4R8PB

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 24
structure length 86
sequence length 86
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pB00
5B40A 3AZEC 1EQZD 4YS3B 5B40C 5BNVB 5AVBD 4J8UD 1R4VA 1S32A 4HGAC 4KUDD 1P3GB 5CHLB 1S32C 3MGQA 4Z66D 3LELD 1KX4C 3MGQC 2F8ND 4H9NB 1M1AA 3AZHA 3MGRB 1P3IA 1M1AC 2HUEB 3AZHC 3LJAD 1P3IC 5KDMA 3LZ1B 3A6ND 3KXBD 2CV5A 3W98A 4AWLB 3W96D 4XZQB 1F1EA 3W98C 3UTAD 4KGCD 2AROB 3R45A 4LD9D 3C1CA 5AV9D 5E5AD 3O62A 1P34D 1BH9B 3X1SA 1M18C 5F99A 3X1SC 1P3FD 5AV8D 3REKA 4ZUXD 5JRGA 1P3KC 5AY8A 2PYOD 3B6GD 3WKJB 3REKC 3B0DC 5JRGC 3C1BD 3AN2B 5DNMB 1U35C 4Z5TA 2NZDB 1TZYA 1P3PB 3W99C 4Z5TC 3X1TD 1WWIA 5B24A 5AVCB 4H9SC 4H9QA 5B24C 1P3OA 1EQZB 3WAAA 3AZED 3UTBC 4CSRA 1N1JA 5B40D 4E45A 4KUDB 3MGPA 3AZNA 2F8NB 3MGPC 1S32D 3AZNC 3AZJA 3WTPA 4J8XA 4WU8C 3KWQA 2BYKA 1KX4D 3AZJC 3MGQD 3WTPC 3A6NB 5BNXB 3W96B 1M1AD 3AZHD 5BO0B 5AV6B 1P3ID 4KGCB 3REHC 2FJ7A 2NQBA 4J8VC 2FJ7C 2F8NH 2L5AA 3W98D 5E5AB 5CP6A 4UUZA 1M19A 3C1CD 4J8UA 1P34B 1M19C 4WU9C 1JFIB 1P3FB 4Z66A 3WA9B 2PYOB 3AFAA 1M18D 2RVQC 3X1SD 3AFAC 1AOIA 1P3KD 5F99D 3REKD 1AOIC 5JRGD 3MGSA 1HQ3B 3X1TB 5GXQB 3KUYB 1U35D 3MGSC 3AZKC 1ID3A 3W99D 1ID3C 4Z5TD 5B31C 2HIOB 2F8NK 3AZGC 4LD9A 5B2JC 5BT1C 1TAFB 3AZLB 5B24D 3RELA 3RELC 5DNNB 3UTBD 3NQUA 5GT3A 4EO5B 3MNNA 5CPJC 5GT3C 5B1MA 3MNNC 3B6GA 3AZMC 5B1MC 5AV8A 3B6FB 3MGPD 3REJB 3AZND 5GSUB 1P3LC 3AZJD 5FUGA 3WTPD 5G49A 5BS7C 3KWQD 3AZHB 3REIB 3MVDB 1ZLAA 5KDMB 5CPIA 3AV1A 2CV5B 1ZLAC 3W98B 5CPIC 3REHD 3AV1C 4J8VD 2FJ7D 2NQBD 3TU4C 4R8PA 3AYWA 3C1CB 4R8PC 3AYWC 1BH8A 5CP6D 1P3MA 1M19D 3O62B 1Q9CA 4J8WB 1P3MC 5C3IC 4X23A 4X23C 4WU9D 3AZFA 1ULYA 1KX4A 5F99B 3AZFC 3REKB 5JRGB 2RVQD 4XUJA 4H9RB 5AY8B 4YM6C 3AFAD 4XUJC 1AOID 1BFMA 1TZYB 5B32A 5AV5A 4E44A 3MGSD 3AZIA 5B32C 3AZKD 1ID3D 5AV5C 5B24B 5B31D 1WWSA 3X1UA 3AZIC 3AZGD 4H9QB 1P3OB 5B2JD 1H3OA 5BT1D 3X1UC 1KX3B 4JJNB 5B1LC 2IO5B 4G92B 3VH6A 3WAAB 4CSRB 3RELD 3LZ0C 3B0BA 5CPJD 5GT3D 1M18A 2YFWA 3AZNB 5B0ZC 3MNND 3X1VA 3UT9A 5CPKA 4CAYB 5B1MD 1P3KA 3X1VC 3UT9C 4J8XB 5B0YC 5CPKC 3KWQB 4QLCB 3KSYA 1P3BA 4G91B 1U35A 1P3BC 3W99A 3NQJA 1F66A 5GT0A 1F66C 2FJ7B 2NQBB 1ZLAD 4H9SA 5GT0C 5CPID 3AV1D 5B32G 4WNNB 4NFTA 5CP6B 4UUZB 3TU4D 3UTBA 1M19B 5JA4B 4YS3C 5AVBB 4R8PD 3AYWD 4J8UB 1HTAA 1P3GA 1P3MD 1P3GC 4Z66B 4X23D 5B33A 3LELB 4H9NA 4WU8A 5B33C 3AZFD 3VH5A 2BYMA 3MGRC 3LJAB 3V9RA 4XUJD 2HUEC 3KXBB 1ID3B 3LZ1C 3REHA 4AWLC 3UTAB 4J8VA 5B32D 4LD9B 5AV5D 3AZID 2AROC 3W97A 1KX5A 5AV9B 4Z2MG 3X1UD 3W97C 1KX5C 5B1LD 3NQUB 3AV2A 3MNNB 4WU9A 3LZ0D 3AV2C 3B6GB 5AV8B 4ZUXB 5B0ZD 3WKJA 2YFVB 3WKJC 3X1VD 3C1BB 3UT9D 5B0YD 3B0CW 5CPKD 2NZDA 1P3PA 5G49B 5DNMC 1P3BD 3AZKA 1P3PC 2NZDC 4NE5A 5B31A 3AV1B 4H9OB 3AZGA 1F66D 5B2JA 4H9PB 5GT0D 3AZEB 5B40B 1BH8B 5B2IA 5CPJA 5B2IC 4HGAB 1S32B 3AZMA 1P3GD 1KX4B 3B0CT 3MGQB 1P3LA 4DRAA 5B33D 4XUJB 4WU8D 5BS7A 3A6NC 1M1AB 5BO0A 3MGRD 3W96C 1P3IB 4KHAA 5B32B 5AV6C 4NE6A 3LZ1D 1P3AA 2JSSA 1P3AC 3X1UB 3TU4A 2AROD 1H3OB 3VH6W 3R45B 5B31G 3W97D 1KX5D 1B67A 4DRBA 1M18B 3WA9C 2YFWB 3AV2D 3UT9B 5CPKB 3X1SB 1P3KB 4YM6A 3B0DB 3WKJD 4WZSB 4NE3A 1U35B 1HQ3C 3X1TC 5GXQC 3W99B 3KUYC 1F66B 2HIOA 4Z5TB 1P3PD 2NZDD 5GT0B 2HIOC 1TAFA 3VH6T 3AZLC 5B1LA 5DNNA 3UTBB 5DNNC 1N1JB 3LZ0A 4EO5C 5B2ID 4ZBJC 5B0ZA 4Z2MH 3B6FA 3MGPB 3REJA 3VH5W 5B33B 5GSUA 3B6FC 4WU8B 5B0YA 3REJC 3AZMD 3AZJB 5GSUC 3WTPB 2BYMB 2BYKB 3REIA 3MVDA 1P3LD 3V9RB 3REIC 3MVDC 3REHB 2CV5C 