4R8PB

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 24
structure length 86
sequence length 86
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pB00
5CP6C 2L5AA 3C1BC 4G92B 4WU8A 5CPJD 5GT0A 4QLCB 1P3OB 5C3IC 1S32A 3MGPA 1M1AB 5JRGD 4H9OA 3REIC 4CAYA 3AYWB 5B33B 5CP6B 3C1BB 3AZKC 3KXBD 4WNNB 1HQ3C 1BH8B 3AZHD 3AN2C 3REKD 4G91B 3AZFD 4JJNC 1P3KA 4ZUXD 5JRGA 3AZKB 3AZNC 1M1AA 1P3MD 2PYOB 3X1TD 3TU4D 3X1VC 4KGCC 3AYWA 3AZGB 5B33A 4KHAA 5GXQC 1H3OB 5BNVA 1KX4D 5BO0A 3AN2B 1M18C 4JJNB 3AZHA 3AZJD 3AZEC 3AZNB 3REKA 4H9SC 5E5AD 4YM6D 3AZFA 4KGCB 3X1VB 2AROD 5CPIB 1P3MA 2NQBD 5B0YB 3KUYD 2YFVA 3TU4A 5AY8D 4XUJC 5AV6D 1KX4A 3NQJB 3WTPC 3X1SD 2CWEA 3B0BA 3LELC 3AZJA 1ZLAB 4E45A 4AWLC 2RVQD 5E5AA 4YM6A 3UTBC 4J8VA 4LD9C 4E44A 5AV8C 5DNND 3WTPE 3W97D 2NQBA 3KUYA 4XUJB 4DRBA 5B1MD 3A6NB 3WTPB 3MGSC 5BT1D 3LJAB 3WA9C 5AV6A 1P3LC 5AVCB 3X1SA 5B24A 3LELB 3MNNC 4J8WD 3AFAD 3UTAB 2IO5C 1WWIA 5G49B 5DNMD 3REHD 4LD9B 5AV8B 5B2JB 4NE5A 3AZIC 3RELB 4H9NA 3B6FD 3MGSB 2BYMA 2F8NG 3WKJC 5BS7C 3WA9B 1P3GB 1P3PD 1P3LB 3O62D 2FJ7D 5B31B 3MNNB 5AV9C 1TAFA 1EQZC 4J8WA 3W99D 4X23D 3AFAA 3AZIB 1P3AC 5B40A 5DNMA 3REHA 1P34A 3X1UD 5CPKA 1KX3B 3B6GD 3MVDC 1WWSA 5GT3C 4YS3D 3B6FA 3NQUB 3LZ1C 1P3BD 5AV9B 1P3PA 1P3FD 3O62A 4J8UC 2FJ7A 5AV5C 4H9RA 1P3AB 4KUDC 5GSUC 5F99D 1M19B 3LZ0C 3W99A 4X23A 5GT3B 1R4VA 3C1CB 3X1UA 2HUEB 3B6GA 3VH5T 4YS3A 4Z5TD 1A7WA 3AZMA 5B2IC 3W98C 1KX5D 4R8PC 1P3BA 1P3FA 3REJA 1F66B 1U35D 4KUDB 5GSUB 3LZ0B 1B6WA 4J8XD 1F1EA 5F99A 4WU8D 2CV5A 3MGQA 1ID3C 4DRAA 5B32C 5B2IB 3W96D 2NZDB 3AZLC 1B67A 3MGPD 5FUGB 4Z5TA 5B1LC 5GT0C 2HIOD 3VH6T 1S32C 1U35A 1ID3B 4J8XA 4WU9C 5B32B 3AV1C 3AZLB 1HTAA 5B1LB 4XZQC 4WZSB 3W96A 4QLCD 1P3IB 2BYKB 1P3KD 5CPJC 5B0ZB 5FUGA 1M1AD 4WV4B 3MGRC 3WAAC 5JA4A 3B0CT 2HIOA 4WU9B 3AYWD 5B33D 5CP6D 3C1BD 3AV1B 3V9RB 5JRGC 5C3IB 3KXBC 1JFIB 5CPJB 4QLCA 3REIB 1P3OA 4Z66C 3MGRB 3WAAB 1P3IA 1BH9B 3AZHC 5BNXB 3AZKD 1HQ3B 2PYOD 5AVBC 3AZFC 5CP6A 3C1BA 4ZUXC 1ULYA 3AZGD 4WNNA 1P3MC 3X1TC 3TU4C 1BH8A 4Z66B 3AN2D 4H9QB 4JJND 3R45B 3AZND 4J8VD 4KGCD 3X1VD 5AVBB 5GXQB 4ZUXB 3AZKA 5CPID 5B0YD 2PYOA 5E5AC 3X1TB 1M18B 2AROC 3AZGA 1H3OA 2NQBC 5B24D 3KUYC 3AZEB 3AN2A 5AY8C 4JJNA 4NFTA 5AV6C 2JSSA 3AZNA 1ZLAD 3X1SC 3R45A 4CSRB 4KGCA 3X1VA 5CPIA 4HGAC 5B0YA 5GXQA 4XUJD 2RVQC 3A6ND 3WTPD 3LJAD 5DNNC 3W97C 5AY8B 3NQJA 4H9PB 4AWLB 5B1MC 5AVCD 3UTBB 3LELD 5B40D 4H9SA 5BT1C 3UTAD 1P34D 5CPKD 4LD9D 5B2JD 5AV8D 1ZLAA 4NE3A 3RELD 4J8WC 3AFAC 3KWQC 5DNNB 3W97B 1P3GD 4XUJA 3A6NA 3WTPA 2IO5B 5B31D 3B6FC 3LJAA 1P3PC 5AVCA 3LELA 2FJ7C 3UTAA 3AZID 3UTBA 5G49A 4LD9A 3AV2C 5B2JA 5AV8A 3B0DC 3KWQB 3AZMD 1KX3D 2F8NB 3WKJB 3RELA 3W99C 3MGSA 3X1UC 3REJD 1TZYC 3WA9A 1P3GA 1P3LA 4YS3C 1EQZB 5B31A 3MNNA 3MVDB 3MGQD 3AV2B 2CV5D 3B0DB 1M19D 5GT3D 3AZIA 3LZ1B 3C1CD 4UUZB 3VH5W 1KX3A 3UT9C 1AOIC 1TZYB 1Q9CA 4J8UB 5AV5B 5KDMB 3NQUA 5AV9A 4Z5TC 1F66D 4KUDD 3LZ0D 1KX5C 1P3AA 1M19A 1U35C 3UT9B 1AOIB 5GT3A 3W98B 3C1CA 4R8PB 4J8XC 2NZDD 4WU8C 1KX5B 3VH6W 3MGPC 1F66A 4KUDA 5GSUA 1N1JB 3LZ0A 3AZLD 4WU8B 4Z2MH 5GT0B 1P3OD 5B1LD 5B2IA 3W98A 2NZDA 1P3ID 1S32B 3KSYA 4NE6A 3VH5A 5B0ZD 2LY8A 3B0CW 4H9OB 1P3KC 1KU5A 4CAYB 1M1AC 1BFMA 4XZQB 1ID3A 4Z2MG 5B32A 3AYWC 5B33C 3AZLA 5B1LA 3REID 2BYKA 3MGRD 3WAAD 1P3KB 5B0ZA 5JRGB 3REKC 1HQ3D 4WU9A 4G91C 3VH6A 3AV1A 3KXBB 4KHAB 3V9RA 5BNVB 5BO0B 4XZQA 2PYOC 4Z66D 3AZHB 3AZGC 1KX4C 1JFIA 5CPJA 4EO5C 3REIA 3MGRA 3REKB 3WAAA 3AZFB 1BH9A 5AVBD 3AZJC 5BNXA 5GXQD 1P3MB 1HQ3A 4YM6C 2YFWB 2YFVB 3TU4B 4J8VC 1M18D 5CPIC 1KX4B 3KXBA 5B0YC 3AZED 4EO5B 4Z66A 4H9QA 2F8NK 5B24C 3AZJB 5E5AB 4YM6B 4J8VB 2AROB 5AVBA 4ZUXA 2NQBB 3KUYB 1ZLAC 3X1TA 2YFWA 1M18A 5AV6B 3AZEA 3X1SB 5B24B 3A6NC 3UTBD 3LJAC 4HGAB 5AVCC 4H9NB 3MGSD 4CSRA 5DNMC 3REHC 3UTAC 5B40C 1P34C 2BYMB 5CPKC 3WA9D 2AROA 5B2JC 1P3LD 5B1MB 3RELC 3MNND 2F8NH 5AY8A 1TAFB 3O62C 4H9PA 1P3GC 4ZBJC 5B31G 4J8WB 3AFAB 5B31C 5B40B 5DNMB 3REHB 1P34B 5CPKB 3KWQD 2F8ND 3WKJD 4X23C 4M6BA 3B6FB 3B6GC 5AV9D 5DNNA 3W97A 3AZMC 1P3PB 1KX3C 3O62B 1EQZD 2FJ7B 4ZBJB 5B1MA 1P3BC 4H9RB 1P3AD 1P3FC 3REJC 3MVDD 3AV2D 3W99B 4X23B 3LZ1D 5F99C 3X1UB 2F8NA 5BS7A 3KWQA 3B6GB 2CV5C 3MGQC 3WKJA 4YS3B 1M19C 3AZMB 1TZYD 4J8UD 5AV5D 3C1CC 1P3BB 2HUEC 5GSUD 1P3FB 3REJB 1EQZA 5F99B 3MVDA 3AV2A 1F66C 2CV5B 3MGQB 3UT9D 1AOID 5B2ID 3W98D 3LZ1A 4R8PD 4UUZA 4Z5TB 1TZYA 5CHLB 4J8UA 5AV5A 3W96C 5KDMA 2NZDC 1U35B 1ID3D 2HIOC 4J8XB 5B32D 3UT9A 1AOIA 5GT0D 4R8PA 3W96B 5B32G 4G92C 3MGPB 1S32D 4QLCC 1P3OC 4WU9D 5JA4B 2HIOB 1P3IC 1KX5A 3AV1D 1N1JA 5B0ZC 4XZQD
