3MGQD

Binding of nickel ions to the nucleosome core particle
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
100
structure length
100
Chain Sequence
GKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 34
structure length 100
sequence length 100
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgqD00
5BNXB 1N1JB 5BS7C 5DNMC 3WTPC 4KGCA 3WKJC 1M1AC 4KUDA 3MGQA 1M19C 4WU9A 3O62B 5B31B 5B1LA 2AROB 3V9RA 4Z2MH 4QLCA 2PYOB 1F66C 4Z66B 1KX5B 5B33A 3X1TC 1P3FA 4KHAB 3MGSC 3MGQD 3TU4C 5B1LD 3B0DB 3AYWA 3B0CW 5B33D 3NQUB 3UT9B 3MGPC 3AZMC 5GT3A 1HTAA 1P3FD 5AV8A 1P3OC 5DNMB 3AYWD 1KX4D 1P3IC 1S32B 3AN2B 5AV6D 5GT3D 3LELC 3REHA 1P3BA 5AY8B 5AVCD 4G92B 5AV5D 4X23A 1P34D 1P3LB 3MGSB 4CSRA 3KUYD 1P3BD 3B6GC 3AZGB 3X1VB 5KDMB 4UUZB 5B24C 5B2IC 4AWLC 1U35A 2CV5C 3AZMB 5B32G 1P3OB 1M18A 2F8NB 3W98D 1HQ3C 2HIOA 2YFVA 5B0ZC 3O62A 5B31A 5CPKB 3W97B 2PYOA 4WNNB 3LJAC 4Z66A 3MVDC 4KHAA 3O62D 5B31D 1P3PB 2AROD 2PYOD 4J8XC 2BYMB 4Z66D 1KX5D 3B6GB 3NQUA 3UT9A 3AZJB 4AWLB 3REJC 2CV5B 5BS7A 5DNMA 3WTPA 3W99C 5GSUC 3WKJA 3AN2A 3UT9D 1M1AA 1HQ3B 1M19A 3R45B 5CPIC 1P3GC 3W96C 1S32D 3MVDB 3AN2D 3X1TA 1P3LA 3MGSA 3MGRB 3TU4A 5AY8D 3X1VA 5KDMA 4J8XB 4H9QB 3MGPA 3AZMA 1P3LD 3REJB 1F1EA 2CWEA 3MGSD 1B67A 1P3OA 3AZGD 3X1VD 4WU8B 5E5AB 5B1LC 3C1CB 4JJNC 4WV4B 3AV1B 3AZMD 5B33C 3W97A 4WNNA 3LELA 1BH9B 1P3OD 5AV9B 5CPJB 4DRAA 1P3GB 2F8ND 5BO0B 3W96B 5CPKD 4H9RB 1KX4C 3W97D 3B0BA 2BYMA 5AV6C 5GT3C 3B6GA 4R8PD 5JRGB 3AZJA 5B2IA 5AVCC 5AV5C 2CV5A 1P3PD 1P34C 1P3MB 3AZKB 3B6GD 3KUYC 3AZLC 4H9OB 1P3BC 4E44A 3AZJD 4JJNB 1HQ3A 2CV5D 3B6FB 3A6NC 3LJAA 3REKD 3AZHC 3MVDA 4XZQD 5B0YC 1P3AD 1HQ3D 3MGRA 3W98C 5F99B 4M6BA 4J8XA 3WTPE 3X1SC 4XUJC 3REJA 3MGRD 4DRBA 4H9SA 4J8XD 5E5AA 5B31C 5GSUA 2AROC 3W99A 3AZLB 4Z66C 1KX5C 5CHLB 3REJD 5GXQB 1BH9A 3AFAB 3VH5W 3A6NB 3AZHB 3UTBB 3AZFC 5E5AD 3C1CD 4WU8D 5CPIA 1P3GA 3W96A 5BO0A 3AV1D 4H9RA 4J8WC 5B0YB 4CAYB 5CP6C 1ID3B 4H9PA 1ZLAB 5AV9D 5CPJD 1P3GD 3W96D 3X1SB 4NE3A 4XUJB 3KXBC 1S32C 3AN2C 2NQBC 3AZKA 4H9OA 5JRGD 4JJNA 5AY8C 4G92C 1P3MD 3AZKD 1P3LC 3UTAC 3AZFB 4JJND 3AZGC 3X1VC 4J8WB 1KX4A 5CP6B 1R4VA 3B6FD 2FJ7B 5AV6A 4YS3B 1KU5A 5AVCA 5B31G 5GT0C 1AOIC 5AV5A 5JA4B 3KXBB 5F99D 1P34A 5CPKC 2NQBB 2YFWA 3KUYA 3AZLA 3W97C 3VH6W 4R8PC 3LZ0B 5B2JC 3B0CT 3A6NA 3AZHA 1P3PC 5BT1D 3UTAB 3AZLD 4H9NB 5B0YA 3KWQB 4CAYA 5GXQD 4WZSB 3AZJC 1TAFB 3W98A 3AFAD 1ZLAA 3A6ND 3AZHD 3UTBD 5BNXA 3X1SA 3REKC 1N1JA 4XUJA 1WWSA 5B0YD 5GT0B 1ID3D 3NQJB 1AOIB 5FUGB 4XZQC 1P3AC 4E45A 1ZLAD 2AROA 1KX3C 3X1SD 3AV2C 4XUJD 1KX5A 5B32B 4R8PB 5B2JB 1A7WA 5BNVB 3MGRC 3AZFA 2HUEC 3LZ1D 4J8WA 5CP6A 2JSSA 4YS3A 2F8NG 4EO5B 1Q9CA 3AZFD 3REKB 4H9SC 4WU8C 5E5AC 3C1CC 3KXBA 4J8WD 1S32A 3AV1C 5CP6D 2NQBA 2FJ7D 4XZQB 4YS3D 1P3AB 3REIB 5AY8A 1KX3B 5AV9C 3AV2B 5CPJC 3KXBD 2NQBD 3UTAA 4H9NA 2HUEB 4ZUXC 3AZGA 5JRGC 1BFMA 3LZ0D 4UUZA 3UTAD 1P3MC 3AZKC 3KWQD 1EQZB 5GT0A 3NQJA 4ZBJB 1AOIA 2F8NA 5CPKA 3B6FC 4R8PA 5GT0D 1AOID 4NE5A 5B2JA 1P3PA 5F99C 5AVBC 4ZUXB 5B32D 3RELC 5B2JD 3REKA 5BT1C 4XZQA 1P3AA 4G91B 5GXQC 5DNNC 3R45A 3AFAC 2IO5C 1KX3A 3UTBC 3AV2A 3REID 1ID3C 4J8UB 3AZIC 3MNNC 5AVBB 1ZLAC 1KX3D 3AV2D 1P3KB 3AZNC 3RELB 4H9QA 3WAAC 1JFIB 4LD9C 1EQZA 4WU8A 4KGCB 3C1CA 3AV1A 3LZ1C 4KUDB 2L5AA 4WU9B 5DNNB 4QLCB 2IO5B 1EQZD 5AV9A 5CPJA 4NFTA 4Z5TD 3AZIB 3MNNB 2FJ7C 4YS3C 4ZUXA 5JRGA 3AZNB 3WAAB 1P3MA 4LD9B 4ZUXD 3VH5T 3LZ1B 5C3IC 3LZ0C 3AZEB 4YM6D 3REHB 3B6FA 4X23B 1BH8B 3KWQC 4J8UA 5F99A 4CSRB 5AVBA 3RELA 2RVQD 3WA9C 5G49B 1WWIA 1U35B 4J8UD 5AVBD 1P3KD 5B40B 1M18B 3RELD 2HIOB 2YFVB 5B32C 5DNNA 5GXQA 5C3IB 3AFAA 3UTBA 4KGCD 5B1MC 4KUDD 4WU9D 1ID3A 5DNND 3AZIA 3MNNA 4QLCD 4EO5C 3X1UB 3AZNA 3VH6T 3WAAA 3WA9B 3AZID 3MNND 4LD9A 3REIC 3WTPB 1B6WA 3WKJB 3AZND 3LZ1A 1M1AB 3WAAD 3AZEA 1M19B 5AV8D 4LD9D 1F66B 1BH8A 5B1MB 3X1TB 2LY8A 3AZED 1H3OB 3REHD 3TU4B 2FJ7A 4X23D 5G49A 3C1BC 1EQZC 3MGPB 4ZBJC 5JA4A 4HGAC 5B40A 4Z5TC 1P3IB 1TZYC 1U35D 3LZ0A 3LELB 5B40D 1M18D 2HIOD 3KWQA 1TAFA 3VH5A 3X1UA 4YM6C 4J8VC 2BYKB 5B24B 5B2IB 3WA9A 3C1BB 5FUGA 4G91C 2NZDC 4HGAB 3X1UD 4Z5TB 1TZYB 3WA9D 5B0ZB 5B32A 2RVQC 3LJAB 1F66A 5DNMD 5BNVA 3WTPD 4J8UC 3WKJD 5B1MA 1M1AD 1P3KC 1M19D 1H3OA 1F66D 2F8NH 4YM6B 4J8VB 5B1MD 3X1TD 4KGCC 3TU4D 4KUDC 3MGQC 3REIA 4WU9C 2NZDB 5GSUB 1P3IA 3W99B 4QLCC 2F8NK 3MGPD 1P3FC 5CPIB 3VH6A 1P3ID 3AYWC 3LELD 4H9PB 5AV8C 2BYKA 5B24A 3C1BA 3MGQB 3AZEC 4Z5TA 3REHC 5B1LB 1TZYA 3V9RB 4Z2MG 5B2ID 5B0ZA 5B24D 3C1BD 4X23C 5B33B 1P3FB 1TZYD 5B0ZD 3AYWB 1KX4B 3LJAD 1U35C 5AV6B 5GT3B 4YM6A 5AV8B 3MVDD 4J8VA 5AVCB 5B40C 1M18C 5AV5B 1P34B 2HIOC 4NE6A 2YFWB 3O62C 2NZDA 3KUYB 2PYOC 4J8VD 1P3BB 1ULYA 2NZDD 3W99D 5GSUD 3B0DC 3X1UC 1P3KA 3W98B 3UT9C 3KSYA 5CPID 1JFIA