5AV6D 4J8VB 1P3AD 3W97B 3C1CC 1KX5B 4YS3A 2CWEA 4J8WA 5BNVA 3O62C 4J8WC 3AV2B 4WU9B 3VH5T 3WA9D 5F99C 4H9RA 3AFAB 5AY8C 3MGRA 1AOIB 4YM6D 3LZ1A 3MGSB 1HQ3D 1TZYC 3AZKB 5GXQD 3KUYD 4XZQA 5B31B 3AZGB 2HIOD 2AROA 4XZQC 5B2JB 1KX3A 4JJNA 1P3OC 3AZLD 1KX3C 4JJNC 3RELB 2IO5C 3WAAC 4G92C 1A7WA 5B2IB 5DNND 5CPJB 1BH9A 5GT3B 4CAYA 3AZMB 5B1MB 4QLCA 3B6FD 4J8XC 1P3LB 3KWQC 4QLCC 3REJD 5GSUD 3AN2A 5DNMA 4G91C 5FUGB 3AN2C 3REID 3MVDD 4KHAB 1ZLAB 1P3AB 5CPIB 5AVCA 2NQBC 2CV5D 4WNNA 1EQZA 5AVCC 3TU4B 1EQZC 5CP6C 5JA4A 5AVBA 4R8PB 3AYWB 5AVBC 4J8UC 4KUDA 4YS3D 1P3MB 5C3IB 3O62D 4J8WD 4KUDC 3LELA 4X23B 2F8NA 4Z66C 3LELC 3AZFB 4YM6B 3LJAA 5AY8D 3A6NA 5BNXA 3KXBA 3LJAC 3W96A 3KXBC 5AV6A 3UTAA 4KGCA 1TZYD 3UTAC 4KGCC 5AV5B 3AZIB 4LD9C 4M6BA 5AV9A 5E5AA 4XZQD 1P3OD 5AV9C 5E5AC 5B1LB 4WV4B 1KX3D 4JJND 1P34A 3WAAD 2LY8A 1P34C 3LZ0B 4ZBJB 1JFIA 1P3FA 3WA9A 4ZUXA 5B0ZB 2PYOA 2YFVA 3B6GC 1P3FC 5AV8C 4ZUXC 3X1VB 3C1BA 2PYOC 5B0YB 3C1BC 1KU5A 3WTPE 4J8XD 2F8NG 4QLCD 1P3BB 1HQ3A 3X1TA 5GXQA 3KUYA 3AN2D 4H9OA 5DNMD 3NQJB 4H9PA 3AZLA 3AZEA 5AVCD 1B6WA
chains in the Genus database with same CATH superfamily
5B40A 3AZEC 1EQZD 4YS3B 5B40C 5BNVB 5AVBD 4J8UD 1R4VA 1S32A 4HGAC 4KUDD 1P3GB 5CHLB 1S32C 3MGQA 4Z66D 3LELD 1KX4C 3MGQC 2F8ND 3EPLA 4H9NB 1M1AA 3AZHA 3MGRB 1P3IA 1M1AC 3H0LC 2HUEB 3AZHC 3LJAD 1P3IC 5KDMA 3LZ1B 3A6ND 3KXBD 2CV5A 3W98A 4AWLB 3W96D 4XZQB 1F1EA 3W98C 3UTAD 4KGCD 2AROB 3R45A 2Y2NA 4LD9D 3C1CA 5AV9D 5E5AD 3O62A 1P34D 1BH9B 3X1SA 1M18C 5F99A 3X1SC 1P3FD 5AV8D 3REKA 4ZUXD 5JRGA 1P3KC 5AY8A 2PYOD 3B6GD 3WKJB 3REKC 3B0DC 5JRGC 3C1BD 3AN2B 5DNMB 1U35C 4Z5TA 2Y2PA 2NZDB 1TZYA 1P3PB 3W99C 2Y2HA 4Z5TC 3X1TD 1WWIA 5B24A 5AVCB 4H9SC 4H9QA 5B24C 1P3OA 1EQZB 3WAAA 3AZED 3UTBC 4CSRA 1N1JA 5B40D 4E45A 4KUDB 3MGPA 3AZNA 2F8NB 3MGPC 1S32D 3AZNC 3AZJA 3WTPA 4J8XA 4WU8C 3KWQA 2BYKA 1KX4D 3AZJC 3MGQD 3WTPC 3A6NB 5BNXB 3W96B 1M1AD 3FDDA 3AZHD 5BO0B 1W2EA 5AV6B 1P3ID 4KGCB 3REHC 2FJ7A 2NQBA 4J8VC 2FJ7C 2F8NH 2L5AA 3W98D 5E5AB 5CP6A 4UUZA 1M19A 1Z2CB 3C1CD 4J8UA 1P34B 1M19C 3AL0C 4WU9C 1JFIB 1P3FB 4Z66A 3WA9B 2PYOB 3AFAA 1M18D 2RVQC 3X1SD 3AFAC 1AOIA 1P3KD 5F99D 3REKD 1AOIC 5JRGD 3MGSA 1HQ3B 3X1TB 5GXQB 3KUYB 1U35D 3MGSC 3AZKC 1ID3A 2ZY3A 3W99D 1ID3C 4Z5TD 5B31C 2HIOB 2F8NK 3AZGC 4LD9A 5B2JC 5BT1C 1TAFB 3AZLB 5B24D 3RELA 2DF4C 3RELC 5DNNB 3UTBD 3NQUA 2DQNC 5GT3A 2XD5A 4EO5B 3MNNA 5CPJC 5GT3C 5B1MA 3MNNC 3B6GA 3AZMC 5B1MC 5AV8A 3B6FB 3MGPD 3REJB 3AZND 5GSUB 1P3LC 3AZJD 5FUGA 3WTPD 5G49A 5BS7C 3KWQD 3AZHB 3REIB 3MVDB 1ZLAA 5KDMB 5CPIA 3AV1A 2CV5B 1ZLAC 3W98B 5CPIC 3REHD 3AV1C 4J8VD 2FJ7D 2NQBD 3TU4C 4R8PA 3AYWA 3C1CB 4R8PC 3AYWC 1BH8A 5CP6D 1P3MA 1M19D 3O62B 1Q9CA 4J8WB 1P3MC 5C3IC 4X23A 4X23C 4WU9D 3AZFA 1ULYA 3A1IA 1KX4A 5F99B 3AZFC 3REKB 5JRGB 2RVQD 4XUJA 4H9RB 5AY8B 4YM6C 3AFAD 2ZY5A 4XUJC 2G5HC 1AOID 1BFMA 1TZYB 5B32A 5AV5A 4E44A 3MGSD 3AZIA 5B32C 3AZKD 1ID3D 5AV5C 5B24B 5B31D 1WWSA 3X1UA 3AZIC 3AZGD 4H9QB 1P3OB 5B2JD 1H3OA 5BT1D 3X1UC 1KX3B 4JJNB 5B1LC 2IO5B 4G92B 3VH6A 3WAAB 4CSRB 3RELD 3LZ0C 3B0BA 3H0RC 2Y2JA 5CPJD 5GT3D 1M18A 2YFWA 3AZNB 5B0ZC 3MNND 3X1VA 3UT9A 5CPKA 4CAYB 5B1MD 1P3KA 3X1VC 3UT9C 4J8XB 5B0YC 5CPKC 3KWQB 4QLCB 3KSYA 1P3BA 4G91B 1U35A 1P3BC 3P5JB 2XD1A 3W99A 3NQJA 1F66A 5GT0A 1F66C 2FJ7B 2NQBB 1ZLAD 4H9SA 5GT0C 5CPID 3AV1D 2FFFB 2W8SA 5B32G 4WNNB 4NFTA 5CP6B 4UUZB 3TU4D 3UTBA 1M19B 5JA4B 4YS3C 5AVBB 4R8PD 3AYWD 4J8UB 1HTAA 1P3GA 1P3MD 1P3GC 4Z66B 