NE6 A;  5AVC B;  1KX5 B;  5B0Y A;  2Y2L A;  4UUZ A;  1KX3 D;  2HIO D;  4J8U D;  1A7W A;  1ID3 A;  3VH5 T;  3WKJ A;  3UTA C;  3EPK A;  3C1C B;  3AZJ A;  3X1V D;  1M18 C;  4QLC B;  3WA9 A;  5B31 C;  1HQ3 C;  4LD9 C;  4WNN A;  1P3G C;  5DNM D;  3REH A;  3W98 C;  3AZH A;  4Z2M G;  3KWQ D;  5DNN C;  2ZY2 A;  4NFT A;  5KDM A;  4X23 B;  2Y2G A;  1U35 D;  3REL B;  4J8V D;  3AZM D;  4KGC D;  4UPK A;  4XZQ D;  2Y2O A;  3REI C;  5AV9 C;  3B6G B;  2BYK B;  5E5A C;  1ULY A;  3MVD D;  3AFA C;  2L5A A;  5AV5 A;  4YS3 C;  3UT9 B;  3MGQ A;  3V9R B;  5B40 D;  2XD1 A;  4KUD D;  1PZR A;  5GXQ A;  4R8P A;  2IO5 C;  3AYW B;  3AZI B;  1P3K C;  1P34 B;  3B0D C;  3AV1 B;  2VQR A;  4WZS B;  1M19 A;  3A1K A;  4H9R B;  5AV8 C;  2Y2J A;  3LEL C;  3X1S C;  4KHA B;  4G92 C;  1ZLA A;  5CPJ A;  3LJA B;  3H0R C;  3X1T B;  5AVC D;  1KX5 D;  2NQB B;  1S32 A;  3F6T A;  1W2E A;  3AZE B;  3A6N B;  5B0Z B;  1P3B C;  3IP4 C;  2FFF B;  4CSR A;  2G5I C;  4WV4 B;  1KX4 C;  3C1C D;  4YM6 D;  5AV6 D;  4QLC D;  3WAA C;  5B0Y D;  3LZ1 A;  3AZG A;  3MGS C;  4JJN A;  1BH8 A;  2YFV B;  4X23 D;  3REL D;  3B6G D;  2HUE C;  1H3O B;  3UT9 D;  3W97 A;  5B1M C;  3X1U C;  3WA9 D;  5BT1 D;  1P3M A;  3REJ C;  3TU4 A;  3AZK C;  2CWE A;  3NQJ B;  4H9O A;  3REH D;  3AZI D;  2PYO C;  1P34 D;  5B2I B;  5CPI A;  5B24 C;  3WTP C;  3AV1 D;  4G91 C;  3B0B A;  5B1L C;  2BG1 A;  3AZL A;  1AOI C;  3LJA D;  3LZ0 C;  3X1T D;  1BFM A;  4H9Q A;  3AV2 C;  2NQB D;  3AN2 C;  1KX3 A;  2HIO A;  4CAY B;  3AZE D;  3A6N D;  3MNN B;  3UTA B;  4H9N A;  5F99 A;  3W96 C;  5B31 B;  1HQ3 B;  3X1V A;  1P3I B;  1P3G B;  5GT3 C;  4LD9 B;  5BS7 A;  1HTA A;  1TZY C;  5DNN B;  2YFW B;  5DNM A;  3KWQ A;  3W99 C;  5B33 B;  1U35 A;  1P3A C;  3REI B;  3C1B C;  5AV9 B;  1WWS A;  4J8W C;  5E5A B;  4J8V A;  1R4V A;  3AZM A;  4NE5 A;  4XZQ A;  4Z66 C;  3AFA B;  4YS3 B;  4KGC A;  2Y2Q A;  3MVD A;  2Y2P A;  1ID3 C;  3WKJ C;  5JRG B;  2CV5 A;  3AZJ C;  2IO5 B;  5B40 A;  4KUD A;  3B0D B;  4DRB A;  5B2I D;  5AV8 B;  2NZD C;  3X1S B;  4G92 B;  3B6F A;  5C3I C;  5GT0 A;  2BYM A;  5B32 D;  5AVC A;  1KX5 A;  3MGR B;  4WU9 B;  1P3B B;  3MNN D;  