chains in the Genus database with same CATH superfamily
5CP6C 2L5AA 3C1BC 4G92B 4WU8A 5CPJD 5GT0A 4QLCB 1P3OB 5C3IC 1S32A 3MGPA 2Y2NA 1M1AB 5JRGD 4H9OA 3REIC 4CAYA 3AYWB 5B33B 5CP6B 3C1BB 4WJ3C 3AZKC 3KXBD 4WNNB 1HQ3C 1BH8B 3AZHD 2FFFB 3AN2C 3REKD 4G91B 3AZFD 4JJNC 1P3KA 4ZUXD 5JRGA 3AZKB 3AZNC 1M1AA 1P3MD 2PYOB 3X1TD 3TU4D 3X1VC 4KGCC 3AYWA 3AZGB 5B33A 4KHAA 5GXQC 1H3OB 5BNVA 1KX4D 5BO0A 3AN2B 1M18C 4JJNB 3AZHA 3AZJD 3AZEC 3AZNB 3REKA 4H9SC 2Y2GA 5E5AD 4YM6D 3AZFA 4KGCB 3X1VB 2AROD 5CPIB 1P3MA 2NQBD 5B0YB 3KUYD 2YFVA 3TU4A 2DQNC 5AY8D 4XUJC 5AV6D 1KX4A 3NQJB 3WTPC 3X1SD 2CWEA 3B0BA 3LELC 3AZJA 1ZLAB 4E45A 4AWLC 2JE5A 2RVQD 5E5AA 4YM6A 3UTBC 4J8VA 4LD9C 4E44A 5AV8C 4UPKA 5DNND 3WTPE 2NQBA 3W97D 3KUYA 4XUJB 4DRBA 5B1MD 3A6NB 3WTPB 3MGSC 5BT1D 3LJAB 2ZY4A 3WA9C 5AV6A 1P3LC 5AVCB 3X1SA 5B24A 3LELB 3MNNC 4J8WD 3AFAD 3UTAB 2IO5C 1WWIA 5G49B 5DNMD 3REHD 4LD9B 5AV8B 2Y2QA 5B2JB 4NE5A 3AZIC 3RELB 4H9NA 3B6FD 3MGSB 2BYMA 2F8NG 3WKJC 5BS7C 3WA9B 1P3GB 1P3PD 2Y2HA 1P3LB 3O62D 2FJ7D 3FDDA 5B31B 3MNNB 5AV9C 1TAFA 1EQZC 4J8WA 3W99D 4X23D 3AFAA 3AZIB 1P3AC 5B40A 5DNMA 3REHA 1P34A 3X1UD 5CPKA 1KX3B 3B6GD 3MVDC 1WWSA 5GT3C 4YS3D 3B6FA 3NQUB 3LZ1C 1P3BD 5AV9B 1P3PA 1P3FD 3O62A 4J8UC 2FJ7A 5AV5C 4H9RA 1P3AB 4KUDC 5GSUC 5F99D 1M19B 3LZ0C 3W99A 4X23A 5GT3B 1R4VA 3C1CB 3X1UA 2HUEB 3B6GA 3VH5T 4YS3A 4Z5TD 1A7WA 3AZMA 5B2IC 3W98C 1KX5D 4R8PC 1P3BA 1P3FA 3REJA 1F66B 1U35D 4KUDB 5GSUB 3LZ0B 1B6WA 4J8XD 1F1EA 5F99A 4WU8D 2CV5A 3MGQA 1ID3C 4DRAA 5B32C 5B2IB 3W96D 2NZDB 3AZLC 1B67A 3MGPD 5FUGB 4Z5TA 5B1LC 5GT0C 2HIOD 3VH6T 1S32C 1U35A 3EG5B 1ID3B 2RIQA 4J8XA 4WU9C 5B32B 3AV1C 3AZLB 1HTAA 5B1LB 4XZQC 4WZSB 3W96A 4QLCD 1P3IB 2BYKB 1P3KD 5CPJC 5B0ZB 5FUGA 1M1AD 3EPKA 4WV4B 3MGRC 3WAAC 5JA4A 3B0CT 2HIOA 4WU9B 1Z2CB 3AL0C 3AYWD 5B33D 5CP6D 3C1BD 3AV1B 3V9RB 5JRGC 5C3IB 2F2AC 2J8PA 3KXBC 1JFIB 5CPJB 4QLCA 3REIB 1P3OA 4Z66C 3F6TA 3MGRB 3WAAB 1P3IA 1BH9B 3AZHC 5BNXB 3AZKD 1HQ3B 2PYOD 5AVBC 3AZFC 5CP6A 3C1BA 4ZUXC 1ULYA 3AZGD 4WNNA 1P3MC 3X1TC 3TU4C 1BH8A 4Z66B 2ZY2A 4H9QB 3AN2D 4JJND 3R45B 3AZND 4J8VD 4KGCD 3X1VD 5AVBB 5GXQB 4ZUXB 3AZKA 5CPID 5B0YD 2PYOA 5E5AC 3X1TB 1M18B 2AROC 3AZGA 1H3OA 2NQBC 5B24D 3KUYC 3AZEB 3AN2A 2ZM5A 5AY8C 4JJNA 4NFTA 5AV6C 2JSSA 3AZNA 1ZLAD 3X1SC 3R45A 4CSRB 4KGCA 3X1VA 2Y2JA 5CPIA 4HGAC 5B0YA 5GXQA 4XUJD 2RVQC 3A6ND 3WTPD 2ZY5A 3LJAD 5DNNC 3W97C 5AY8B 3NQJA 4H9PB 4AWLB 5B1MC 5AVCD 2G5HC 3LELD 3UTBB 5B40D 4H9SA 2Y2IA 2ZY3A 5BT1C 3UTAD 1P34D 5CPKD 4LD9D 5AV8D 5B2JD 1ZLAA 4NE3A 3RELD 4J8WC 3AFAC 3KWQC 5DNNB 3W97B 1P3GD 4XUJA 3A6NA 3WTPA 2IO5B 5B31D 3B6FC 3LJAA 1P3PC 5AVCA 3LELA 2FJ7C 3UTAA 3AZID 3UTBA 5G49A 4LD9A 3AV2C 5B2JA 5AV8A 3B0DC 3KWQB 3AZMD 1KX3D 2F8NB 3WKJB 3RELA 3W99C 3MGSA 3X1UC 3REJD 1TZYC 3WA9A 1P3GA 1P3LA 4YS3C 1EQZB 2UWXA 5B31A 3MNNA 3EPJA 3MVDB 3MGQD 3AV2B 2CV5D 3B0DB 1M19D 5GT3D 3AZIA 3LZ1B 3C1CD 4UUZB 3VH5W 1KX3A 3UT9C 1AOIC 1TZYB 1Q9CA 4J8UB 5AV5B 5KDMB 3NQUA 5AV9A 4Z5TC 1F66D 4KUDD 3LZ0D 1KX5C 1P3AA 1M19A 1U35C 3UT9B 1AOIB 5GT3A 3W98B 3C1CA 4R8PB 4J8XC 1W2EA 2NZDD 2W8SA 4WU8C 1KX5B 3VH6W 3MGPC 1F66A 4KUDA 5GSUA 1N1JB 3LZ0A 3AZLD 4WU8B 4Z2MH 5GT0B 1P3OD 2Y2MA 5B1LD 5B2IA 3W98A 2NZDA 1P3ID 1S32B 3KSYA 4NE6A 3VH5A 5B0ZD 2LY8A 3B0CW 3H0MC 4H9OB 1P3KC 1KU5A 4CAYB 3KFUG 1M1AC 1BFMA 4XZQB 1ID3A 4Z2MG 2XD1A 5B32A 3AYWC 5B33C 3AZLA 5B1LA 3REID 2BYKA 3MGRD 3WAAD 1P3KB 5B0ZA 5JRGB 3REKC 1HQ3D 3H0RC 4WU9A 4G91C 3VH6A 3AV1A 3KXBB 4KHAB 3V9RA 5BNVB 5BO0B 4XZQA 2PYOC 4Z66D 3AZHB 3AZGC 1KX4C 1JFIA 5CPJA 4EO5C 3REIA 3MGRA 3REKB 3WAAA 3AZFB 1BH9A 5AVBD 3AZJC 1T3UA 5GXQD 5BNXA 1P3MB 1HQ3A 4YM6C 2YFWB 2YFVB 3TU4B 4J8VC 2Y2LA 1M18D 3A1IA 5CPIC 1KX4B 3KXBA 5B0YC 3AZED 4EO5B 4Z66A 4H9QA 2F8NK 5B24C 3AZJB 5E5AB 4YM6B 4J8VB 2AROB 5AVBA 4ZUXA 2NQBB 3KUYB 1ZLAC 3X1TA 2YFWA 1M18A 5AV6B 3AZEA 3X1SB 5B24B 3A6NC 3UTBD 3LJAC 4HGAB 5AVCC 4H9NB 3MGSD 4CSRA 5DNMC 3REHC 3UTAC 5B40C 1P34C 2BYMB 5CPKC 3WA9D 2AROA 5B2JC 1P3LD 5B1MB 3EPHA 3RELC 3MNND 3IP4C 2F8NH 5AY8A 1TAFB 3O62C 3H0LC 4H9PA 1P3GC 4ZBJC 5B31G 4J8WB 3AFAB 2Y2PA 2Y2KA 5B31C 5B40B 5DNMB 3REHB 1P34B 5CPKB 3KWQD 2F8ND 3WKJD 4X23C 4M6BA 3B6FB 3B6GC 5AV9D 5DNNA 3W97A 3AZMC 1P3PB 1KX3C 3O62B 1EQZD 2FJ7B 4ZBJB 5B1MA 1P3BC 4H9RB 1P3AD 1P3FC 3A1KA 3REJC 3MVDD 2DF4C 3AV2D 3W99B 4X23B 2G5IC 3LZ1D 5F99C 3X1UB 2F8NA 5BS7A 3KWQA 3B6GB 2CV5C 3MGQC 3WKJA 4YS3B 1M19C 3AZMB 1TZYD 4J8UD 5AV5D 3C1CC 1P3BB 2XD5A 2HUEC 2BG1A 5GSUD 3REJB 1P3FB 1EQZA 2Y2OA 5F99B 3MVDA 3AV2A 1F66C 2CV5B 3MGQB 3UT9D 2JCHA 1AOID 5B2ID 4DQYB 3W98D 3LZ1A 4R8PD 4UUZA 2VQRA 4Z5TB 1TZYA 5CHLB 4J8UA 5AV5A 3W96C 5KDMA 2NZDC 1U35B 1ID3D 2HIOC 4J8XB 5B32D 3P5JB 3UT9A 1AOIA 5GT0D 4R8PA 3W96B 5B32G 4G92C 3EPLA 3MGPB 1S32D 4QLCC 1P3OC 4WU9D 5JA4B 2HIOB 1P3IC 1KX5A 3AV1D 1PZRA 1N1JA 5B0ZC 4XZQD