4X23D 5B33A 3LELB 4H9NA 3H0MC 4WU8A 5B33C 3AZFD 3VH5A 2BYMA 3MGRC 3LJAB 3A1KA 3V9RA 4XUJD 2HUEC 3KXBB 1ID3B 3LZ1C 2Y2LA 3REHA 4AWLC 3UTAB 4DQYB 4J8VA 5B32D 4LD9B 5AV5D 3AZID 2AROC 3W97A 1KX5A 5AV9B 4Z2MG 3X1UD 3W97C 1KX5C 5B1LD 3NQUB 2ZY4A 3AV2A 3MNNB 4WU9A 3LZ0D 3AV2C 3B6GB 5AV8B 4ZUXB 5B0ZD 3WKJA 2YFVB 3WKJC 3X1VD 3C1BB 3UT9D 5B0YD 3B0CW 5CPKD 2NZDA 1P3PA 5G49B 5DNMC 1P3BD 3AZKA 1P3PC 2NZDC 4NE5A 5B31A 3AV1B 4H9OB 3AZGA 1F66D 5B2JA 4H9PB 5GT0D 2BG1A 3AZEB 1PZRA 5B40B 1BH8B 5B2IA 5CPJA 5B2IC 4HGAB 1S32B 3AZMA 2J8PA 1P3GD 1KX4B 3B0CT 3MGQB 1P3LA 1T3UA 4DRAA 5B33D 4XUJB 4WU8D 5BS7A 3A6NC 1M1AB 5BO0A 3MGRD 3W96C 1P3IB 4KHAA 5B32B 5AV6C 4NE6A 3LZ1D 1P3AA 2JSSA 1P3AC 2JE5A 3X1UB 3TU4A 2AROD 1H3OB 3IP4C 3VH6W 3R45B 5B31G 3W97D 1KX5D 2UWXA 1B67A 4DRBA 3KFUG 1M18B 3WA9C 2YFWB 3AV2D 3UT9B 5CPKB 2VQRA 3X1SB 1P3KB 4YM6A 3B0DB 3WKJD 4WZSB 4NE3A 1U35B 1HQ3C 3X1TC 5GXQC 3W99B 3KUYC 1F66B 2HIOA 4Z5TB 1P3PD 2NZDD 5GT0B 2HIOC 1TAFA 3VH6T 3AZLC 5B1LA 5DNNA 3UTBB 5DNNC 1N1JB 3LZ0A 4EO5C 5B2ID 4ZBJC 5B0ZA 4Z2MH 3B6FA 3MGPB 3REJA 3VH5W 5B33B 2G5IC 5GSUA 3B6FC 4WU8B 5B0YA 3REJC 3AZMD 3AZJB 5GSUC 3WTPB 2BYMB 2BYKB 3REIA 3MVDA 1P3LD 2F2AC 2Y2KA 3V9RB 3REIC 3MVDC 3REHB 2CV5C 5AV6D 4J8VB 3EG5B 1P3AD 3W97B 3C1CC 1KX5B 4YS3A 2CWEA 4J8WA 5BNVA 3O62C 4J8WC 3AV2B 4WU9B 3VH5T 2Y2OA 2Y2MA 3WA9D 2Y2QA 5F99C 4H9RA 3AFAB 5AY8C 3MGRA 1AOIB 4YM6D 3LZ1A 3MGSB 1HQ3D 1TZYC 3AZKB 5GXQD 3KUYD 2RIQA 4XZQA 5B31B 3AZGB 2HIOD 2AROA 4XZQC 5B2JB 1KX3A 4JJNA 1P3OC 3AZLD 1KX3C 4JJNC 3RELB 2IO5C 3WAAC 4G92C 1A7WA 5B2IB 5DNND 3EPJA 1BH9A 5CPJB 5GT3B 4UPKA 4CAYA 3AZMB 5B1MB 4QLCA 3B6FD 4J8XC 1P3LB 3KWQC 4QLCC 3REJD 4WJ3C 5GSUD 3AN2A 5DNMA 4G91C 5FUGB 3AN2C 2Y2GA 3MVDD 4KHAB 3REID 1ZLAB 1P3AB 5CPIB 5AVCA 2NQBC 2CV5D 4WNNA 1EQZA 5AVCC 3TU4B 1EQZC 5CP6C 5JA4A 5AVBA 4R8PB 3AYWB 5AVBC 4J8UC 4KUDA 4YS3D 1P3MB 5C3IB 3O62D 4J8WD 4KUDC 3LELA 4X23B 2F8NA 4Z66C 3LELC 3AZFB 4YM6B 3LJAA 2Y2IA 5AY8D 3A6NA 3F6TA 5BNXA 3KXBA 3LJAC 3W96A 3KXBC 5AV6A 3UTAA 4KGCA 1TZYD 3UTAC 4KGCC 5AV5B 3AZIB 4LD9C 4M6BA 5AV9A 5E5AA 4XZQD 1P3OD 5AV9C 2JCHA 5E5AC 5B1LB 4WV4B 1KX3D 4JJND 1P34A 3WAAD 2LY8A 1P34C 3LZ0B 4ZBJB 1JFIA 1P3FA 3WA9A 4ZUXA 5B0ZB 2PYOA 2YFVA 3B6GC 1P3FC 5AV8C 4ZUXC 3EPKA 2ZM5A 3C1BA 3X1VB 2PYOC 5B0YB 3C1BC 1KU5A 3WTPE 4J8XD 2F8NG 4QLCD 1P3BB 1HQ3A 3X1TA 5GXQA 3KUYA 3AN2D 4H9OA 5DNMD 3NQJB 2ZY2A 4H9PA 3AZLA 3AZEA 3EPHA 5AVCD 1B6WA
chains in the Genus database with same CATH topology
5B40A 3AZEC 1EQZD 4YS3B 5B40C 5BNVB 5AVBD 4J8UD 1R4VA 1S32A 4HGAC 4KUDD 1P3GB 5CHLB 1S32C 3MGQA 4Z66D 3LELD 1KX4C 3MGQC 2F8ND 3EPLA 4H9NB 1M1AA 3AZHA 3MGRB 1P3IA 1M1AC 3H0LC 2HUEB 3AZHC 3LJAD 1P3IC 5KDMA 3LZ1B 3A6ND 3KXBD 2CV5A 3W98A 4AWLB 3W96D 4XZQB 1F1EA 3W98C 3UTAD 4KGCD 2AROB 3R45A 2Y2NA 4LD9D 3C1CA 5AV9D 5E5AD 3O62A 1P34D 1BH9B 3X1SA 1M18C 5F99A 3X1SC 1P3FD 5AV8D 3REKA 4ZUXD 5JRGA 1P3KC 5AY8A 2PYOD 3B6GD 3WKJB 3REKC 3B0DC 5JRGC 3C1BD 3AN2B 5DNMB 1U35C 4Z5TA 2Y2PA 2NZDB 1TZYA 1P3PB 3W99C 2Y2HA 4Z5TC 3X1TD 1WWIA 5B24A 5AVCB 4H9SC 4H9QA 5B24C 1P3OA 1EQZB 3WAAA 3AZED 3UTBC 4CSRA 1N1JA 5B40D 4E45A 4KUDB 3MGPA 3AZNA 2F8NB 3MGPC 1S32D 3AZNC 3AZJA 3WTPA 4J8XA 4WU8C 3KWQA 2BYKA 1KX4D 3AZJC 3MGQD 3WTPC 3A6NB 5BNXB 3W96B 1M1AD 3FDDA 3AZHD 5BO0B 1W2EA 5AV6B 1P3ID 4KGCB 3REHC 2FJ7A 2NQBA 4J8VC 2FJ7C 2F8NH 2L5AA 3W98D 5E5AB 5CP6A 4UUZA 1M19A 1Z2CB 3C1CD 4J8UA 1P34B 1M19C 3AL0C 4WU9C 1JFIB 1P3FB 4Z66A 3WA9B 2PYOB 3AFAA 1M18D 