chains in the Genus database with same CATH superfamily
5BNXB 1N1JB 5BS7C 5DNMC 3WTPC 4KGCA 3WKJC 1M1AC 4KUDA 3MGQA 1M19C 4WU9A 3O62B 5B31B 5B1LA 2AROB 3V9RA 4Z2MH 4QLCA 2G5HC 2PYOB 1F66C 4Z66B 1KX5B 5B33A 3X1TC 1P3FA 4KHAB 3MGSC 3MGQD 3TU4C 1Z2CB 5B1LD 3B0DB 3AYWA 3B0CW 5B33D 3NQUB 1W2EA 3UT9B 3MGPC 3AZMC 5GT3A 1HTAA 1P3FD 5AV8A 1P3OC 5DNMB 3AYWD 1KX4D 1P3IC 1S32B 3AN2B 5AV6D 5GT3D 3LELC 3REHA 1P3BA 5AY8B 5AVCD 4G92B 5AV5D 4X23A 1P34D 1P3LB 3MGSB 4CSRA 2J8PA 3KUYD 1P3BD 3B6GC 3AZGB 3X1VB 5KDMB 4UUZB 5B24C 5B2IC 4AWLC 1U35A 2CV5C 3AZMB 5B32G 1P3OB 1M18A 2F8NB 3W98D 1HQ3C 2HIOA 2YFVA 5B0ZC 3O62A 5B31A 5CPKB 3W97B 2PYOA 4WNNB 3LJAC 4Z66A 3MVDC 4KHAA 3O62D 5B31D 1P3PB 2AROD 2PYOD 4J8XC 2BYMB 4Z66D 1KX5D 3B6GB 3NQUA 3UT9A 3AZJB 4AWLB 3REJC 2CV5B 5BS7A 5DNMA 3WTPA 3W99C 5GSUC 3WKJA 3AN2A 3UT9D 2VQRA 1M1AA 1HQ3B 1M19A 3R45B 5CPIC 1P3GC 3W96C 1S32D 3MVDB 3AN2D 3X1TA 1P3LA 3MGSA 3MGRB 3TU4A 3P5JB 5AY8D 3X1VA 5KDMA 4J8XB 4H9QB 3MGPA 3AZMA 1P3LD 3REJB 1F1EA 2CWEA 3MGSD 2BG1A 1B67A 1P3OA 3AZGD 3X1VD 4WU8B 5E5AB 5B1LC 3C1CB 4JJNC 4WV4B 3AV1B 3A1IA 3AZMD 5B33C 3W97A 4WNNA 3LELA 1BH9B 1P3OD 5AV9B 5CPJB 4DRAA 1P3GB 2F8ND 5BO0B 3W96B 5CPKD 4H9RB 1KX4C 3W97D 3B0BA 2BYMA 5AV6C 5GT3C 3B6GA 4R8PD 5JRGB 3AZJA 2ZY3A 5B2IA 5AVCC 5AV5C 2CV5A 1P3PD 1P34C 1P3MB 3AZKB 3B6GD 3KUYC 3AZLC 4H9OB 1P3BC 2DF4C 4E44A 3AZJD 4JJNB 1HQ3A 2ZY5A 2CV5D 3B6FB 3A6NC 3LJAA 3REKD 3AZHC 3MVDA 4XZQD 5B0YC 1P3AD 1HQ3D 3MGRA 3W98C 5F99B 4M6BA 4J8XA 3WTPE 3X1SC 4XUJC 3REJA 3MGRD 4DRBA 4UPKA 4H9SA 4J8XD 5E5AA 5B31C 5GSUA 2AROC 3W99A 3AZLB 4Z66C 1KX5C 5CHLB 3REJD 5GXQB 1BH9A 3AFAB 3VH5W 3A6NB 3AZHB 3UTBB 3AZFC 5E5AD 3C1CD 4WU8D 5CPIA 1P3GA 3W96A 5BO0A 3AV1D 4H9RA 4J8WC 5B0YB 4CAYB 5CP6C 1ID3B 4H9PA 1ZLAB 3EG5B 5AV9D 5CPJD 1P3GD 3W96D 3X1SB 4NE3A 4XUJB 3KXBC 1S32C 3AN2C 2NQBC 3AZKA 4H9OA 5JRGD 4JJNA 5AY8C 4G92C 1P3MD 3AZKD 1P3LC 2W8SA 3UTAC 2DQNC 3AZFB 4JJND 3AZGC 3X1VC 4J8WB 1KX4A 5CP6B 1R4VA 3B6FD 2FJ7B 5AV6A 4YS3B 1KU5A 2UWXA 5AVCA 5B31G 5GT0C 1AOIC 5AV5A 5JA4B 3KXBB 5F99D 1P34A 5CPKC 2NQBB 2YFWA 3KUYA 3AZLA 3W97C 3VH6W 3AL0C 4R8PC 3LZ0B 5B2JC 3B0CT 2Y2OA 3A6NA 3AZHA 1P3PC 3A1KA 5BT1D 3UTAB 3AZLD 4H9NB 5B0YA 3KWQB 4CAYA 2Y2QA 5GXQD 4WZSB 3AZJC 1TAFB 3W98A 3AFAD 1ZLAA 3A6ND 3AZHD 3UTBD 2Y2NA 5BNXA 3X1SA 3REKC 1N1JA 2Y2IA 4XUJA 1WWSA 5B0YD 1PZRA 5GT0B 1ID3D 3NQJB 1AOIB 5FUGB 4XZQC 1P3AC 4E45A 1ZLAD 2AROA 2XD5A 1KX3C 3X1SD 3AV2C 4XUJD 1KX5A 5B32B 3H0MC 4R8PB 5B2JB 1A7WA 5BNVB 3MGRC 3AZFA 2HUEC 3LZ1D 4J8WA 5CP6A 2JSSA 4YS3A 2ZY4A 2F8NG 4EO5B 1Q9CA 3AZFD 3REKB 4H9SC 4WU8C 5E5AC 3C1CC 3KXBA 4J8WD 1S32A 3AV1C 5CP6D 2NQBA 2FJ7D 2JE5A 4XZQB 4YS3D 3REIB 1P3AB 2Y2LA 5AY8A 1KX3B 5AV9C 3AV2B 5CPJC 3KXBD 2NQBD 3UTAA 4H9NA 2HUEB 4ZUXC 3AZGA 5JRGC 3EPKA 3LZ0D 1BFMA 4UUZA 2G5IC 2ZY2A 3UTAD 1P3MC 3AZKC 3KWQD 1EQZB 5GT0A 3NQJA 4ZBJB 1AOIA 2F8NA 5CPKA 3B6FC 4R8PA 5GT0D 1AOID 4NE5A 5B2JA 1P3PA 5F99C 5AVBC 4ZUXB 5B32D 3RELC 5B2JD 3F6TA 3REKA 5BT1C 4XZQA 1P3AA 4G91B 5GXQC 5DNNC 4WJ3C 3R45A 3AFAC 2IO5C 1KX3A 3UTBC 3AV2A 3REID 1ID3C 4J8UB 3AZIC 3MNNC 5AVBB 1ZLAC 1KX3D 3AV2D 1P3KB 3AZNC 3RELB 4H9QA 3WAAC 1JFIB 4LD9C 1EQZA 4WU8A 4KGCB 3C1CA 3AV1A 3LZ1C 4KUDB 2L5AA 4WU9B 5DNNB 4QLCB 2IO5B 1EQZD 5AV9A 5CPJA 4NFTA 4Z5TD 3AZIB 1T3UA 3MNNB 2FJ7C 4YS3C 4ZUXA 5JRGA 3AZNB 3WAAB 1P3MA 2Y2MA 4LD9B 4ZUXD 3VH5T 2JCHA 3H0RC 2RIQA 3LZ1B 5C3IC 3LZ0C 3AZEB 4YM6D 3REHB 3B6FA 2Y2KA 4X23B 1BH8B 3KWQC 4J8UA 5F99A 4CSRB 5AVBA 2F2AC 3RELA 2RVQD 3WA9C 5G49B 1WWIA 1U35B 3FDDA 4J8UD 5AVBD 2ZM5A 5B40B 1P3KD 1M18B 3RELD 2HIOB 2YFVB 5B32C 5DNNA 5GXQA 5C3IB 2Y2JA 3AFAA 3UTBA 4KGCD 5B1MC 4KUDD 2Y2PA 3H0LC 4WU9D 2Y2HA 5DNND 3AZIA 3MNNA 1ID3A 4QLCD 4EO5C 3X1UB 3AZNA 3VH6T 3WAAA 3WA9B 3AZID 3MNND 4LD9A 3REIC 3WTPB 1B6WA 3WKJB 3AZND 3LZ1A 1M1AB 3WAAD 3AZEA 1M19B 5AV8D 4LD9D 1F66B 1BH8A 3EPHA 5B1MB 3X1TB 2LY8A 3AZED 1H3OB 3REHD 3TU4B 2FJ7A 4X23D 5G49A 3C1BC 1EQZC 3MGPB 4ZBJC 5JA4A 2Y2GA 4HGAC 5B40A 4Z5TC 3EPJA 1P3IB 1TZYC 1U35D 3LZ0A 3LELB 5B40D 1M18D 3EPLA 2HIOD 3KWQA 1TAFA 3VH5A 3X1UA 2FFFB 4YM6C 4J8VC 2BYKB 5B24B 5B2IB 3WA9A 3C1BB 5FUGA 