4R8PB

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
b'RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
molecule tags Structural protein/dna
source organism Xenopus laevis
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
total genus 24
structure length 86
sequence length 86
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pB00
3LJAB 1M19C 1HQ3B 2CV5D 3KSYA 3AZED 3AN2C 3W96A 3O62D 1TZYB 2AROC 3AFAA 4G92B 5KDMB 3AZFB 3TU4A 3AV1A 1P3LD 3MVDB 4CSRB 1M1AB 4KGCD 1WWSA 5B24B 5BT1C 4X23A 2F8NH 5B1MA 5GXQA 3WTPC 3C1CC 3AZLC 3LZ0A 4Z5TA 5B2IC 3MGQA 2FJ7A 1EQZD 1H3OB 1AOID 3AZLD 4Z66B 3W98D 3AZKD 4R8PB 4J8VC 5DNNA 3NQUB 5AV9C 3UTBC 5JRGD 5AVBA 4XZQD 4JJNB 5C3IC 5B31G 4XUJB 3MVDC 5E5AB 3KXBA 4J8WA 2CV5C 2RVQC 5B24A 5AV6D 4J8UB 3REKB 3KUYC 2RVQD 4QLCA 4KUDB 5CP6D 3AZJD 5DNMB 1P3OB 4YM6B 1P3PA 1AOIC 1TZYA 2YFWB 3A6ND 5GXQB 2NQBD 1P3AC 5GT0D 1KX5C 5GT3D 5BS7C 3W97D 2HIOA 4H9NB 1M1AA 1TAFA 2NZDD 4CAYA 1U35D 1KX3D 2NZDB 4HGAB 5AY8C 5AV8D 1U35B 5B0ZA 1P3AB 3AZHB 3AZGC 3X1SA 1P3ID 1KX4C 3B6FA 3W96B 5GSUA 5B1LD 5B40D 1P34A 1P3IB 3TU4B 4LD9C 5AVCB 1M18A 4H9PA 5CPJA 4J8UC 3AN2D 2HIOB 4H9NA 5CP6C 3WAAA 1HQ3A 3AZKA 3WKJA 3R45A 5B2JD 4NE3A 4J8XC 1P3LC 5JRGA 4M6BA 4KUDA 2LY8A 5C3IB 3KXBD 4J8WD 2F8NK 3B6GB 3KXBB 4J8WB 5AV6C 2IO5B 3AZMC 4LD9D 1EQZC 5AV9B 3UTBB 1P3PB 5AVCA 3MGRA 4LD9B 1P3FD 4UUZB 2BYKA 4H9OB 4J8VD 1S32D 3AZKC 3AZIA 1H3OA 4J8UA 5CPID 1P3GB 1ZLAC 3VH5T 2NZDC 3LELD 1M18C 4CAYB 3UTAD 1P3GD 3REJD 3W99A 3MNND 1P34C 3MGQD 2PYOB 5GT0C 1KX5D 3C1BA 3X1TD 2NQBC 1P3GC 3LZ1C 5AY8A 5CPJD 5B32C 3X1TB 1ZLAB 3O62C 3REKA 2HUEB 5BNVB 1HQ3D 5BT1D 3AZEC 3REHC 5B33B 1M19B 3KWQB 3MGPC 4YS3B 5B33D 4H9RA 3AZFD 4YS3D 1P3MD 1TZYC 1P3KD 1P3LB 4AWLB 1P3MB 4XZQC 3REHB 4YM6A 5B24D 3AZND 4E44A 3WA9A 4WV4B 1F66A 4WU9B 5B31B 1P3KC 5AVBC 4H9QB 5AV9A 3UTBA 3AV2C 4J8VA 3W98B 2HUEC 3AZEB 3AZKB 3AZGB 1F66C 4Z66C 4X23D 1KX3A 3AYWB 1M18B 2YFVA 3AYWD 5CPKD 2FJ7C 4XUJD 3X1SB 3B6FB 3MNNC 4WNNA 5E5AD 3REJC 3LZ0C 3AYWC 3V9RB 3REHA 4KGCA 3REID 3W97C 5B31A 1P3FC 1AOIB 5G49B 5GXQD 3X1UB 3LZ1A 4WU8D 1B67A 4WU8B 3X1UD 4H9OA 3RELD 5KDMA 1BH9A 3W99C 3WA9C 1KX3B 5B32B 3NQJA 4JJND 3AZIC 3W96D 3VH5A 4H9RB 3TU4D 3A6NA 4YS3C 5AVCC 2HIOD 5CP6B 1P3OD 5B1MD 5B32G 1Q9CA 5AV6A 2NQBB 3AYWA 3REJA 4Z2MG 2F8NB 3B6GD 5B0YA 4KUDC 4H9QA 5BO0A 5DNMA 3UT9A 1KX3C 1P3LA 3MGSB 4Z66A 4J8XA 3AZHD 3MGSD 4CSRA 3AV2A 1BH9B 1HQ3C 5B33A 2CWEA 5GT3C 1ID3C 1TAFB 4G91B 2AROB 4G92C 3AZMB 1BFMA 1P3FB 5E5AC 2CV5B 3X1UA 3LZ1B 2AROD 3AZMD 3X1TC 3X1SC 3AZGA 3B6FC 3NQUA 3B0CT 4ZBJB 5CPIB 1P3BD 3LELB 3KWQC 4R8PC 4QLCB 1S32C 2PYOC 2HIOC 5G49A 3MGRD 5CHLB 1P3AA 1HTAA 3MGPA 3VH6A 1P3PC 2PYOA 5F99D 5CPIA 3KWQD 4NE5A 3KUYA 5B32A 1P3GA 1P3PD 4DRAA 1P3KB 5B24C 3C1BC 3KXBC 4J8WC 5GT0A 2CV5A 5B1LA 5B40A 5B2ID 1KX4D 3C1CB 2IO5C 5JRGB 4WNNB 3LJAC 3C1CD 1P3MC 1U35A 5GT3A 5DNNC 3MGSA 5B31D 3UT9C 3X1VD 1EQZA 5DNMC 4H9SC 5B0YC 3B6GC 4KUDD 3X1VC 5GSUD 4AWLC 4YM6D 4DRBA 3AZGD 1M19D 1P34B 5B2JA 3AZLA 3UT9B 4UUZA 3W97B 1F66D 3WKJD 3MVDD 2F8NA 3WAAB 5AV5B 5AV5D 5AV8B 5AVBD 1P3AD 5JRGC 4YS3A 3TU4C 5AVBB 3AFAC 3WKJC 3VH5W 4WU9D 3WAAC 5CP6A 1P3OA 3VH6T 3AZIB 1EQZB 5BNVA 3RELC 1B6WA 5GSUC 2BYMB 1KX4A 5B0ZC 4X23B 4WU8C 3WTPD 4R8PD 5B31C 1P3FA 4G91C 3W97A 4WZSB 3W99B 1M1AC 4KGCC 3W99D 3X1SD 1P3IA 3VH6W 5BS7A 3B6FD 5FUGA 3UTAA 1AOIA 1ID3D 3MNNA 3REKD 4Z5TD 4ZUXA 3REIB 1KU5A 3AZHC 3MGPB 3LZ0B 4J8VB 3W98A 3V9RA 3LZ0D 4EO5B 3MVDA 2F8ND 3RELB 3UTAB 3AZNA 5CPKC 1P3KA 1BH8B 1ULYA 5BNXA 3AZJC 3AFAB 4WU9C 5BO0B 3AFAD 3KUYB 3AZNC 5CPKA 5AVCD 4YM6C 4Z5TC 4NE6A 4XZQA 3AV2B 1TZYD 3C1CA 5GXQC 3WTPA 4JJNC 5B2JB 2YFVB 4J8XD 3AZHA 3REHD 4J8XB 4KHAA 1M1AD 4Z2MH 4ZUXC 3AZEA 1JFIA 4KGCB 3REKC 3O62A 3LELA 2YFWA 3AV1C 1R4VA 5AV8A 2NQBA 2AROA 1N1JB 3AN2A 1P3IC 5DNNB 5DNND 4E45A 2NZDA 3AZLB 1ZLAA 4Z66D 4WU8A 3LZ1D 3LJAD 5B2IB 2FJ7B 3O62B 1S32B 5AV5A 3MGRC 2FJ7D 5CPKB 1WWIA 3WTPE 3AZMA 4QLCD 1P3OC 5F99A 1P3BA 1KX5B 3MGRB 5AV6B 5DNMD 3R45B 3UT9D 3A6NB 3WA9B 5JA4A 5B2JC 5GT3B 1P3BC 3WA9D 3X1VA 5B32D 3AV1B 4H9SA 5CPJC 3B6GA 4LD9A 5FUGB 3AZNB 3AV1D 4XZQB 4XUJC 1N1JA 5B1LB 5B40B 3MGSC 3REIA 1U35C 4J8UD 5JA4B 3LJAA 1P3MA 5BNXB 4KHAB 5GSUB 3AZJB 5B1LC 5B40C 1P34D 1KX5A 3WTPB 4NFTA 5AV8C 5GT0B 3LELC 1M18D 1F66B 5CPIC 3WAAD 3WKJB 4QLCC 2JSSA 4JJNA 1ID3B 3NQJB 3B0DB 1JFIB 1S32A 3AZID 4R8PA 3KWQA 5AV9D 3MGPD 3UTBD 4ZBJC 3REIC 3AN2B 4WU9A 3B0DC 4XUJA 1P3BB 5B0YB 3AZJA 3X1UC 3X1TA 5E5AA 5B0YD 1ID3A 3REJB 5B33C 5B2IA 3MGQC 3MNNB 3W98C 3B0BA 1ZLAD 1A7WA 1BH8A 5B1MC 5B0ZB 4X23C 5B0ZD 5F99B 4Z5TB 2BYKB 3AV2D 3C1BB 4EO5C 2F8NG 1F1EA 3C1BD 4HGAC 5AY8B 5B1MB 3UTAC 5AY8D 2BYMA 3W96C 1KX4B 4ZUXD 5F99C 1M19A 4ZUXB 3AZFA 5AV5C 3A6NC 3MGQB 2PYOD 3B0CW 3X1VB 3RELA 3AZFC 3KUYD 4H9PB 5CPJB 2L5AA