2RVQC 3X1SD 3AFAC 1AOIA 1P3KD 5F99D 3REKD 1AOIC 5JRGD 3MGSA 1HQ3B 3X1TB 5GXQB 3KUYB 1U35D 3MGSC 3AZKC 1ID3A 2ZY3A 3W99D 1ID3C 4Z5TD 5B31C 2HIOB 2F8NK 3AZGC 4LD9A 5B2JC 5BT1C 1TAFB 3AZLB 5B24D 3RELA 2DF4C 3RELC 5DNNB 3UTBD 3NQUA 2DQNC 5GT3A 2XD5A 4EO5B 3MNNA 5CPJC 5GT3C 5B1MA 3MNNC 3B6GA 3AZMC 5B1MC 5AV8A 3B6FB 3MGPD 3REJB 3AZND 5GSUB 1P3LC 3AZJD 5FUGA 3WTPD 5G49A 5BS7C 3KWQD 3AZHB 3REIB 3MVDB 1ZLAA 5KDMB 5CPIA 3AV1A 2CV5B 1ZLAC 3W98B 5CPIC 3REHD 3AV1C 4J8VD 2FJ7D 2NQBD 3TU4C 4R8PA 3AYWA 3C1CB 4R8PC 3AYWC 1BH8A 5CP6D 1P3MA 1M19D 3O62B 1Q9CA 4J8WB 1P3MC 5C3IC 4X23A 4X23C 4WU9D 3AZFA 1ULYA 3A1IA 1KX4A 5F99B 3AZFC 3REKB 5JRGB 2RVQD 4XUJA 4H9RB 5AY8B 4YM6C 3AFAD 2ZY5A 4XUJC 2G5HC 1AOID 1BFMA 1TZYB 5B32A 5AV5A 4E44A 3MGSD 3AZIA 5B32C 3AZKD 1ID3D 5AV5C 5B24B 5B31D 1WWSA 3X1UA 3AZIC 3AZGD 4H9QB 1P3OB 5B2JD 1H3OA 5BT1D 3X1UC 1KX3B 4JJNB 5B1LC 2IO5B 4G92B 3VH6A 3WAAB 4CSRB 3RELD 3LZ0C 3B0BA 3H0RC 2Y2JA 5CPJD 5GT3D 1M18A 2YFWA 3AZNB 5B0ZC 3MNND 3X1VA 3UT9A 5CPKA 4CAYB 5B1MD 1P3KA 3X1VC 3UT9C 4J8XB 5B0YC 5CPKC 3KWQB 4QLCB 3KSYA 1P3BA 4G91B 1U35A 1P3BC 3P5JB 2XD1A 3W99A 3NQJA 1F66A 5GT0A 1F66C 2FJ7B 2NQBB 1ZLAD 4H9SA 5GT0C 5CPID 3AV1D 2FFFB 2W8SA 5B32G 4WNNB 4NFTA 5CP6B 4UUZB 3TU4D 3UTBA 1M19B 5JA4B 4YS3C 5AVBB 4R8PD 3AYWD 4J8UB 1HTAA 1P3GA 1P3MD 1P3GC 4Z66B 4X23D 5B33A 3LELB 4H9NA 3H0MC 4WU8A 5B33C 3AZFD 3VH5A 2BYMA 3MGRC 3LJAB 3A1KA 3V9RA 4XUJD 2HUEC 3KXBB 1ID3B 3LZ1C 2Y2LA 3REHA 4AWLC 3UTAB 4DQYB 4J8VA 5B32D 4LD9B 5AV5D 3AZID 2AROC 3W97A 1KX5A 5AV9B 4Z2MG 3X1UD 3W97C 1KX5C 5B1LD 3NQUB 2ZY4A 3AV2A 3MNNB 4WU9A 3LZ0D 3AV2C 3B6GB 5AV8B 4ZUXB 5B0ZD 3WKJA 2YFVB 3WKJC 3X1VD 3C1BB 3UT9D 5B0YD 3B0CW 5CPKD 2NZDA 1P3PA 5G49B 5DNMC 1P3BD 3AZKA 1P3PC 2NZDC 4NE5A 5B31A 3AV1B 4H9OB 3AZGA 1F66D 5B2JA 4H9PB 5GT0D 2BG1A 3AZEB 1PZRA 5B40B 1BH8B 5B2IA 5CPJA 5B2IC 4HGAB 1S32B 3AZMA 2J8PA 1P3GD 1KX4B 3B0CT 3MGQB 1P3LA 1T3UA 4DRAA 5B33D 4XUJB 4WU8D 5BS7A 3A6NC 1M1AB 5BO0A 3MGRD 3W96C 1P3IB 4KHAA 5B32B 5AV6C 4NE6A 3LZ1D 1P3AA 2JSSA 1P3AC 2JE5A 3X1UB 3TU4A 2AROD 1H3OB 3IP4C 3VH6W 3R45B 5B31G 3W97D 1KX5D 2UWXA 1B67A 4DRBA 3KFUG 1M18B 3WA9C 2YFWB 3AV2D 3UT9B 5CPKB 2VQRA 3X1SB 1P3KB 4YM6A 3B0DB 3WKJD 4WZSB 4NE3A 1U35B 1HQ3C 3X1TC 5GXQC 3W99B 3KUYC 1F66B 2HIOA 4Z5TB 1P3PD 2NZDD 5GT0B 2HIOC 1TAFA 3VH6T 3AZLC 5B1LA 5DNNA 3UTBB 5DNNC 1N1JB 3LZ0A 4EO5C 5B2ID 4ZBJC 5B0ZA 4Z2MH 3B6FA 3MGPB 3REJA 3VH5W 5B33B 2G5IC 5GSUA 3B6FC 4WU8B 5B0YA 3REJC 3AZMD 3AZJB 5GSUC 3WTPB 2BYMB 2BYKB 3REIA 3MVDA 1P3LD 2F2AC 2Y2KA 3V9RB 3REIC 3MVDC 3REHB 2CV5C 5AV6D 4J8VB 3EG5B 1P3AD 3W97B 3C1CC 1KX5B 4YS3A 2CWEA 4J8WA 5BNVA 3O62C 4J8WC 3AV2B 4WU9B 3VH5T 2Y2OA 2Y2MA 3WA9D 2Y2QA 5F99C 4H9RA 3AFAB 5AY8C 3MGRA 1AOIB 4YM6D 3LZ1A 3MGSB 1HQ3D 1TZYC 3AZKB 5GXQD 3KUYD 2RIQA 4XZQA 5B31B 3AZGB 2HIOD 2AROA 4XZQC 5B2JB 1KX3A 4JJNA 1P3OC 3AZLD 1KX3C 4JJNC 3RELB 2IO5C 3WAAC 4G92C 1A7WA 5B2IB 5DNND 3EPJA 1BH9A 5CPJB 5GT3B 4UPKA 4CAYA 3AZMB 5B1MB 4QLCA 3B6FD 4J8XC 1P3LB 3KWQC 4QLCC 3REJD 4WJ3C 5GSUD 3AN2A 5DNMA 4G91C 5FUGB 3AN2C 2Y2GA 3MVDD 4KHAB 3REID 1ZLAB 1P3AB 5CPIB 5AVCA 2NQBC 2CV5D 4WNNA 1EQZA 5AVCC 3TU4B 1EQZC 5CP6C 5JA4A 5AVBA 4R8PB 3AYWB 5AVBC 4J8UC 4KUDA 4YS3D 1P3MB 5C3IB 3O62D 4J8WD 4KUDC 3LELA 4X23B 2F8NA 4Z66C 3LELC 3AZFB 4YM6B 3LJAA 2Y2IA 5AY8D 3A6NA 3F6TA 5BNXA 3KXBA 3LJAC 3W96A 3KXBC 5AV6A 3UTAA 4KGCA 1TZYD 3UTAC 4KGCC 5AV5B 3AZIB 4LD9C 4M6BA 5AV9A 5E5AA 4XZQD 1P3OD 5AV9C 2JCHA 5E5AC 5B1LB 4WV4B 