4G91C 2NZDC 4HGAB 3X1UD 4Z5TB 3IP4C 1TZYB 3WA9D 5B0ZB 5B32A 2RVQC 3LJAB 1F66A 5DNMD 5BNVA 3WTPD 4J8UC 3WKJD 5B1MA 1M1AD 1P3KC 1M19D 1H3OA 1F66D 2F8NH 4YM6B 4J8VB 5B1MD 3X1TD 4KGCC 3TU4D 4KUDC 3MGQC 3REIA 4WU9C 2NZDB 5GSUB 1P3IA 3W99B 4QLCC 2F8NK 3MGPD 1P3FC 5CPIB 3VH6A 1P3ID 3AYWC 3LELD 4H9PB 4DQYB 5AV8C 2BYKA 5B24A 3C1BA 3MGQB 3AZEC 4Z5TA 3REHC 5B1LB 1TZYA 3V9RB 4Z2MG 5B2ID 5B0ZA 5B24D 3C1BD 4X23C 3KFUG 5B33B 1P3FB 1TZYD 5B0ZD 3AYWB 1KX4B 3LJAD 1U35C 5AV6B 5GT3B 4YM6A 5AV8B 3MVDD 4J8VA 5AVCB 5B40C 1M18C 5AV5B 1P34B 2HIOC 4NE6A 2YFWB 3O62C 2NZDA 3KUYB 2PYOC 4J8VD 1P3BB 2XD1A 1ULYA 2NZDD 3W99D 5GSUD 3B0DC 3X1UC 1P3KA 3W98B 3UT9C 3KSYA 5CPID 1JFIA
chains in the Genus database with same CATH topology
5BNXB 1N1JB 5BS7C 5DNMC 3WTPC 4KGCA 3WKJC 1M1AC 4KUDA 3MGQA 1M19C 4WU9A 3O62B 5B31B 5B1LA 2AROB 3V9RA 4Z2MH 4QLCA 2G5HC 2PYOB 1F66C 4Z66B 1KX5B 5B33A 3X1TC 1P3FA 4KHAB 3MGSC 3MGQD 3TU4C 1Z2CB 5B1LD 3B0DB 3AYWA 3B0CW 5B33D 3NQUB 1W2EA 3UT9B 3MGPC 3AZMC 5GT3A 1HTAA 1P3FD 5AV8A 1P3OC 5DNMB 3AYWD 1KX4D 1P3IC 1S32B 3AN2B 5AV6D 5GT3D 3LELC 3REHA 1P3BA 5AY8B 5AVCD 4G92B 5AV5D 4X23A 1P34D 1P3LB 3MGSB 4CSRA 2J8PA 3KUYD 1P3BD 3B6GC 3AZGB 3X1VB 5KDMB 4UUZB 5B24C 5B2IC 4AWLC 1U35A 2CV5C 3AZMB 5B32G 1P3OB 1M18A 2F8NB 3W98D 1HQ3C 2HIOA 2YFVA 5B0ZC 3O62A 5B31A 5CPKB 3W97B 2PYOA 4WNNB 3LJAC 4Z66A 3MVDC 4KHAA 3O62D 5B31D 1P3PB 2AROD 2PYOD 4J8XC 2BYMB 4Z66D 1KX5D 3B6GB 3NQUA 3UT9A 3AZJB 4AWLB 3REJC 2CV5B 5BS7A 5DNMA 3WTPA 3W99C 5GSUC 3WKJA 3AN2A 3UT9D 2VQRA 1M1AA 1HQ3B 1M19A 3R45B 5CPIC 1P3GC 3W96C 1S32D 3MVDB 3AN2D 3X1TA 1P3LA 3MGSA 3MGRB 3TU4A 3P5JB 5AY8D 3X1VA 5KDMA 4J8XB 4H9QB 3MGPA 3AZMA 1P3LD 3REJB 1F1EA 2CWEA 3MGSD 2BG1A 1B67A 1P3OA 3AZGD 3X1VD 4WU8B 5E5AB 5B1LC 3C1CB 4JJNC 4WV4B 3AV1B 3A1IA 3AZMD 5B33C 3W97A 4WNNA 3LELA 1BH9B 1P3OD 5AV9B 5CPJB 4DRAA 1P3GB 2F8ND 5BO0B 3W96B 5CPKD 4H9RB 1KX4C 3W97D 3B0BA 2BYMA 5AV6C 5GT3C 3B6GA 4R8PD 5JRGB 3AZJA 2ZY3A 5B2IA 5AVCC 5AV5C 2CV5A 1P3PD 1P34C 1P3MB 3AZKB 3B6GD 3KUYC 3AZLC 4H9OB 1P3BC 2DF4C 4E44A 3AZJD 4JJNB 1HQ3A 2ZY5A 2CV5D 3B6FB 3A6NC 3LJAA 3REKD 3AZHC 3MVDA 4XZQD 5B0YC 1P3AD 1HQ3D 3MGRA 3W98C 5F99B 4M6BA 4J8XA 3WTPE 3X1SC 4XUJC 3REJA 3MGRD 4DRBA 4UPKA 4H9SA 4J8XD 5E5AA 5B31C 5GSUA 2AROC 3W99A 3AZLB 4Z66C 1KX5C 5CHLB 3REJD 5GXQB 1BH9A 3AFAB 3VH5W 3A6NB 3AZHB 3UTBB 3AZFC 5E5AD 3C1CD 4WU8D 5CPIA 1P3GA 3W96A 5BO0A 3AV1D 4H9RA 4J8WC 5B0YB 4CAYB 5CP6C 1ID3B 4H9PA 1ZLAB 3EG5B 5AV9D 5CPJD 1P3GD 3W96D 3X1SB 4NE3A 4XUJB 3KXBC 1S32C 3AN2C 2NQBC 3AZKA 4H9OA 5JRGD 4JJNA 5AY8C 4G92C 1P3MD 3AZKD 1P3LC 2W8SA 3UTAC 2DQNC 3AZFB 4JJND 3AZGC 3X1VC 4J8WB 1KX4A 5CP6B 1R4VA 3B6FD 2FJ7B 5AV6A 4YS3B 1KU5A 2UWXA 5AVCA 5B31G 5GT0C 1AOIC 5AV5A 5JA4B 3KXBB 5F99D 1P34A 5CPKC 2NQBB 2YFWA 3KUYA 3AZLA 3W97C 3VH6W 3AL0C 4R8PC 3LZ0B 5B2JC 3B0CT 2Y2OA 3A6NA 3AZHA 1P3PC 3A1KA 5BT1D 3UTAB 3AZLD 4H9NB 5B0YA 3KWQB 4CAYA 2Y2QA 5GXQD 4WZSB 3AZJC 1TAFB 3W98A 3AFAD 1ZLAA 3A6ND 3AZHD 3UTBD 2Y2NA 5BNXA 3X1SA 3REKC 1N1JA 2Y2IA 4XUJA 1WWSA 5B0YD 1PZRA 5GT0B 1ID3D 3NQJB 1AOIB 5FUGB 4XZQC 1P3AC 4E45A 1ZLAD 2AROA 2XD5A 1KX3C 3X1SD 3AV2C 4XUJD 1KX5A 5B32B 3H0MC 4R8PB 5B2JB 1A7WA 5BNVB 3MGRC 3AZFA 2HUEC 3LZ1D 4J8WA 5CP6A 2JSSA 4YS3A 2ZY4A 2F8NG 4EO5B 1Q9CA 3AZFD 3REKB 4H9SC 4WU8C 5E5AC 3C1CC 3KXBA 4J8WD 1S32A 3AV1C 5CP6D 2NQBA 2FJ7D 2JE5A 4XZQB 4YS3D 3REIB 1P3AB 2Y2LA 5AY8A 1KX3B 5AV9C 3AV2B 5CPJC 3KXBD 2NQBD 3UTAA 4H9NA 2HUEB 4ZUXC 3AZGA 5JRGC 3EPKA 3LZ0D 1BFMA 4UUZA 2G5IC 2ZY2A 3UTAD 1P3MC 3AZKC 3KWQD 1EQZB 5GT0A 3NQJA 4ZBJB 1AOIA 2F8NA 5CPKA 3B6FC 4R8PA 5GT0D 1AOID 4NE5A 5B2JA 1P3PA 5F99C 5AVBC 4ZUXB 5B32D 3RELC 5B2JD 3F6TA 3REKA 5BT1C 4XZQA 1P3AA 4G91B 5GXQC 5DNNC 4WJ3C 3R45A 3AFAC 2IO5C 1KX3A 3UTBC 3AV2A 3REID 1ID3C 4J8UB 3AZIC 3MNNC 5AVBB 1ZLAC 1KX3D 3AV2D 1P3KB 3AZNC 3RELB 4H9QA 3WAAC 1JFIB 4LD9C 1EQZA 4WU8A 4KGCB 3C1CA 3AV1A 3LZ1C 4KUDB 2L5AA 4WU9B 5DNNB 4QLCB 2IO5B 1EQZD 5AV9A 5CPJA 4NFTA 4Z5TD 3AZIB 1T3UA 3MNNB 2FJ7C 4YS3C 4ZUXA 5JRGA 3AZNB 3WAAB 1P3MA 2Y2MA 4LD9B 4ZUXD 3VH5T 2JCHA 3H0RC 2RIQA 3LZ1B 5C3IC 3LZ0C 3AZEB 4YM6D 3REHB 3B6FA 2Y2KA 4X23B 1BH8B 3KWQC 4J8UA 5F99A 4CSRB 5AVBA 2F2AC 3RELA 2RVQD 3WA9C 5G49B 1WWIA 1U35B 3FDDA 4J8UD 5AVBD 2ZM5A 5B40B 1P3KD 1M18B 3RELD 2HIOB 2YFVB 5B32C 5DNNA 5GXQA 5C3IB 2Y2JA 3AFAA 3UTBA 4KGCD 5B1MC 4KUDD 2Y2PA 3H0LC 4WU9D 2Y2HA 5DNND 3AZIA 3MNNA 1ID3A 4QLCD 4EO5C 3X1UB 3AZNA 3VH6T 3WAAA 3WA9B 3AZID 