4R8PB

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
total genus 24
structure length 86
sequence length 86
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pB00
5DNMA 3VH5W 3VH6T 5B24C 5B40C 4KHAA 3X1TC 3AZMC 3AZKD 2F8NG 1P3LC 4WNNA 5B2IA 3MGSC 3O62B 3W96D 4H9QB 1A7WA 4R8PC 3MGSA 1S32B 3B6FA 3WA9C 1P3MB 1H3OA 2CV5D 4R8PA 3LJAD 2F8NK 3UTBD 2FJ7D 3AFAC 4Z2MH 3AZID 2PYOB 2NZDD 3AFAA 1P3PD 5B1LB 4UUZA 5JRGD 5B2JC 1R4VA 3LZ1C 5B33C 3MGQC 3LZ0D 3AZEA 4WU8B 3WKJC 1M18C 1P3BD 1F1EA 5E5AC 5BT1D 3AZFB 3LZ1A 5GXQC 3MGQA 4G92B 3WKJA 3AYWC 5GSUA 5E5AA 1N1JB 5AV9C 3UTAC 4QLCC 1P3AD 5AVCB 3AYWA 1P34B 5AV9A 3UTAA 3REJD 4YS3B 4QLCA 4J8UD 3B0CW 1KX3D 1AOIC 3X1VD 4H9RB 3TU4C 4XUJB 3MNND 3AV1A 5B0ZC 3MVDB 3TU4A 4J8WB 5CPIC 5B0YD 5DNMD 3AZLA 3NQJA 4WU9A 3C1CB 3AZHC 5B40D 5B24D 5FUGB 3X1TD 3B6GB 3UT9B 3AZMD 4JJNB 3AZGC 3AZHA 4J8VC 5GSUB 3KWQB 1P3LD 3MGSD 3B0DB 4WV4B 1KX4C 3W97B 5BO0B 4G91B 3AZGA 5GT0C 5B31C 4J8VA 4R8PD 1KX4A 3VH5A 1ID3B 3WA9D 5B31A 1F66A 3AFAD 5C3IC 1P3GB 2YFWA 5BS7C 2BYKA 5F99B 3WTPE 5B32B 4DRAA 1ZLAC 5AVBB 5B1MC 2NQBB 1ZLAA 5B2JD 5B1MA 5B33D 3LZ1D 1U35B 3MGQD 4WU9B 1EQZA 3WKJD 1M18D 5BNXA 5E5AD 2IO5C 4EO5C 5GXQD 2YFVA 3WAAB 3AYWD 5AV9D 3UTAD 3W96A 4ZUXB 4QLCD 4X23C 4AWLC 3KUYB 5DNNB 1AOID 3X1SC 4DRBA 3W98C 1TZYB 3MGPC 3AZIA 4XZQC 3TU4D 2NZDA 3W98A 3REHB 1TAFA 4Z66C 5B0ZD 5AV6B 1P3PA 1B6WA 5CPID 2HUEB 4Z66A 5JRGA 5AY8B 1EQZB 2AROC 3AZHD 5CP6C 1P3BA 1KX5B 1JFIB 2AROA 3AZGD 5BNVA 4YM6C 4J8VD 3AZKB 5KDMA 1P3AC 1KX4D 5B31D 5GT0D 1P3AA 2CV5B 3LELC 3LJAB 1HQ3C 5B32G 2BYMA 3UTBB 2FJ7B 3LELA 1HQ3A 4H9SC 1BH9B 1ZLAD 3MNNA 4H9SA 5B1MD 1M19C 5B0YA 4H9PB 2F8ND 1M19A 3LZ0B 5B40A 5B24A 3X1TA 5CPJC 3MGRB 3AZMA 2PYOC 2HIOB 5CPJA 1P3LA 4X23D 3REIC 3X1UC 3REJB 3WA9A 3REIA 4E44A 4J8UB 3X1UA 3C1BB 3X1SD 1KX3B 2BYMB 3AN2C 3X1VB 1P3IC 4H9NA 3W98D 5AV5C 4WU8C 3MGPD 4XZQD 3AN2A 1P3IA 4G92C 5AV5A 4Z66D 1HTAA 3KXBB 4CAYB 5AVCC 4H9OA 3NQUA 5DNMB 4NE6A 2CWEA 4KHAB 5B2JA 5B33A 2AROD 5CP6D 1M18A 5B24B 4WNNB 5B2IB 3AZMB 5GXQA 4YM6D 3AZJC 3MGSB 3REKC 3B6FB 1H3OB 3AV2C 3AZJA 4R8PB 3REKA 3WA9B 3AV2A 3LELD 1M1AC 1HQ3D 1AOIA 4H9NB 3AFAB 5CPKC 1M1AA 3UT9C 3RELC 4UUZB 5CPKA 3KWQC 5B0ZA 3B0DC 3RELA 5CPIA 2RVQC 3AZEB 1M19D 4Z2MG 5B2JB 3LZ1B 3MGQB 3WKJB 4LD9C 5E5AB 5CPJD 4KGCC 5AV8C 2PYOD 3AYWB 4LD9A 4CSRA 5AV9B 3UTAB 5F99C 4KGCA 3REID 4QLCB 5AV8A 5GT0A 5AVBC 3X1UD 3WTPC 3W99C 3WTPA 3W99A 1P3OC 3AN2D 1WWIA 4ZBJC 1P3ID 4NE5A 4Z5TC 5AV5D 4WU8D 3AV1B 5BS7A 1P3OA 3TU4B 4Z5TA 3WAAC 3AZLB 5CPIB 5AVCD 3NQJB 2F8NA 1BH8A 3AZHB 3R45A 1TZYC 3AZGB 4J8VB 3AZJD 1KX4B 3REKD 4KUDC 3AV2D 4X23A 5B31B 5AV6C 3MVDD 4KUDA 2HUEC 3AZNC 1P3FC 1F66B 1P3KC 1M1AD 2YFWB 1B67A 2BYKB 3X1SA 3AZNA 3VH6W 1P3KA 5CPKD 3MGPA 3UT9D 4XZQA 3RELD 5GT3C 1KX5C 3KWQD 2JSSA 3V9RA 1ZLAB 5GT3A 5B1MB 2RVQD 5BNXB 3A6NC 1KU5A 2F8NB 2YFVB 4J8XC 5CP6A 4LD9D 2IO5B 4EO5B 4KGCD 3W96B 5AV8D 4YM6A 4J8XA 5F99D 2F8NH 4AWLB 5AVBD 3WTPD 3W99D 4HGAC 3AZIB 1P3OD 5G49A 2NZDB 4Z5TD 3W98B 1TAFB 3KSYA 1P3PB 3MGRC 3O62C 3WAAD 2HIOC 4Z66B 5JRGB 1BFMA 3O62A 1S32C 1P3MC 4H9QA 4E45A 4WZSB 1S32A 1P3BB 1P3MA 2AROB 5BNVB 3C1BC 5KDMB 1TZYD 1P3AB 2PYOA 4KUDD 5B1LC 4NE3A 5AV6D 3KXBC 5B1LA 3AZND 1P3FD 1P3KD 3LELB 1HQ3B 3AZFC 4WU8A 3MNNB 5B2IC 3AZFA 5GT3D 1KX5D 1P34C 1N1JA 5B0YB 3B6FC 4YS3C 1ULYA 3VH6A 5AVCA 1P34A 1M19B 3A6ND 5JA4A 5B40B 4YS3A 3X1TB 4M6BA 4J8XD 5CPJB 1P3LB 4XUJC 3MVDC 4H9RA 4J8WC 4XUJA 3REIB 3X1UB 3MVDA 4J8WA 3AZEC 3C1CC 3B6GC 3AN2B 1P3IB 5AV5B 3C1CA 4JJNC 5FUGA 5GSUC 3W97C 3B6GA 3MGRD 3O62D 3UT9A 4JJNA 2HIOD 4G91C 4H9OB 3W97A 3KWQA 3NQUB 1S32D 1ID3C 1P3MD 3B0BA 5BO0A 5B33B 3VH5T 5JA4B 1M18B 1ID3A 5GXQB 1P3GC 3C1BD 1P3GA 3AV1C 5B32C 3AZJB 3REKB 5B1LD 5F99A 3AV2B 2NQBC 3KXBD 5B32A 5AVBA 3AZLC 1AOIB 1U35C 2NQBA 4WU9C 1M1AB 3AZFD 1U35A 5CPKB 2L5AA 5B0ZB 5B2ID 4ZUXC 3RELB 3WAAA 1P34D 3KUYC 3B6FD 4YS3D 4ZUXA 5CHLB 5DNNC 3KUYA 1F66C 5DNNA 4LD9B 4CSRB 4KGCB 4XUJD 1TZYA 5AV8B 3REHC 5GT0B 4J8WD 3REHA 3B0CT 5AV6A 3WTPB 3W99B 5AY8C 3AZED 1P3FA 1EQZC 3C1CD 5C3IB 3B6GD 5AY8A 1P3OB 4ZBJB 4Z5TB 4JJND 5GSUD 3AZKC 3W97D 3W96C 1KX5A 1JFIA 3AZKA 1ID3D 2CV5C 1BH8B 4NFTA 3A6NA 3R45B 3LJAC 3UTBC 2CV5A 1P3GD 2FJ7C 3AZIC 3LJAA 3UTBA 2NZDC 2FJ7A 1WWSA 4X23B 3AV1D 5B32D 1P3PC 4KUDB 1BH9A 2NQBD 5JRGC 3AZLD 3AZNB 3X1SB 1U35D 1P3FB 4WU9D 3LZ0C 1P3KB 3MGPB 1P3BC 4H9PA 4XZQB 1Q9CA 5BT1C 3LZ0A 3V9RB 4ZUXD 5GT3B 3MGRA 2HIOA 3KUYD 3REJC 4J8UC 5DNND 3A6NB 5CP6B 3REJA 2LY8A 5B31G 1KX3C 1F66D 3X1VC 4J8UA 4YM6B 3C1BA 4J8XB 1KX3A 3X1VA 3REHD 3MNNC 3KXBA 5B0YC 5DNMC 4CAYA 5AY8D 5G49B 1EQZD 4HGAB