chains in the Genus database with same CATH superfamily
3LJAB 1M19C 1HQ3B 2CV5D 3KSYA 3AZED 3AN2C 3W96A 3O62D 1TZYB 2AROC 3AFAA 4G92B 5KDMB 3AZFB 3TU4A 3AV1A 1P3LD 3MVDB 3F6TA 4CSRB 1M1AB 3H0LC 4KGCD 1WWSA 5B24B 5BT1C 4X23A 4DQYB 2F8NH 5B1MA 5GXQA 3WTPC 3C1CC 3AZLC 3LZ0A 4Z5TA 5B2IC 3MGQA 2FJ7A 1EQZD 1H3OB 1AOID 3AZLD 4Z66B 3W98D 3AZKD 1W2EA 4R8PB 4J8VC 5DNNA 3NQUB 5AV9C 3UTBC 5JRGD 3P5JB 5AVBA 4XZQD 4JJNB 5C3IC 5B31G 4XUJB 3MVDC 5E5AB 3KXBA 4J8WA 2CV5C 2RVQC 5B24A 5AV6D 4J8UB 2Y2HA 3REKB 3KUYC 2RVQD 4QLCA 4KUDB 5CP6D 3AZJD 5DNMB 1P3OB 4YM6B 1P3PA 1AOIC 1TZYA 2YFWB 3A6ND 5GXQB 2NQBD 1P3AC 5GT0D 1KX5C 5GT3D 5BS7C 3W97D 2HIOA 4H9NB 1M1AA 1TAFA 2NZDD 4CAYA 1U35D 2G5IC 1KX3D 2NZDB 4HGAB 5AY8C 5AV8D 1U35B 5B0ZA 1P3AB 3AZHB 3AZGC 3X1SA 1P3ID 1KX4C 3B6FA 3W96B 5GSUA 5B1LD 5B40D 4UPKA 1P34A 1P3IB 3TU4B 4LD9C 5AVCB 1M18A 4H9PA 5CPJA 4J8UC 3AN2D 2HIOB 4H9NA 5CP6C 3WAAA 1HQ3A 3AZKA 3WKJA 3R45A 5B2JD 4NE3A 4J8XC 1P3LC 5JRGA 4M6BA 4KUDA 2LY8A 5C3IB 3KXBD 4J8WD 2F8NK 3B6GB 3KXBB 4J8WB 5AV6C 2IO5B 3AZMC 4LD9D 1EQZC 5AV9B 3UTBB 1P3PB 5AVCA 3MGRA 4LD9B 1P3FD 4UUZB 2BYKA 4H9OB 2DF4C 4J8VD 1S32D 2Y2OA 3AZKC 3AZIA 1H3OA 4J8UA 5CPID 1P3GB 2Y2KA 3VH5T 1ZLAC 3LELD 1M18C 2NZDC 4CAYB 3UTAD 1P3GD 3REJD 3W99A 3MNND 1P34C 3MGQD 2PYOB 5GT0C 1KX5D 3C1BA 3X1TD 2Y2IA 2NQBC 1P3GC 3LZ1C 5AY8A 5CPJD 5B32C 3X1TB 1ZLAB 3O62C 3REKA 2G5HC 2HUEB 5BNVB 1HQ3D 5BT1D 3AZEC 3REHC 5B33B 1M19B 3KWQB 3MGPC 4YS3B 5B33D 4H9RA 3AZFD 4YS3D 1P3MD 1TZYC 1P3KD 1P3LB 4AWLB 1P3MB 4XZQC 3REHB 4YM6A 5B24D 3AZND 4E44A 3WA9A 4WV4B 1F66A 4WU9B 5B31B 1P3KC 5AVBC 4H9QB 5AV9A 3UTBA 2ZY3A 4J8VA 3AV2C 3W98B 2HUEC 3AZEB 3AZKB 3AZGB 1F66C 4Z66C 4X23D 1KX3A 3AYWB 1M18B 2YFVA 3AYWD 5CPKD 2FJ7C 4XUJD 3X1SB 3B6FB 3MNNC 4WNNA 5E5AD 3REJC 3LZ0C 3AYWC 3A1KA 3V9RB 2J8PA 3REHA 4KGCA 3IP4C 3REID 3AL0C 3W97C 5B31A 1P3FC 1AOIB 5G49B 5GXQD 3X1UB 3LZ1A 2ZY5A 4WU8D 1B67A 4WU8B 3X1UD 4H9OA 3RELD 5KDMA 1BH9A 3W99C 3WA9C 1KX3B 5B32B 3NQJA 4JJND 3AZIC 3W96D 3VH5A 4H9RB 3TU4D 3A6NA 4YS3C 5AVCC 2BG1A 2HIOD 5CP6B 1P3OD 5B1MD 5B32G 1Q9CA 5AV6A 2NQBB 3A1IA 3AYWA 3REJA 4Z2MG 2F8NB 3B6GD 5B0YA 4KUDC 4H9QA 5BO0A 5DNMA 3H0RC 3UT9A 1KX3C 1P3LA 3MGSB 4Z66A 4J8XA 3AZHD 3MGSD 4CSRA 3H0MC 3AV2A 1BH9B 1HQ3C 5B33A 2CWEA 5GT3C 1ID3C 1TAFB 4G91B 2AROB 4G92C 3AZMB 1BFMA 1P3FB 5E5AC 2CV5B 3X1UA 3LZ1B 2AROD 3AZMD 3X1TC 3X1SC 3AZGA 3B6FC 3NQUA 3B0CT 4ZBJB 5CPIB 1P3BD 3LELB 3KWQC 4R8PC 4QLCB 1S32C 2PYOC 2HIOC 5G49A 3KFUG 3MGRD 5CHLB 1P3AA 1HTAA 3MGPA 3VH6A 1P3PC 2PYOA 5F99D 5CPIA 3KWQD 4NE5A 3KUYA 5B32A 1P3GA 1P3PD 4DRAA 1P3KB 5B24C 3C1BC 3KXBC 4J8WC 5GT0A 2CV5A 5B1LA 5B40A 5B2ID 1KX4D 3C1CB 2IO5C 5JRGB 4WNNB 3LJAC 3C1CD 1P3MC 1U35A 2Y2JA 5GT3A 5DNNC 3MGSA 5B31D 3UT9C 3X1VD 1EQZA 5DNMC 4H9SC 5B0YC 3B6GC 4KUDD 3X1VC 5GSUD 4AWLC 4YM6D 4DRBA 3AZGD 1PZRA 1P34B 1M19D 5B2JA 3AZLA 3UT9B 4UUZA 3W97B 1F66D 3WKJD 3MVDD 2F8NA 3WAAB 5AV5B 5AV5D 5AV8B 5AVBD 1P3AD 5JRGC 4YS3A 3TU4C 5AVBB 3AFAC 3WKJC 3VH5W 4WU9D 3WAAC 5CP6A 1P3OA 3VH6T 3AZIB 2ZM5A 1EQZB 5BNVA 3RELC 1B6WA 5GSUC 2BYMB 1KX4A 5B0ZC 4X23B 4WU8C 3WTPD 4R8PD 5B31C 1P3FA 4G91C 3W97A 4WZSB 3W99B 1M1AC 4KGCC 3W99D 3X1SD 1P3IA 3VH6W 5BS7A 3B6FD 5FUGA 3UTAA 1AOIA 1ID3D 3MNNA 3REKD 4Z5TD 4ZUXA 3REIB 1KU5A 3AZHC 3MGPB 3LZ0B 4J8VB 3W98A 3V9RA 3LZ0D 4EO5B 3MVDA 2F8ND 3RELB 3UTAB 3AZNA 5CPKC 1P3KA 2XD1A 1BH8B 1ULYA 5BNXA 3AZJC 3AFAB 4WU9C 5BO0B 2Y2QA 3AFAD 3KUYB 3AZNC 5CPKA 5AVCD 4YM6C 2DQNC 4Z5TC 4NE6A 4XZQA 3AV2B 1TZYD 3C1CA 5GXQC 3WTPA 4JJNC 5B2JB 2YFVB 4J8XD 3AZHA 3REHD 1T3UA 4J8XB 4KHAA 1M1AD 4Z2MH 4ZUXC 3AZEA 1JFIA 4KGCB 3REKC 3O62A 3LELA 2YFWA 3AV1C 1R4VA 5AV8A 3EPKA 2NQBA 2AROA 1N1JB 3AN2A 1P3IC 5DNNB 5DNND 4E45A 2NZDA 3AZLB 1ZLAA 4Z66D 4WU8A 3LZ1D 3LJAD 5B2IB 2FJ7B 3O62B 1S32B 5AV5A 3MGRC 2FJ7D 5CPKB 1WWIA 3WTPE 2JE5A 3AZMA 4QLCD 1P3OC 5F99A 3EPHA 1P3BA 1Z2CB 2F2AC 3FDDA 1KX5B 3MGRB 5AV6B 2W8SA 2UWXA 3EPLA 5DNMD 3R45B 3UT9D 3A6NB 2VQRA 2FFFB 3WA9B 5JA4A 5B2JC 5GT3B 1P3BC 3WA9D 2Y2NA 2ZY2A 3X1VA 3EG5B 5B32D 4H9SA 3AV1B 5CPJC 3B6GA 4WJ3C 4LD9A 5FUGB 3AZNB 3AV1D 4XZQB 4XUJC 