chains in the Genus database with same CATH topology
5CP6C 2L5AA 3C1BC 4G92B 4WU8A 5CPJD 5GT0A 4QLCB 1P3OB 5C3IC 1S32A 3MGPA 2Y2NA 1M1AB 5JRGD 4H9OA 3REIC 4CAYA 3AYWB 5B33B 5CP6B 3C1BB 4WJ3C 3AZKC 3KXBD 4WNNB 1HQ3C 1BH8B 3AZHD 2FFFB 3AN2C 3REKD 4G91B 3AZFD 4JJNC 1P3KA 4ZUXD 5JRGA 3AZKB 3AZNC 1M1AA 1P3MD 2PYOB 3X1TD 3TU4D 3X1VC 4KGCC 3AYWA 3AZGB 5B33A 4KHAA 5GXQC 1H3OB 5BNVA 1KX4D 5BO0A 3AN2B 1M18C 4JJNB 3AZHA 3AZJD 3AZEC 3AZNB 3REKA 4H9SC 2Y2GA 5E5AD 4YM6D 3AZFA 4KGCB 3X1VB 2AROD 5CPIB 1P3MA 2NQBD 5B0YB 3KUYD 2YFVA 3TU4A 2DQNC 5AY8D 4XUJC 5AV6D 1KX4A 3NQJB 3WTPC 3X1SD 2CWEA 3B0BA 3LELC 3AZJA 1ZLAB 4E45A 4AWLC 2JE5A 2RVQD 5E5AA 4YM6A 3UTBC 4J8VA 4LD9C 4E44A 5AV8C 4UPKA 5DNND 3WTPE 2NQBA 3W97D 3KUYA 4XUJB 4DRBA 5B1MD 3A6NB 3WTPB 3MGSC 5BT1D 3LJAB 2ZY4A 3WA9C 5AV6A 1P3LC 5AVCB 3X1SA 5B24A 3LELB 3MNNC 4J8WD 3AFAD 3UTAB 2IO5C 1WWIA 5G49B 5DNMD 3REHD 4LD9B 5AV8B 2Y2QA 5B2JB 4NE5A 3AZIC 3RELB 4H9NA 3B6FD 3MGSB 2BYMA 2F8NG 3WKJC 5BS7C 3WA9B 1P3GB 1P3PD 2Y2HA 1P3LB 3O62D 2FJ7D 3FDDA 5B31B 3MNNB 5AV9C 1TAFA 1EQZC 4J8WA 3W99D 4X23D 3AFAA 3AZIB 1P3AC 5B40A 5DNMA 3REHA 1P34A 3X1UD 5CPKA 1KX3B 3B6GD 3MVDC 1WWSA 5GT3C 4YS3D 3B6FA 3NQUB 3LZ1C 1P3BD 5AV9B 1P3PA 1P3FD 3O62A 4J8UC 2FJ7A 5AV5C 4H9RA 1P3AB 4KUDC 5GSUC 5F99D 1M19B 3LZ0C 3W99A 4X23A 5GT3B 1R4VA 3C1CB 3X1UA 2HUEB 3B6GA 3VH5T 4YS3A 4Z5TD 1A7WA 3AZMA 5B2IC 3W98C 1KX5D 4R8PC 1P3BA 1P3FA 3REJA 1F66B 1U35D 4KUDB 5GSUB 3LZ0B 1B6WA 4J8XD 1F1EA 5F99A 4WU8D 2CV5A 3MGQA 1ID3C 4DRAA 5B32C 5B2IB 3W96D 2NZDB 3AZLC 1B67A 3MGPD 5FUGB 4Z5TA 5B1LC 5GT0C 2HIOD 3VH6T 1S32C 1U35A 3EG5B 1ID3B 2RIQA 4J8XA 4WU9C 5B32B 3AV1C 3AZLB 1HTAA 5B1LB 4XZQC 4WZSB 3W96A 4QLCD 1P3IB 2BYKB 1P3KD 5CPJC 5B0ZB 5FUGA 1M1AD 3EPKA 4WV4B 3MGRC 3WAAC 5JA4A 3B0CT 2HIOA 4WU9B 1Z2CB 3AL0C 3AYWD 5B33D 5CP6D 3C1BD 3AV1B 3V9RB 5JRGC 5C3IB 2F2AC 2J8PA 3KXBC 1JFIB 5CPJB 4QLCA 3REIB 1P3OA 4Z66C 3F6TA 3MGRB 3WAAB 1P3IA 1BH9B 3AZHC 5BNXB 3AZKD 1HQ3B 2PYOD 5AVBC 3AZFC 5CP6A 3C1BA 4ZUXC 1ULYA 3AZGD 4WNNA 1P3MC 3X1TC 3TU4C 1BH8A 4Z66B 2ZY2A 4H9QB 3AN2D 4JJND 3R45B 3AZND 4J8VD 4KGCD 3X1VD 5AVBB 5GXQB 4ZUXB 3AZKA 5CPID 5B0YD 2PYOA 5E5AC 3X1TB 1M18B 2AROC 3AZGA 1H3OA 2NQBC 5B24D 3KUYC 3AZEB 3AN2A 2ZM5A 5AY8C 4JJNA 4NFTA 5AV6C 2JSSA 3AZNA 1ZLAD 3X1SC 3R45A 4CSRB 4KGCA 3X1VA 2Y2JA 5CPIA 4HGAC 5B0YA 5GXQA 4XUJD 2RVQC 3A6ND 3WTPD 2ZY5A 3LJAD 5DNNC 3W97C 5AY8B 3NQJA 4H9PB 4AWLB 5B1MC 5AVCD 2G5HC 3LELD 3UTBB 5B40D 4H9SA 2Y2IA 2ZY3A 5BT1C 3UTAD 1P34D 5CPKD 4LD9D 5AV8D 5B2JD 1ZLAA 4NE3A 3RELD 4J8WC 3AFAC 3KWQC 5DNNB 3W97B 1P3GD 4XUJA 3A6NA 3WTPA 2IO5B 5B31D 3B6FC 3LJAA 1P3PC 5AVCA 3LELA 2FJ7C 3UTAA 3AZID 3UTBA 5G49A 4LD9A 3AV2C 5B2JA 5AV8A 3B0DC 3KWQB 3AZMD 1KX3D 2F8NB 3WKJB 3RELA 3W99C 3MGSA 3X1UC 3REJD 1TZYC 3WA9A 1P3GA 1P3LA 4YS3C 1EQZB 2UWXA 5B31A 3MNNA 3EPJA 3MVDB 3MGQD 3AV2B 2CV5D 3B0DB 1M19D 5GT3D 3AZIA 3LZ1B 3C1CD 4UUZB 3VH5W 1KX3A 3UT9C 1AOIC 1TZYB 1Q9CA 4J8UB 5AV5B 5KDMB 3NQUA 5AV9A 4Z5TC 1F66D 4KUDD 3LZ0D 1KX5C 1P3AA 1M19A 1U35C 3UT9B 1AOIB 5GT3A 3W98B 3C1CA 4R8PB 4J8XC 1W2EA 2NZDD 2W8SA 4WU8C 1KX5B 3VH6W 3MGPC 1F66A 4KUDA 5GSUA 1N1JB 3LZ0A 3AZLD 4WU8B 4Z2MH 5GT0B 1P3OD 2Y2MA 5B1LD 5B2IA 3W98A 2NZDA 1P3ID 1S32B 3KSYA 4NE6A 3VH5A 5B0ZD 2LY8A 3B0CW 3H0MC 4H9OB 1P3KC 1KU5A 4CAYB 3KFUG 1M1AC 1BFMA 4XZQB 1ID3A 4Z2MG 2XD1A 5B32A 3AYWC 5B33C 3AZLA 5B1LA 3REID 2BYKA 3MGRD 3WAAD 1P3KB 5B0ZA 5JRGB 3REKC 1HQ3D 3H0RC 4WU9A 4G91C 3VH6A 3AV1A 3KXBB 4KHAB 3V9RA 5BNVB 5BO0B 4XZQA 2PYOC 4Z66D 3AZHB 3AZGC 1KX4C 1JFIA 5CPJA 4EO5C 3REIA 3MGRA 3REKB 3WAAA 3AZFB 1BH9A 5AVBD 3AZJC 1T3UA 5GXQD 5BNXA 1P3MB 1HQ3A 4YM6C 2YFWB 2YFVB 3TU4B 4J8VC 2Y2LA 1M18D 3A1IA 5CPIC 1KX4B 3KXBA 5B0YC 3AZED 4EO5B 4Z66A 4H9QA 2F8NK 5B24C 3AZJB 5E5AB 4YM6B 4J8VB 2AROB 5AVBA 4ZUXA 2NQBB 3KUYB 1ZLAC 3X1TA 2YFWA 1M18A 5AV6B 3AZEA 3X1SB 