chains in the Genus database with same CATH superfamily
4WJ3C 5DNMA 3VH5W 3VH6T 5B24C 5B40C 4KHAA 3X1TC 3AZMC 3AZKD 2F8NG 1P3LC 4WNNA 5B2IA 3MGSC 3O62B 3W96D 4H9QB 1A7WA 4R8PC 3MGSA 1S32B 3B6FA 3WA9C 1P3MB 1H3OA 2CV5D 4R8PA 3LJAD 2F8NK 3UTBD 2FJ7D 3AFAC 4Z2MH 3AZID 2PYOB 2NZDD 3EPHA 2FFFB 3AFAA 1P3PD 5B1LB 4UUZA 5JRGD 3EPJA 5B2JC 1R4VA 3LZ1C 2Y2JA 3H0RC 3LZ0D 3MGQC 5B33C 4WU8B 3AZEA 1M18C 3WKJC 1P3BD 1F1EA 5E5AC 5BT1D 3AZFB 3LZ1A 5GXQC 3MGQA 4G92B 3WKJA 3AYWC 5GSUA 5E5AA 1N1JB 2JE5A 5AV9C 3UTAC 4QLCC 1P3AD 5AVCB 3AYWA 1P34B 5AV9A 3UTAA 3REJD 4YS3B 4QLCA 4J8UD 3B0CW 1KX3D 1AOIC 3X1VD 4H9RB 3TU4C 4XUJB 3MNND 3AV1A 5B0ZC 3MVDB 3TU4A 2Y2HA 4J8WB 5CPIC 5B0YD 5DNMD 3AZLA 3NQJA 2Y2IA 4WU9A 3C1CB 3AZHC 5B40D 5B24D 5FUGB 3X1TD 3B6GB 3UT9B 3AZMD 4JJNB 3AZGC 3AZHA 4J8VC 5GSUB 3KWQB 1P3LD 3MGSD 3B0DB 4WV4B 1KX4C 3W97B 5BO0B 4G91B 3AZGA 5GT0C 5B31C 4J8VA 4R8PD 1KX4A 3VH5A 1ID3B 3WA9D 5B31A 1F66A 3AFAD 5C3IC 1P3GB 2YFWA 5BS7C 2BYKA 5F99B 3WTPE 5B32B 4DRAA 1ZLAC 5AVBB 5B1MC 2NQBB 1ZLAA 5B2JD 5B1MA 5B33D 3LZ1D 1U35B 3MGQD 4WU9B 1EQZA 3WKJD 3KFUG 1M18D 5BNXA 5E5AD 2IO5C 3A1KA 5GXQD 4EO5C 2YFVA 3WAAB 3AYWD 5AV9D 3UTAD 1T3UA 3W96A 4ZUXB 4QLCD 4X23C 4AWLC 3KUYB 5DNNB 2Y2QA 3X1SC 1AOID 4DRBA 3W98C 1TZYB 3MGPC 2JCHA 3AZIA 4XZQC 3TU4D 2NZDA 3W98A 3REHB 1TAFA 2DQNC 4Z66C 5B0ZD 5AV6B 1P3PA 1B6WA 5CPID 2HUEB 4Z66A 5JRGA 5AY8B 1EQZB 2AROC 3AZHD 5CP6C 1P3BA 1KX5B 1JFIB 2AROA 1W2EA 5BNVA 4YM6C 4J8VD 3AZGD 5KDMA 3AZKB 1P3AC 1KX4D 5B31D 5GT0D 1P3AA 2CV5B 3LELC 3LJAB 1HQ3C 5B32G 1Z2CB 2BYMA 3UTBB 2FJ7B 3LELA 1HQ3A 4H9SC 1BH9B 2XD1A 1ZLAD 3MNNA 2G5IC 4H9SA 5B1MD 1M19C 5B0YA 4H9PB 2F8ND 1M19A 3LZ0B 5B40A 5B24A 3X1TA 5CPJC 3MGRB 3AZMA 2PYOC 2HIOB 5CPJA 1P3LA 4X23D 3REIC 3X1UC 3REJB 3WA9A 3REIA 2ZY3A 4E44A 4J8UB 3X1UA 3C1BB 3X1SD 1KX3B 2BYMB 3AN2C 3X1VB 1P3IC 4H9NA 3W98D 5AV5C 4WU8C 3MGPD 4XZQD 3AN2A 3FDDA 4G92C 1P3IA 5AV5A 4Z66D 1HTAA 3KXBB 4CAYB 5AVCC 4H9OA 3NQUA 5DNMB 4NE6A 2CWEA 4KHAB 5B2JA 5B33A 2AROD 5CP6D 1M18A 5B24B 4WNNB 5B2IB 3AZMB 5GXQA 4YM6D 3AZJC 3MGSB 3REKC 3B6FB 1H3OB 3AV2C 2ZM5A 3AZJA 4R8PB 3REKA 3WA9B 3AV2A 3LELD 1M1AC 1HQ3D 1AOIA 4H9NB 3AFAB 5CPKC 1M1AA 2ZY5A 3UT9C 3RELC 4UUZB 5CPKA 3KWQC 5B0ZA 3B0DC 3RELA 5CPIA 2RVQC 3AZEB 1M19D 4Z2MG 5B2JB 3LZ1B 3MGQB 3WKJB 4LD9C 5E5AB 5CPJD 4KGCC 5AV8C 2PYOD 3H0LC 3AYWB 4LD9A 3IP4C 4CSRA 5AV9B 3UTAB 5F99C 4KGCA 3REID 4QLCB 5AV8A 5GT0A 5AVBC 2Y2GA 3X1UD 3WTPC 3EPLA 3W99C 3WTPA 3W99A 1P3OC 3AN2D 1WWIA 4ZBJC 1P3ID 4NE5A 4Z5TC 5AV5D 4WU8D 3AV1B 5BS7A 1P3OA 3TU4B 4Z5TA 3WAAC 3AZLB 5CPIB 5AVCD 3NQJB 2F8NA 1BH8A 3AZHB 3R45A 1TZYC 3AZGB 4J8VB 3AZJD 1KX4B 3REKD 4KUDC 3AV2D 4X23A 5B31B 5AV6C 3MVDD 4KUDA 2HUEC 3AZNC 1P3FC 1F66B 2DF4C 1P3KC 2RIQA 2YFWB 1M1AD 1B67A 2BYKB 3X1SA 3AZNA 3VH6W 1P3KA 5CPKD 3MGPA 3UT9D 4XZQA 3RELD 5GT3C 1KX5C 3KWQD 2JSSA 3V9RA 1ZLAB 5GT3A 5B1MB 2RVQD 4DQYB 5BNXB 3A6NC 3A1IA 1KU5A 2F8NB 2YFVB 2Y2OA 4J8XC 5CP6A 4LD9D 2IO5B 4EO5B 4KGCD 3W96B 5AV8D 4YM6A 4J8XA 5F99D 3AL0C 2UWXA 2F8NH 4AWLB 5AVBD 3WTPD 3W99D 4HGAC 3AZIB 1P3OD 5G49A 2NZDB 4Z5TD 3W98B 1TAFB 3KSYA 1P3PB 3MGRC 3O62C 3WAAD 2HIOC 4Z66B 5JRGB 1BFMA 3O62A 1S32C 1P3MC 4H9QA 4E45A 4WZSB 1S32A 1P3BB 1P3MA 2AROB 5BNVB 3C1BC 5KDMB 1TZYD 1P3AB 2PYOA 4KUDD 5B1LC 1PZRA 4NE3A 5AV6D 3KXBC 5B1LA 3AZND 1P3FD 1P3KD 3LELB 1HQ3B 3AZFC 4WU8A 2W8SA 3MNNB 5B2IC 3AZFA 5GT3D 1KX5D 1P34C 1N1JA 5B0YB 3H0MC 3B6FC 4YS3C 1ULYA 3VH6A 5AVCA 1P34A 1M19B 3A6ND 5JA4A 5B40B 4YS3A 3X1TB 4M6BA 4J8XD 5CPJB 1P3LB 4XUJC 3MVDC 4H9RA 4J8WC 4XUJA 3REIB 3X1UB 3MVDA 2BG1A 4J8WA 3AZEC 3C1CC 3B6GC 3AN2B 1P3IB 5AV5B 3C1CA 4JJNC 5FUGA 5GSUC 2VQRA 3B6GA 3W97C 3MGRD 3O62D 3UT9A 4JJNA 2HIOD 4G91C 4H9OB 3W97A 3KWQA 3NQUB 1S32D 1ID3C 1P3MD 3B0BA 5BO0A 5B33B 3VH5T 5JA4B 2ZY2A 1M18B 1ID3A 5GXQB 1P3GC 3C1BD 2Y2NA 2Y2PA 1P3GA 3AV1C 5B32C 3AZJB 3REKB 5B1LD 5F99A 3AV2B 2NQBC 3KXBD 5B32A 5AVBA 3AZLC 2Y2LA 1AOIB 1U35C 2NQBA 2G5HC 4WU9C 1M1AB 3AZFD 1U35A 5CPKB 2L5AA 5B2ID 5B0ZB 3EPKA 4ZUXC 3RELB 3WAAA 1P34D 3KUYC 3B6FD 4YS3D 4ZUXA 5CHLB 5DNNC 3KUYA 1F66C 2J8PA 5DNNA 4LD9B 4CSRB 4KGCB 4XUJD 1TZYA 3P5JB 5AV8B 3REHC 5GT0B 4J8WD 3REHA 3B0CT 3EG5B 5AV6A 3WTPB 3W99B 5AY8C 3AZED 1P3FA 1EQZC 3C1CD 5C3IB 2F2AC 3B6GD 5AY8A 1P3OB 4ZBJB 4UPKA 4Z5TB 4JJND 5GSUD 3AZKC 3W97D 3W96C 1KX5A 1JFIA 3AZKA 1ID3D 2CV5C 1BH8B 4NFTA 3A6NA 3R45B 3LJAC 3UTBC 2CV5A 1P3GD 2FJ7C 3AZIC 3LJAA 3UTBA 2NZDC 2FJ7A 1WWSA 4X23B 3AV1D 5B32D 1P3PC 2XD5A 4KUDB 1BH9A 2NQBD 3F6TA 5JRGC 2Y2MA 3AZLD 2Y2KA 3AZNB 3X1SB 1U35D 1P3FB 4WU9D 3LZ0C 1P3KB 3MGPB 2ZY4A 1P3BC 4H9PA 4XZQB 1Q9CA 5BT1C 3LZ0A 3V9RB 4ZUXD 5GT3B 3MGRA 2HIOA 3KUYD 3REJC 4J8UC 5DNND 3A6NB 5CP6B 3REJA 2LY8A 5B31G 1KX3C 1F66D 3X1VC 4J8UA 4YM6B 3C1BA 4J8XB 1KX3A 3X1VA 3REHD 3MNNC 3KXBA 5B0YC 5DNMC 4CAYA 5AY8D 5G49B 1EQZD 4HGAB