1N1JA 5B1LB 5B40B 3MGSC 3REIA 1U35C 4J8UD 5JA4B 3LJAA 1P3MA 5BNXB 4KHAB 5GSUB 3AZJB 5B1LC 5B40C 1P34D 1KX5A 3WTPB 2JCHA 4NFTA 5AV8C 5GT0B 3LELC 1M18D 1F66B 5CPIC 3WAAD 3WKJB 4QLCC 2JSSA 2ZY4A 3EPJA 4JJNA 2RIQA 2XD5A 1ID3B 3NQJB 3B0DB 1JFIB 1S32A 3AZID 4R8PA 3KWQA 5AV9D 3MGPD 3UTBD 2Y2MA 4ZBJC 3REIC 3AN2B 4WU9A 3B0DC 4XUJA 1P3BB 5B0YB 3AZJA 3X1UC 3X1TA 5E5AA 5B0YD 1ID3A 3REJB 5B33C 5B2IA 2Y2LA 3MGQC 3MNNB 3W98C 3B0BA 1ZLAD 1A7WA 1BH8A 5B1MC 5B0ZB 4X23C 5B0ZD 2Y2PA 5F99B 4Z5TB 2BYKB 3AV2D 3C1BB 4EO5C 2F8NG 1F1EA 3C1BD 4HGAC 5AY8B 5B1MB 3UTAC 5AY8D 2BYMA 3W96C 1KX4B 4ZUXD 5F99C 1M19A 4ZUXB 2Y2GA 3AZFA 5AV5C 3A6NC 3MGQB 2PYOD 3B0CW 3X1VB 3RELA 3AZFC 3KUYD 4H9PB 5CPJB 2L5AA
chains in the Genus database with same CATH topology
3LJAB 1M19C 1HQ3B 2CV5D 3KSYA 3AZED 3AN2C 3W96A 3O62D 1TZYB 2AROC 3AFAA 4G92B 5KDMB 3AZFB 3TU4A 3AV1A 1P3LD 3MVDB 3F6TA 4CSRB 1M1AB 3H0LC 4KGCD 1WWSA 5B24B 5BT1C 4X23A 4DQYB 2F8NH 5B1MA 5GXQA 3WTPC 3C1CC 3AZLC 3LZ0A 4Z5TA 5B2IC 3MGQA 2FJ7A 1EQZD 1H3OB 1AOID 3AZLD 4Z66B 3W98D 3AZKD 1W2EA 4R8PB 4J8VC 5DNNA 3NQUB 5AV9C 3UTBC 5JRGD 3P5JB 5AVBA 4XZQD 4JJNB 5C3IC 5B31G 4XUJB 3MVDC 5E5AB 3KXBA 4J8WA 2CV5C 2RVQC 5B24A 5AV6D 4J8UB 2Y2HA 3REKB 3KUYC 2RVQD 4QLCA 4KUDB 5CP6D 3AZJD 5DNMB 1P3OB 4YM6B 1P3PA 1AOIC 1TZYA 2YFWB 3A6ND 5GXQB 2NQBD 1P3AC 5GT0D 1KX5C 5GT3D 5BS7C 3W97D 2HIOA 4H9NB 1M1AA 1TAFA 2NZDD 4CAYA 1U35D 2G5IC 1KX3D 2NZDB 4HGAB 5AY8C 5AV8D 1U35B 5B0ZA 1P3AB 3AZHB 3AZGC 3X1SA 1P3ID 1KX4C 3B6FA 3W96B 5GSUA 5B1LD 5B40D 4UPKA 1P34A 1P3IB 3TU4B 4LD9C 5AVCB 1M18A 4H9PA 5CPJA 4J8UC 3AN2D 2HIOB 4H9NA 5CP6C 3WAAA 1HQ3A 3AZKA 3WKJA 3R45A 5B2JD 4NE3A 4J8XC 1P3LC 5JRGA 4M6BA 4KUDA 2LY8A 5C3IB 3KXBD 4J8WD 2F8NK 3B6GB 3KXBB 4J8WB 5AV6C 2IO5B 3AZMC 4LD9D 1EQZC 5AV9B 3UTBB 1P3PB 5AVCA 3MGRA 4LD9B 1P3FD 4UUZB 2BYKA 4H9OB 2DF4C 4J8VD 1S32D 2Y2OA 3AZKC 3AZIA 1H3OA 4J8UA 5CPID 1P3GB 2Y2KA 3VH5T 1ZLAC 3LELD 1M18C 2NZDC 4CAYB 3UTAD 1P3GD 3REJD 3W99A 3MNND 1P34C 3MGQD 2PYOB 5GT0C 1KX5D 3C1BA 3X1TD 2Y2IA 2NQBC 1P3GC 3LZ1C 5AY8A 5CPJD 5B32C 3X1TB 1ZLAB 3O62C 3REKA 2G5HC 2HUEB 5BNVB 1HQ3D 5BT1D 3AZEC 3REHC 5B33B 1M19B 3KWQB 3MGPC 4YS3B 5B33D 4H9RA 3AZFD 4YS3D 1P3MD 1TZYC 1P3KD 1P3LB 4AWLB 1P3MB 4XZQC 3REHB 4YM6A 5B24D 3AZND 4E44A 3WA9A 4WV4B 1F66A 4WU9B 5B31B 1P3KC 5AVBC 4H9QB 5AV9A 3UTBA 2ZY3A 4J8VA 3AV2C 3W98B 2HUEC 3AZEB 3AZKB 3AZGB 1F66C 4Z66C 4X23D 1KX3A 3AYWB 1M18B 2YFVA 3AYWD 5CPKD 2FJ7C 4XUJD 3X1SB 3B6FB 3MNNC 4WNNA 5E5AD 3REJC 3LZ0C 3AYWC 3A1KA 3V9RB 2J8PA 3REHA 4KGCA 3IP4C 3REID 3AL0C 3W97C 5B31A 1P3FC 1AOIB 5G49B 5GXQD 3X1UB 3LZ1A 2ZY5A 4WU8D 1B67A 4WU8B 3X1UD 4H9OA 3RELD 5KDMA 1BH9A 3W99C 3WA9C 1KX3B 5B32B 3NQJA 4JJND 3AZIC 3W96D 3VH5A 4H9RB 3TU4D 3A6NA 4YS3C 5AVCC 2BG1A 2HIOD 5CP6B 1P3OD 5B1MD 5B32G 1Q9CA 5AV6A 2NQBB 3A1IA 3AYWA 3REJA 4Z2MG 2F8NB 3B6GD 5B0YA 4KUDC 4H9QA 5BO0A 5DNMA 3H0RC 3UT9A 1KX3C 1P3LA 3MGSB 4Z66A 4J8XA 3AZHD 3MGSD 4CSRA 3H0MC 3AV2A 1BH9B 1HQ3C 5B33A 2CWEA 5GT3C 1ID3C 1TAFB 4G91B 2AROB 4G92C 3AZMB 1BFMA 1P3FB 5E5AC 2CV5B 3X1UA 3LZ1B 2AROD 3AZMD 3X1TC 3X1SC 3AZGA 3B6FC 3NQUA 3B0CT 4ZBJB 5CPIB 1P3BD 3LELB 3KWQC 4R8PC 4QLCB 1S32C 2PYOC 2HIOC 5G49A 3KFUG 3MGRD 5CHLB 1P3AA 1HTAA 3MGPA 3VH6A 1P3PC 2PYOA 5F99D 5CPIA 3KWQD 4NE5A 3KUYA 5B32A 1P3GA 1P3PD 4DRAA 1P3KB 5B24C 3C1BC 3KXBC 4J8WC 5GT0A 2CV5A 5B1LA 5B40A 5B2ID 1KX4D 3C1CB 2IO5C 5JRGB 4WNNB 3LJAC 3C1CD 1P3MC 1U35A 2Y2JA 5GT3A 5DNNC 3MGSA 5B31D 3UT9C 3X1VD 1EQZA 5DNMC 4H9SC 5B0YC 3B6GC 4KUDD 3X1VC 5GSUD 4AWLC 4YM6D 4DRBA 3AZGD 1PZRA 1P34B 1M19D 5B2JA 3AZLA 3UT9B 4UUZA 3W97B 1F66D 3WKJD 3MVDD 2F8NA 3WAAB 5AV5B 5AV5D 5AV8B 5AVBD 1P3AD 5JRGC 4YS3A 3TU4C 5AVBB 3AFAC 3WKJC 3VH5W 4WU9D 3WAAC 5CP6A 1P3OA 3VH6T 3AZIB 2ZM5A 1EQZB 5BNVA 3RELC 1B6WA 5GSUC 2BYMB 1KX4A 5B0ZC 4X23B 4WU8C 3WTPD 4R8PD 5B31C 1P3FA 4G91C 3W97A 4WZSB 3W99B 1M1AC 4KGCC 3W99D 3X1SD 1P3IA 3VH6W 5BS7A 3B6FD 5FUGA 3UTAA 1AOIA 1ID3D 3MNNA 3REKD 4Z5TD 4ZUXA 3REIB 1KU5A 3AZHC 3MGPB 3LZ0B 4J8VB 3W98A 3V9RA 3LZ0D 4EO5B 3MVDA 2F8ND 3RELB 3UTAB 3AZNA 5CPKC 1P3KA 2XD1A 1BH8B 1ULYA 5BNXA 3AZJC 3AFAB 4WU9C 5BO0B 2Y2QA 3AFAD 3KUYB 3AZNC 5CPKA 5AVCD 4YM6C 2DQNC 4Z5TC 4NE6A 4XZQA 3AV2B 1TZYD 3C1CA 5GXQC 3WTPA 4JJNC 5B2JB 2YFVB 4J8XD 3AZHA 3REHD 1T3UA 4J8XB 4KHAA 1M1AD 4Z2MH 4ZUXC 3AZEA 1JFIA 4KGCB 3REKC 3O62A 3LELA 2YFWA 3AV1C 1R4VA 5AV8A 3EPKA 2NQBA 2AROA 1N1JB 3AN2A 1P3IC 5DNNB 5DNND 4E45A 2NZDA 3AZLB 