5B24B 3A6NC 3UTBD 3LJAC 4HGAB 5AVCC 4H9NB 3MGSD 4CSRA 5DNMC 3REHC 3UTAC 5B40C 1P34C 2BYMB 5CPKC 3WA9D 2AROA 5B2JC 1P3LD 5B1MB 3EPHA 3RELC 3MNND 3IP4C 2F8NH 5AY8A 1TAFB 3O62C 3H0LC 4H9PA 1P3GC 4ZBJC 5B31G 4J8WB 3AFAB 2Y2PA 2Y2KA 5B31C 5B40B 5DNMB 3REHB 1P34B 5CPKB 3KWQD 2F8ND 3WKJD 4X23C 4M6BA 3B6FB 3B6GC 5AV9D 5DNNA 3W97A 3AZMC 1P3PB 1KX3C 3O62B 1EQZD 2FJ7B 4ZBJB 5B1MA 1P3BC 4H9RB 1P3AD 1P3FC 3A1KA 3REJC 3MVDD 2DF4C 3AV2D 3W99B 4X23B 2G5IC 3LZ1D 5F99C 3X1UB 2F8NA 5BS7A 3KWQA 3B6GB 2CV5C 3MGQC 3WKJA 4YS3B 1M19C 3AZMB 1TZYD 4J8UD 5AV5D 3C1CC 1P3BB 2XD5A 2HUEC 2BG1A 5GSUD 3REJB 1P3FB 1EQZA 2Y2OA 5F99B 3MVDA 3AV2A 1F66C 2CV5B 3MGQB 3UT9D 2JCHA 1AOID 5B2ID 4DQYB 3W98D 3LZ1A 4R8PD 4UUZA 2VQRA 4Z5TB 1TZYA 5CHLB 4J8UA 5AV5A 3W96C 5KDMA 2NZDC 1U35B 1ID3D 2HIOC 4J8XB 5B32D 3P5JB 3UT9A 1AOIA 5GT0D 4R8PA 3W96B 5B32G 4G92C 3EPLA 3MGPB 1S32D 4QLCC 1P3OC 4WU9D 5JA4B 2HIOB 1P3IC 1KX5A 3AV1D 1PZRA 1N1JA 5B0ZC 4XZQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP6 C;  2L5A A;  3C1B C;  4G92 B;  4WU8 A;  5CPJ D;  5GT0 A;  4QLC B;  1P3O B;  5C3I C;  1S32 A;  3MGP A;  1M1A B;  5JRG D;  4H9O A;  3REI C;  4CAY A;  3AYW B;  5B33 B;  5CP6 B;  3C1B B;  3AZK C;  3KXB D;  4WNN B;  1HQ3 C;  1BH8 B;  3AZH D;  3AN2 C;  3REK D;  4G91 B;  3AZF D;  4JJN C;  1P3K A;  4ZUX D;  5JRG A;  3AZK B;  3AZN C;  1M1A A;  1P3M D;  2PYO B;  3X1T D;  3TU4 D;  3X1V C;  4KGC C;  3AYW A;  3AZG B;  5B33 A;  4KHA A;  5GXQ C;  1H3O B;  5BNV A;  1KX4 D;  5BO0 A;  3AN2 B;  1M18 C;  4JJN B;  3AZH A;  3AZJ D;  3AZE C;  3AZN B;  3REK A;  4H9S C;  5E5A D;  4YM6 D;  3AZF A;  4KGC B;  3X1V B;  2ARO D;  5CPI B;  1P3M A;  2NQB D;  5B0Y B;  3KUY D;  2YFV A;  3TU4 A;  5AY8 D;  4XUJ C;  5AV6 D;  1KX4 A;  3NQJ B;  3WTP C;  3X1S D;  2CWE A;  3B0B A;  3LEL C;  3AZJ A;  1ZLA B;  4E45 A;  4AWL C;  2RVQ D;  5E5A A;  4YM6 A;  3UTB C;  4J8V A;  4LD9 C;  4E44 A;  5AV8 C;  5DNN D;  3WTP E;  3W97 D;  2NQB A;  3KUY A;  4XUJ B;  4DRB A;  5B1M D;  3A6N B;  3WTP B;  3MGS C;  5BT1 D;  3LJA B;  3WA9 C;  5AV6 A;  1P3L C;  5AVC B;  3X1S A;  5B24 A;  3LEL B;  3MNN C;  4J8W D;  3AFA D;  3UTA B;  2IO5 C;  1WWI A;  5G49 B;  5DNM D;  3REH D;  4LD9 B;  5AV8 B;  5B2J B;  4NE5 A;  3AZI C;  3REL B;  4H9N A;  3B6F D;  3MGS B;  2BYM A;  2F8N G;  3WKJ C;  5BS7 C;  3WA9 B;  1P3G B;  1P3P D;  1P3L B;  3O62 D;  2FJ7 D;  5B31 B;  3MNN B;  5AV9 C;  1TAF A;  1EQZ C;  4J8W A;  3W99 D;  4X23 D;  3AFA A;  3AZI B;  1P3A C;  5B40 A;  5DNM A;  3REH A;  1P34 A;  3X1U D;  5CPK A;  1KX3 B;  3B6G D;  3MVD C;  1WWS A;  5GT3 C;  4YS3 D;  3B6F A;  3NQU B;  3LZ1 C;  1P3B D;  5AV9 B;  1P3P A;  1P3F D;  3O62 A;  4J8U C;  2FJ7 A;  5AV5 C;  4H9R A;  1P3A B;  4KUD C;  5GSU C;  5F99 D;  1M19 B;  3LZ0 C;  3W99 A;  4X23 A;  5GT3 B;  1R4V A;  3C1C B;  3X1U A;  2HUE B;  3B6G A;  3VH5 T;  4YS3 A;  4Z5T D;  1A7W A;  3AZM A;  5B2I C;  3W98 C;  1KX5 D;  4R8P C;  1P3B A;  1P3F A;  3REJ A;  1F66 B;  1U35 D;  4KUD B;  5GSU B;  3LZ0 B;  1B6W A;  4J8X D;  1F1E A;  5F99 A;  4WU8 D;  2CV5 A;  3MGQ A;  1ID3 C;  4DRA A;  5B32 C;  5B2I B;  3W96 D;  2NZD B;  3AZL C;  1B67 A;  3MGP D;  5FUG B;  4Z5T A;  5B1L C;  5GT0 C;  2HIO D;  3VH6 T;  1S32 C;  1U35 A;  1ID3 B;  4J8X A;  4WU9 C;  5B32 B;  3AV1 C;  3AZL B;  1HTA A;  5B1L B;  4XZQ C;  4WZS B;  3W96 A;  4QLC D;  1P3I B;  2BYK B;  1P3K D;  5CPJ C;  5B0Z B;  5FUG A;  1M1A D;  4WV4 B;  3MGR C;  3WAA C;  5JA4 A;  3B0C T;  2HIO A;  4WU9 B;  3AYW D;  5B33 D;  5CP6 D;  3C1B D;  3AV1 B;  3V9R B;  5JRG C;  5C3I B;  3KXB C;  1JFI B;  5CPJ B;  4QLC A;  3REI B;  1P3O A;  4Z66 C;  3MGR B;  3WAA B;  1P3I A;  1BH9 B;  3AZH C;  5BNX B;  3AZK D;  1HQ3 B;  2PYO D;  5AVB C;  3AZF C;  5CP6 A;  3C1B A;  4ZUX C;  1ULY A;  3AZG D;  4WNN A;  1P3M C;  3X1T C;  3TU4 C;  1BH8 A;  4Z66 B;  3AN2 D;  4H9Q B;  4JJN D;  3R45 B;  3AZN D;  4J8V D;  4KGC D;  3X1V D;  5AVB B;  5GXQ B;  4ZUX B;  3AZK A;  5CPI D;  5B0Y D;  2PYO A;  5E5A C;  3X1T B;  1M18 B;  2ARO C;  3AZG A;  1H3O A;  2NQB C;  5B24 D;  3KUY C;  3AZE B;  3AN2 A;  5AY8 C;  4JJN A;  4NFT A;  5AV6 C;  2JSS A;  3AZN A;  1ZLA D;  3X1S C;  3R45 A;  4CSR B;  4KGC A;  3X1V A;  5CPI A;  4HGA C;  5B0Y A;  5GXQ A;  4XUJ D;  2RVQ C;  3A6N D;  3WTP D;  3LJA D;  5DNN C;  3W97 C;  5AY8 B;  3NQJ A;  4H9P B;  4AWL B;  5B1M C;  5AVC D;  3UTB B;  3LEL D;  5B40 D;  4H9S A;  