chains in the Genus database with same CATH topology
4WJ3C 5DNMA 3VH5W 3VH6T 5B24C 5B40C 4KHAA 3X1TC 3AZMC 3AZKD 2F8NG 1P3LC 4WNNA 5B2IA 3MGSC 3O62B 3W96D 4H9QB 1A7WA 4R8PC 3MGSA 1S32B 3B6FA 3WA9C 1P3MB 1H3OA 2CV5D 4R8PA 3LJAD 2F8NK 3UTBD 2FJ7D 3AFAC 4Z2MH 3AZID 2PYOB 2NZDD 3EPHA 2FFFB 3AFAA 1P3PD 5B1LB 4UUZA 5JRGD 3EPJA 5B2JC 1R4VA 3LZ1C 2Y2JA 3H0RC 3LZ0D 3MGQC 5B33C 4WU8B 3AZEA 1M18C 3WKJC 1P3BD 1F1EA 5E5AC 5BT1D 3AZFB 3LZ1A 5GXQC 3MGQA 4G92B 3WKJA 3AYWC 5GSUA 5E5AA 1N1JB 2JE5A 5AV9C 3UTAC 4QLCC 1P3AD 5AVCB 3AYWA 1P34B 5AV9A 3UTAA 3REJD 4YS3B 4QLCA 4J8UD 3B0CW 1KX3D 1AOIC 3X1VD 4H9RB 3TU4C 4XUJB 3MNND 3AV1A 5B0ZC 3MVDB 3TU4A 2Y2HA 4J8WB 5CPIC 5B0YD 5DNMD 3AZLA 3NQJA 2Y2IA 4WU9A 3C1CB 3AZHC 5B40D 5B24D 5FUGB 3X1TD 3B6GB 3UT9B 3AZMD 4JJNB 3AZGC 3AZHA 4J8VC 5GSUB 3KWQB 1P3LD 3MGSD 3B0DB 4WV4B 1KX4C 3W97B 5BO0B 4G91B 3AZGA 5GT0C 5B31C 4J8VA 4R8PD 1KX4A 3VH5A 1ID3B 3WA9D 5B31A 1F66A 3AFAD 5C3IC 1P3GB 2YFWA 5BS7C 2BYKA 5F99B 3WTPE 5B32B 4DRAA 1ZLAC 5AVBB 5B1MC 2NQBB 1ZLAA 5B2JD 5B1MA 5B33D 3LZ1D 1U35B 3MGQD 4WU9B 1EQZA 3WKJD 3KFUG 1M18D 5BNXA 5E5AD 2IO5C 3A1KA 5GXQD 4EO5C 2YFVA 3WAAB 3AYWD 5AV9D 3UTAD 1T3UA 3W96A 4ZUXB 4QLCD 4X23C 4AWLC 3KUYB 5DNNB 2Y2QA 3X1SC 1AOID 4DRBA 3W98C 1TZYB 3MGPC 2JCHA 3AZIA 4XZQC 3TU4D 2NZDA 3W98A 3REHB 1TAFA 2DQNC 4Z66C 5B0ZD 5AV6B 1P3PA 1B6WA 5CPID 2HUEB 4Z66A 5JRGA 5AY8B 1EQZB 2AROC 3AZHD 5CP6C 1P3BA 1KX5B 1JFIB 2AROA 1W2EA 5BNVA 4YM6C 4J8VD 3AZGD 5KDMA 3AZKB 1P3AC 1KX4D 5B31D 5GT0D 1P3AA 2CV5B 3LELC 3LJAB 1HQ3C 5B32G 1Z2CB 2BYMA 3UTBB 2FJ7B 3LELA 1HQ3A 4H9SC 1BH9B 2XD1A 1ZLAD 3MNNA 2G5IC 4H9SA 5B1MD 1M19C 5B0YA 4H9PB 2F8ND 1M19A 3LZ0B 5B40A 5B24A 3X1TA 5CPJC 3MGRB 3AZMA 2PYOC 2HIOB 5CPJA 1P3LA 4X23D 3REIC 3X1UC 3REJB 3WA9A 3REIA 2ZY3A 4E44A 4J8UB 3X1UA 3C1BB 3X1SD 1KX3B 2BYMB 3AN2C 3X1VB 1P3IC 4H9NA 3W98D 5AV5C 4WU8C 3MGPD 4XZQD 3AN2A 3FDDA 4G92C 1P3IA 5AV5A 4Z66D 1HTAA 3KXBB 4CAYB 5AVCC 4H9OA 3NQUA 5DNMB 4NE6A 2CWEA 4KHAB 5B2JA 5B33A 2AROD 5CP6D 1M18A 5B24B 4WNNB 5B2IB 3AZMB 5GXQA 4YM6D 3AZJC 3MGSB 3REKC 3B6FB 1H3OB 3AV2C 2ZM5A 3AZJA 4R8PB 3REKA 3WA9B 3AV2A 3LELD 1M1AC 1HQ3D 1AOIA 4H9NB 3AFAB 5CPKC 1M1AA 2ZY5A 3UT9C 3RELC 4UUZB 5CPKA 3KWQC 5B0ZA 3B0DC 3RELA 5CPIA 2RVQC 3AZEB 1M19D 4Z2MG 5B2JB 3LZ1B 3MGQB 3WKJB 4LD9C 5E5AB 5CPJD 4KGCC 5AV8C 2PYOD 3H0LC 3AYWB 4LD9A 3IP4C 4CSRA 5AV9B 3UTAB 5F99C 4KGCA 3REID 4QLCB 5AV8A 5GT0A 5AVBC 2Y2GA 3X1UD 3WTPC 3EPLA 3W99C 3WTPA 3W99A 1P3OC 3AN2D 1WWIA 4ZBJC 1P3ID 4NE5A 4Z5TC 5AV5D 4WU8D 3AV1B 5BS7A 1P3OA 3TU4B 4Z5TA 3WAAC 3AZLB 5CPIB 5AVCD 3NQJB 2F8NA 1BH8A 3AZHB 3R45A 1TZYC 3AZGB 4J8VB 3AZJD 1KX4B 3REKD 4KUDC 3AV2D 4X23A 5B31B 5AV6C 3MVDD 4KUDA 2HUEC 3AZNC 1P3FC 1F66B 2DF4C 1P3KC 2RIQA 2YFWB 1M1AD 1B67A 2BYKB 3X1SA 3AZNA 3VH6W 1P3KA 5CPKD 3MGPA 3UT9D 4XZQA 3RELD 5GT3C 1KX5C 3KWQD 2JSSA 3V9RA 1ZLAB 5GT3A 5B1MB 2RVQD 4DQYB 5BNXB 3A6NC 3A1IA 1KU5A 2F8NB 2YFVB 2Y2OA 4J8XC 5CP6A 4LD9D 2IO5B 4EO5B 4KGCD 3W96B 5AV8D 4YM6A 4J8XA 5F99D 3AL0C 2UWXA 2F8NH 4AWLB 5AVBD 3WTPD 3W99D 4HGAC 3AZIB 1P3OD 5G49A 2NZDB 4Z5TD 3W98B 1TAFB 3KSYA 1P3PB 3MGRC 3O62C 3WAAD 2HIOC 4Z66B 5JRGB 1BFMA 3O62A 1S32C 1P3MC 4H9QA 4E45A 4WZSB 1S32A 1P3BB 1P3MA 2AROB 5BNVB 3C1BC 5KDMB 1TZYD 1P3AB 2PYOA 4KUDD 5B1LC 1PZRA 4NE3A 5AV6D 3KXBC 5B1LA 3AZND 1P3FD 1P3KD 3LELB 1HQ3B 3AZFC 4WU8A 2W8SA 3MNNB 5B2IC 3AZFA 5GT3D 1KX5D 1P34C 1N1JA 5B0YB 3H0MC 3B6FC 4YS3C 1ULYA 3VH6A 5AVCA 1P34A 1M19B 3A6ND 5JA4A 5B40B 4YS3A 3X1TB 4M6BA 4J8XD 5CPJB 1P3LB 4XUJC 3MVDC 4H9RA 4J8WC 4XUJA 3REIB 3X1UB 3MVDA 2BG1A 4J8WA 3AZEC 3C1CC 3B6GC 3AN2B 1P3IB 5AV5B 3C1CA 4JJNC 5FUGA 5GSUC 2VQRA 3B6GA 3W97C 3MGRD 3O62D 3UT9A 4JJNA 2HIOD 4G91C 4H9OB 3W97A 3KWQA 3NQUB 1S32D 1ID3C 1P3MD 3B0BA 5BO0A 5B33B 3VH5T 5JA4B 2ZY2A 1M18B 1ID3A 5GXQB 1P3GC 3C1BD 2Y2NA 2Y2PA 1P3GA 3AV1C 5B32C 