1ZLAA 4Z66D 4WU8A 3LZ1D 3LJAD 5B2IB 2FJ7B 3O62B 1S32B 5AV5A 3MGRC 2FJ7D 5CPKB 1WWIA 3WTPE 2JE5A 3AZMA 4QLCD 1P3OC 5F99A 3EPHA 1P3BA 1Z2CB 2F2AC 3FDDA 1KX5B 3MGRB 5AV6B 2W8SA 2UWXA 3EPLA 5DNMD 3R45B 3UT9D 3A6NB 2VQRA 2FFFB 3WA9B 5JA4A 5B2JC 5GT3B 1P3BC 3WA9D 2Y2NA 2ZY2A 3X1VA 3EG5B 5B32D 4H9SA 3AV1B 5CPJC 3B6GA 4WJ3C 4LD9A 5FUGB 3AZNB 3AV1D 4XZQB 4XUJC 1N1JA 5B1LB 5B40B 3MGSC 3REIA 1U35C 4J8UD 5JA4B 3LJAA 1P3MA 5BNXB 4KHAB 5GSUB 3AZJB 5B1LC 5B40C 1P34D 1KX5A 3WTPB 2JCHA 4NFTA 5AV8C 5GT0B 3LELC 1M18D 1F66B 5CPIC 3WAAD 3WKJB 4QLCC 2JSSA 2ZY4A 3EPJA 4JJNA 2RIQA 2XD5A 1ID3B 3NQJB 3B0DB 1JFIB 1S32A 3AZID 4R8PA 3KWQA 5AV9D 3MGPD 3UTBD 2Y2MA 4ZBJC 3REIC 3AN2B 4WU9A 3B0DC 4XUJA 1P3BB 5B0YB 3AZJA 3X1UC 3X1TA 5E5AA 5B0YD 1ID3A 3REJB 5B33C 5B2IA 2Y2LA 3MGQC 3MNNB 3W98C 3B0BA 1ZLAD 1A7WA 1BH8A 5B1MC 5B0ZB 4X23C 5B0ZD 2Y2PA 5F99B 4Z5TB 2BYKB 3AV2D 3C1BB 4EO5C 2F8NG 1F1EA 3C1BD 4HGAC 5AY8B 5B1MB 3UTAC 5AY8D 2BYMA 3W96C 1KX4B 4ZUXD 5F99C 1M19A 4ZUXB 2Y2GA 3AZFA 5AV5C 3A6NC 3MGQB 2PYOD 3B0CW 3X1VB 3RELA 3AZFC 3KUYD 4H9PB 5CPJB 2L5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJA B;  1M19 C;  1HQ3 B;  2CV5 D;  3KSY A;  3AZE D;  3AN2 C;  3W96 A;  3O62 D;  1TZY B;  2ARO C;  3AFA A;  4G92 B;  5KDM B;  3AZF B;  3TU4 A;  3AV1 A;  1P3L D;  3MVD B;  4CSR B;  1M1A B;  4KGC D;  1WWS A;  5B24 B;  5BT1 C;  4X23 A;  2F8N H;  5B1M A;  5GXQ A;  3WTP C;  3C1C C;  3AZL C;  3LZ0 A;  4Z5T A;  5B2I C;  3MGQ A;  2FJ7 A;  1EQZ D;  1H3O B;  1AOI D;  3AZL D;  4Z66 B;  3W98 D;  3AZK D;  4R8P B;  4J8V C;  5DNN A;  3NQU B;  5AV9 C;  3UTB C;  5JRG D;  5AVB A;  4XZQ D;  4JJN B;  5C3I C;  5B31 G;  4XUJ B;  3MVD C;  5E5A B;  3KXB A;  4J8W A;  2CV5 C;  2RVQ C;  5B24 A;  5AV6 D;  4J8U B;  3REK B;  3KUY C;  2RVQ D;  4QLC A;  4KUD B;  5CP6 D;  3AZJ D;  5DNM B;  1P3O B;  4YM6 B;  1P3P A;  1AOI C;  1TZY A;  2YFW B;  3A6N D;  5GXQ B;  2NQB D;  1P3A C;  5GT0 D;  1KX5 C;  5GT3 D;  5BS7 C;  3W97 D;  2HIO A;  4H9N B;  1M1A A;  1TAF A;  2NZD D;  4CAY A;  1U35 D;  1KX3 D;  2NZD B;  4HGA B;  5AY8 C;  5AV8 D;  1U35 B;  5B0Z A;  1P3A B;  3AZH B;  3AZG C;  3X1S A;  1P3I D;  1KX4 C;  3B6F A;  3W96 B;  5GSU A;  5B1L D;  5B40 D;  1P34 A;  1P3I B;  3TU4 B;  4LD9 C;  5AVC B;  1M18 A;  4H9P A;  5CPJ A;  4J8U C;  3AN2 D;  2HIO B;  4H9N A;  5CP6 C;  3WAA A;  1HQ3 A;  3AZK A;  3WKJ A;  3R45 A;  5B2J D;  4NE3 A;  4J8X C;  1P3L C;  5JRG A;  4M6B A;  4KUD A;  2LY8 A;  5C3I B;  3KXB D;  4J8W D;  2F8N K;  3B6G B;  3KXB B;  4J8W B;  5AV6 C;  2IO5 B;  3AZM C;  4LD9 D;  1EQZ C;  5AV9 B;  3UTB B;  1P3P B;  5AVC A;  3MGR A;  4LD9 B;  1P3F D;  4UUZ B;  2BYK A;  4H9O B;  4J8V D;  1S32 D;  3AZK C;  3AZI A;  1H3O A;  4J8U A;  5CPI D;  1P3G B;  1ZLA C;  3VH5 T;  2NZD C;  3LEL D;  1M18 C;  4CAY B;  3UTA D;  1P3G D;  3REJ D;  3W99 A;  3MNN D;  1P34 C;  3MGQ D;  2PYO B;  5GT0 C;  1KX5 D;  3C1B A;  3X1T D;  2NQB C;  1P3G C;  3LZ1 C;  5AY8 A;  5CPJ D;  5B32 C;  3X1T B;  1ZLA B;  3O62 C;  3REK A;  2HUE B;  5BNV B;  1HQ3 D;  5BT1 D;  3AZE C;  3REH C;  5B33 B;  1M19 B;  3KWQ B;  3MGP C;  4YS3 B;  5B33 D;  4H9R A;  3AZF D;  4YS3 D;  1P3M D;  1TZY C;  1P3K D;  1P3L B;  4AWL B;  1P3M B;  4XZQ C;  3REH B;  4YM6 A;  5B24 D;  3AZN D;  4E44 A;  3WA9 A;  4WV4 B;  1F66 A;  4WU9 B;  5B31 B;  1P3K C;  5AVB C;  4H9Q B;  5AV9 A;  3UTB A;  3AV2 C;  4J8V A;  3W98 B;  2HUE C;  3AZE B;  3AZK B;  3AZG B;  1F66 C;  4Z66 C;  4X23 D;  1KX3 A;  3AYW B;  1M18 B;  2YFV A;  3AYW D;  5CPK D;  2FJ7 C;  4XUJ D;  3X1S B;  3B6F B;  3MNN C;  4WNN A;  5E5A D;  3REJ C;  3LZ0 C;  3AYW C;  3V9R B;  3REH A;  4KGC A;  3REI D;  3W97 C;  5B31 A;  1P3F C;  1AOI B;  5G49 B;  5GXQ D;  3X1U B;  3LZ1 A;  4WU8 D;  1B67 A;  4WU8 B;  3X1U D;  4H9O A;  3REL D;  5KDM A;  1BH9 A;  3W99 C;  3WA9 C;  1KX3 B;  5B32 B;  3NQJ A;  4JJN D;  3AZI C;  3W96 D;  3VH5 A;  4H9R B;  3TU4 D;  3A6N A;  4YS3 C;  5AVC C;  2HIO D;  5CP6 B;  1P3O D;  5B1M D;  5B32 G;  1Q9C A;  5AV6 A;  2NQB B;  3AYW A;  3REJ A;  4Z2M G;  2F8N B;  3B6G D;  5B0Y A;  4KUD C;  4H9Q A;  5BO0 A;  5DNM A;  3UT9 A;  1KX3 C;  1P3L A;  3MGS B;  4Z66 A;  4J8X A;  3AZH D;  3MGS D;  4CSR A;  3AV2 A;  1BH9 B;  1HQ3 C;  5B33 A;  2CWE A;  5GT3 C;  1ID3 C;  1TAF B;  4G91 B;  2ARO B;  4G92 C;  3AZM B;  1BFM A;  1P3F B;  5E5A C;  2CV5 B;  3X1U A;  3LZ1 B;  2ARO D;  3AZM D;  3X1T C;  3X1S C;  3AZG A;  3B6F C;  3NQU