3MNND 4LD9A 3REIC 3WTPB 1B6WA 3WKJB 3AZND 3LZ1A 1M1AB 3WAAD 3AZEA 1M19B 5AV8D 4LD9D 1F66B 1BH8A 3EPHA 5B1MB 3X1TB 2LY8A 3AZED 1H3OB 3REHD 3TU4B 2FJ7A 4X23D 5G49A 3C1BC 1EQZC 3MGPB 4ZBJC 5JA4A 2Y2GA 4HGAC 5B40A 4Z5TC 3EPJA 1P3IB 1TZYC 1U35D 3LZ0A 3LELB 5B40D 1M18D 3EPLA 2HIOD 3KWQA 1TAFA 3VH5A 3X1UA 2FFFB 4YM6C 4J8VC 2BYKB 5B24B 5B2IB 3WA9A 3C1BB 5FUGA 4G91C 2NZDC 4HGAB 3X1UD 4Z5TB 3IP4C 1TZYB 3WA9D 5B0ZB 5B32A 2RVQC 3LJAB 1F66A 5DNMD 5BNVA 3WTPD 4J8UC 3WKJD 5B1MA 1M1AD 1P3KC 1M19D 1H3OA 1F66D 2F8NH 4YM6B 4J8VB 5B1MD 3X1TD 4KGCC 3TU4D 4KUDC 3MGQC 3REIA 4WU9C 2NZDB 5GSUB 1P3IA 3W99B 4QLCC 2F8NK 3MGPD 1P3FC 5CPIB 3VH6A 1P3ID 3AYWC 3LELD 4H9PB 4DQYB 5AV8C 2BYKA 5B24A 3C1BA 3MGQB 3AZEC 4Z5TA 3REHC 5B1LB 1TZYA 3V9RB 4Z2MG 5B2ID 5B0ZA 5B24D 3C1BD 4X23C 3KFUG 5B33B 1P3FB 1TZYD 5B0ZD 3AYWB 1KX4B 3LJAD 1U35C 5AV6B 5GT3B 4YM6A 5AV8B 3MVDD 4J8VA 5AVCB 5B40C 1M18C 5AV5B 1P34B 2HIOC 4NE6A 2YFWB 3O62C 2NZDA 3KUYB 2PYOC 4J8VD 1P3BB 2XD1A 1ULYA 2NZDD 3W99D 5GSUD 3B0DC 3X1UC 1P3KA 3W98B 3UT9C 3KSYA 5CPID 1JFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNX B;  1N1J B;  5BS7 C;  5DNM C;  3WTP C;  4KGC A;  3WKJ C;  1M1A C;  4KUD A;  3MGQ A;  1M19 C;  4WU9 A;  3O62 B;  5B31 B;  5B1L A;  2ARO B;  3V9R A;  4Z2M H;  4QLC A;  2PYO B;  1F66 C;  4Z66 B;  1KX5 B;  5B33 A;  3X1T C;  1P3F A;  4KHA B;  3MGS C;  3MGQ D;  3TU4 C;  5B1L D;  3B0D B;  3AYW A;  3B0C W;  5B33 D;  3NQU B;  3UT9 B;  3MGP C;  3AZM C;  5GT3 A;  1HTA A;  1P3F D;  5AV8 A;  1P3O C;  5DNM B;  3AYW D;  1KX4 D;  1P3I C;  1S32 B;  3AN2 B;  5AV6 D;  5GT3 D;  3LEL C;  3REH A;  1P3B A;  5AY8 B;  5AVC D;  4G92 B;  5AV5 D;  4X23 A;  1P34 D;  1P3L B;  3MGS B;  4CSR A;  3KUY D;  1P3B D;  3B6G C;  3AZG B;  3X1V B;  5KDM B;  4UUZ B;  5B24 C;  5B2I C;  4AWL C;  1U35 A;  2CV5 C;  3AZM B;  5B32 G;  1P3O B;  1M18 A;  2F8N B;  3W98 D;  1HQ3 C;  2HIO A;  2YFV A;  5B0Z C;  3O62 A;  5B31 A;  5CPK B;  3W97 B;  2PYO A;  4WNN B;  3LJA C;  4Z66 A;  3MVD C;  4KHA A;  3O62 D;  5B31 D;  1P3P B;  2ARO D;  2PYO D;  4J8X C;  2BYM B;  4Z66 D;  1KX5 D;  3B6G B;  3NQU A;  3UT9 A;  3AZJ B;  4AWL B;  3REJ C;  2CV5 B;  5BS7 A;  5DNM A;  3WTP A;  3W99 C;  5GSU C;  3WKJ A;  3AN2 A;  3UT9 D;  1M1A A;  1HQ3 B;  1M19 A;  3R45 B;  5CPI C;  1P3G C;  3W96 C;  1S32 D;  3MVD B;  3AN2 D;  3X1T A;  1P3L A;  3MGS A;  3MGR B;  3TU4 A;  5AY8 D;  3X1V A;  5KDM A;  4J8X B;  4H9Q B;  3MGP A;  3AZM A;  1P3L D;  3REJ B;  1F1E A;  2CWE A;  3MGS D;  1B67 A;  1P3O A;  3AZG D;  3X1V D;  4WU8 B;  5E5A B;  5B1L C;  3C1C B;  4JJN C;  4WV4 B;  3AV1 B;  3AZM D;  5B33 C;  3W97 A;  4WNN A;  3LEL A;  1BH9 B;  1P3O D;  5AV9 B;  5CPJ B;  4DRA A;  1P3G B;  2F8N D;  5BO0 B;  3W96 B;  5CPK D;  4H9R B;  1KX4 C;  3W97 D;  3B0B A;  2BYM A;  5AV6 C;  5GT3 C;  3B6G A;  4R8P D;  5JRG B;  3AZJ A;  5B2I A;  5AVC C;  5AV5 C;  2CV5 A;  1P3P D;  1P34 C;  1P3M B;  3AZK B;  3B6G D;  3KUY C;  3AZL C;  4H9O B;  1P3B C;  4E44 A;  3AZJ D;  4JJN B;  1HQ3 A;  2CV5 D;  3B6F B;  3A6N C;  3LJA A;  3REK D;  3AZH C;  3MVD A;  4XZQ D;  5B0Y C;  1P3A D;  1HQ3 D;  3MGR A;  3W98 C;  5F99 B;  4M6B A;  4J8X A;  3WTP E;  3X1S C;  4XUJ C;  3REJ A;  3MGR D;  4DRB A;  4H9S A;  4J8X D;  5E5A A;  5B31 C;  5GSU A;  2ARO C;  3W99 A;  3AZL B;  4Z66 C;  1KX5 C;  5CHL B;  3REJ D;  5GXQ B;  1BH9 A;  3AFA B;  3VH5 W;  3A6N B;  3AZH B;  3UTB B;  3AZF C;  5E5A D;  3C1C D;  4WU8 D;  5CPI A;  1P3G A;  3W96 A;  5BO0 A;  3AV1 D;  4H9R A;  4J8W C;  5B0Y B;  4CAY B;  5CP6 C;  1ID3 B;  4H9P A;  1ZLA B;  5AV9 D;  5CPJ D;  1P3G D;  3W96 D;  3X1S B;  4NE3 A;  4XUJ B;  3KXB C;  1S32 C;  3AN2 C;  2NQB C;  3AZK A;  4H9O A;  5JRG D;  4JJN A;  5AY8 C;  4G92 C;  1P3M D;  3AZK D;  1P3L C;  3UTA C;  3AZF B;  4JJN D;  3AZG C;  3X1V C;  4J8W B;  1KX4 A;  5CP6 B;  1R4V A;  3B6F D;  2FJ7 B;  5AV6 A;  4YS3 B;  1KU5 A;  5AVC A;  5B31 G;  5GT0 C;  1AOI C;  5AV5 A;  5JA4 B;  3KXB B;  5F99 D;  1P34 A;  5CPK C;  2NQB B;  2YFW A;  3KUY A;  3AZL A;  3W97 C;  3VH6 W;  4R8P C;  3LZ0 B;  5B2J C;  3B0C T;  3A6N A;  3AZH A;  1P3P C;  5BT1 D;  3UTA B;  3AZL D;  4H9N B;  5B0Y A;  3KWQ B;  4CAY A;  5GXQ D;  4WZS B;  3AZJ C;  1TAF B;  3W98 A;  3AFA D;  1ZLA A;  3A6N D;  3AZH D;  3UTB D;  5BNX A;  3X1S A;  3REK C;  1N1J A;  4XUJ A;  1WWS A;  5B0Y D;  5GT0 B;  1ID3 D;  3NQJ B;  1AOI B;  5FUG B;  4XZQ C;  1P3A C;  4E45 A;  1ZLA