3AZJB 3REKB 5B1LD 5F99A 3AV2B 2NQBC 3KXBD 5B32A 5AVBA 3AZLC 2Y2LA 1AOIB 1U35C 2NQBA 2G5HC 4WU9C 1M1AB 3AZFD 1U35A 5CPKB 2L5AA 5B2ID 5B0ZB 3EPKA 4ZUXC 3RELB 3WAAA 1P34D 3KUYC 3B6FD 4YS3D 4ZUXA 5CHLB 5DNNC 3KUYA 1F66C 2J8PA 5DNNA 4LD9B 4CSRB 4KGCB 4XUJD 1TZYA 3P5JB 5AV8B 3REHC 5GT0B 4J8WD 3REHA 3B0CT 3EG5B 5AV6A 3WTPB 3W99B 5AY8C 3AZED 1P3FA 1EQZC 3C1CD 5C3IB 2F2AC 3B6GD 5AY8A 1P3OB 4ZBJB 4UPKA 4Z5TB 4JJND 5GSUD 3AZKC 3W97D 3W96C 1KX5A 1JFIA 3AZKA 1ID3D 2CV5C 1BH8B 4NFTA 3A6NA 3R45B 3LJAC 3UTBC 2CV5A 1P3GD 2FJ7C 3AZIC 3LJAA 3UTBA 2NZDC 2FJ7A 1WWSA 4X23B 3AV1D 5B32D 1P3PC 2XD5A 4KUDB 1BH9A 2NQBD 3F6TA 5JRGC 2Y2MA 3AZLD 2Y2KA 3AZNB 3X1SB 1U35D 1P3FB 4WU9D 3LZ0C 1P3KB 3MGPB 2ZY4A 1P3BC 4H9PA 4XZQB 1Q9CA 5BT1C 3LZ0A 3V9RB 4ZUXD 5GT3B 3MGRA 2HIOA 3KUYD 3REJC 4J8UC 5DNND 3A6NB 5CP6B 3REJA 2LY8A 5B31G 1KX3C 1F66D 3X1VC 4J8UA 4YM6B 3C1BA 4J8XB 1KX3A 3X1VA 3REHD 3MNNC 3KXBA 5B0YC 5DNMC 4CAYA 5AY8D 5G49B 1EQZD 4HGAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNM A;  3VH5 W;  3VH6 T;  5B24 C;  5B40 C;  4KHA A;  3X1T C;  3AZM C;  3AZK D;  2F8N G;  1P3L C;  4WNN A;  5B2I A;  3MGS C;  3O62 B;  3W96 D;  4H9Q B;  1A7W A;  4R8P C;  3MGS A;  1S32 B;  3B6F A;  3WA9 C;  1P3M B;  1H3O A;  2CV5 D;  4R8P A;  3LJA D;  2F8N K;  3UTB D;  2FJ7 D;  3AFA C;  4Z2M H;  3AZI D;  2PYO B;  2NZD D;  3AFA A;  1P3P D;  5B1L B;  4UUZ A;  5JRG D;  5B2J C;  1R4V A;  3LZ1 C;  5B33 C;  3MGQ C;  3LZ0 D;  3AZE A;  4WU8 B;  3WKJ C;  1M18 C;  1P3B D;  1F1E A;  5E5A C;  5BT1 D;  3AZF B;  3LZ1 A;  5GXQ C;  3MGQ A;  4G92 B;  3WKJ A;  3AYW C;  5GSU A;  5E5A A;  1N1J B;  5AV9 C;  3UTA C;  4QLC C;  1P3A D;  5AVC B;  3AYW A;  1P34 B;  5AV9 A;  3UTA A;  3REJ D;  4YS3 B;  4QLC A;  4J8U D;  3B0C W;  1KX3 D;  1AOI C;  3X1V D;  4H9R B;  3TU4 C;  4XUJ B;  3MNN D;  3AV1 A;  5B0Z C;  3MVD B;  3TU4 A;  4J8W B;  5CPI C;  5B0Y D;  5DNM D;  3AZL A;  3NQJ A;  4WU9 A;  3C1C B;  3AZH C;  5B40 D;  5B24 D;  5FUG B;  3X1T D;  3B6G B;  3UT9 B;  3AZM D;  4JJN B;  3AZG C;  3AZH A;  4J8V C;  5GSU B;  3KWQ B;  1P3L D;  3MGS D;  3B0D B;  4WV4 B;  1KX4 C;  3W97 B;  5BO0 B;  4G91 B;  3AZG A;  5GT0 C;  5B31 C;  4J8V A;  4R8P D;  1KX4 A;  3VH5 A;  1ID3 B;  3WA9 D;  5B31 A;  1F66 A;  3AFA D;  5C3I C;  1P3G B;  2YFW A;  5BS7 C;  2BYK A;  5F99 B;  3WTP E;  5B32 B;  4DRA A;  1ZLA C;  5AVB B;  5B1M C;  2NQB B;  1ZLA A;  5B2J D;  5B1M A;  5B33 D;  3LZ1 D;  1U35 B;  3MGQ D;  4WU9 B;  1EQZ A;  3WKJ D;  1M18 D;  5BNX A;  5E5A D;  2IO5 C;  4EO5 C;  5GXQ D;  2YFV A;  3WAA B;  3AYW D;  5AV9 D;  3UTA D;  3W96 A;  4ZUX B;  4QLC D;  4X23 C;  4AWL C;  3KUY B;  5DNN B;  1AOI D;  3X1S C;  4DRB A;  3W98 C;  1TZY B;  3MGP C;  3AZI A;  4XZQ C;  3TU4 D;  2NZD A;  3W98 A;  3REH B;  1TAF A;  4Z66 C;  5B0Z D;  5AV6 B;  1P3P A;  1B6W A;  5CPI D;  2HUE B;  4Z66 A;  5JRG A;  5AY8 B;  1EQZ B;  2ARO C;  3AZH D;  5CP6 C;  1P3B A;  1KX5 B;  1JFI B;  2ARO A;  3AZG D;  5BNV A;  4YM6 C;  4J8V D;  3AZK B;  5KDM A;  1P3A C;  1KX4 D;  5B31 D;  5GT0 D;  1P3A A;  2CV5 B;  3LEL C;  3LJA B;  1HQ3 C;  5B32 G;  2BYM A;  3UTB B;  2FJ7 B;  3LEL A;  1HQ3 A;  4H9S C;  1BH9 B;  1ZLA D;  3MNN A;  4H9S A;  5B1M D;  1M19 C;  5B0Y A;  4H9P B;  2F8N D;  1M19 A;  3LZ0 B;  5B40 A;  5B24 A;  3X1T A;  5CPJ C;  3MGR B;  3AZM A;  2PYO C;  2HIO B;  5CPJ A;  1P3L A;  4X23 D;  3REI C;  3X1U C;  3REJ B;  3WA9 A;  3REI A;  4E44 A;  4J8U B;  3X1U A;  3C1B B;  3X1S D;  1KX3 B;  2BYM B;  3AN2 C;  3X1V B;  1P3I C;  4H9N A;  3W98 D;  5AV5 C;  4WU8 C;  3MGP D;  4XZQ D;  3AN2 A;  1P3I A;  4G92 C;  5AV5 A;  4Z66 D;  1HTA A;  3KXB B;  4CAY B;  5AVC C;  4H9O A;  3NQU A;  5DNM B;  4NE6 A;  2CWE A;  4KHA B;  5B2J A;  5B33 A;  2ARO D;  5CP6 D;  1M18 A;  5B24 B;  4WNN B;  5B2I B;  3AZM B;  5GXQ A;  4YM6 D;  3AZJ C;  3MGS B;  3REK C;  3B6F B;  1H3O B;  3AV2 C;  3AZJ A;  4R8P B;  3REK A;  3WA9 B;  3AV2 A;  3LEL D;  1M1A C;  1HQ3 D;  1AOI A;  4H9N B;  3AFA B;  5CPK C;  1M1A A;  3UT9 C;  3REL C;  4UUZ B;  5CPK A;  3KWQ C;  5B0Z A;  3B0D C;  3REL A;  5CPI A;  2RVQ C;  3AZE B;  1M19 D;  4Z2M G;  5B2J B;  3LZ1 B;  3MGQ B;  3WKJ B;  4LD9 C;  5E5A B;  5CPJ D;  4KGC C;  5AV8 C;  2PYO D;  3AYW B;  4LD9 A;  4CSR A;  5AV9 B;  3UTA B;  5F99 C;  4KGC A;  3REI D;  4QLC B;  5AV8 A;  5GT0 A;  5AVB C;  3X1U D;  3WTP C;  3W99 C;  3WTP A;  3W99 A;  1P3O C;  3AN2 D;  1WWI