A;  3B0C T;  4ZBJ B;  5CPI B;  1P3B D;  3LEL B;  3KWQ C;  4R8P C;  4QLC B;  1S32 C;  2PYO C;  2HIO C;  5G49 A;  3MGR D;  5CHL B;  1P3A A;  1HTA A;  3MGP A;  3VH6 A;  1P3P C;  2PYO A;  5F99 D;  5CPI A;  3KWQ D;  4NE5 A;  3KUY A;  5B32 A;  1P3G A;  1P3P D;  4DRA A;  1P3K B;  5B24 C;  3C1B C;  3KXB C;  4J8W C;  5GT0 A;  2CV5 A;  5B1L A;  5B40 A;  5B2I D;  1KX4 D;  3C1C B;  2IO5 C;  5JRG B;  4WNN B;  3LJA C;  3C1C D;  1P3M C;  1U35 A;  5GT3 A;  5DNN C;  3MGS A;  5B31 D;  3UT9 C;  3X1V D;  1EQZ A;  5DNM C;  4H9S C;  5B0Y C;  3B6G C;  4KUD D;  3X1V C;  5GSU D;  4AWL C;  4YM6 D;  4DRB A;  3AZG D;  1M19 D;  1P34 B;  5B2J A;  3AZL A;  3UT9 B;  4UUZ A;  3W97 B;  1F66 D;  3WKJ D;  3MVD D;  2F8N A;  3WAA B;  5AV5 B;  5AV5 D;  5AV8 B;  5AVB D;  1P3A D;  5JRG C;  4YS3 A;  3TU4 C;  5AVB B;  3AFA C;  3WKJ C;  3VH5 W;  4WU9 D;  3WAA C;  5CP6 A;  1P3O A;  3VH6 T;  3AZI B;  1EQZ B;  5BNV A;  3REL C;  1B6W A;  5GSU C;  2BYM B;  1KX4 A;  5B0Z C;  4X23 B;  4WU8 C;  3WTP D;  4R8P D;  5B31 C;  1P3F A;  4G91 C;  3W97 A;  4WZS B;  3W99 B;  1M1A C;  4KGC C;  3W99 D;  3X1S D;  1P3I A;  3VH6 W;  5BS7 A;  3B6F D;  5FUG A;  3UTA A;  1AOI A;  1ID3 D;  3MNN A;  3REK D;  4Z5T D;  4ZUX A;  3REI B;  1KU5 A;  3AZH C;  3MGP B;  3LZ0 B;  4J8V B;  3W98 A;  3V9R A;  3LZ0 D;  4EO5 B;  3MVD A;  2F8N D;  3REL B;  3UTA B;  3AZN A;  5CPK C;  1P3K A;  1BH8 B;  1ULY A;  5BNX A;  3AZJ C;  3AFA B;  4WU9 C;  5BO0 B;  3AFA D;  3KUY B;  3AZN C;  5CPK A;  5AVC D;  4YM6 C;  4Z5T C;  4NE6 A;  4XZQ A;  3AV2 B;  1TZY D;  3C1C A;  5GXQ C;  3WTP A;  4JJN C;  5B2J B;  2YFV B;  4J8X D;  3AZH A;  3REH D;  4J8X B;  4KHA A;  1M1A D;  4Z2M H;  4ZUX C;  3AZE A;  1JFI A;  4KGC B;  3REK C;  3O62 A;  3LEL A;  2YFW A;  3AV1 C;  1R4V A;  5AV8 A;  2NQB A;  2ARO A;  1N1J B;  3AN2 A;  1P3I C;  5DNN B;  5DNN D;  4E45 A;  2NZD A;  3AZL B;  1ZLA A;  4Z66 D;  4WU8 A;  3LZ1 D;  3LJA D;  5B2I B;  2FJ7 B;  3O62 B;  1S32 B;  5AV5 A;  3MGR C;  2FJ7 D;  5CPK B;  1WWI A;  3WTP E;  3AZM A;  4QLC D;  1P3O C;  5F99 A;  1P3B A;  1KX5 B;  3MGR B;  5AV6 B;  5DNM D;  3R45 B;  3UT9 D;  3A6N B;  3WA9 B;  5JA4 A;  5B2J C;  5GT3 B;  1P3B C;  3WA9 D;  3X1V A;  5B32 D;  3AV1 B;  4H9S A;  5CPJ C;  3B6G A;  4LD9 A;  5FUG B;  3AZN B;  3AV1 D;  4XZQ B;  4XUJ C;  1N1J A;  5B1L B;  5B40 B;  3MGS C;  3REI A;  1U35 C;  4J8U D;  5JA4 B;  3LJA A;  1P3M A;  5BNX B;  4KHA B;  5GSU B;  3AZJ B;  5B1L C;  5B40 C;  1P34 D;  1KX5 A;  3WTP B;  4NFT A;  5AV8 C;  5GT0 B;  3LEL C;  1M18 D;  1F66 B;  5CPI C;  3WAA D;  3WKJ B;  4QLC C;  2JSS A;  4JJN A;  1ID3 B;  3NQJ B;  3B0D B;  1JFI B;  1S32 A;  3AZI D;  4R8P A;  3KWQ A;  5AV9 D;  3MGP D;  3UTB D;  4ZBJ C;  3REI C;  3AN2 B;  4WU9 A;  3B0D C;  4XUJ A;  1P3B B;  5B0Y B;  3AZJ A;  3X1U C;  3X1T A;  5E5A A;  5B0Y D;  1ID3 A;  3REJ B;  5B33 C;  5B2I A;  3MGQ C;  3MNN B;  3W98 C;  3B0B A;  1ZLA D;  1A7W A;  1BH8 A;  5B1M C;  5B0Z B;  4X23 C;  5B0Z D;  5F99 B;  4Z5T B;  2BYK B;  3AV2 D;  3C1B B;  4EO5 C;  2F8N G;  1F1E A;  3C1B D;  4HGA C;  5AY8 B;  5B1M B;  3UTA C;  5AY8 D;  2BYM A;  3W96 C;  1KX4 B;  4ZUX D;  5F99 C;  1M19 A;  4ZUX B;  3AZF A;  5AV5 C;  3A6N C;  3MGQ B;  2PYO D;  3B0C W;  3X1V B;  3REL A;  3AZF C;  3KUY D;  4H9P B;  5CPJ B;  2L5A A; 
#chains in the Genus database with same CATH topology
 3LJA B;  1M19 C;  1HQ3 B;  2CV5 D;  3KSY A;  3AZE D;  3AN2 C;  3W96 A;  3O62 D;  1TZY B;  2ARO C;  3AFA A;  4G92 B;  5KDM B;  3AZF B;  3TU4 A;  3AV1 A;  1P3L D;  3MVD B;  3F6T A;  4CSR B;  1M1A B;  3H0L C;  4KGC D;  1WWS A;  5B24 B;  5BT1 C;  4X23 A;  4DQY B;  2F8N H;  5B1M A;  5GXQ A;  3WTP C;  3C1C C;  3AZL C;  3LZ0 A;  4Z5T A;  5B2I C;  3MGQ A;  2FJ7 A;  1EQZ D;  1H3O B;  1AOI D;  3AZL D;  4Z66 B;  3W98 D;  3AZK D;  1W2E A;  4R8P B;  4J8V C;  5DNN A;  3NQU B;  5AV9 C;  3UTB C;  5JRG D;  3P5J B;  5AVB A;  4XZQ D;  4JJN B;  5C3I C;  5B31 G;  4XUJ B;  3MVD C;  5E5A B;  3KXB A;  4J8W A;  2CV5 C;  2RVQ C;  5B24 A;  5AV6 D;  4J8U B;  2Y2H A;  3REK B;  3KUY C;  2RVQ D;  4QLC A;  4KUD B;  5CP6 D;  3AZJ D;  5DNM B;  1P3O B;  4YM6 B;  1P3P A;  1AOI C;  1TZY A;  2YFW B;  3A6N D;  5GXQ B;  2NQB D;  1P3A C;  5GT0 D;  1KX5 C;  5GT3 D;  5BS7 C;  3W97 D;  2HIO A;  4H9N B;  1M1A A;  1TAF A;  2NZD D;  4CAY A;  1U35 D;  2G5I C;  1KX3 D;  2NZD B;  4HGA B;  5AY8 C;  5AV8 D;  1U35 B;  5B0Z A;  1P3A B;  3AZH B;  