5BT1 C;  3UTA D;  1P34 D;  5CPK D;  4LD9 D;  5B2J D;  5AV8 D;  1ZLA A;  4NE3 A;  3REL D;  4J8W C;  3AFA C;  3KWQ C;  5DNN B;  3W97 B;  1P3G D;  4XUJ A;  3A6N A;  3WTP A;  2IO5 B;  5B31 D;  3B6F C;  3LJA A;  1P3P C;  5AVC A;  3LEL A;  2FJ7 C;  3UTA A;  3AZI D;  3UTB A;  5G49 A;  4LD9 A;  3AV2 C;  5B2J A;  5AV8 A;  3B0D C;  3KWQ B;  3AZM D;  1KX3 D;  2F8N B;  3WKJ B;  3REL A;  3W99 C;  3MGS A;  3X1U C;  3REJ D;  1TZY C;  3WA9 A;  1P3G A;  1P3L A;  4YS3 C;  1EQZ B;  5B31 A;  3MNN A;  3MVD B;  3MGQ D;  3AV2 B;  2CV5 D;  3B0D B;  1M19 D;  5GT3 D;  3AZI A;  3LZ1 B;  3C1C D;  4UUZ B;  3VH5 W;  1KX3 A;  3UT9 C;  1AOI C;  1TZY B;  1Q9C A;  4J8U B;  5AV5 B;  5KDM B;  3NQU A;  5AV9 A;  4Z5T C;  1F66 D;  4KUD D;  3LZ0 D;  1KX5 C;  1P3A A;  1M19 A;  1U35 C;  3UT9 B;  1AOI B;  5GT3 A;  3W98 B;  3C1C A;  4R8P B;  4J8X C;  2NZD D;  4WU8 C;  1KX5 B;  3VH6 W;  3MGP C;  1F66 A;  4KUD A;  5GSU A;  1N1J B;  3LZ0 A;  3AZL D;  4WU8 B;  4Z2M H;  5GT0 B;  1P3O D;  5B1L D;  5B2I A;  3W98 A;  2NZD A;  1P3I D;  1S32 B;  3KSY A;  4NE6 A;  3VH5 A;  5B0Z D;  2LY8 A;  3B0C W;  4H9O B;  1P3K C;  1KU5 A;  4CAY B;  1M1A C;  1BFM A;  4XZQ B;  1ID3 A;  4Z2M G;  5B32 A;  3AYW C;  5B33 C;  3AZL A;  5B1L A;  3REI D;  2BYK A;  3MGR D;  3WAA D;  1P3K B;  5B0Z A;  5JRG B;  3REK C;  1HQ3 D;  4WU9 A;  4G91 C;  3VH6 A;  3AV1 A;  3KXB B;  4KHA B;  3V9R A;  5BNV B;  5BO0 B;  4XZQ A;  2PYO C;  4Z66 D;  3AZH B;  3AZG C;  1KX4 C;  1JFI A;  5CPJ A;  4EO5 C;  3REI A;  3MGR A;  3REK B;  3WAA A;  3AZF B;  1BH9 A;  5AVB D;  3AZJ C;  5BNX A;  5GXQ D;  1P3M B;  1HQ3 A;  4YM6 C;  2YFW B;  2YFV B;  3TU4 B;  4J8V C;  1M18 D;  5CPI C;  1KX4 B;  3KXB A;  5B0Y C;  3AZE D;  4EO5 B;  4Z66 A;  4H9Q A;  2F8N K;  5B24 C;  3AZJ B;  5E5A B;  4YM6 B;  4J8V B;  2ARO B;  5AVB A;  4ZUX A;  2NQB B;  3KUY B;  1ZLA C;  3X1T A;  2YFW A;  1M18 A;  5AV6 B;  3AZE A;  3X1S B;  5B24 B;  3A6N C;  3UTB D;  3LJA C;  4HGA B;  5AVC C;  4H9N B;  3MGS D;  4CSR A;  5DNM C;  3REH C;  3UTA C;  5B40 C;  1P34 C;  2BYM B;  5CPK C;  3WA9 D;  2ARO A;  5B2J C;  1P3L D;  5B1M B;  3REL C;  3MNN D;  2F8N H;  5AY8 A;  1TAF B;  3O62 C;  4H9P A;  1P3G C;  4ZBJ C;  5B31 G;  4J8W B;  3AFA B;  5B31 C;  5B40 B;  5DNM B;  3REH B;  1P34 B;  5CPK B;  3KWQ D;  2F8N D;  3WKJ D;  4X23 C;  4M6B A;  3B6F B;  3B6G C;  5AV9 D;  5DNN A;  3W97 A;  3AZM C;  1P3P B;  1KX3 C;  3O62 B;  1EQZ D;  2FJ7 B;  4ZBJ B;  5B1M A;  1P3B C;  4H9R B;  1P3A D;  1P3F C;  3REJ C;  3MVD D;  3AV2 D;  3W99 B;  4X23 B;  3LZ1 D;  5F99 C;  3X1U B;  2F8N A;  5BS7 A;  3KWQ A;  3B6G B;  2CV5 C;  3MGQ C;  3WKJ A;  4YS3 B;  1M19 C;  3AZM B;  1TZY D;  4J8U D;  5AV5 D;  3C1C C;  1P3B B;  2HUE C;  5GSU D;  1P3F B;  3REJ B;  1EQZ A;  5F99 B;  3MVD A;  3AV2 A;  1F66 C;  2CV5 B;  3MGQ B;  3UT9 D;  1AOI D;  5B2I D;  3W98 D;  3LZ1 A;  4R8P D;  4UUZ A;  4Z5T B;  1TZY A;  5CHL B;  4J8U A;  5AV5 A;  3W96 C;  5KDM A;  2NZD C;  1U35 B;  1ID3 D;  2HIO C;  4J8X B;  5B32 D;  3UT9 A;  1AOI A;  5GT0 D;  4R8P A;  3W96 B;  5B32 G;  4G92 C;  3MGP B;  1S32 D;  4QLC C;  1P3O C;  4WU9 D;  5JA4 B;  2HIO B;  1P3I C;  1KX5 A;  3AV1 D;  1N1J A;  5B0Z C;  4XZQ D; 
#chains in the Genus database with same CATH topology
 5CP6 C;  2L5A A;  3C1B C;  4G92 B;  4WU8 A;  5CPJ D;  5GT0 A;  4QLC B;  1P3O B;  5C3I C;  1S32 A;  3MGP A;  2Y2N A;  1M1A B;  5JRG D;  4H9O A;  3REI C;  4CAY A;  3AYW B;  5B33 B;  5CP6 B;  3C1B B;  4WJ3 C;  3AZK C;  3KXB D;  4WNN B;  1HQ3 C;  1BH8 B;  3AZH D;  2FFF B;  3AN2 C;  3REK D;  4G91 B;  3AZF D;  4JJN C;  1P3K A;  4ZUX D;  5JRG A;  3AZK B;  3AZN C;  1M1A A;  1P3M D;  2PYO B;  3X1T D;  3TU4 D;  3X1V C;  4KGC C;  3AYW A;  3AZG B;  5B33 A;  4KHA A;  5GXQ C;  1H3O B;  5BNV A;  1KX4 D;  5BO0 A;  3AN2 B;  1M18 C;  4JJN B;  3AZH A;  3AZJ D;  3AZE C;  3AZN B;  3REK A;  4H9S C;  2Y2G A;  5E5A D;  4YM6 D;  3AZF A;  4KGC B;  3X1V B;  2ARO D;  5CPI B;  1P3M A;  2NQB D;  5B0Y B;  3KUY D;  2YFV A;  3TU4 A;  2DQN C;  5AY8 D;  4XUJ C;  5AV6 D;  1KX4 A;  3NQJ B;  3WTP C;  3X1S D;  2CWE A;  3B0B A;  3LEL C;  3AZJ A;  1ZLA B;  4E45 A;  4AWL C;  2JE5 A;  2RVQ D;  5E5A A;  4YM6 A;  3UTB C;  4J8V A;  4LD9 C;  4E44 A;  5AV8 C;  4UPK A;  5DNN D;  3WTP E;  2NQB A;  3W97 D;  3KUY A;  4XUJ B;  4DRB A;  5B1M D;  3A6N B;  3WTP B;  3MGS C;  5BT1 D;  3LJA B;  2ZY4 A;  3WA9 C;  5AV6 A;  