A;  4ZBJ C;  1P3I D;  4NE5 A;  4Z5T C;  5AV5 D;  4WU8 D;  3AV1 B;  5BS7 A;  1P3O A;  3TU4 B;  4Z5T A;  3WAA C;  3AZL B;  5CPI B;  5AVC D;  3NQJ B;  2F8N A;  1BH8 A;  3AZH B;  3R45 A;  1TZY C;  3AZG B;  4J8V B;  3AZJ D;  1KX4 B;  3REK D;  4KUD C;  3AV2 D;  4X23 A;  5B31 B;  5AV6 C;  3MVD D;  4KUD A;  2HUE C;  3AZN C;  1P3F C;  1F66 B;  1P3K C;  1M1A D;  2YFW B;  1B67 A;  2BYK B;  3X1S A;  3AZN A;  3VH6 W;  1P3K A;  5CPK D;  3MGP A;  3UT9 D;  4XZQ A;  3REL D;  5GT3 C;  1KX5 C;  3KWQ D;  2JSS A;  3V9R A;  1ZLA B;  5GT3 A;  5B1M B;  2RVQ D;  5BNX B;  3A6N C;  1KU5 A;  2F8N B;  2YFV B;  4J8X C;  5CP6 A;  4LD9 D;  2IO5 B;  4EO5 B;  4KGC D;  3W96 B;  5AV8 D;  4YM6 A;  4J8X A;  5F99 D;  2F8N H;  4AWL B;  5AVB D;  3WTP D;  3W99 D;  4HGA C;  3AZI B;  1P3O D;  5G49 A;  2NZD B;  4Z5T D;  3W98 B;  1TAF B;  3KSY A;  1P3P B;  3MGR C;  3O62 C;  3WAA D;  2HIO C;  4Z66 B;  5JRG B;  1BFM A;  3O62 A;  1S32 C;  1P3M C;  4H9Q A;  4E45 A;  4WZS B;  1S32 A;  1P3B B;  1P3M A;  2ARO B;  5BNV B;  3C1B C;  5KDM B;  1TZY D;  1P3A B;  2PYO A;  4KUD D;  5B1L C;  4NE3 A;  5AV6 D;  3KXB C;  5B1L A;  3AZN D;  1P3F D;  1P3K D;  3LEL B;  1HQ3 B;  3AZF C;  4WU8 A;  3MNN B;  5B2I C;  3AZF A;  5GT3 D;  1KX5 D;  1P34 C;  1N1J A;  5B0Y B;  3B6F C;  4YS3 C;  1ULY A;  3VH6 A;  5AVC A;  1P34 A;  1M19 B;  3A6N D;  5JA4 A;  5B40 B;  4YS3 A;  3X1T B;  4M6B A;  4J8X D;  5CPJ B;  1P3L B;  4XUJ C;  3MVD C;  4H9R A;  4J8W C;  4XUJ A;  3REI B;  3X1U B;  3MVD A;  4J8W A;  3AZE C;  3C1C C;  3B6G C;  3AN2 B;  1P3I B;  5AV5 B;  3C1C A;  4JJN C;  5FUG A;  5GSU C;  3W97 C;  3B6G A;  3MGR D;  3O62 D;  3UT9 A;  4JJN A;  2HIO D;  4G91 C;  4H9O B;  3W97 A;  3KWQ A;  3NQU B;  1S32 D;  1ID3 C;  1P3M D;  3B0B A;  5BO0 A;  5B33 B;  3VH5 T;  5JA4 B;  1M18 B;  1ID3 A;  5GXQ B;  1P3G C;  3C1B D;  1P3G A;  3AV1 C;  5B32 C;  3AZJ B;  3REK B;  5B1L D;  5F99 A;  3AV2 B;  2NQB C;  3KXB D;  5B32 A;  5AVB A;  3AZL C;  1AOI B;  1U35 C;  2NQB A;  4WU9 C;  1M1A B;  3AZF D;  1U35 A;  5CPK B;  2L5A A;  5B0Z B;  5B2I D;  4ZUX C;  3REL B;  3WAA A;  1P34 D;  3KUY C;  3B6F D;  4YS3 D;  4ZUX A;  5CHL B;  5DNN C;  3KUY A;  1F66 C;  5DNN A;  4LD9 B;  4CSR B;  4KGC B;  4XUJ D;  1TZY A;  5AV8 B;  3REH C;  5GT0 B;  4J8W D;  3REH A;  3B0C T;  5AV6 A;  3WTP B;  3W99 B;  5AY8 C;  3AZE D;  1P3F A;  1EQZ C;  3C1C D;  5C3I B;  3B6G D;  5AY8 A;  1P3O B;  4ZBJ B;  4Z5T B;  4JJN D;  5GSU D;  3AZK C;  3W97 D;  3W96 C;  1KX5 A;  1JFI A;  3AZK A;  1ID3 D;  2CV5 C;  1BH8 B;  4NFT A;  3A6N A;  3R45 B;  3LJA C;  3UTB C;  2CV5 A;  1P3G D;  2FJ7 C;  3AZI C;  3LJA A;  3UTB A;  2NZD C;  2FJ7 A;  1WWS A;  4X23 B;  3AV1 D;  5B32 D;  1P3P C;  4KUD B;  1BH9 A;  2NQB D;  5JRG C;  3AZL D;  3AZN B;  3X1S B;  1U35 D;  1P3F B;  4WU9 D;  3LZ0 C;  1P3K B;  3MGP B;  1P3B C;  4H9P A;  4XZQ B;  1Q9C A;  5BT1 C;  3LZ0 A;  3V9R B;  4ZUX D;  5GT3 B;  3MGR A;  2HIO A;  3KUY D;  3REJ C;  4J8U C;  5DNN D;  3A6N B;  5CP6 B;  3REJ A;  2LY8 A;  5B31 G;  1KX3 C;  1F66 D;  3X1V C;  4J8U A;  4YM6 B;  3C1B A;  4J8X B;  1KX3 A;  3X1V A;  3REH D;  3MNN C;  3KXB A;  5B0Y C;  5DNM C;  4CAY A;  5AY8 D;  5G49 B;  1EQZ D;  4HGA B; 
#chains in the Genus database with same CATH topology
 4WJ3 C;  5DNM A;  3VH5 W;  3VH6 T;  5B24 C;  5B40 C;  4KHA A;  3X1T C;  3AZM C;  3AZK D;  2F8N G;  1P3L C;  4WNN A;  5B2I A;  3MGS C;  3O62 B;  3W96 D;  4H9Q B;  1A7W A;  4R8P C;  3MGS A;  1S32 B;  3B6F A;  3WA9 C;  1P3M B;  1H3O A;  2CV5 D;  4R8P A;  3LJA D;  2F8N K;  3UTB D;  2FJ7 D;  3AFA C;  4Z2M H;  3AZI D;  2PYO B;  2NZD D;  3EPH A;  2FFF B;  3AFA A;  1P3P D;  5B1L B;  4UUZ A;  5JRG D;  3EPJ A;  5B2J C;  1R4V A;  3LZ1 C;  2Y2J A;  3H0R C;  3LZ0 D;  3MGQ C;  5B33 C;  4WU8 B;  3AZE A;  1M18 C;  3WKJ C;  1P3B D;  1F1E A;  5E5A C;  5BT1 D;  3AZF B;  3LZ1 A;  5GXQ C;  3MGQ A;  4G92 B;  3WKJ A;  3AYW C;  5GSU A;  5E5A A;  1N1J B;  2JE5 A;  5AV9 C;  3UTA C;  4QLC C;  1P3A D;  5AVC B;  3AYW A;  1P34 B;  5AV9 A;  3UTA A;  3REJ D;  4YS3 B;  4QLC A;  4J8U D;  3B0C W;  1KX3 D;  1AOI C;  3X1V D;  4H9R B;  3TU4 C;  4XUJ B;  3MNN D;  3AV1 A;  5B0Z C;  3MVD B;  3TU4 A;  2Y2H A;  4J8W B;  5CPI C;  5B0Y D;  5DNM D;  3AZL A;  3NQJ A;  2Y2I A;  4WU9 A;  3C1C B;  3AZH C;  5B40 D;  5B24 D;  5FUG B;  3X1T D;  3B6G B;  3UT9 B;  3AZM D;  4JJN B;  3AZG C;  3AZH A;  4J8V C;  5GSU