1KX4 B;  4HGA C;  5BNV B;  4H9P B;  5B31 D;  1HQ3 D;  3WAA B;  3C1C A;  4YM6 A;  1P3I D;  1M19 C;  4LD9 D;  4QLC A;  3AZL D;  3MGS B;  4ZUX C;  5CPJ C;  1F66 C;  1WWI A;  3EPH A;  3O62 B;  2DF4 C;  5B33 D;  3EG5 B;  4X23 A;  3REL A;  3REI D;  1EQZ D;  5B32 G;  3REK B;  3AFA D;  3B6G A;  3KUY C;  2BYK A;  5F99 D;  3X1U B;  3UT9 A;  5JRG D;  3V9R A;  3REJ B;  2ARO C;  3AZK B;  2PYO B;  5B24 B;  3WTP B;  3AZN B;  3AYW A;  1P3P D;  3AZI A;  5AV8 D;  1P34 A;  4ZBJ C;  5GSU C;  5CP6 C;  3LZ1 C;  3AV1 A;  4H9R A;  1AOI B;  3LZ0 B;  3A1I A;  2FJ7 C;  4KHA A;  2Y2H A;  3VH6 A;  3AN2 B;  3P5J B;  3LJA A;  3X1T A;  3MGR D;  4WU9 D;  2NQB A;  5B2J C;  2CV5 D;  1P3B D;  3AZE A;  3W97 C;  3AL0 C;  3WTP E;  1P3O C;  3A6N A;  2RVQ C;  5B0Z A;  5CPK C;  1P3M C;  2XD5 A;  1KX4 D;  3W96 B;  5GT3 B;  5CPI C;  3WAA D;  5BNX B;  3VH6 W;  1TZY B;  3B6F D;  3MGP B;  5GT0 D;  3KSY A;  3MGS D;  3W99 B;  3O62 D;  1P3A B;  3C1B B;  2YFV A;  2HIO C;  4J8W B;  4J8U C;  4Z66 B;  3REK D;  4E45 A;  1ID3 B;  1P3L C;  3X1U D;  1H3O A;  3REJ D;  3X1V C;  3H0L C;  1B6W A;  2ZY3 A;  3WTP D;  3NQJ A;  3AZN D;  3H0M C;  2NZD B;  1BH9 B;  5B2I A;  5C3I B;  4Z5T B;  1AOI D;  3LZ0 D;  2Y2M A;  3AN2 D;  3AZM C;  1F1E A;  5B32 A;  5JA4 B;  3KXB B;  4J8X C;  4CAY A;  3AZF C;  3MNN A;  5G49 B;  4HGA B;  5B40 C;  2ZY5 A;  1M1A B;  3R45 B;  5AVB B;  4NE3 A;  3AYW D;  5GT3 D;  5B31 A;  1HQ3 A;  1TZY D;  1P3I A;  1P3G A;  4LD9 A;  3MGP D;  4ZUX B;  5AY8 C;  1F66 B;  2F8N B;  4E44 A;  5DNN A;  3W99 D;  2YFW A;  3EPJ A;  3B0C T;  1P3A D;  3C1B D;  4J8W D;  5B33 A;  4XUJ C;  3UTB C;  3VH5 W;  5B0Z D;  4Z66 D;  3REI A;  1EQZ A;  5AV9 A;  3KUY B;  3AFA A;  1TAF B;  3KFU G;  2ZY4 A;  1M18 B;  4WU8 C;  2ARO B;  1P3F C;  5JRG A;  3C1C C;  4YM6 C;  4H9S C;  5AV6 C;  4QLC C;  3W98 B;  4ZBJ B;  5GSU B;  5CP6 B;  3LZ1 B;  2NZD D;  1P3P A;  5AV8 A;  5B0Y C;  4Z5T D;  3X1S A;  2FJ7 B;  2F2A C;  4X23 C;  1JFI B;  2F8N K;  5B2J B;  3MGR A;  3KXB D;  4WU9 A;  2F8N H;  1P3O B;  5CPK B;  3UT9 C;  1P3B A;  1P3M B;  1M1A D;  5BT1 C;  1P3K B;  5AVB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...