1KX3D 4JJND 1P34A 3WAAD 2LY8A 1P34C 3LZ0B 4ZBJB 1JFIA 1P3FA 3WA9A 4ZUXA 5B0ZB 2PYOA 2YFVA 3B6GC 1P3FC 5AV8C 4ZUXC 3EPKA 2ZM5A 3C1BA 3X1VB 2PYOC 5B0YB 3C1BC 1KU5A 3WTPE 4J8XD 2F8NG 4QLCD 1P3BB 1HQ3A 3X1TA 5GXQA 3KUYA 3AN2D 4H9OA 5DNMD 3NQJB 2ZY2A 4H9PA 3AZLA 3AZEA 3EPHA 5AVCD 1B6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B40 A;  3AZE C;  1EQZ D;  4YS3 B;  5B40 C;  5BNV B;  5AVB D;  4J8U D;  1R4V A;  1S32 A;  4HGA C;  4KUD D;  1P3G B;  5CHL B;  1S32 C;  3MGQ A;  4Z66 D;  3LEL D;  1KX4 C;  3MGQ C;  2F8N D;  4H9N B;  1M1A A;  3AZH A;  3MGR B;  1P3I A;  1M1A C;  2HUE B;  3AZH C;  3LJA D;  1P3I C;  5KDM A;  3LZ1 B;  3A6N D;  3KXB D;  2CV5 A;  3W98 A;  4AWL B;  3W96 D;  4XZQ B;  1F1E A;  3W98 C;  3UTA D;  4KGC D;  2ARO B;  3R45 A;  4LD9 D;  3C1C A;  5AV9 D;  5E5A D;  3O62 A;  1P34 D;  1BH9 B;  3X1S A;  1M18 C;  5F99 A;  3X1S C;  1P3F D;  5AV8 D;  3REK A;  4ZUX D;  5JRG A;  1P3K C;  5AY8 A;  2PYO D;  3B6G D;  3WKJ B;  3REK C;  3B0D C;  5JRG C;  3C1B D;  3AN2 B;  5DNM B;  1U35 C;  4Z5T A;  2NZD B;  1TZY A;  1P3P B;  3W99 C;  4Z5T C;  3X1T D;  1WWI A;  5B24 A;  5AVC B;  4H9S C;  4H9Q A;  5B24 C;  1P3O A;  1EQZ B;  3WAA A;  3AZE D;  3UTB C;  4CSR A;  1N1J A;  5B40 D;  4E45 A;  4KUD B;  3MGP A;  3AZN A;  2F8N B;  3MGP C;  1S32 D;  3AZN C;  3AZJ A;  3WTP A;  4J8X A;  4WU8 C;  3KWQ A;  2BYK A;  1KX4 D;  3AZJ C;  3MGQ D;  3WTP C;  3A6N B;  5BNX B;  3W96 B;  1M1A D;  3AZH D;  5BO0 B;  5AV6 B;  1P3I D;  4KGC B;  3REH C;  2FJ7 A;  2NQB A;  4J8V C;  2FJ7 C;  2F8N H;  2L5A A;  3W98 D;  5E5A B;  5CP6 A;  4UUZ A;  1M19 A;  3C1C D;  4J8U A;  1P34 B;  1M19 C;  4WU9 C;  1JFI B;  1P3F B;  4Z66 A;  3WA9 B;  2PYO B;  3AFA A;  1M18 D;  2RVQ C;  3X1S D;  3AFA C;  1AOI A;  1P3K D;  5F99 D;  3REK D;  1AOI C;  5JRG D;  3MGS A;  1HQ3 B;  3X1T B;  5GXQ B;  3KUY B;  1U35 D;  3MGS C;  3AZK C;  1ID3 A;  3W99 D;  1ID3 C;  4Z5T D;  5B31 C;  2HIO B;  2F8N K;  3AZG C;  4LD9 A;  5B2J C;  5BT1 C;  1TAF B;  3AZL B;  5B24 D;  3REL A;  3REL C;  5DNN B;  3UTB D;  3NQU A;  5GT3 A;  4EO5 B;  3MNN A;  5CPJ C;  5GT3 C;  5B1M A;  3MNN C;  3B6G A;  3AZM C;  5B1M C;  5AV8 A;  3B6F B;  3MGP D;  3REJ B;  3AZN D;  5GSU B;  1P3L C;  3AZJ D;  5FUG A;  3WTP D;  5G49 A;  5BS7 C;  3KWQ D;  3AZH B;  3REI B;  3MVD B;  1ZLA A;  5KDM B;  5CPI A;  3AV1 A;  2CV5 B;  1ZLA C;  3W98 B;  5CPI C;  3REH D;  3AV1 C;  4J8V D;  2FJ7 D;  2NQB D;  3TU4 C;  4R8P A;  3AYW A;  3C1C B;  4R8P C;  3AYW C;  1BH8 A;  5CP6 D;  1P3M A;  1M19 D;  3O62 B;  1Q9C A;  4J8W B;  1P3M C;  5C3I C;  4X23 A;  4X23 C;  4WU9 D;  3AZF A;  1ULY A;  1KX4 A;  5F99 B;  3AZF C;  3REK B;  5JRG B;  2RVQ D;  4XUJ A;  4H9R B;  5AY8 B;  4YM6 C;  3AFA D;  4XUJ C;  1AOI D;  1BFM A;  1TZY B;  5B32 A;  5AV5 A;  4E44 A;  3MGS D;  3AZI A;  5B32 C;  3AZK D;  1ID3 D;  5AV5 C;  5B24 B;  5B31 D;  1WWS A;  3X1U A;  3AZI C;  3AZG D;  4H9Q B;  1P3O B;  5B2J D;  1H3O A;  5BT1 D;  3X1U C;  1KX3 B;  4JJN B;  5B1L C;  2IO5 B;  4G92 B;  3VH6 A;  3WAA B;  4CSR B;  3REL D;  3LZ0 C;  3B0B A;  5CPJ D;  5GT3 D;  1M18 A;  2YFW A;  3AZN B;  5B0Z C;  3MNN D;  3X1V A;  3UT9 A;  5CPK A;  4CAY B;  5B1M D;  1P3K A;  3X1V C;  3UT9 C;  4J8X B;  5B0Y C;  5CPK C;  3KWQ B;  4QLC B;  3KSY A;  1P3B A;  4G91 B;  1U35 A;  1P3B C;  3W99 A;  3NQJ A;  1F66 A;  5GT0 A;  1F66 C;  2FJ7 B;  2NQB B;  1ZLA D;  4H9S A;  5GT0 C;  5CPI D;  3AV1 D;  5B32 G;  4WNN B;  4NFT A;  5CP6 B;  