D;  2ARO A;  1KX3 C;  3X1S D;  3AV2 C;  4XUJ D;  1KX5 A;  5B32 B;  4R8P B;  5B2J B;  1A7W A;  5BNV B;  3MGR C;  3AZF A;  2HUE C;  3LZ1 D;  4J8W A;  5CP6 A;  2JSS A;  4YS3 A;  2F8N G;  4EO5 B;  1Q9C A;  3AZF D;  3REK B;  4H9S C;  4WU8 C;  5E5A C;  3C1C C;  3KXB A;  4J8W D;  1S32 A;  3AV1 C;  5CP6 D;  2NQB A;  2FJ7 D;  4XZQ B;  4YS3 D;  1P3A B;  3REI B;  5AY8 A;  1KX3 B;  5AV9 C;  3AV2 B;  5CPJ C;  3KXB D;  2NQB D;  3UTA A;  4H9N A;  2HUE B;  4ZUX C;  3AZG A;  5JRG C;  1BFM A;  3LZ0 D;  4UUZ A;  3UTA D;  1P3M C;  3AZK C;  3KWQ D;  1EQZ B;  5GT0 A;  3NQJ A;  4ZBJ B;  1AOI A;  2F8N A;  5CPK A;  3B6F C;  4R8P A;  5GT0 D;  1AOI D;  4NE5 A;  5B2J A;  1P3P A;  5F99 C;  5AVB C;  4ZUX B;  5B32 D;  3REL C;  5B2J D;  3REK A;  5BT1 C;  4XZQ A;  1P3A A;  4G91 B;  5GXQ C;  5DNN C;  3R45 A;  3AFA C;  2IO5 C;  1KX3 A;  3UTB C;  3AV2 A;  3REI D;  1ID3 C;  4J8U B;  3AZI C;  3MNN C;  5AVB B;  1ZLA C;  1KX3 D;  3AV2 D;  1P3K B;  3AZN C;  3REL B;  4H9Q A;  3WAA C;  1JFI B;  4LD9 C;  1EQZ A;  4WU8 A;  4KGC B;  3C1C A;  3AV1 A;  3LZ1 C;  4KUD B;  2L5A A;  4WU9 B;  5DNN B;  4QLC B;  2IO5 B;  1EQZ D;  5AV9 A;  5CPJ A;  4NFT A;  4Z5T D;  3AZI B;  3MNN B;  2FJ7 C;  4YS3 C;  4ZUX A;  5JRG A;  3AZN B;  3WAA B;  1P3M A;  4LD9 B;  4ZUX D;  3VH5 T;  3LZ1 B;  5C3I C;  3LZ0 C;  3AZE B;  4YM6 D;  3REH B;  3B6F A;  4X23 B;  1BH8 B;  3KWQ C;  4J8U A;  5F99 A;  4CSR B;  5AVB A;  3REL A;  2RVQ D;  3WA9 C;  5G49 B;  1WWI A;  1U35 B;  4J8U D;  5AVB D;  1P3K D;  5B40 B;  1M18 B;  3REL D;  2HIO B;  2YFV B;  5B32 C;  5DNN A;  5GXQ A;  5C3I B;  3AFA A;  3UTB A;  4KGC D;  5B1M C;  4KUD D;  4WU9 D;  1ID3 A;  5DNN D;  3AZI A;  3MNN A;  4QLC D;  4EO5 C;  3X1U B;  3AZN A;  3VH6 T;  3WAA A;  3WA9 B;  3AZI D;  3MNN D;  4LD9 A;  3REI C;  3WTP B;  1B6W A;  3WKJ B;  3AZN D;  3LZ1 A;  1M1A B;  3WAA D;  3AZE A;  1M19 B;  5AV8 D;  4LD9 D;  1F66 B;  1BH8 A;  5B1M B;  3X1T B;  2LY8 A;  3AZE D;  1H3O B;  3REH D;  3TU4 B;  2FJ7 A;  4X23 D;  5G49 A;  3C1B C;  1EQZ C;  3MGP B;  4ZBJ C;  5JA4 A;  4HGA C;  5B40 A;  4Z5T C;  1P3I B;  1TZY C;  1U35 D;  3LZ0 A;  3LEL B;  5B40 D;  1M18 D;  2HIO D;  3KWQ A;  1TAF A;  3VH5 A;  3X1U A;  4YM6 C;  4J8V C;  2BYK B;  5B24 B;  5B2I B;  3WA9 A;  3C1B B;  5FUG A;  4G91 C;  2NZD C;  4HGA B;  3X1U D;  4Z5T B;  1TZY B;  3WA9 D;  5B0Z B;  5B32 A;  2RVQ C;  3LJA B;  1F66 A;  5DNM D;  5BNV A;  3WTP D;  4J8U C;  3WKJ D;  5B1M A;  1M1A D;  1P3K C;  1M19 D;  1H3O A;  1F66 D;  2F8N H;  4YM6 B;  4J8V B;  5B1M D;  3X1T D;  4KGC C;  3TU4 D;  4KUD C;  3MGQ C;  3REI A;  4WU9 C;  2NZD B;  5GSU B;  1P3I A;  3W99 B;  4QLC C;  2F8N K;  3MGP D;  1P3F C;  5CPI B;  3VH6 A;  1P3I D;  3AYW C;  3LEL D;  4H9P B;  5AV8 C;  2BYK A;  5B24 A;  3C1B A;  3MGQ B;  3AZE C;  4Z5T A;  3REH C;  5B1L B;  1TZY A;  3V9R B;  4Z2M G;  5B2I D;  5B0Z A;  5B24 D;  3C1B D;  4X23 C;  5B33 B;  1P3F B;  1TZY D;  5B0Z D;  3AYW B;  1KX4 B;  3LJA D;  1U35 C;  5AV6 B;  5GT3 B;  4YM6 A;  5AV8 B;  3MVD D;  4J8V A;  5AVC B;  5B40 C;  1M18 C;  5AV5 B;  1P34 B;  2HIO C;  4NE6 A;  2YFW B;  3O62 C;  2NZD A;  3KUY B;  2PYO C;  4J8V D;  1P3B B;  1ULY A;  2NZD D;  3W99 D;  5GSU D;  3B0D C;  3X1U C;  1P3K A;  3W98 B;  3UT9 C;  3KSY A;  5CPI D;  1JFI A; 
#chains in the Genus database with same CATH topology
 5BNX B;  1N1J B;  5BS7 C;  5DNM C;  3WTP C;  4KGC A;  3WKJ C;  1M1A C;  4KUD A;  3MGQ A;  1M19 C;  4WU9 A;  3O62 B;  5B31 B;  5B1L A;  2ARO B;  3V9R A;  4Z2M H;  4QLC A;  2G5H C;  2PYO B;  1F66 C;  4Z66 B;  1KX5 B;  5B33 A;  3X1T C;  1P3F A;  4KHA B;  3MGS C;  3MGQ D;  3TU4 C;  1Z2C B;  5B1L D;  3B0D B;  3AYW A;  3B0C W;  5B33 D;  3NQU B;  1W2E A;  3UT9 B;  3MGP C;  3AZM C;  5GT3 A;  1HTA A;  1P3F D;  5AV8 A;  1P3O C;  5DNM B;  3AYW D;  1KX4 D;  1P3I C;  1S32 B;  3AN2 B;  5AV6 D;  5GT3 D;  3LEL C;  3REH A;  1P3B A;  5AY8 B;  5AVC D;  4G92 B;  5AV5 D;  4X23 A;  1P34 D;  1P3L B;  3MGS B;  4CSR A;  2J8P A;  3KUY D;  1P3B D;  3B6G C;  3AZG B;  3X1V B;  5KDM B;  4UUZ B;  5B24 C;  5B2I C;  4AWL C;  1U35 A;  2CV5 C;  3AZM B;  5B32 G;  1P3O B;  1M18 A;  2F8N B;  3W98 D;  1HQ3 C;  2HIO A;  2YFV A;  5B0Z C;  3O62 A;  5B31 A;  5CPK B;  3W97 B;  2PYO A;  4WNN B;  3LJA C;  4Z66 A;  3MVD C;  4KHA A;  3O62 D;  5B31 D;  1P3P B;  2ARO D;  2PYO D;  4J8X C;  2BYM B;  4Z66 D;  1KX5 D;  3B6G B;  3NQU A;  3UT9 A;  3AZJ B;  4AWL