B;  3KWQ B;  1P3L D;  3MGS D;  3B0D B;  4WV4 B;  1KX4 C;  3W97 B;  5BO0 B;  4G91 B;  3AZG A;  5GT0 C;  5B31 C;  4J8V A;  4R8P D;  1KX4 A;  3VH5 A;  1ID3 B;  3WA9 D;  5B31 A;  1F66 A;  3AFA D;  5C3I C;  1P3G B;  2YFW A;  5BS7 C;  2BYK A;  5F99 B;  3WTP E;  5B32 B;  4DRA A;  1ZLA C;  5AVB B;  5B1M C;  2NQB B;  1ZLA A;  5B2J D;  5B1M A;  5B33 D;  3LZ1 D;  1U35 B;  3MGQ D;  4WU9 B;  1EQZ A;  3WKJ D;  3KFU G;  1M18 D;  5BNX A;  5E5A D;  2IO5 C;  3A1K A;  5GXQ D;  4EO5 C;  2YFV A;  3WAA B;  3AYW D;  5AV9 D;  3UTA D;  1T3U A;  3W96 A;  4ZUX B;  4QLC D;  4X23 C;  4AWL C;  3KUY B;  5DNN B;  2Y2Q A;  3X1S C;  1AOI D;  4DRB A;  3W98 C;  1TZY B;  3MGP C;  2JCH A;  3AZI A;  4XZQ C;  3TU4 D;  2NZD A;  3W98 A;  3REH B;  1TAF A;  2DQN C;  4Z66 C;  5B0Z D;  5AV6 B;  1P3P A;  1B6W A;  5CPI D;  2HUE B;  4Z66 A;  5JRG A;  5AY8 B;  1EQZ B;  2ARO C;  3AZH D;  5CP6 C;  1P3B A;  1KX5 B;  1JFI B;  2ARO A;  1W2E A;  5BNV A;  4YM6 C;  4J8V D;  3AZG D;  5KDM A;  3AZK B;  1P3A C;  1KX4 D;  5B31 D;  5GT0 D;  1P3A A;  2CV5 B;  3LEL C;  3LJA B;  1HQ3 C;  5B32 G;  1Z2C B;  2BYM A;  3UTB B;  2FJ7 B;  3LEL A;  1HQ3 A;  4H9S C;  1BH9 B;  2XD1 A;  1ZLA D;  3MNN A;  2G5I C;  4H9S A;  5B1M D;  1M19 C;  5B0Y A;  4H9P B;  2F8N D;  1M19 A;  3LZ0 B;  5B40 A;  5B24 A;  3X1T A;  5CPJ C;  3MGR B;  3AZM A;  2PYO C;  2HIO B;  5CPJ A;  1P3L A;  4X23 D;  3REI C;  3X1U C;  3REJ B;  3WA9 A;  3REI A;  2ZY3 A;  4E44 A;  4J8U B;  3X1U A;  3C1B B;  3X1S D;  1KX3 B;  2BYM B;  3AN2 C;  3X1V B;  1P3I C;  4H9N A;  3W98 D;  5AV5 C;  4WU8 C;  3MGP D;  4XZQ D;  3AN2 A;  3FDD A;  4G92 C;  1P3I A;  5AV5 A;  4Z66 D;  1HTA A;  3KXB B;  4CAY B;  5AVC C;  4H9O A;  3NQU A;  5DNM B;  4NE6 A;  2CWE A;  4KHA B;  5B2J A;  5B33 A;  2ARO D;  5CP6 D;  1M18 A;  5B24 B;  4WNN B;  5B2I B;  3AZM B;  5GXQ A;  4YM6 D;  3AZJ C;  3MGS B;  3REK C;  3B6F B;  1H3O B;  3AV2 C;  2ZM5 A;  3AZJ A;  4R8P B;  3REK A;  3WA9 B;  3AV2 A;  3LEL D;  1M1A C;  1HQ3 D;  1AOI A;  4H9N B;  3AFA B;  5CPK C;  1M1A A;  2ZY5 A;  3UT9 C;  3REL C;  4UUZ B;  5CPK A;  3KWQ C;  5B0Z A;  3B0D C;  3REL A;  5CPI A;  2RVQ C;  3AZE B;  1M19 D;  4Z2M G;  5B2J B;  3LZ1 B;  3MGQ B;  3WKJ B;  4LD9 C;  5E5A B;  5CPJ D;  4KGC C;  5AV8 C;  2PYO D;  3H0L C;  3AYW B;  4LD9 A;  3IP4 C;  4CSR A;  5AV9 B;  3UTA B;  5F99 C;  4KGC A;  3REI D;  4QLC B;  5AV8 A;  5GT0 A;  5AVB C;  2Y2G A;  3X1U D;  3WTP C;  3EPL A;  3W99 C;  3WTP A;  3W99 A;  1P3O C;  3AN2 D;  1WWI A;  4ZBJ C;  1P3I D;  4NE5 A;  4Z5T C;  5AV5 D;  4WU8 D;  3AV1 B;  5BS7 A;  1P3O A;  3TU4 B;  4Z5T A;  3WAA C;  3AZL B;  5CPI B;  5AVC D;  3NQJ B;  2F8N A;  1BH8 A;  3AZH B;  3R45 A;  1TZY C;  3AZG B;  4J8V B;  3AZJ D;  1KX4 B;  3REK D;  4KUD C;  3AV2 D;  4X23 A;  5B31 B;  5AV6 C;  3MVD D;  4KUD A;  2HUE C;  3AZN C;  1P3F C;  1F66 B;  2DF4 C;  1P3K C;  2RIQ A;  2YFW B;  1M1A D;  1B67 A;  2BYK B;  3X1S A;  3AZN A;  3VH6 W;  1P3K A;  5CPK D;  3MGP A;  3UT9 D;  4XZQ A;  3REL D;  5GT3 C;  1KX5 C;  3KWQ D;  2JSS A;  3V9R A;  1ZLA B;  5GT3 A;  5B1M B;  2RVQ D;  4DQY B;  5BNX B;  3A6N C;  3A1I A;  1KU5 A;  2F8N B;  2YFV B;  2Y2O A;  4J8X C;  5CP6 A;  4LD9 D;  2IO5 B;  4EO5 B;  4KGC D;  3W96 B;  5AV8 D;  4YM6 A;  4J8X A;  5F99 D;  3AL0 C;  2UWX A;  2F8N H;  4AWL B;  5AVB D;  3WTP D;  3W99 D;  4HGA C;  3AZI B;  1P3O D;  5G49 A;  2NZD B;  4Z5T D;  3W98 B;  1TAF B;  3KSY A;  1P3P B;  3MGR C;  3O62 C;  3WAA D;  2HIO C;  4Z66 B;  5JRG B;  1BFM A;  3O62 A;  1S32 C;  1P3M C;  4H9Q A;  4E45 A;  4WZS B;  1S32 A;  1P3B B;  1P3M A;  2ARO B;  5BNV B;  3C1B C;  5KDM B;  1TZY D;  1P3A B;  2PYO A;  4KUD D;  5B1L C;  1PZR A;  4NE3 A;  5AV6 D;  3KXB C;  5B1L A;  3AZN D;  1P3F D;  1P3K D;  3LEL B;  1HQ3 B;  3AZF C;  4WU8 A;  2W8S A;  3MNN B;  5B2I C;  3AZF A;  5GT3 D;  1KX5 D;  1P34 C;  1N1J A;  5B0Y B;  3H0M C;  3B6F C;  4YS3 C;  1ULY A;  3VH6 A;  5AVC A;  1P34 A;  1M19 B;  3A6N D;  5JA4 A;  5B40 B;  4YS3 A;  3X1T B;  4M6B A;  4J8X D;  5CPJ B;  1P3L B;  4XUJ C;  3MVD C;  4H9R A;  4J8W C;  4XUJ A;  3REI B;  3X1U B;  3MVD A;  2BG1 A;  4J8W A;  3AZE C;  3C1C C;  3B6G C;  3AN2 B;  1P3I B;  5AV5 B;  3C1C A;  4JJN C;  5FUG A;  5GSU C;  2VQR A;  3B6G A;  3W97 C;  3MGR D;  3O62 D;  3UT9 A;  4JJN A;  2HIO D;  4G91 C;  4H9O B;  3W97 A;  3KWQ A;  3NQU B;  1S32 D;  1ID3 C;  1P3M D;  3B0B A;  5BO0 A;  5B33 