3AZG C;  3X1S A;  1P3I D;  1KX4 C;  3B6F A;  3W96 B;  5GSU A;  5B1L D;  5B40 D;  4UPK A;  1P34 A;  1P3I B;  3TU4 B;  4LD9 C;  5AVC B;  1M18 A;  4H9P A;  5CPJ A;  4J8U C;  3AN2 D;  2HIO B;  4H9N A;  5CP6 C;  3WAA A;  1HQ3 A;  3AZK A;  3WKJ A;  3R45 A;  5B2J D;  4NE3 A;  4J8X C;  1P3L C;  5JRG A;  4M6B A;  4KUD A;  2LY8 A;  5C3I B;  3KXB D;  4J8W D;  2F8N K;  3B6G B;  3KXB B;  4J8W B;  5AV6 C;  2IO5 B;  3AZM C;  4LD9 D;  1EQZ C;  5AV9 B;  3UTB B;  1P3P B;  5AVC A;  3MGR A;  4LD9 B;  1P3F D;  4UUZ B;  2BYK A;  4H9O B;  2DF4 C;  4J8V D;  1S32 D;  2Y2O A;  3AZK C;  3AZI A;  1H3O A;  4J8U A;  5CPI D;  1P3G B;  2Y2K A;  3VH5 T;  1ZLA C;  3LEL D;  1M18 C;  2NZD C;  4CAY B;  3UTA D;  1P3G D;  3REJ D;  3W99 A;  3MNN D;  1P34 C;  3MGQ D;  2PYO B;  5GT0 C;  1KX5 D;  3C1B A;  3X1T D;  2Y2I A;  2NQB C;  1P3G C;  3LZ1 C;  5AY8 A;  5CPJ D;  5B32 C;  3X1T B;  1ZLA B;  3O62 C;  3REK A;  2G5H C;  2HUE B;  5BNV B;  1HQ3 D;  5BT1 D;  3AZE C;  3REH C;  5B33 B;  1M19 B;  3KWQ B;  3MGP C;  4YS3 B;  5B33 D;  4H9R A;  3AZF D;  4YS3 D;  1P3M D;  1TZY C;  1P3K D;  1P3L B;  4AWL B;  1P3M B;  4XZQ C;  3REH B;  4YM6 A;  5B24 D;  3AZN D;  4E44 A;  3WA9 A;  4WV4 B;  1F66 A;  4WU9 B;  5B31 B;  1P3K C;  5AVB C;  4H9Q B;  5AV9 A;  3UTB A;  2ZY3 A;  4J8V A;  3AV2 C;  3W98 B;  2HUE C;  3AZE B;  3AZK B;  3AZG B;  1F66 C;  4Z66 C;  4X23 D;  1KX3 A;  3AYW B;  1M18 B;  2YFV A;  3AYW D;  5CPK D;  2FJ7 C;  4XUJ D;  3X1S B;  3B6F B;  3MNN C;  4WNN A;  5E5A D;  3REJ C;  3LZ0 C;  3AYW C;  3A1K A;  3V9R B;  2J8P A;  3REH A;  4KGC A;  3IP4 C;  3REI D;  3AL0 C;  3W97 C;  5B31 A;  1P3F C;  1AOI B;  5G49 B;  5GXQ D;  3X1U B;  3LZ1 A;  2ZY5 A;  4WU8 D;  1B67 A;  4WU8 B;  3X1U D;  4H9O A;  3REL D;  5KDM A;  1BH9 A;  3W99 C;  3WA9 C;  1KX3 B;  5B32 B;  3NQJ A;  4JJN D;  3AZI C;  3W96 D;  3VH5 A;  4H9R B;  3TU4 D;  3A6N A;  4YS3 C;  5AVC C;  2BG1 A;  2HIO D;  5CP6 B;  1P3O D;  5B1M D;  5B32 G;  1Q9C A;  5AV6 A;  2NQB B;  3A1I A;  3AYW A;  3REJ A;  4Z2M G;  2F8N B;  3B6G D;  5B0Y A;  4KUD C;  4H9Q A;  5BO0 A;  5DNM A;  3H0R C;  3UT9 A;  1KX3 C;  1P3L A;  3MGS B;  4Z66 A;  4J8X A;  3AZH D;  3MGS D;  4CSR A;  3H0M C;  3AV2 A;  1BH9 B;  1HQ3 C;  5B33 A;  2CWE A;  5GT3 C;  1ID3 C;  1TAF B;  4G91 B;  2ARO B;  4G92 C;  3AZM B;  1BFM A;  1P3F B;  5E5A C;  2CV5 B;  3X1U A;  3LZ1 B;  2ARO D;  3AZM D;  3X1T C;  3X1S C;  3AZG A;  3B6F C;  3NQU A;  3B0C T;  4ZBJ B;  5CPI B;  1P3B D;  3LEL B;  3KWQ C;  4R8P C;  4QLC B;  1S32 C;  2PYO C;  2HIO C;  5G49 A;  3KFU G;  3MGR D;  5CHL B;  1P3A A;  1HTA A;  3MGP A;  3VH6 A;  1P3P C;  2PYO A;  5F99 D;  5CPI A;  3KWQ D;  4NE5 A;  3KUY A;  5B32 A;  1P3G A;  1P3P D;  4DRA A;  1P3K B;  5B24 C;  3C1B C;  3KXB C;  4J8W C;  5GT0 A;  2CV5 A;  5B1L A;  5B40 A;  5B2I D;  1KX4 D;  3C1C B;  2IO5 C;  5JRG B;  4WNN B;  3LJA C;  3C1C D;  1P3M C;  1U35 A;  2Y2J A;  5GT3 A;  5DNN C;  3MGS A;  5B31 D;  3UT9 C;  3X1V D;  1EQZ A;  5DNM C;  4H9S C;  5B0Y C;  3B6G C;  4KUD D;  3X1V C;  5GSU D;  4AWL C;  4YM6 D;  4DRB A;  3AZG D;  1PZR A;  1P34 B;  1M19 D;  5B2J A;  3AZL A;  3UT9 B;  4UUZ A;  3W97 B;  1F66 D;  3WKJ D;  3MVD D;  2F8N A;  3WAA B;  5AV5 B;  5AV5 D;  5AV8 B;  5AVB D;  1P3A D;  5JRG C;  4YS3 A;  3TU4 C;  5AVB B;  3AFA C;  3WKJ C;  3VH5 W;  4WU9 D;  3WAA C;  5CP6 A;  1P3O A;  3VH6 T;  3AZI B;  2ZM5 A;  1EQZ B;  5BNV A;  3REL C;  1B6W A;  5GSU C;  2BYM B;  1KX4 A;  5B0Z C;  4X23 B;  4WU8 C;  3WTP D;  4R8P D;  5B31 C;  1P3F A;  4G91 C;  3W97 A;  4WZS B;  3W99 B;  1M1A C;  4KGC C;  3W99 D;  3X1S D;  1P3I A;  3VH6 W;  5BS7 A;  3B6F D;  5FUG A;  3UTA A;  1AOI A;  1ID3 D;  3MNN A;  3REK D;  4Z5T D;  4ZUX A;  3REI B;  1KU5 A;  3AZH C;  3MGP B;  3LZ0 B;  4J8V B;  3W98 A;  3V9R A;  3LZ0 D;  4EO5 B;  3MVD A;  2F8N D;  3REL B;  3UTA B;  3AZN A;  5CPK C;  1P3K A;  2XD1 A;  1BH8 B;  1ULY A;  5BNX A;  3AZJ C;  3AFA B;  4WU9 C;  5BO0 B;  2Y2Q A;  3AFA D;  3KUY B;  3AZN C;  5CPK A;  5AVC D;  4YM6 C;  2DQN C;  4Z5T C;  4NE6 A;  4XZQ A;  3AV2 B;  1TZY D;  3C1C A;  5GXQ C;  3WTP A;  4JJN C;  5B2J B;  2YFV B;  4J8X D;  3AZH A;  3REH D;  1T3U A;  4J8X B;  4KHA A;  1M1A D;  4Z2M H;  4ZUX C;  3AZE A;  1JFI A;  4KGC B;  3REK C;  3O62 A;  3LEL A;  2YFW A;  3AV1 C;  1R4V A;  5AV8 A;  3EPK A;  2NQB A;  2ARO A;  1N1J B;  3AN2 A;  1P3I C;  5DNN B;  5DNN D;  4E45 A;  2NZD A;  3AZL B;  1ZLA