B;  3REJ C;  2CV5 B;  5BS7 A;  5DNM A;  3WTP A;  3W99 C;  5GSU C;  3WKJ A;  3AN2 A;  3UT9 D;  2VQR A;  1M1A A;  1HQ3 B;  1M19 A;  3R45 B;  5CPI C;  1P3G C;  3W96 C;  1S32 D;  3MVD B;  3AN2 D;  3X1T A;  1P3L A;  3MGS A;  3MGR B;  3TU4 A;  3P5J B;  5AY8 D;  3X1V A;  5KDM A;  4J8X B;  4H9Q B;  3MGP A;  3AZM A;  1P3L D;  3REJ B;  1F1E A;  2CWE A;  3MGS D;  2BG1 A;  1B67 A;  1P3O A;  3AZG D;  3X1V D;  4WU8 B;  5E5A B;  5B1L C;  3C1C B;  4JJN C;  4WV4 B;  3AV1 B;  3A1I A;  3AZM D;  5B33 C;  3W97 A;  4WNN A;  3LEL A;  1BH9 B;  1P3O D;  5AV9 B;  5CPJ B;  4DRA A;  1P3G B;  2F8N D;  5BO0 B;  3W96 B;  5CPK D;  4H9R B;  1KX4 C;  3W97 D;  3B0B A;  2BYM A;  5AV6 C;  5GT3 C;  3B6G A;  4R8P D;  5JRG B;  3AZJ A;  2ZY3 A;  5B2I A;  5AVC C;  5AV5 C;  2CV5 A;  1P3P D;  1P34 C;  1P3M B;  3AZK B;  3B6G D;  3KUY C;  3AZL C;  4H9O B;  1P3B C;  2DF4 C;  4E44 A;  3AZJ D;  4JJN B;  1HQ3 A;  2ZY5 A;  2CV5 D;  3B6F B;  3A6N C;  3LJA A;  3REK D;  3AZH C;  3MVD A;  4XZQ D;  5B0Y C;  1P3A D;  1HQ3 D;  3MGR A;  3W98 C;  5F99 B;  4M6B A;  4J8X A;  3WTP E;  3X1S C;  4XUJ C;  3REJ A;  3MGR D;  4DRB A;  4UPK A;  4H9S A;  4J8X D;  5E5A A;  5B31 C;  5GSU A;  2ARO C;  3W99 A;  3AZL B;  4Z66 C;  1KX5 C;  5CHL B;  3REJ D;  5GXQ B;  1BH9 A;  3AFA B;  3VH5 W;  3A6N B;  3AZH B;  3UTB B;  3AZF C;  5E5A D;  3C1C D;  4WU8 D;  5CPI A;  1P3G A;  3W96 A;  5BO0 A;  3AV1 D;  4H9R A;  4J8W C;  5B0Y B;  4CAY B;  5CP6 C;  1ID3 B;  4H9P A;  1ZLA B;  3EG5 B;  5AV9 D;  5CPJ D;  1P3G D;  3W96 D;  3X1S B;  4NE3 A;  4XUJ B;  3KXB C;  1S32 C;  3AN2 C;  2NQB C;  3AZK A;  4H9O A;  5JRG D;  4JJN A;  5AY8 C;  4G92 C;  1P3M D;  3AZK D;  1P3L C;  2W8S A;  3UTA C;  2DQN C;  3AZF B;  4JJN D;  3AZG C;  3X1V C;  4J8W B;  1KX4 A;  5CP6 B;  1R4V A;  3B6F D;  2FJ7 B;  5AV6 A;  4YS3 B;  1KU5 A;  2UWX A;  5AVC A;  5B31 G;  5GT0 C;  1AOI C;  5AV5 A;  5JA4 B;  3KXB B;  5F99 D;  1P34 A;  5CPK C;  2NQB B;  2YFW A;  3KUY A;  3AZL A;  3W97 C;  3VH6 W;  3AL0 C;  4R8P C;  3LZ0 B;  5B2J C;  3B0C T;  2Y2O A;  3A6N A;  3AZH A;  1P3P C;  3A1K A;  5BT1 D;  3UTA B;  3AZL D;  4H9N B;  5B0Y A;  3KWQ B;  4CAY A;  2Y2Q A;  5GXQ D;  4WZS B;  3AZJ C;  1TAF B;  3W98 A;  3AFA D;  1ZLA A;  3A6N D;  3AZH D;  3UTB D;  2Y2N A;  5BNX A;  3X1S A;  3REK C;  1N1J A;  2Y2I A;  4XUJ A;  1WWS A;  5B0Y D;  1PZR A;  5GT0 B;  1ID3 D;  3NQJ B;  1AOI B;  5FUG B;  4XZQ C;  1P3A C;  4E45 A;  1ZLA D;  2ARO A;  2XD5 A;  1KX3 C;  3X1S D;  3AV2 C;  4XUJ D;  1KX5 A;  5B32 B;  3H0M C;  4R8P B;  5B2J B;  1A7W A;  5BNV B;  3MGR C;  3AZF A;  2HUE C;  3LZ1 D;  4J8W A;  5CP6 A;  2JSS A;  4YS3 A;  2ZY4 A;  2F8N G;  4EO5 B;  1Q9C A;  3AZF D;  3REK B;  4H9S C;  4WU8 C;  5E5A C;  3C1C C;  3KXB A;  4J8W D;  1S32 A;  3AV1 C;  5CP6 D;  2NQB A;  2FJ7 D;  2JE5 A;  4XZQ B;  4YS3 D;  3REI B;  1P3A B;  2Y2L A;  5AY8 A;  1KX3 B;  5AV9 C;  3AV2 B;  5CPJ C;  3KXB D;  2NQB D;  3UTA A;  4H9N A;  2HUE B;  4ZUX C;  3AZG A;  5JRG C;  3EPK A;  3LZ0 D;  1BFM A;  4UUZ A;  2G5I C;  2ZY2 A;  3UTA D;  1P3M C;  3AZK C;  3KWQ D;  1EQZ B;  5GT0 A;  3NQJ A;  4ZBJ B;  1AOI A;  2F8N A;  5CPK A;  3B6F C;  4R8P A;  5GT0 D;  1AOI D;  4NE5 A;  5B2J A;  1P3P A;  5F99 C;  5AVB C;  4ZUX B;  5B32 D;  3REL C;  5B2J D;  3F6T A;  3REK A;  5BT1 C;  4XZQ A;  1P3A A;  4G91 B;  5GXQ C;  5DNN C;  4WJ3 C;  3R45 A;  3AFA C;  2IO5 C;  1KX3 A;  3UTB C;  3AV2 A;  3REI D;  1ID3 C;  4J8U B;  3AZI C;  3MNN C;  5AVB B;  1ZLA C;  1KX3 D;  3AV2 D;  1P3K B;  3AZN C;  3REL B;  4H9Q A;  3WAA C;  1JFI B;  4LD9 C;  1EQZ A;  4WU8 A;  4KGC B;  3C1C A;  3AV1 A;  3LZ1 C;  4KUD B;  2L5A A;  4WU9 B;  5DNN B;  4QLC B;  2IO5 B;  1EQZ D;  5AV9 A;  5CPJ A;  4NFT A;  4Z5T D;  3AZI B;  1T3U A;  3MNN B;  2FJ7 C;  4YS3 C;  4ZUX A;  5JRG A;  3AZN B;  3WAA B;  1P3M A;  2Y2M A;  4LD9 B;  4ZUX D;  3VH5 T;  2JCH A;  3H0R C;  2RIQ A;  3LZ1 B;  5C3I C;  3LZ0 C;  3AZE B;  4YM6 D;  3REH B;  3B6F A;  2Y2K A;  4X23 B;  1BH8 B;  3KWQ C;  4J8U A;  5F99 A;  4CSR B;  5AVB A;  2F2A C;  3REL A;  2RVQ D;  3WA9 C;  5G49 B;  1WWI A;  1U35 B;  3FDD A;  4J8U D;  5AVB D;  2ZM5 A;  5B40 B;  1P3K D;  1M18 B;  3REL D;  2HIO B;  2YFV B;  5B32 C;  5DNN A;  5GXQ A;  5C3I B;  2Y2J A;  3AFA A;  3UTB A;  4KGC D;  5B1M C;  4KUD D;  2Y2P A;  3H0L C;  4WU9 D;  2Y2H A;  5DNN D;  3AZI A;  3MNN A;  1ID3 A;  4QLC D;  4EO5 C;  3X1U B;  3AZN A;  3VH6 T;  3WAA