B;  3VH5 T;  5JA4 B;  2ZY2 A;  1M18 B;  1ID3 A;  5GXQ B;  1P3G C;  3C1B D;  2Y2N A;  2Y2P A;  1P3G A;  3AV1 C;  5B32 C;  3AZJ B;  3REK B;  5B1L D;  5F99 A;  3AV2 B;  2NQB C;  3KXB D;  5B32 A;  5AVB A;  3AZL C;  2Y2L A;  1AOI B;  1U35 C;  2NQB A;  2G5H C;  4WU9 C;  1M1A B;  3AZF D;  1U35 A;  5CPK B;  2L5A A;  5B2I D;  5B0Z B;  3EPK A;  4ZUX C;  3REL B;  3WAA A;  1P34 D;  3KUY C;  3B6F D;  4YS3 D;  4ZUX A;  5CHL B;  5DNN C;  3KUY A;  1F66 C;  2J8P A;  5DNN A;  4LD9 B;  4CSR B;  4KGC B;  4XUJ D;  1TZY A;  3P5J B;  5AV8 B;  3REH C;  5GT0 B;  4J8W D;  3REH A;  3B0C T;  3EG5 B;  5AV6 A;  3WTP B;  3W99 B;  5AY8 C;  3AZE D;  1P3F A;  1EQZ C;  3C1C D;  5C3I B;  2F2A C;  3B6G D;  5AY8 A;  1P3O B;  4ZBJ B;  4UPK A;  4Z5T B;  4JJN D;  5GSU D;  3AZK C;  3W97 D;  3W96 C;  1KX5 A;  1JFI A;  3AZK A;  1ID3 D;  2CV5 C;  1BH8 B;  4NFT A;  3A6N A;  3R45 B;  3LJA C;  3UTB C;  2CV5 A;  1P3G D;  2FJ7 C;  3AZI C;  3LJA A;  3UTB A;  2NZD C;  2FJ7 A;  1WWS A;  4X23 B;  3AV1 D;  5B32 D;  1P3P C;  2XD5 A;  4KUD B;  1BH9 A;  2NQB D;  3F6T A;  5JRG C;  2Y2M A;  3AZL D;  2Y2K A;  3AZN B;  3X1S B;  1U35 D;  1P3F B;  4WU9 D;  3LZ0 C;  1P3K B;  3MGP B;  2ZY4 A;  1P3B C;  4H9P A;  4XZQ B;  1Q9C A;  5BT1 C;  3LZ0 A;  3V9R B;  4ZUX D;  5GT3 B;  3MGR A;  2HIO A;  3KUY D;  3REJ C;  4J8U C;  5DNN D;  3A6N B;  5CP6 B;  3REJ A;  2LY8 A;  5B31 G;  1KX3 C;  1F66 D;  3X1V C;  4J8U A;  4YM6 B;  3C1B A;  4J8X B;  1KX3 A;  3X1V A;  3REH D;  3MNN C;  3KXB A;  5B0Y C;  5DNM C;  4CAY A;  5AY8 D;  5G49 B;  1EQZ D;  4HGA B; 
#chains in the Genus database with same CATH homology
 4WJ3 C;  5DNM A;  3VH5 W;  3VH6 T;  5B24 C;  5B40 C;  4KHA A;  3X1T C;  3AZM C;  3AZK D;  2F8N G;  1P3L C;  4WNN A;  5B2I A;  3MGS C;  3O62 B;  3W96 D;  4H9Q B;  1A7W A;  4R8P C;  3MGS A;  1S32 B;  3B6F A;  3WA9 C;  1P3M B;  1H3O A;  2CV5 D;  4R8P A;  3LJA D;  2F8N K;  3UTB D;  2FJ7 D;  3AFA C;  4Z2M H;  3AZI D;  2PYO B;  2NZD D;  3EPH A;  2FFF B;  3AFA A;  1P3P D;  5B1L B;  4UUZ A;  5JRG D;  3EPJ A;  5B2J C;  1R4V A;  3LZ1 C;  2Y2J A;  3H0R C;  3LZ0 D;  3MGQ C;  5B33 C;  4WU8 B;  3AZE A;  1M18 C;  3WKJ C;  1P3B D;  1F1E A;  5E5A C;  5BT1 D;  3AZF B;  3LZ1 A;  5GXQ C;  3MGQ A;  4G92 B;  3WKJ A;  3AYW C;  5GSU A;  5E5A A;  1N1J B;  2JE5 A;  5AV9 C;  3UTA C;  4QLC C;  1P3A D;  5AVC B;  3AYW A;  1P34 B;  5AV9 A;  3UTA A;  3REJ D;  4YS3 B;  4QLC A;  4J8U D;  3B0C W;  1KX3 D;  1AOI C;  3X1V D;  4H9R B;  3TU4 C;  4XUJ B;  3MNN D;  3AV1 A;  5B0Z C;  3MVD B;  3TU4 A;  2Y2H A;  4J8W B;  5CPI C;  5B0Y D;  5DNM D;  3AZL A;  3NQJ A;  2Y2I A;  4WU9 A;  3C1C B;  3AZH C;  5B40 D;  5B24 D;  5FUG B;  3X1T D;  3B6G B;  3UT9 B;  3AZM D;  4JJN B;  3AZG C;  3AZH A;  4J8V C;  5GSU B;  3KWQ B;  1P3L D;  3MGS D;  3B0D B;  4WV4 B;  1KX4 C;  3W97 B;  5BO0 B;  4G91 B;  3AZG A;  5GT0 C;  5B31 C;  4J8V A;  4R8P D;  1KX4 A;  3VH5 A;  1ID3 B;  3WA9 D;  5B31 A;  1F66 A;  3AFA D;  5C3I C;  1P3G B;  2YFW A;  5BS7 C;  2BYK A;  5F99 B;  3WTP E;  5B32 B;  4DRA A;  1ZLA C;  5AVB B;  5B1M C;  2NQB B;  1ZLA A;  5B2J D;  5B1M A;  5B33 D;  3LZ1 D;  1U35 B;  3MGQ D;  4WU9 B;  1EQZ A;  3WKJ D;  3KFU G;  1M18 D;  5BNX A;  5E5A D;  2IO5 C;  3A1K A;  5GXQ D;  4EO5 C;  2YFV A;  3WAA B;  3AYW D;  5AV9 D;  3UTA D;  1T3U A;  3W96 A;  4ZUX B;  4QLC D;  4X23 C;  4AWL C;  3KUY B;  5DNN B;  2Y2Q A;  3X1S C;  1AOI D;  4DRB A;  3W98 C;  1TZY B;  3MGP C;  2JCH A;  3AZI A;  4XZQ C;  3TU4 D;  2NZD A;  3W98 A;  3REH B;  1TAF A;  2DQN C;  4Z66 C;  5B0Z D;  5AV6 B;  1P3P A;  1B6W A;  5CPI D;  2HUE B;  4Z66 A;  5JRG A;  5AY8 B;  1EQZ B;  2ARO C;  3AZH D;  5CP6 C;  1P3B A;  1KX5 B;  1JFI B;  2ARO A;  1W2E A;  5BNV A;  4YM6 C;  4J8V D;  3AZG D;  5KDM A;  3AZK B;  1P3A C;  1KX4 D;  5B31 D;  5GT0 D;  1P3A A;  2CV5 B;  3LEL C;  3LJA B;  1HQ3 C;  5B32 G;  1Z2C B;  2BYM A;  3UTB B;  2FJ7 B;  3LEL A;  1HQ3 A;  4H9S C;  1BH9 B;  2XD1 A;  1ZLA D;  3MNN A;  2G5I C;  4H9S A;  5B1M D;  1M19 C;  5B0Y A;  4H9P B;  2F8N D;  1M19 A;  3LZ0 B;  5B40 A;  5B24 A;  3X1T A;  5CPJ C;  3MGR B;  3AZM A;  2PYO C;  2HIO B;  5CPJ A;  1P3L A;  4X23 D;  3REI C;  3X1U C;  3REJ B;  3WA9 A;  3REI A;  2ZY3 A;  4E44 A;  4J8U B;  3X1U A;  3C1B B;  3X1S D;  1KX3 B;  2BYM B;  3AN2 C;  3X1V B;  1P3I C;  4H9N A;  3W98 D;  5AV5 C;  4WU8 C;  3MGP D;  4XZQ D;  3AN2 A;  3FDD A;  4G92 