1P3L C;  5AVC B;  3X1S A;  5B24 A;  3LEL B;  3MNN C;  4J8W D;  3AFA D;  3UTA B;  2IO5 C;  1WWI A;  5G49 B;  5DNM D;  3REH D;  4LD9 B;  5AV8 B;  2Y2Q A;  5B2J B;  4NE5 A;  3AZI C;  3REL B;  4H9N A;  3B6F D;  3MGS B;  2BYM A;  2F8N G;  3WKJ C;  5BS7 C;  3WA9 B;  1P3G B;  1P3P D;  2Y2H A;  1P3L B;  3O62 D;  2FJ7 D;  3FDD A;  5B31 B;  3MNN B;  5AV9 C;  1TAF A;  1EQZ C;  4J8W A;  3W99 D;  4X23 D;  3AFA A;  3AZI B;  1P3A C;  5B40 A;  5DNM A;  3REH A;  1P34 A;  3X1U D;  5CPK A;  1KX3 B;  3B6G D;  3MVD C;  1WWS A;  5GT3 C;  4YS3 D;  3B6F A;  3NQU B;  3LZ1 C;  1P3B D;  5AV9 B;  1P3P A;  1P3F D;  3O62 A;  4J8U C;  2FJ7 A;  5AV5 C;  4H9R A;  1P3A B;  4KUD C;  5GSU C;  5F99 D;  1M19 B;  3LZ0 C;  3W99 A;  4X23 A;  5GT3 B;  1R4V A;  3C1C B;  3X1U A;  2HUE B;  3B6G A;  3VH5 T;  4YS3 A;  4Z5T D;  1A7W A;  3AZM A;  5B2I C;  3W98 C;  1KX5 D;  4R8P C;  1P3B A;  1P3F A;  3REJ A;  1F66 B;  1U35 D;  4KUD B;  5GSU B;  3LZ0 B;  1B6W A;  4J8X D;  1F1E A;  5F99 A;  4WU8 D;  2CV5 A;  3MGQ A;  1ID3 C;  4DRA A;  5B32 C;  5B2I B;  3W96 D;  2NZD B;  3AZL C;  1B67 A;  3MGP D;  5FUG B;  4Z5T A;  5B1L C;  5GT0 C;  2HIO D;  3VH6 T;  1S32 C;  1U35 A;  3EG5 B;  1ID3 B;  2RIQ A;  4J8X A;  4WU9 C;  5B32 B;  3AV1 C;  3AZL B;  1HTA A;  5B1L B;  4XZQ C;  4WZS B;  3W96 A;  4QLC D;  1P3I B;  2BYK B;  1P3K D;  5CPJ C;  5B0Z B;  5FUG A;  1M1A D;  3EPK A;  4WV4 B;  3MGR C;  3WAA C;  5JA4 A;  3B0C T;  2HIO A;  4WU9 B;  1Z2C B;  3AL0 C;  3AYW D;  5B33 D;  5CP6 D;  3C1B D;  3AV1 B;  3V9R B;  5JRG C;  5C3I B;  2F2A C;  2J8P A;  3KXB C;  1JFI B;  5CPJ B;  4QLC A;  3REI B;  1P3O A;  4Z66 C;  3F6T A;  3MGR B;  3WAA B;  1P3I A;  1BH9 B;  3AZH C;  5BNX B;  3AZK D;  1HQ3 B;  2PYO D;  5AVB C;  3AZF C;  5CP6 A;  3C1B A;  4ZUX C;  1ULY A;  3AZG D;  4WNN A;  1P3M C;  3X1T C;  3TU4 C;  1BH8 A;  4Z66 B;  2ZY2 A;  4H9Q B;  3AN2 D;  4JJN D;  3R45 B;  3AZN D;  4J8V D;  4KGC D;  3X1V D;  5AVB B;  5GXQ B;  4ZUX B;  3AZK A;  5CPI D;  5B0Y D;  2PYO A;  5E5A C;  3X1T B;  1M18 B;  2ARO C;  3AZG A;  1H3O A;  2NQB C;  5B24 D;  3KUY C;  3AZE B;  3AN2 A;  2ZM5 A;  5AY8 C;  4JJN A;  4NFT A;  5AV6 C;  2JSS A;  3AZN A;  1ZLA D;  3X1S C;  3R45 A;  4CSR B;  4KGC A;  3X1V A;  2Y2J A;  5CPI A;  4HGA C;  5B0Y A;  5GXQ A;  4XUJ D;  2RVQ C;  3A6N D;  3WTP D;  2ZY5 A;  3LJA D;  5DNN C;  3W97 C;  5AY8 B;  3NQJ A;  4H9P B;  4AWL B;  5B1M C;  5AVC D;  2G5H C;  3LEL D;  3UTB B;  5B40 D;  4H9S A;  2Y2I A;  2ZY3 A;  5BT1 C;  3UTA D;  1P34 D;  5CPK D;  4LD9 D;  5AV8 D;  5B2J D;  1ZLA A;  4NE3 A;  3REL D;  4J8W C;  3AFA C;  3KWQ C;  5DNN B;  3W97 B;  1P3G D;  4XUJ A;  3A6N A;  3WTP A;  2IO5 B;  5B31 D;  3B6F C;  3LJA A;  1P3P C;  5AVC A;  3LEL A;  2FJ7 C;  3UTA A;  3AZI D;  3UTB A;  5G49 A;  4LD9 A;  3AV2 C;  5B2J A;  5AV8 A;  3B0D C;  3KWQ B;  3AZM D;  1KX3 D;  2F8N B;  3WKJ B;  3REL A;  3W99 C;  3MGS A;  3X1U C;  3REJ D;  1TZY C;  3WA9 A;  1P3G A;  1P3L A;  4YS3 C;  1EQZ B;  2UWX A;  5B31 A;  3MNN A;  3EPJ A;  3MVD B;  3MGQ D;  3AV2 B;  2CV5 D;  3B0D B;  1M19 D;  5GT3 D;  3AZI A;  3LZ1 B;  3C1C D;  4UUZ B;  3VH5 W;  1KX3 A;  3UT9 C;  1AOI C;  1TZY B;  1Q9C A;  4J8U B;  5AV5 B;  5KDM B;  3NQU A;  5AV9 A;  4Z5T C;  1F66 D;  4KUD D;  3LZ0 D;  1KX5 C;  1P3A A;  1M19 A;  1U35 C;  3UT9 B;  1AOI B;  5GT3 A;  3W98 B;  3C1C A;  4R8P B;  4J8X C;  1W2E A;  2NZD D;  2W8S A;  4WU8 C;  1KX5 B;  3VH6 W;  3MGP C;  1F66 A;  4KUD A;  5GSU A;  1N1J B;  3LZ0 A;  3AZL D;  4WU8 B;  4Z2M H;  5GT0 B;  1P3O D;  2Y2M A;  5B1L D;  5B2I A;  3W98 A;  2NZD A;  1P3I D;  1S32 B;  3KSY A;  4NE6 A;  3VH5 A;  5B0Z D;  2LY8 A;  3B0C W;  3H0M C;  4H9O B;  1P3K C;  1KU5 A;  4CAY B;  3KFU G;  1M1A C;  1BFM A;  4XZQ B;  1ID3 A;  4Z2M G;  2XD1 A;  5B32 A;  3AYW C;  5B33 C;  3AZL A;  5B1L A;  3REI D;  2BYK A;  3MGR D;  3WAA D;  1P3K B;  5B0Z A;  5JRG B;  3REK C;  1HQ3 D;  3H0R C;  4WU9 A;  4G91 C;  3VH6 A;  3AV1 A;  3KXB B;  4KHA B;  3V9R A;  5BNV B;  5BO0 B;  4XZQ A;  2PYO C;  4Z66 D;  3AZH B;  3AZG C;  1KX4 C;  1JFI A;  5CPJ A;  4EO5 C;  3REI A;  3MGR A;  3REK B;  3WAA A;  3AZF B;  1BH9 A;  5AVB D;  3AZJ C;  1T3U A;  5GXQ D;  5BNX A;  1P3M B;  1HQ3 A;  4YM6 C;  2YFW B;  2YFV B;  3TU4 B;  4J8V C;  2Y2L A;  1M18 D;  3A1I A;  5CPI C;  1KX4 B;  3KXB A;  5B0Y C;  3AZE D;  4EO5 B;  4Z66 A;  4H9Q A;  2F8N K;  5B24 C;  3AZJ B;  5E5A B;  