A;  3WA9 B;  3AZI D;  3MNN D;  4LD9 A;  3REI C;  3WTP B;  1B6W A;  3WKJ B;  3AZN D;  3LZ1 A;  1M1A B;  3WAA D;  3AZE A;  1M19 B;  5AV8 D;  4LD9 D;  1F66 B;  1BH8 A;  3EPH A;  5B1M B;  3X1T B;  2LY8 A;  3AZE D;  1H3O B;  3REH D;  3TU4 B;  2FJ7 A;  4X23 D;  5G49 A;  3C1B C;  1EQZ C;  3MGP B;  4ZBJ C;  5JA4 A;  2Y2G A;  4HGA C;  5B40 A;  4Z5T C;  3EPJ A;  1P3I B;  1TZY C;  1U35 D;  3LZ0 A;  3LEL B;  5B40 D;  1M18 D;  3EPL A;  2HIO D;  3KWQ A;  1TAF A;  3VH5 A;  3X1U A;  2FFF B;  4YM6 C;  4J8V C;  2BYK B;  5B24 B;  5B2I B;  3WA9 A;  3C1B B;  5FUG A;  4G91 C;  2NZD C;  4HGA B;  3X1U D;  4Z5T B;  3IP4 C;  1TZY B;  3WA9 D;  5B0Z B;  5B32 A;  2RVQ C;  3LJA B;  1F66 A;  5DNM D;  5BNV A;  3WTP D;  4J8U C;  3WKJ D;  5B1M A;  1M1A D;  1P3K C;  1M19 D;  1H3O A;  1F66 D;  2F8N H;  4YM6 B;  4J8V B;  5B1M D;  3X1T D;  4KGC C;  3TU4 D;  4KUD C;  3MGQ C;  3REI A;  4WU9 C;  2NZD B;  5GSU B;  1P3I A;  3W99 B;  4QLC C;  2F8N K;  3MGP D;  1P3F C;  5CPI B;  3VH6 A;  1P3I D;  3AYW C;  3LEL D;  4H9P B;  4DQY B;  5AV8 C;  2BYK A;  5B24 A;  3C1B A;  3MGQ B;  3AZE C;  4Z5T A;  3REH C;  5B1L B;  1TZY A;  3V9R B;  4Z2M G;  5B2I D;  5B0Z A;  5B24 D;  3C1B D;  4X23 C;  3KFU G;  5B33 B;  1P3F B;  1TZY D;  5B0Z D;  3AYW B;  1KX4 B;  3LJA D;  1U35 C;  5AV6 B;  5GT3 B;  4YM6 A;  5AV8 B;  3MVD D;  4J8V A;  5AVC B;  5B40 C;  1M18 C;  5AV5 B;  1P34 B;  2HIO C;  4NE6 A;  2YFW B;  3O62 C;  2NZD A;  3KUY B;  2PYO C;  4J8V D;  1P3B B;  2XD1 A;  1ULY A;  2NZD D;  3W99 D;  5GSU D;  3B0D C;  3X1U C;  1P3K A;  3W98 B;  3UT9 C;  3KSY A;  5CPI D;  1JFI A; 
#chains in the Genus database with same CATH homology
 5BNX B;  1N1J B;  5BS7 C;  5DNM C;  3WTP C;  4KGC A;  3WKJ C;  1M1A C;  4KUD A;  3MGQ A;  1M19 C;  4WU9 A;  3O62 B;  5B31 B;  5B1L A;  2ARO B;  3V9R A;  4Z2M H;  4QLC A;  2G5H C;  2PYO B;  1F66 C;  4Z66 B;  1KX5 B;  5B33 A;  3X1T C;  1P3F A;  4KHA B;  3MGS C;  3MGQ D;  3TU4 C;  1Z2C B;  5B1L D;  3B0D B;  3AYW A;  3B0C W;  5B33 D;  3NQU B;  1W2E A;  3UT9 B;  3MGP C;  3AZM C;  5GT3 A;  1HTA A;  1P3F D;  5AV8 A;  1P3O C;  5DNM B;  3AYW D;  1KX4 D;  1P3I C;  1S32 B;  3AN2 B;  5AV6 D;  5GT3 D;  3LEL C;  3REH A;  1P3B A;  5AY8 B;  5AVC D;  4G92 B;  5AV5 D;  4X23 A;  1P34 D;  1P3L B;  3MGS B;  4CSR A;  2J8P A;  3KUY D;  1P3B D;  3B6G C;  3AZG B;  3X1V B;  5KDM B;  4UUZ B;  5B24 C;  5B2I C;  4AWL C;  1U35 A;  2CV5 C;  3AZM B;  5B32 G;  1P3O B;  1M18 A;  2F8N B;  3W98 D;  1HQ3 C;  2HIO A;  2YFV A;  5B0Z C;  3O62 A;  5B31 A;  5CPK B;  3W97 B;  2PYO A;  4WNN B;  3LJA C;  4Z66 A;  3MVD C;  4KHA A;  3O62 D;  5B31 D;  1P3P B;  2ARO D;  2PYO D;  4J8X C;  2BYM B;  4Z66 D;  1KX5 D;  3B6G B;  3NQU A;  3UT9 A;  3AZJ B;  4AWL B;  3REJ C;  2CV5 B;  5BS7 A;  5DNM A;  3WTP A;  3W99 C;  5GSU C;  3WKJ A;  3AN2 A;  3UT9 D;  2VQR A;  1M1A A;  1HQ3 B;  1M19 A;  3R45 B;  5CPI C;  1P3G C;  3W96 C;  1S32 D;  3MVD B;  3AN2 D;  3X1T A;  1P3L A;  3MGS A;  3MGR B;  3TU4 A;  3P5J B;  5AY8 D;  3X1V A;  5KDM A;  4J8X B;  4H9Q B;  3MGP A;  3AZM A;  1P3L D;  3REJ B;  1F1E A;  2CWE A;  3MGS D;  2BG1 A;  1B67 A;  1P3O A;  3AZG D;  3X1V D;  4WU8 B;  5E5A B;  5B1L C;  3C1C B;  4JJN C;  4WV4 B;  3AV1 B;  3A1I A;  3AZM D;  5B33 C;  3W97 A;  4WNN A;  3LEL A;  1BH9 B;  1P3O D;  5AV9 B;  5CPJ B;  4DRA A;  1P3G B;  2F8N D;  5BO0 B;  3W96 B;  5CPK D;  4H9R B;  1KX4 C;  3W97 D;  3B0B A;  2BYM A;  5AV6 C;  5GT3 C;  3B6G A;  4R8P D;  5JRG B;  3AZJ A;  2ZY3 A;  5B2I A;  5AVC C;  5AV5 C;  2CV5 A;  1P3P D;  1P34 C;  1P3M B;  3AZK B;  3B6G D;  3KUY C;  3AZL C;  4H9O B;  1P3B C;  2DF4 C;  4E44 A;  3AZJ D;  4JJN B;  1HQ3 A;  2ZY5 A;  2CV5 D;  3B6F B;  3A6N C;  3LJA A;  3REK D;  3AZH C;  3MVD A;  4XZQ D;  5B0Y C;  1P3A D;  1HQ3 D;  3MGR A;  3W98 C;  5F99 B;  4M6B A;  4J8X A;  3WTP E;  3X1S C;  4XUJ C;  3REJ A;  3MGR D;  4DRB A;  4UPK A;  4H9S A;  4J8X D;  5E5A A;  5B31 C;  5GSU A;  2ARO C;  3W99 A;  3AZL B;  4Z66 C;  1KX5 C;  5CHL B;  3REJ D;  5GXQ B;  1BH9 A;  3AFA B;  3VH5 W;  3A6N B;  3AZH B;  3UTB B;  3AZF C;  5E5A D;  3C1C D;  4WU8 D;  5CPI A;  1P3G A;  3W96 A;  5BO0 A;  3AV1 D;  4H9R A;  4J8W C;  5B0Y B;  4CAY B;  5CP6 C;  1ID3 B;  4H9P A;  1ZLA B;  3EG5 B;  5AV9 D;  5CPJ D;  1P3G D;  3W96 D;  3X1S B;  4NE3 A;  4XUJ B;  3KXB C;  1S32 C;  3AN2 C;  2NQB C;  3AZK A;  4H9O A;  5JRG D;  4JJN A;  5AY8 C;  4G92 C;  1P3M