4UUZ B;  3TU4 D;  3UTB A;  1M19 B;  5JA4 B;  4YS3 C;  5AVB B;  4R8P D;  3AYW D;  4J8U B;  1HTA A;  1P3G A;  1P3M D;  1P3G C;  4Z66 B;  4X23 D;  5B33 A;  3LEL B;  4H9N A;  4WU8 A;  5B33 C;  3AZF D;  3VH5 A;  2BYM A;  3MGR C;  3LJA B;  3V9R A;  4XUJ D;  2HUE C;  3KXB B;  1ID3 B;  3LZ1 C;  3REH A;  4AWL C;  3UTA B;  4J8V A;  5B32 D;  4LD9 B;  5AV5 D;  3AZI D;  2ARO C;  3W97 A;  1KX5 A;  5AV9 B;  4Z2M G;  3X1U D;  3W97 C;  1KX5 C;  5B1L D;  3NQU B;  3AV2 A;  3MNN B;  4WU9 A;  3LZ0 D;  3AV2 C;  3B6G B;  5AV8 B;  4ZUX B;  5B0Z D;  3WKJ A;  2YFV B;  3WKJ C;  3X1V D;  3C1B B;  3UT9 D;  5B0Y D;  3B0C W;  5CPK D;  2NZD A;  1P3P A;  5G49 B;  5DNM C;  1P3B D;  3AZK A;  1P3P C;  2NZD C;  4NE5 A;  5B31 A;  3AV1 B;  4H9O B;  3AZG A;  1F66 D;  5B2J A;  4H9P B;  5GT0 D;  3AZE B;  5B40 B;  1BH8 B;  5B2I A;  5CPJ A;  5B2I C;  4HGA B;  1S32 B;  3AZM A;  1P3G D;  1KX4 B;  3B0C T;  3MGQ B;  1P3L A;  4DRA A;  5B33 D;  4XUJ B;  4WU8 D;  5BS7 A;  3A6N C;  1M1A B;  5BO0 A;  3MGR D;  3W96 C;  1P3I B;  4KHA A;  5B32 B;  5AV6 C;  4NE6 A;  3LZ1 D;  1P3A A;  2JSS A;  1P3A C;  3X1U B;  3TU4 A;  2ARO D;  1H3O B;  3VH6 W;  3R45 B;  5B31 G;  3W97 D;  1KX5 D;  1B67 A;  4DRB A;  1M18 B;  3WA9 C;  2YFW B;  3AV2 D;  3UT9 B;  5CPK B;  3X1S B;  1P3K B;  4YM6 A;  3B0D B;  3WKJ D;  4WZS B;  4NE3 A;  1U35 B;  1HQ3 C;  3X1T C;  5GXQ C;  3W99 B;  3KUY C;  1F66 B;  2HIO A;  4Z5T B;  1P3P D;  2NZD D;  5GT0 B;  2HIO C;  1TAF A;  3VH6 T;  3AZL C;  5B1L A;  5DNN A;  3UTB B;  5DNN C;  1N1J B;  3LZ0 A;  4EO5 C;  5B2I D;  4ZBJ C;  5B0Z A;  4Z2M H;  3B6F A;  3MGP B;  3REJ A;  3VH5 W;  5B33 B;  5GSU A;  3B6F C;  4WU8 B;  5B0Y A;  3REJ C;  3AZM D;  3AZJ B;  5GSU C;  3WTP B;  2BYM B;  2BYK B;  3REI A;  3MVD A;  1P3L D;  3V9R B;  3REI C;  3MVD C;  3REH B;  2CV5 C;  5AV6 D;  4J8V B;  1P3A D;  3W97 B;  3C1C C;  1KX5 B;  4YS3 A;  2CWE A;  4J8W A;  5BNV A;  3O62 C;  4J8W C;  3AV2 B;  4WU9 B;  3VH5 T;  3WA9 D;  5F99 C;  4H9R A;  3AFA B;  5AY8 C;  3MGR A;  1AOI B;  4YM6 D;  3LZ1 A;  3MGS B;  1HQ3 D;  1TZY C;  3AZK B;  5GXQ D;  3KUY D;  4XZQ A;  5B31 B;  3AZG B;  2HIO D;  2ARO A;  4XZQ C;  5B2J B;  1KX3 A;  4JJN A;  1P3O C;  3AZL D;  1KX3 C;  4JJN C;  3REL B;  2IO5 C;  3WAA C;  4G92 C;  1A7W A;  5B2I B;  5DNN D;  5CPJ B;  1BH9 A;  5GT3 B;  4CAY A;  3AZM B;  5B1M B;  4QLC A;  3B6F D;  4J8X C;  1P3L B;  3KWQ C;  4QLC C;  3REJ D;  5GSU D;  3AN2 A;  5DNM A;  4G91 C;  5FUG B;  3AN2 C;  3REI D;  3MVD D;  4KHA B;  1ZLA B;  1P3A B;  5CPI B;  5AVC A;  2NQB C;  2CV5 D;  4WNN A;  1EQZ A;  5AVC C;  3TU4 B;  1EQZ C;  5CP6 C;  5JA4 A;  5AVB A;  4R8P B;  3AYW B;  5AVB C;  4J8U C;  4KUD A;  4YS3 D;  1P3M B;  5C3I B;  3O62 D;  4J8W D;  4KUD C;  3LEL A;  4X23 B;  2F8N A;  4Z66 C;  3LEL C;  3AZF B;  4YM6 B;  3LJA A;  5AY8 D;  3A6N A;  5BNX A;  3KXB A;  3LJA C;  3W96 A;  3KXB C;  5AV6 A;  3UTA A;  4KGC A;  1TZY D;  3UTA C;  4KGC C;  5AV5 B;  3AZI B;  4LD9 C;  4M6B A;  5AV9 A;  5E5A A;  4XZQ D;  1P3O D;  5AV9 C;  5E5A C;  5B1L B;  4WV4 B;  1KX3 D;  4JJN D;  1P34 A;  3WAA D;  2LY8 A;  1P34 C;  3LZ0 B;  4ZBJ B;  1JFI A;  1P3F A;  3WA9 A;  4ZUX A;  5B0Z B;  2PYO A;  2YFV A;  3B6G C;  1P3F C;  5AV8 C;  4ZUX C;  3X1V B;  3C1B A;  2PYO C;  5B0Y B;  3C1B C;  1KU5 A;  3WTP E;  4J8X D;  2F8N G;  4QLC D;  1P3B B;  1HQ3 A;  3X1T A;  5GXQ A;  3KUY A;  3AN2 D;  4H9O A;  5DNM D;  3NQJ B;  4H9P A;  3AZL A;  3AZE A;  5AVC D;  1B6W A; 