4YM6 B;  4J8V B;  2ARO B;  5AVB A;  4ZUX A;  2NQB B;  3KUY B;  1ZLA C;  3X1T A;  2YFW A;  1M18 A;  5AV6 B;  3AZE A;  3X1S B;  5B24 B;  3A6N C;  3UTB D;  3LJA C;  4HGA B;  5AVC C;  4H9N B;  3MGS D;  4CSR A;  5DNM C;  3REH C;  3UTA C;  5B40 C;  1P34 C;  2BYM B;  5CPK C;  3WA9 D;  2ARO A;  5B2J C;  1P3L D;  5B1M B;  3EPH A;  3REL C;  3MNN D;  3IP4 C;  2F8N H;  5AY8 A;  1TAF B;  3O62 C;  3H0L C;  4H9P A;  1P3G C;  4ZBJ C;  5B31 G;  4J8W B;  3AFA B;  2Y2P A;  2Y2K A;  5B31 C;  5B40 B;  5DNM B;  3REH B;  1P34 B;  5CPK B;  3KWQ D;  2F8N D;  3WKJ D;  4X23 C;  4M6B A;  3B6F B;  3B6G C;  5AV9 D;  5DNN A;  3W97 A;  3AZM C;  1P3P B;  1KX3 C;  3O62 B;  1EQZ D;  2FJ7 B;  4ZBJ B;  5B1M A;  1P3B C;  4H9R B;  1P3A D;  1P3F C;  3A1K A;  3REJ C;  3MVD D;  2DF4 C;  3AV2 D;  3W99 B;  4X23 B;  2G5I C;  3LZ1 D;  5F99 C;  3X1U B;  2F8N A;  5BS7 A;  3KWQ A;  3B6G B;  2CV5 C;  3MGQ C;  3WKJ A;  4YS3 B;  1M19 C;  3AZM B;  1TZY D;  4J8U D;  5AV5 D;  3C1C C;  1P3B B;  2XD5 A;  2HUE C;  2BG1 A;  5GSU D;  3REJ B;  1P3F B;  1EQZ A;  2Y2O A;  5F99 B;  3MVD A;  3AV2 A;  1F66 C;  2CV5 B;  3MGQ B;  3UT9 D;  2JCH A;  1AOI D;  5B2I D;  4DQY B;  3W98 D;  3LZ1 A;  4R8P D;  4UUZ A;  2VQR A;  4Z5T B;  1TZY A;  5CHL B;  4J8U A;  5AV5 A;  3W96 C;  5KDM A;  2NZD C;  1U35 B;  1ID3 D;  2HIO C;  4J8X B;  5B32 D;  3P5J B;  3UT9 A;  1AOI A;  5GT0 D;  4R8P A;  3W96 B;  5B32 G;  4G92 C;  3EPL A;  3MGP B;  1S32 D;  4QLC C;  1P3O C;  4WU9 D;  5JA4 B;  2HIO B;  1P3I C;  1KX5 A;  3AV1 D;  1PZR A;  1N1J A;  5B0Z C;  4XZQ D; 
#chains in the Genus database with same CATH homology
 5CP6 C;  2L5A A;  3C1B C;  4G92 B;  4WU8 A;  5CPJ D;  5GT0 A;  4QLC B;  1P3O B;  5C3I C;  1S32 A;  3MGP A;  2Y2N A;  1M1A B;  5JRG D;  4H9O A;  3REI C;  4CAY A;  3AYW B;  5B33 B;  5CP6 B;  3C1B B;  4WJ3 C;  3AZK C;  3KXB D;  4WNN B;  1HQ3 C;  1BH8 B;  3AZH D;  2FFF B;  3AN2 C;  3REK D;  4G91 B;  3AZF D;  4JJN C;  1P3K A;  4ZUX D;  5JRG A;  3AZK B;  3AZN C;  1M1A A;  1P3M D;  2PYO B;  3X1T D;  3TU4 D;  3X1V C;  4KGC C;  3AYW A;  3AZG B;  5B33 A;  4KHA A;  5GXQ C;  1H3O B;  5BNV A;  1KX4 D;  5BO0 A;  3AN2 B;  1M18 C;  4JJN B;  3AZH A;  3AZJ D;  3AZE C;  3AZN B;  3REK A;  4H9S C;  2Y2G A;  5E5A D;  4YM6 D;  3AZF A;  4KGC B;  3X1V B;  2ARO D;  5CPI B;  1P3M A;  2NQB D;  5B0Y B;  3KUY D;  2YFV A;  3TU4 A;  2DQN C;  5AY8 D;  4XUJ C;  5AV6 D;  1KX4 A;  3NQJ B;  3WTP C;  3X1S D;  2CWE A;  3B0B A;  3LEL C;  3AZJ A;  1ZLA B;  4E45 A;  4AWL C;  2JE5 A;  2RVQ D;  5E5A A;  4YM6 A;  3UTB C;  4J8V A;  4LD9 C;  4E44 A;  5AV8 C;  4UPK A;  5DNN D;  3WTP E;  2NQB A;  3W97 D;  3KUY A;  4XUJ B;  4DRB A;  5B1M D;  3A6N B;  3WTP B;  3MGS C;  5BT1 D;  3LJA B;  2ZY4 A;  3WA9 C;  5AV6 A;  1P3L C;  5AVC B;  3X1S A;  5B24 A;  3LEL B;  3MNN C;  4J8W D;  3AFA D;  3UTA B;  2IO5 C;  1WWI A;  5G49 B;  5DNM D;  3REH D;  4LD9 B;  5AV8 B;  2Y2Q A;  5B2J B;  4NE5 A;  3AZI C;  3REL B;  4H9N A;  3B6F D;  3MGS B;  2BYM A;  2F8N G;  3WKJ C;  5BS7 C;  3WA9 B;  1P3G B;  1P3P D;  2Y2H A;  1P3L B;  3O62 D;  2FJ7 D;  3FDD A;  5B31 B;  3MNN B;  5AV9 C;  1TAF A;  1EQZ C;  4J8W A;  3W99 D;  4X23 D;  3AFA A;  3AZI B;  1P3A C;  5B40 A;  5DNM A;  3REH A;  1P34 A;  3X1U D;  5CPK A;  1KX3 B;  3B6G D;  3MVD C;  1WWS A;  5GT3 C;  4YS3 D;  3B6F A;  3NQU B;  3LZ1 C;  1P3B D;  5AV9 B;  1P3P A;  1P3F D;  3O62 A;  4J8U C;  2FJ7 A;  5AV5 C;  4H9R A;  1P3A B;  4KUD C;  5GSU C;  5F99 D;  1M19 B;  3LZ0 C;  3W99 A;  4X23 A;  5GT3 B;  1R4V A;  3C1C B;  3X1U A;  2HUE B;  3B6G A;  3VH5 T;  4YS3 A;  4Z5T D;  1A7W A;  3AZM A;  5B2I C;  3W98 C;  1KX5 D;  4R8P C;  1P3B A;  1P3F A;  3REJ A;  1F66 B;  1U35 D;  4KUD B;  5GSU B;  3LZ0 B;  1B6W A;  4J8X D;  1F1E A;  5F99 A;  4WU8 D;  2CV5 A;  3MGQ A;  1ID3 C;  4DRA A;  5B32 C;  5B2I B;  3W96 D;  2NZD B;  3AZL C;  1B67 A;  3MGP D;  5FUG B;  4Z5T A;  5B1L C;  5GT0 C;  2HIO D;  3VH6 T;  1S32 C;  1U35 A;  3EG5 B;  1ID3 B;  2RIQ A;  4J8X A;  4WU9 C;  5B32 B;  3AV1 C;  3AZL B;  1HTA A;  5B1L B;  4XZQ C;  4WZS B;  3W96 A;  4QLC D;  1P3I B;  2BYK B;  1P3K D;  5CPJ C;  5B0Z B;  5FUG A;  1M1A D;  3EPK A;  4WV4 B;  3MGR C;  3WAA C;  5JA4 A;  3B0C T;  2HIO A;  4WU9 B;  1Z2C B;  3AL0 C;  3AYW D;  5B33 D;  5CP6 D;  3C1B D;  3AV1 B;  3V9R B;  5JRG C;  5C3I B;  2F2A C;  2J8P A;  3KXB C;  1JFI B;  5CPJ B;  4QLC A;  3REI