D;  3AZK D;  1P3L C;  2W8S A;  3UTA C;  2DQN C;  3AZF B;  4JJN D;  3AZG C;  3X1V C;  4J8W B;  1KX4 A;  5CP6 B;  1R4V A;  3B6F D;  2FJ7 B;  5AV6 A;  4YS3 B;  1KU5 A;  2UWX A;  5AVC A;  5B31 G;  5GT0 C;  1AOI C;  5AV5 A;  5JA4 B;  3KXB B;  5F99 D;  1P34 A;  5CPK C;  2NQB B;  2YFW A;  3KUY A;  3AZL A;  3W97 C;  3VH6 W;  3AL0 C;  4R8P C;  3LZ0 B;  5B2J C;  3B0C T;  2Y2O A;  3A6N A;  3AZH A;  1P3P C;  3A1K A;  5BT1 D;  3UTA B;  3AZL D;  4H9N B;  5B0Y A;  3KWQ B;  4CAY A;  2Y2Q A;  5GXQ D;  4WZS B;  3AZJ C;  1TAF B;  3W98 A;  3AFA D;  1ZLA A;  3A6N D;  3AZH D;  3UTB D;  2Y2N A;  5BNX A;  3X1S A;  3REK C;  1N1J A;  2Y2I A;  4XUJ A;  1WWS A;  5B0Y D;  1PZR A;  5GT0 B;  1ID3 D;  3NQJ B;  1AOI B;  5FUG B;  4XZQ C;  1P3A C;  4E45 A;  1ZLA D;  2ARO A;  2XD5 A;  1KX3 C;  3X1S D;  3AV2 C;  4XUJ D;  1KX5 A;  5B32 B;  3H0M C;  4R8P B;  5B2J B;  1A7W A;  5BNV B;  3MGR C;  3AZF A;  2HUE C;  3LZ1 D;  4J8W A;  5CP6 A;  2JSS A;  4YS3 A;  2ZY4 A;  2F8N G;  4EO5 B;  1Q9C A;  3AZF D;  3REK B;  4H9S C;  4WU8 C;  5E5A C;  3C1C C;  3KXB A;  4J8W D;  1S32 A;  3AV1 C;  5CP6 D;  2NQB A;  2FJ7 D;  2JE5 A;  4XZQ B;  4YS3 D;  3REI B;  1P3A B;  2Y2L A;  5AY8 A;  1KX3 B;  5AV9 C;  3AV2 B;  5CPJ C;  3KXB D;  2NQB D;  3UTA A;  4H9N A;  2HUE B;  4ZUX C;  3AZG A;  5JRG C;  3EPK A;  3LZ0 D;  1BFM A;  4UUZ A;  2G5I C;  2ZY2 A;  3UTA D;  1P3M C;  3AZK C;  3KWQ D;  1EQZ B;  5GT0 A;  3NQJ A;  4ZBJ B;  1AOI A;  2F8N A;  5CPK A;  3B6F C;  4R8P A;  5GT0 D;  1AOI D;  4NE5 A;  5B2J A;  1P3P A;  5F99 C;  5AVB C;  4ZUX B;  5B32 D;  3REL C;  5B2J D;  3F6T A;  3REK A;  5BT1 C;  4XZQ A;  1P3A A;  4G91 B;  5GXQ C;  5DNN C;  4WJ3 C;  3R45 A;  3AFA C;  2IO5 C;  1KX3 A;  3UTB C;  3AV2 A;  3REI D;  1ID3 C;  4J8U B;  3AZI C;  3MNN C;  5AVB B;  1ZLA C;  1KX3 D;  3AV2 D;  1P3K B;  3AZN C;  3REL B;  4H9Q A;  3WAA C;  1JFI B;  4LD9 C;  1EQZ A;  4WU8 A;  4KGC B;  3C1C A;  3AV1 A;  3LZ1 C;  4KUD B;  2L5A A;  4WU9 B;  5DNN B;  4QLC B;  2IO5 B;  1EQZ D;  5AV9 A;  5CPJ A;  4NFT A;  4Z5T D;  3AZI B;  1T3U A;  3MNN B;  2FJ7 C;  4YS3 C;  4ZUX A;  5JRG A;  3AZN B;  3WAA B;  1P3M A;  2Y2M A;  4LD9 B;  4ZUX D;  3VH5 T;  2JCH A;  3H0R C;  2RIQ A;  3LZ1 B;  5C3I C;  3LZ0 C;  3AZE B;  4YM6 D;  3REH B;  3B6F A;  2Y2K A;  4X23 B;  1BH8 B;  3KWQ C;  4J8U A;  5F99 A;  4CSR B;  5AVB A;  2F2A C;  3REL A;  2RVQ D;  3WA9 C;  5G49 B;  1WWI A;  1U35 B;  3FDD A;  4J8U D;  5AVB D;  2ZM5 A;  5B40 B;  1P3K D;  1M18 B;  3REL D;  2HIO B;  2YFV B;  5B32 C;  5DNN A;  5GXQ A;  5C3I B;  2Y2J A;  3AFA A;  3UTB A;  4KGC D;  5B1M C;  4KUD D;  2Y2P A;  3H0L C;  4WU9 D;  2Y2H A;  5DNN D;  3AZI A;  3MNN A;  1ID3 A;  4QLC D;  4EO5 C;  3X1U B;  3AZN A;  3VH6 T;  3WAA A;  3WA9 B;  3AZI D;  3MNN D;  4LD9 A;  3REI C;  3WTP B;  1B6W A;  3WKJ B;  3AZN D;  3LZ1 A;  1M1A B;  3WAA D;  3AZE A;  1M19 B;  5AV8 D;  4LD9 D;  1F66 B;  1BH8 A;  3EPH A;  5B1M B;  3X1T B;  2LY8 A;  3AZE D;  1H3O B;  3REH D;  3TU4 B;  2FJ7 A;  4X23 D;  5G49 A;  3C1B C;  1EQZ C;  3MGP B;  4ZBJ C;  5JA4 A;  2Y2G A;  4HGA C;  5B40 A;  4Z5T C;  3EPJ A;  1P3I B;  1TZY C;  1U35 D;  3LZ0 A;  3LEL B;  5B40 D;  1M18 D;  3EPL A;  2HIO D;  3KWQ A;  1TAF A;  3VH5 A;  3X1U A;  2FFF B;  4YM6 C;  4J8V C;  2BYK B;  5B24 B;  5B2I B;  3WA9 A;  3C1B B;  5FUG A;  4G91 C;  2NZD C;  4HGA B;  3X1U D;  4Z5T B;  3IP4 C;  1TZY B;  3WA9 D;  5B0Z B;  5B32 A;  2RVQ C;  3LJA B;  1F66 A;  5DNM D;  5BNV A;  3WTP D;  4J8U C;  3WKJ D;  5B1M A;  1M1A D;  1P3K C;  1M19 D;  1H3O A;  1F66 D;  2F8N H;  4YM6 B;  4J8V B;  5B1M D;  3X1T D;  4KGC C;  3TU4 D;  4KUD C;  3MGQ C;  3REI A;  4WU9 C;  2NZD B;  5GSU B;  1P3I A;  3W99 B;  4QLC C;  2F8N K;  3MGP D;  1P3F C;  5CPI B;  3VH6 A;  1P3I D;  3AYW C;  3LEL D;  4H9P B;  4DQY B;  5AV8 C;  2BYK A;  5B24 A;  3C1B A;  3MGQ B;  3AZE C;  4Z5T A;  3REH C;  5B1L B;  1TZY A;  3V9R B;  4Z2M G;  5B2I D;  5B0Z A;  5B24 D;  3C1B D;  4X23 C;  3KFU G;  5B33 B;  1P3F B;  1TZY D;  5B0Z D;  3AYW B;  1KX4 B;  3LJA D;  1U35 C;  5AV6 B;  5GT3 B;  4YM6 A;  5AV8 B;  3MVD D;  4J8V A;  5AVC B;  5B40 C;  1M18 C;  5AV5 B;  1P34 B;  2HIO C;  4NE6 A;  2YFW B;  3O62 C;  2NZD A;  3KUY B;  2PYO C;  4J8V D;  1P3B B;  2XD1 A;  1ULY A;  2NZD D;  3W99 D;  5GSU D;  3B0D C;  3X1U C;  1P3K A;  3W98 B;  3UT9 C;  3KSY A;  5CPI D;  1JFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...