#chains in the Genus database with same CATH topology
 5B40 A;  3AZE C;  1EQZ D;  4YS3 B;  5B40 C;  5BNV B;  5AVB D;  4J8U D;  1R4V A;  1S32 A;  4HGA C;  4KUD D;  1P3G B;  5CHL B;  1S32 C;  3MGQ A;  4Z66 D;  3LEL D;  1KX4 C;  3MGQ C;  2F8N D;  3EPL A;  4H9N B;  1M1A A;  3AZH A;  3MGR B;  1P3I A;  1M1A C;  3H0L C;  2HUE B;  3AZH C;  3LJA D;  1P3I C;  5KDM A;  3LZ1 B;  3A6N D;  3KXB D;  2CV5 A;  3W98 A;  4AWL B;  3W96 D;  4XZQ B;  1F1E A;  3W98 C;  3UTA D;  4KGC D;  2ARO B;  3R45 A;  2Y2N A;  4LD9 D;  3C1C A;  5AV9 D;  5E5A D;  3O62 A;  1P34 D;  1BH9 B;  3X1S A;  1M18 C;  5F99 A;  3X1S C;  1P3F D;  5AV8 D;  3REK A;  4ZUX D;  5JRG A;  1P3K C;  5AY8 A;  2PYO D;  3B6G D;  3WKJ B;  3REK C;  3B0D C;  5JRG C;  3C1B D;  3AN2 B;  5DNM B;  1U35 C;  4Z5T A;  2Y2P A;  2NZD B;  1TZY A;  1P3P B;  3W99 C;  2Y2H A;  4Z5T C;  3X1T D;  1WWI A;  5B24 A;  5AVC B;  4H9S C;  4H9Q A;  5B24 C;  1P3O A;  1EQZ B;  3WAA A;  3AZE D;  3UTB C;  4CSR A;  1N1J A;  5B40 D;  4E45 A;  4KUD B;  3MGP A;  3AZN A;  2F8N B;  3MGP C;  1S32 D;  3AZN C;  3AZJ A;  3WTP A;  4J8X A;  4WU8 C;  3KWQ A;  2BYK A;  1KX4 D;  3AZJ C;  3MGQ D;  3WTP C;  3A6N B;  5BNX B;  3W96 B;  1M1A D;  3FDD A;  3AZH D;  5BO0 B;  1W2E A;  5AV6 B;  1P3I D;  4KGC B;  3REH C;  2FJ7 A;  2NQB A;  4J8V C;  2FJ7 C;  2F8N H;  2L5A A;  3W98 D;  5E5A B;  5CP6 A;  4UUZ A;  1M19 A;  1Z2C B;  3C1C D;  4J8U A;  1P34 B;  1M19 C;  3AL0 C;  4WU9 C;  1JFI B;  1P3F B;  4Z66 A;  3WA9 B;  2PYO B;  3AFA A;  1M18 D;  2RVQ C;  3X1S D;  3AFA C;  1AOI A;  1P3K D;  5F99 D;  3REK D;  1AOI C;  5JRG D;  3MGS A;  1HQ3 B;  3X1T B;  5GXQ B;  3KUY B;  1U35 D;  3MGS C;  3AZK C;  1ID3 A;  2ZY3 A;  3W99 D;  1ID3 C;  4Z5T D;  5B31 C;  2HIO B;  2F8N K;  3AZG C;  4LD9 A;  5B2J C;  5BT1 C;  1TAF B;  3AZL B;  5B24 D;  3REL A;  2DF4 C;  3REL C;  5DNN B;  3UTB D;  3NQU A;  2DQN C;  5GT3 A;  2XD5 A;  4EO5 B;  3MNN A;  5CPJ C;  5GT3 C;  5B1M A;  3MNN C;  3B6G A;  3AZM C;  5B1M C;  5AV8 A;  3B6F B;  3MGP D;  3REJ B;  3AZN D;  5GSU B;  1P3L C;  3AZJ D;  5FUG A;  3WTP D;  5G49 A;  5BS7 C;  3KWQ D;  3AZH B;  3REI B;  3MVD B;  1ZLA A;  5KDM B;  5CPI A;  3AV1 A;  2CV5 B;  1ZLA C;  3W98 B;  5CPI C;  3REH D;  3AV1 C;  4J8V D;  2FJ7 D;  2NQB D;  3TU4 C;  4R8P A;  3AYW A;  3C1C B;  4R8P C;  3AYW C;  1BH8 A;  5CP6 D;  1P3M A;  1M19 D;  3O62 B;  1Q9C A;  4J8W B;  1P3M C;  5C3I C;  4X23 A;  4X23 C;  4WU9 D;  3AZF A;  1ULY A;  3A1I A;  1KX4 A;  5F99 B;  3AZF C;  3REK B;  5JRG B;  2RVQ D;  4XUJ A;  4H9R B;  5AY8 B;  4YM6 C;  3AFA D;  2ZY5 A;  4XUJ C;  2G5H C;  1AOI D;  1BFM A;  1TZY B;  5B32 A;  5AV5 A;  4E44 A;  3MGS D;  3AZI A;  5B32 C;  3AZK D;  1ID3 D;  5AV5 C;  5B24 B;  5B31 D;  1WWS A;  3X1U A;  3AZI C;  3AZG D;  4H9Q B;  1P3O B;  5B2J D;  1H3O A;  5BT1 D;  3X1U C;  1KX3 B;  4JJN B;  5B1L C;  2IO5 B;  4G92 B;  3VH6 A;  3WAA B;  4CSR B;  3REL D;  3LZ0 C;  3B0B A;  3H0R C;  2Y2J A;  5CPJ D;  5GT3 D;  1M18 A;  2YFW A;  3AZN B;  5B0Z C;  3MNN D;  3X1V A;  3UT9 A;  5CPK A;  4CAY B;  5B1M D;  1P3K A;  3X1V C;  3UT9 C;  4J8X B;  5B0Y C;  5CPK C;  3KWQ B;  4QLC B;  3KSY A;  1P3B A;  4G91 B;  1U35 A;  1P3B C;  3P5J B;  2XD1 A;  3W99 A;  3NQJ A;  1F66 A;  5GT0 A;  1F66 C;  2FJ7 B;  2NQB B;  1ZLA D;  4H9S A;  5GT0 C;  5CPI D;  3AV1 D;  2FFF B;  2W8S A;  5B32 G;  4WNN B;  4NFT A;  5CP6 B;  4UUZ B;  3TU4 D;  3UTB A;  1M19 B;  5JA4 B;  4YS3 C;  5AVB B;  4R8P D;  