A;  4Z66 D;  4WU8 A;  3LZ1 D;  3LJA D;  5B2I B;  2FJ7 B;  3O62 B;  1S32 B;  5AV5 A;  3MGR C;  2FJ7 D;  5CPK B;  1WWI A;  3WTP E;  2JE5 A;  3AZM A;  4QLC D;  1P3O C;  5F99 A;  3EPH A;  1P3B A;  1Z2C B;  2F2A C;  3FDD A;  1KX5 B;  3MGR B;  5AV6 B;  2W8S A;  2UWX A;  3EPL A;  5DNM D;  3R45 B;  3UT9 D;  3A6N B;  2VQR A;  2FFF B;  3WA9 B;  5JA4 A;  5B2J C;  5GT3 B;  1P3B C;  3WA9 D;  2Y2N A;  2ZY2 A;  3X1V A;  3EG5 B;  5B32 D;  4H9S A;  3AV1 B;  5CPJ C;  3B6G A;  4WJ3 C;  4LD9 A;  5FUG B;  3AZN B;  3AV1 D;  4XZQ B;  4XUJ C;  1N1J A;  5B1L B;  5B40 B;  3MGS C;  3REI A;  1U35 C;  4J8U D;  5JA4 B;  3LJA A;  1P3M A;  5BNX B;  4KHA B;  5GSU B;  3AZJ B;  5B1L C;  5B40 C;  1P34 D;  1KX5 A;  3WTP B;  2JCH A;  4NFT A;  5AV8 C;  5GT0 B;  3LEL C;  1M18 D;  1F66 B;  5CPI C;  3WAA D;  3WKJ B;  4QLC C;  2JSS A;  2ZY4 A;  3EPJ A;  4JJN A;  2RIQ A;  2XD5 A;  1ID3 B;  3NQJ B;  3B0D B;  1JFI B;  1S32 A;  3AZI D;  4R8P A;  3KWQ A;  5AV9 D;  3MGP D;  3UTB D;  2Y2M A;  4ZBJ C;  3REI C;  3AN2 B;  4WU9 A;  3B0D C;  4XUJ A;  1P3B B;  5B0Y B;  3AZJ A;  3X1U C;  3X1T A;  5E5A A;  5B0Y D;  1ID3 A;  3REJ B;  5B33 C;  5B2I A;  2Y2L A;  3MGQ C;  3MNN B;  3W98 C;  3B0B A;  1ZLA D;  1A7W A;  1BH8 A;  5B1M C;  5B0Z B;  4X23 C;  5B0Z D;  2Y2P A;  5F99 B;  4Z5T B;  2BYK B;  3AV2 D;  3C1B B;  4EO5 C;  2F8N G;  1F1E A;  3C1B D;  4HGA C;  5AY8 B;  5B1M B;  3UTA C;  5AY8 D;  2BYM A;  3W96 C;  1KX4 B;  4ZUX D;  5F99 C;  1M19 A;  4ZUX B;  2Y2G A;  3AZF A;  5AV5 C;  3A6N C;  3MGQ B;  2PYO D;  3B0C W;  3X1V B;  3REL A;  3AZF C;  3KUY D;  4H9P B;  5CPJ B;  2L5A A; 
#chains in the Genus database with same CATH homology
 3LJA B;  1M19 C;  1HQ3 B;  2CV5 D;  3KSY A;  3AZE D;  3AN2 C;  3W96 A;  3O62 D;  1TZY B;  2ARO C;  3AFA A;  4G92 B;  5KDM B;  3AZF B;  3TU4 A;  3AV1 A;  1P3L D;  3MVD B;  3F6T A;  4CSR B;  1M1A B;  3H0L C;  4KGC D;  1WWS A;  5B24 B;  5BT1 C;  4X23 A;  4DQY B;  2F8N H;  5B1M A;  5GXQ A;  3WTP C;  3C1C C;  3AZL C;  3LZ0 A;  4Z5T A;  5B2I C;  3MGQ A;  2FJ7 A;  1EQZ D;  1H3O B;  1AOI D;  3AZL D;  4Z66 B;  3W98 D;  3AZK D;  1W2E A;  4R8P B;  4J8V C;  5DNN A;  3NQU B;  5AV9 C;  3UTB C;  5JRG D;  3P5J B;  5AVB A;  4XZQ D;  4JJN B;  5C3I C;  5B31 G;  4XUJ B;  3MVD C;  5E5A B;  3KXB A;  4J8W A;  2CV5 C;  2RVQ C;  5B24 A;  5AV6 D;  4J8U B;  2Y2H A;  3REK B;  3KUY C;  2RVQ D;  4QLC A;  4KUD B;  5CP6 D;  3AZJ D;  5DNM B;  1P3O B;  4YM6 B;  1P3P A;  1AOI C;  1TZY A;  2YFW B;  3A6N D;  5GXQ B;  2NQB D;  1P3A C;  5GT0 D;  1KX5 C;  5GT3 D;  5BS7 C;  3W97 D;  2HIO A;  4H9N B;  1M1A A;  1TAF A;  2NZD D;  4CAY A;  1U35 D;  2G5I C;  1KX3 D;  2NZD B;  4HGA B;  5AY8 C;  5AV8 D;  1U35 B;  5B0Z A;  1P3A B;  3AZH B;  3AZG C;  3X1S A;  1P3I D;  1KX4 C;  3B6F A;  3W96 B;  5GSU A;  5B1L D;  5B40 D;  4UPK A;  1P34 A;  1P3I B;  3TU4 B;  4LD9 C;  5AVC B;  1M18 A;  4H9P A;  5CPJ A;  4J8U C;  3AN2 D;  2HIO B;  4H9N A;  5CP6 C;  3WAA A;  1HQ3 A;  3AZK A;  3WKJ A;  3R45 A;  5B2J D;  4NE3 A;  4J8X C;  1P3L C;  5JRG A;  4M6B A;  4KUD A;  2LY8 A;  5C3I B;  3KXB D;  4J8W D;  2F8N K;  3B6G B;  3KXB B;  4J8W B;  5AV6 C;  2IO5 B;  3AZM C;  4LD9 D;  1EQZ C;  5AV9 B;  3UTB B;  1P3P B;  5AVC A;  3MGR A;  4LD9 B;  1P3F D;  4UUZ B;  2BYK A;  4H9O B;  2DF4 C;  4J8V D;  1S32 D;  2Y2O A;  3AZK C;  3AZI A;  1H3O A;  4J8U A;  5CPI D;  1P3G B;  2Y2K A;  3VH5 T;  1ZLA C;  3LEL D;  1M18 C;  2NZD C;  4CAY B;  3UTA D;  1P3G D;  3REJ D;  3W99 A;  3MNN D;  1P34 C;  3MGQ D;  2PYO B;  5GT0 C;  1KX5 D;  3C1B A;  3X1T D;  2Y2I A;  2NQB C;  1P3G C;  3LZ1 C;  5AY8 A;  5CPJ D;  5B32 C;  3X1T B;  1ZLA B;  3O62 C;  3REK A;  2G5H C;  2HUE B;  5BNV B;  1HQ3 D;  5BT1 D;  3AZE C;  3REH C;  5B33 B;  1M19 B;  3KWQ B;  3MGP C;  4YS3 B;  5B33 D;  4H9R A;  3AZF D;  4YS3 D;  1P3M D;  1TZY C;  1P3K D;  1P3L B;  4AWL B;  1P3M B;  4XZQ C;  3REH B;  4YM6 A;  5B24 D;  3AZN D;  4E44 A;  3WA9 A;  4WV4 B;  1F66 A;  4WU9 B;  5B31 B;  1P3K C;  5AVB C;  4H9Q B;  5AV9 A;  3UTB A;  2ZY3 A;  4J8V A;  3AV2 C;  3W98 B;  2HUE C;  3AZE B;  3AZK B;  3AZG B;  1F66 C;  4Z66 C;  4X23 D;  1KX3 A;  3AYW B;  1M18 B;  2YFV A;  3AYW D;  5CPK D;  2FJ7 C;  4XUJ D;  3X1S B;  3B6F B;  3MNN C;  4WNN A;  5E5A D;  3REJ C;  3LZ0 C;  3AYW C;  3A1K A;  3V9R B;  2J8P A;  3REH A;  4KGC A;  3IP4 C;  3REI D;  3AL0 C;  3W97 C;  5B31 A;  1P3F C;  1AOI B;  5G49 B;  5GXQ D;  