C;  1P3I A;  5AV5 A;  4Z66 D;  1HTA A;  3KXB B;  4CAY B;  5AVC C;  4H9O A;  3NQU A;  5DNM B;  4NE6 A;  2CWE A;  4KHA B;  5B2J A;  5B33 A;  2ARO D;  5CP6 D;  1M18 A;  5B24 B;  4WNN B;  5B2I B;  3AZM B;  5GXQ A;  4YM6 D;  3AZJ C;  3MGS B;  3REK C;  3B6F B;  1H3O B;  3AV2 C;  2ZM5 A;  3AZJ A;  4R8P B;  3REK A;  3WA9 B;  3AV2 A;  3LEL D;  1M1A C;  1HQ3 D;  1AOI A;  4H9N B;  3AFA B;  5CPK C;  1M1A A;  2ZY5 A;  3UT9 C;  3REL C;  4UUZ B;  5CPK A;  3KWQ C;  5B0Z A;  3B0D C;  3REL A;  5CPI A;  2RVQ C;  3AZE B;  1M19 D;  4Z2M G;  5B2J B;  3LZ1 B;  3MGQ B;  3WKJ B;  4LD9 C;  5E5A B;  5CPJ D;  4KGC C;  5AV8 C;  2PYO D;  3H0L C;  3AYW B;  4LD9 A;  3IP4 C;  4CSR A;  5AV9 B;  3UTA B;  5F99 C;  4KGC A;  3REI D;  4QLC B;  5AV8 A;  5GT0 A;  5AVB C;  2Y2G A;  3X1U D;  3WTP C;  3EPL A;  3W99 C;  3WTP A;  3W99 A;  1P3O C;  3AN2 D;  1WWI A;  4ZBJ C;  1P3I D;  4NE5 A;  4Z5T C;  5AV5 D;  4WU8 D;  3AV1 B;  5BS7 A;  1P3O A;  3TU4 B;  4Z5T A;  3WAA C;  3AZL B;  5CPI B;  5AVC D;  3NQJ B;  2F8N A;  1BH8 A;  3AZH B;  3R45 A;  1TZY C;  3AZG B;  4J8V B;  3AZJ D;  1KX4 B;  3REK D;  4KUD C;  3AV2 D;  4X23 A;  5B31 B;  5AV6 C;  3MVD D;  4KUD A;  2HUE C;  3AZN C;  1P3F C;  1F66 B;  2DF4 C;  1P3K C;  2RIQ A;  2YFW B;  1M1A D;  1B67 A;  2BYK B;  3X1S A;  3AZN A;  3VH6 W;  1P3K A;  5CPK D;  3MGP A;  3UT9 D;  4XZQ A;  3REL D;  5GT3 C;  1KX5 C;  3KWQ D;  2JSS A;  3V9R A;  1ZLA B;  5GT3 A;  5B1M B;  2RVQ D;  4DQY B;  5BNX B;  3A6N C;  3A1I A;  1KU5 A;  2F8N B;  2YFV B;  2Y2O A;  4J8X C;  5CP6 A;  4LD9 D;  2IO5 B;  4EO5 B;  4KGC D;  3W96 B;  5AV8 D;  4YM6 A;  4J8X A;  5F99 D;  3AL0 C;  2UWX A;  2F8N H;  4AWL B;  5AVB D;  3WTP D;  3W99 D;  4HGA C;  3AZI B;  1P3O D;  5G49 A;  2NZD B;  4Z5T D;  3W98 B;  1TAF B;  3KSY A;  1P3P B;  3MGR C;  3O62 C;  3WAA D;  2HIO C;  4Z66 B;  5JRG B;  1BFM A;  3O62 A;  1S32 C;  1P3M C;  4H9Q A;  4E45 A;  4WZS B;  1S32 A;  1P3B B;  1P3M A;  2ARO B;  5BNV B;  3C1B C;  5KDM B;  1TZY D;  1P3A B;  2PYO A;  4KUD D;  5B1L C;  1PZR A;  4NE3 A;  5AV6 D;  3KXB C;  5B1L A;  3AZN D;  1P3F D;  1P3K D;  3LEL B;  1HQ3 B;  3AZF C;  4WU8 A;  2W8S A;  3MNN B;  5B2I C;  3AZF A;  5GT3 D;  1KX5 D;  1P34 C;  1N1J A;  5B0Y B;  3H0M C;  3B6F C;  4YS3 C;  1ULY A;  3VH6 A;  5AVC A;  1P34 A;  1M19 B;  3A6N D;  5JA4 A;  5B40 B;  4YS3 A;  3X1T B;  4M6B A;  4J8X D;  5CPJ B;  1P3L B;  4XUJ C;  3MVD C;  4H9R A;  4J8W C;  4XUJ A;  3REI B;  3X1U B;  3MVD A;  2BG1 A;  4J8W A;  3AZE C;  3C1C C;  3B6G C;  3AN2 B;  1P3I B;  5AV5 B;  3C1C A;  4JJN C;  5FUG A;  5GSU C;  2VQR A;  3B6G A;  3W97 C;  3MGR D;  3O62 D;  3UT9 A;  4JJN A;  2HIO D;  4G91 C;  4H9O B;  3W97 A;  3KWQ A;  3NQU B;  1S32 D;  1ID3 C;  1P3M D;  3B0B A;  5BO0 A;  5B33 B;  3VH5 T;  5JA4 B;  2ZY2 A;  1M18 B;  1ID3 A;  5GXQ B;  1P3G C;  3C1B D;  2Y2N A;  2Y2P A;  1P3G A;  3AV1 C;  5B32 C;  3AZJ B;  3REK B;  5B1L D;  5F99 A;  3AV2 B;  2NQB C;  3KXB D;  5B32 A;  5AVB A;  3AZL C;  2Y2L A;  1AOI B;  1U35 C;  2NQB A;  2G5H C;  4WU9 C;  1M1A B;  3AZF D;  1U35 A;  5CPK B;  2L5A A;  5B2I D;  5B0Z B;  3EPK A;  4ZUX C;  3REL B;  3WAA A;  1P34 D;  3KUY C;  3B6F D;  4YS3 D;  4ZUX A;  5CHL B;  5DNN C;  3KUY A;  1F66 C;  2J8P A;  5DNN A;  4LD9 B;  4CSR B;  4KGC B;  4XUJ D;  1TZY A;  3P5J B;  5AV8 B;  3REH C;  5GT0 B;  4J8W D;  3REH A;  3B0C T;  3EG5 B;  5AV6 A;  3WTP B;  3W99 B;  5AY8 C;  3AZE D;  1P3F A;  1EQZ C;  3C1C D;  5C3I B;  2F2A C;  3B6G D;  5AY8 A;  1P3O B;  4ZBJ B;  4UPK A;  4Z5T B;  4JJN D;  5GSU D;  3AZK C;  3W97 D;  3W96 C;  1KX5 A;  1JFI A;  3AZK A;  1ID3 D;  2CV5 C;  1BH8 B;  4NFT A;  3A6N A;  3R45 B;  3LJA C;  3UTB C;  2CV5 A;  1P3G D;  2FJ7 C;  3AZI C;  3LJA A;  3UTB A;  2NZD C;  2FJ7 A;  1WWS A;  4X23 B;  3AV1 D;  5B32 D;  1P3P C;  2XD5 A;  4KUD B;  1BH9 A;  2NQB D;  3F6T A;  5JRG C;  2Y2M A;  3AZL D;  2Y2K A;  3AZN B;  3X1S B;  1U35 D;  1P3F B;  4WU9 D;  3LZ0 C;  1P3K B;  3MGP B;  2ZY4 A;  1P3B C;  4H9P A;  4XZQ B;  1Q9C A;  5BT1 C;  3LZ0 A;  3V9R B;  4ZUX D;  5GT3 B;  3MGR A;  2HIO A;  3KUY D;  3REJ C;  4J8U C;  5DNN D;  3A6N B;  5CP6 B;  3REJ A;  2LY8 A;  5B31 G;  1KX3 C;  1F66 D;  3X1V C;  4J8U A;  4YM6 B;  3C1B A;  4J8X B;  1KX3 A;  3X1V A;  3REH D;  3MNN C;  3KXB A;  5B0Y C;  5DNM C;  4CAY A;  5AY8 D;  5G49 B;  1EQZ D;  4HGA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...