B;  1P3O A;  4Z66 C;  3F6T A;  3MGR B;  3WAA B;  1P3I A;  1BH9 B;  3AZH C;  5BNX B;  3AZK D;  1HQ3 B;  2PYO D;  5AVB C;  3AZF C;  5CP6 A;  3C1B A;  4ZUX C;  1ULY A;  3AZG D;  4WNN A;  1P3M C;  3X1T C;  3TU4 C;  1BH8 A;  4Z66 B;  2ZY2 A;  4H9Q B;  3AN2 D;  4JJN D;  3R45 B;  3AZN D;  4J8V D;  4KGC D;  3X1V D;  5AVB B;  5GXQ B;  4ZUX B;  3AZK A;  5CPI D;  5B0Y D;  2PYO A;  5E5A C;  3X1T B;  1M18 B;  2ARO C;  3AZG A;  1H3O A;  2NQB C;  5B24 D;  3KUY C;  3AZE B;  3AN2 A;  2ZM5 A;  5AY8 C;  4JJN A;  4NFT A;  5AV6 C;  2JSS A;  3AZN A;  1ZLA D;  3X1S C;  3R45 A;  4CSR B;  4KGC A;  3X1V A;  2Y2J A;  5CPI A;  4HGA C;  5B0Y A;  5GXQ A;  4XUJ D;  2RVQ C;  3A6N D;  3WTP D;  2ZY5 A;  3LJA D;  5DNN C;  3W97 C;  5AY8 B;  3NQJ A;  4H9P B;  4AWL B;  5B1M C;  5AVC D;  2G5H C;  3LEL D;  3UTB B;  5B40 D;  4H9S A;  2Y2I A;  2ZY3 A;  5BT1 C;  3UTA D;  1P34 D;  5CPK D;  4LD9 D;  5AV8 D;  5B2J D;  1ZLA A;  4NE3 A;  3REL D;  4J8W C;  3AFA C;  3KWQ C;  5DNN B;  3W97 B;  1P3G D;  4XUJ A;  3A6N A;  3WTP A;  2IO5 B;  5B31 D;  3B6F C;  3LJA A;  1P3P C;  5AVC A;  3LEL A;  2FJ7 C;  3UTA A;  3AZI D;  3UTB A;  5G49 A;  4LD9 A;  3AV2 C;  5B2J A;  5AV8 A;  3B0D C;  3KWQ B;  3AZM D;  1KX3 D;  2F8N B;  3WKJ B;  3REL A;  3W99 C;  3MGS A;  3X1U C;  3REJ D;  1TZY C;  3WA9 A;  1P3G A;  1P3L A;  4YS3 C;  1EQZ B;  2UWX A;  5B31 A;  3MNN A;  3EPJ A;  3MVD B;  3MGQ D;  3AV2 B;  2CV5 D;  3B0D B;  1M19 D;  5GT3 D;  3AZI A;  3LZ1 B;  3C1C D;  4UUZ B;  3VH5 W;  1KX3 A;  3UT9 C;  1AOI C;  1TZY B;  1Q9C A;  4J8U B;  5AV5 B;  5KDM B;  3NQU A;  5AV9 A;  4Z5T C;  1F66 D;  4KUD D;  3LZ0 D;  1KX5 C;  1P3A A;  1M19 A;  1U35 C;  3UT9 B;  1AOI B;  5GT3 A;  3W98 B;  3C1C A;  4R8P B;  4J8X C;  1W2E A;  2NZD D;  2W8S A;  4WU8 C;  1KX5 B;  3VH6 W;  3MGP C;  1F66 A;  4KUD A;  5GSU A;  1N1J B;  3LZ0 A;  3AZL D;  4WU8 B;  4Z2M H;  5GT0 B;  1P3O D;  2Y2M A;  5B1L D;  5B2I A;  3W98 A;  2NZD A;  1P3I D;  1S32 B;  3KSY A;  4NE6 A;  3VH5 A;  5B0Z D;  2LY8 A;  3B0C W;  3H0M C;  4H9O B;  1P3K C;  1KU5 A;  4CAY B;  3KFU G;  1M1A C;  1BFM A;  4XZQ B;  1ID3 A;  4Z2M G;  2XD1 A;  5B32 A;  3AYW C;  5B33 C;  3AZL A;  5B1L A;  3REI D;  2BYK A;  3MGR D;  3WAA D;  1P3K B;  5B0Z A;  5JRG B;  3REK C;  1HQ3 D;  3H0R C;  4WU9 A;  4G91 C;  3VH6 A;  3AV1 A;  3KXB B;  4KHA B;  3V9R A;  5BNV B;  5BO0 B;  4XZQ A;  2PYO C;  4Z66 D;  3AZH B;  3AZG C;  1KX4 C;  1JFI A;  5CPJ A;  4EO5 C;  3REI A;  3MGR A;  3REK B;  3WAA A;  3AZF B;  1BH9 A;  5AVB D;  3AZJ C;  1T3U A;  5GXQ D;  5BNX A;  1P3M B;  1HQ3 A;  4YM6 C;  2YFW B;  2YFV B;  3TU4 B;  4J8V C;  2Y2L A;  1M18 D;  3A1I A;  5CPI C;  1KX4 B;  3KXB A;  5B0Y C;  3AZE D;  4EO5 B;  4Z66 A;  4H9Q A;  2F8N K;  5B24 C;  3AZJ B;  5E5A B;  4YM6 B;  4J8V B;  2ARO B;  5AVB A;  4ZUX A;  2NQB B;  3KUY B;  1ZLA C;  3X1T A;  2YFW A;  1M18 A;  5AV6 B;  3AZE A;  3X1S B;  5B24 B;  3A6N C;  3UTB D;  3LJA C;  4HGA B;  5AVC C;  4H9N B;  3MGS D;  4CSR A;  5DNM C;  3REH C;  3UTA C;  5B40 C;  1P34 C;  2BYM B;  5CPK C;  3WA9 D;  2ARO A;  5B2J C;  1P3L D;  5B1M B;  3EPH A;  3REL C;  3MNN D;  3IP4 C;  2F8N H;  5AY8 A;  1TAF B;  3O62 C;  3H0L C;  4H9P A;  1P3G C;  4ZBJ C;  5B31 G;  4J8W B;  3AFA B;  2Y2P A;  2Y2K A;  5B31 C;  5B40 B;  5DNM B;  3REH B;  1P34 B;  5CPK B;  3KWQ D;  2F8N D;  3WKJ D;  4X23 C;  4M6B A;  3B6F B;  3B6G C;  5AV9 D;  5DNN A;  3W97 A;  3AZM C;  1P3P B;  1KX3 C;  3O62 B;  1EQZ D;  2FJ7 B;  4ZBJ B;  5B1M A;  1P3B C;  4H9R B;  1P3A D;  1P3F C;  3A1K A;  3REJ C;  3MVD D;  2DF4 C;  3AV2 D;  3W99 B;  4X23 B;  2G5I C;  3LZ1 D;  5F99 C;  3X1U B;  2F8N A;  5BS7 A;  3KWQ A;  3B6G B;  2CV5 C;  3MGQ C;  3WKJ A;  4YS3 B;  1M19 C;  3AZM B;  1TZY D;  4J8U D;  5AV5 D;  3C1C C;  1P3B B;  2XD5 A;  2HUE C;  2BG1 A;  5GSU D;  3REJ B;  1P3F B;  1EQZ A;  2Y2O A;  5F99 B;  3MVD A;  3AV2 A;  1F66 C;  2CV5 B;  3MGQ B;  3UT9 D;  2JCH A;  1AOI D;  5B2I D;  4DQY B;  3W98 D;  3LZ1 A;  4R8P D;  4UUZ A;  2VQR A;  4Z5T B;  1TZY A;  5CHL B;  4J8U A;  5AV5 A;  3W96 C;  5KDM A;  2NZD C;  1U35 B;  1ID3 D;  2HIO C;  4J8X B;  5B32 D;  3P5J B;  3UT9 A;  1AOI A;  5GT0 D;  4R8P A;  3W96 B;  5B32 G;  4G92 C;  3EPL A;  3MGP B;  1S32 D;  4QLC C;  1P3O C;  4WU9 D;  5JA4 B;  2HIO B;  1P3I C;  1KX5 A;  3AV1 D;  1PZR A;  1N1J A;  5B0Z C;  4XZQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...