3X1U B;  3LZ1 A;  2ZY5 A;  4WU8 D;  1B67 A;  4WU8 B;  3X1U D;  4H9O A;  3REL D;  5KDM A;  1BH9 A;  3W99 C;  3WA9 C;  1KX3 B;  5B32 B;  3NQJ A;  4JJN D;  3AZI C;  3W96 D;  3VH5 A;  4H9R B;  3TU4 D;  3A6N A;  4YS3 C;  5AVC C;  2BG1 A;  2HIO D;  5CP6 B;  1P3O D;  5B1M D;  5B32 G;  1Q9C A;  5AV6 A;  2NQB B;  3A1I A;  3AYW A;  3REJ A;  4Z2M G;  2F8N B;  3B6G D;  5B0Y A;  4KUD C;  4H9Q A;  5BO0 A;  5DNM A;  3H0R C;  3UT9 A;  1KX3 C;  1P3L A;  3MGS B;  4Z66 A;  4J8X A;  3AZH D;  3MGS D;  4CSR A;  3H0M C;  3AV2 A;  1BH9 B;  1HQ3 C;  5B33 A;  2CWE A;  5GT3 C;  1ID3 C;  1TAF B;  4G91 B;  2ARO B;  4G92 C;  3AZM B;  1BFM A;  1P3F B;  5E5A C;  2CV5 B;  3X1U A;  3LZ1 B;  2ARO D;  3AZM D;  3X1T C;  3X1S C;  3AZG A;  3B6F C;  3NQU A;  3B0C T;  4ZBJ B;  5CPI B;  1P3B D;  3LEL B;  3KWQ C;  4R8P C;  4QLC B;  1S32 C;  2PYO C;  2HIO C;  5G49 A;  3KFU G;  3MGR D;  5CHL B;  1P3A A;  1HTA A;  3MGP A;  3VH6 A;  1P3P C;  2PYO A;  5F99 D;  5CPI A;  3KWQ D;  4NE5 A;  3KUY A;  5B32 A;  1P3G A;  1P3P D;  4DRA A;  1P3K B;  5B24 C;  3C1B C;  3KXB C;  4J8W C;  5GT0 A;  2CV5 A;  5B1L A;  5B40 A;  5B2I D;  1KX4 D;  3C1C B;  2IO5 C;  5JRG B;  4WNN B;  3LJA C;  3C1C D;  1P3M C;  1U35 A;  2Y2J A;  5GT3 A;  5DNN C;  3MGS A;  5B31 D;  3UT9 C;  3X1V D;  1EQZ A;  5DNM C;  4H9S C;  5B0Y C;  3B6G C;  4KUD D;  3X1V C;  5GSU D;  4AWL C;  4YM6 D;  4DRB A;  3AZG D;  1PZR A;  1P34 B;  1M19 D;  5B2J A;  3AZL A;  3UT9 B;  4UUZ A;  3W97 B;  1F66 D;  3WKJ D;  3MVD D;  2F8N A;  3WAA B;  5AV5 B;  5AV5 D;  5AV8 B;  5AVB D;  1P3A D;  5JRG C;  4YS3 A;  3TU4 C;  5AVB B;  3AFA C;  3WKJ C;  3VH5 W;  4WU9 D;  3WAA C;  5CP6 A;  1P3O A;  3VH6 T;  3AZI B;  2ZM5 A;  1EQZ B;  5BNV A;  3REL C;  1B6W A;  5GSU C;  2BYM B;  1KX4 A;  5B0Z C;  4X23 B;  4WU8 C;  3WTP D;  4R8P D;  5B31 C;  1P3F A;  4G91 C;  3W97 A;  4WZS B;  3W99 B;  1M1A C;  4KGC C;  3W99 D;  3X1S D;  1P3I A;  3VH6 W;  5BS7 A;  3B6F D;  5FUG A;  3UTA A;  1AOI A;  1ID3 D;  3MNN A;  3REK D;  4Z5T D;  4ZUX A;  3REI B;  1KU5 A;  3AZH C;  3MGP B;  3LZ0 B;  4J8V B;  3W98 A;  3V9R A;  3LZ0 D;  4EO5 B;  3MVD A;  2F8N D;  3REL B;  3UTA B;  3AZN A;  5CPK C;  1P3K A;  2XD1 A;  1BH8 B;  1ULY A;  5BNX A;  3AZJ C;  3AFA B;  4WU9 C;  5BO0 B;  2Y2Q A;  3AFA D;  3KUY B;  3AZN C;  5CPK A;  5AVC D;  4YM6 C;  2DQN C;  4Z5T C;  4NE6 A;  4XZQ A;  3AV2 B;  1TZY D;  3C1C A;  5GXQ C;  3WTP A;  4JJN C;  5B2J B;  2YFV B;  4J8X D;  3AZH A;  3REH D;  1T3U A;  4J8X B;  4KHA A;  1M1A D;  4Z2M H;  4ZUX C;  3AZE A;  1JFI A;  4KGC B;  3REK C;  3O62 A;  3LEL A;  2YFW A;  3AV1 C;  1R4V A;  5AV8 A;  3EPK A;  2NQB A;  2ARO A;  1N1J B;  3AN2 A;  1P3I C;  5DNN B;  5DNN D;  4E45 A;  2NZD A;  3AZL B;  1ZLA A;  4Z66 D;  4WU8 A;  3LZ1 D;  3LJA D;  5B2I B;  2FJ7 B;  3O62 B;  1S32 B;  5AV5 A;  3MGR C;  2FJ7 D;  5CPK B;  1WWI A;  3WTP E;  2JE5 A;  3AZM A;  4QLC D;  1P3O C;  5F99 A;  3EPH A;  1P3B A;  1Z2C B;  2F2A C;  3FDD A;  1KX5 B;  3MGR B;  5AV6 B;  2W8S A;  2UWX A;  3EPL A;  5DNM D;  3R45 B;  3UT9 D;  3A6N B;  2VQR A;  2FFF B;  3WA9 B;  5JA4 A;  5B2J C;  5GT3 B;  1P3B C;  3WA9 D;  2Y2N A;  2ZY2 A;  3X1V A;  3EG5 B;  5B32 D;  4H9S A;  3AV1 B;  5CPJ C;  3B6G A;  4WJ3 C;  4LD9 A;  5FUG B;  3AZN B;  3AV1 D;  4XZQ B;  4XUJ C;  1N1J A;  5B1L B;  5B40 B;  3MGS C;  3REI A;  1U35 C;  4J8U D;  5JA4 B;  3LJA A;  1P3M A;  5BNX B;  4KHA B;  5GSU B;  3AZJ B;  5B1L C;  5B40 C;  1P34 D;  1KX5 A;  3WTP B;  2JCH A;  4NFT A;  5AV8 C;  5GT0 B;  3LEL C;  1M18 D;  1F66 B;  5CPI C;  3WAA D;  3WKJ B;  4QLC C;  2JSS A;  2ZY4 A;  3EPJ A;  4JJN A;  2RIQ A;  2XD5 A;  1ID3 B;  3NQJ B;  3B0D B;  1JFI B;  1S32 A;  3AZI D;  4R8P A;  3KWQ A;  5AV9 D;  3MGP D;  3UTB D;  2Y2M A;  4ZBJ C;  3REI C;  3AN2 B;  4WU9 A;  3B0D C;  4XUJ A;  1P3B B;  5B0Y B;  3AZJ A;  3X1U C;  3X1T A;  5E5A A;  5B0Y D;  1ID3 A;  3REJ B;  5B33 C;  5B2I A;  2Y2L A;  3MGQ C;  3MNN B;  3W98 C;  3B0B A;  1ZLA D;  1A7W A;  1BH8 A;  5B1M C;  5B0Z B;  4X23 C;  5B0Z D;  2Y2P A;  5F99 B;  4Z5T B;  2BYK B;  3AV2 D;  3C1B B;  4EO5 C;  2F8N G;  1F1E A;  3C1B D;  4HGA C;  5AY8 B;  5B1M B;  3UTA C;  5AY8 D;  2BYM A;  3W96 C;  1KX4 B;  4ZUX D;  5F99 C;  1M19 A;  4ZUX B;  2Y2G A;  3AZF A;  5AV5 C;  3A6N C;  3MGQ B;  2PYO D;  3B0C W;  3X1V B;  3REL A;  3AZF C;  3KUY D;  4H9P B;  5CPJ B;  2L5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...