3AYW D;  4J8U B;  1HTA A;  1P3G A;  1P3M D;  1P3G C;  4Z66 B;  4X23 D;  5B33 A;  3LEL B;  4H9N A;  3H0M C;  4WU8 A;  5B33 C;  3AZF D;  3VH5 A;  2BYM A;  3MGR C;  3LJA B;  3A1K A;  3V9R A;  4XUJ D;  2HUE C;  3KXB B;  1ID3 B;  3LZ1 C;  2Y2L A;  3REH A;  4AWL C;  3UTA B;  4DQY B;  4J8V A;  5B32 D;  4LD9 B;  5AV5 D;  3AZI D;  2ARO C;  3W97 A;  1KX5 A;  5AV9 B;  4Z2M G;  3X1U D;  3W97 C;  1KX5 C;  5B1L D;  3NQU B;  2ZY4 A;  3AV2 A;  3MNN B;  4WU9 A;  3LZ0 D;  3AV2 C;  3B6G B;  5AV8 B;  4ZUX B;  5B0Z D;  3WKJ A;  2YFV B;  3WKJ C;  3X1V D;  3C1B B;  3UT9 D;  5B0Y D;  3B0C W;  5CPK D;  2NZD A;  1P3P A;  5G49 B;  5DNM C;  1P3B D;  3AZK A;  1P3P C;  2NZD C;  4NE5 A;  5B31 A;  3AV1 B;  4H9O B;  3AZG A;  1F66 D;  5B2J A;  4H9P B;  5GT0 D;  2BG1 A;  3AZE B;  1PZR A;  5B40 B;  1BH8 B;  5B2I A;  5CPJ A;  5B2I C;  4HGA B;  1S32 B;  3AZM A;  2J8P A;  1P3G D;  1KX4 B;  3B0C T;  3MGQ B;  1P3L A;  1T3U A;  4DRA A;  5B33 D;  4XUJ B;  4WU8 D;  5BS7 A;  3A6N C;  1M1A B;  5BO0 A;  3MGR D;  3W96 C;  1P3I B;  4KHA A;  5B32 B;  5AV6 C;  4NE6 A;  3LZ1 D;  1P3A A;  2JSS A;  1P3A C;  2JE5 A;  3X1U B;  3TU4 A;  2ARO D;  1H3O B;  3IP4 C;  3VH6 W;  3R45 B;  5B31 G;  3W97 D;  1KX5 D;  2UWX A;  1B67 A;  4DRB A;  3KFU G;  1M18 B;  3WA9 C;  2YFW B;  3AV2 D;  3UT9 B;  5CPK B;  2VQR A;  3X1S B;  1P3K B;  4YM6 A;  3B0D B;  3WKJ D;  4WZS B;  4NE3 A;  1U35 B;  1HQ3 C;  3X1T C;  5GXQ C;  3W99 B;  3KUY C;  1F66 B;  2HIO A;  4Z5T B;  1P3P D;  2NZD D;  5GT0 B;  2HIO C;  1TAF A;  3VH6 T;  3AZL C;  5B1L A;  5DNN A;  3UTB B;  5DNN C;  1N1J B;  3LZ0 A;  4EO5 C;  5B2I D;  4ZBJ C;  5B0Z A;  4Z2M H;  3B6F A;  3MGP B;  3REJ A;  3VH5 W;  5B33 B;  2G5I C;  5GSU A;  3B6F C;  4WU8 B;  5B0Y A;  3REJ C;  3AZM D;  3AZJ B;  5GSU C;  3WTP B;  2BYM B;  2BYK B;  3REI A;  3MVD A;  1P3L D;  2F2A C;  2Y2K A;  3V9R B;  3REI C;  3MVD C;  3REH B;  2CV5 C;  5AV6 D;  4J8V B;  3EG5 B;  1P3A D;  3W97 B;  3C1C C;  1KX5 B;  4YS3 A;  2CWE A;  4J8W A;  5BNV A;  3O62 C;  4J8W C;  3AV2 B;  4WU9 B;  3VH5 T;  2Y2O A;  2Y2M A;  3WA9 D;  2Y2Q A;  5F99 C;  4H9R A;  3AFA B;  5AY8 C;  3MGR A;  1AOI B;  4YM6 D;  3LZ1 A;  3MGS B;  1HQ3 D;  1TZY C;  3AZK B;  5GXQ D;  3KUY D;  2RIQ A;  4XZQ A;  5B31 B;  3AZG B;  2HIO D;  2ARO A;  4XZQ C;  5B2J B;  1KX3 A;  4JJN A;  1P3O C;  3AZL D;  1KX3 C;  4JJN C;  3REL B;  2IO5 C;  3WAA C;  4G92 C;  1A7W A;  5B2I B;  5DNN D;  3EPJ A;  1BH9 A;  5CPJ B;  5GT3 B;  4UPK A;  4CAY A;  3AZM B;  5B1M B;  4QLC A;  3B6F D;  4J8X C;  1P3L B;  3KWQ C;  4QLC C;  3REJ D;  4WJ3 C;  5GSU D;  3AN2 A;  5DNM A;  4G91 C;  5FUG B;  3AN2 C;  2Y2G A;  3MVD D;  4KHA B;  3REI D;  1ZLA B;  1P3A B;  5CPI B;  5AVC A;  2NQB C;  2CV5 D;  4WNN A;  1EQZ A;  5AVC C;  3TU4 B;  1EQZ C;  5CP6 C;  5JA4 A;  5AVB A;  4R8P B;  3AYW B;  5AVB C;  4J8U C;  4KUD A;  4YS3 D;  1P3M B;  5C3I B;  3O62 D;  4J8W D;  4KUD C;  3LEL A;  4X23 B;  2F8N A;  4Z66 C;  3LEL C;  3AZF B;  4YM6 B;  3LJA A;  2Y2I A;  5AY8 D;  3A6N A;  3F6T A;  5BNX A;  3KXB A;  3LJA C;  3W96 A;  3KXB C;  5AV6 A;  3UTA A;  4KGC A;  1TZY D;  3UTA C;  4KGC C;  5AV5 B;  3AZI B;  4LD9 C;  4M6B A;  5AV9 A;  5E5A A;  4XZQ D;  1P3O D;  5AV9 C;  2JCH A;  5E5A C;  5B1L B;  4WV4 B;  1KX3 D;  4JJN D;  1P34 A;  3WAA D;  2LY8 A;  1P34 C;  3LZ0 B;  4ZBJ B;  1JFI A;  1P3F A;  3WA9 A;  4ZUX A;  5B0Z B;  2PYO A;  2YFV A;  3B6G C;  1P3F C;  5AV8 C;  4ZUX C;  3EPK A;  2ZM5 A;  3C1B A;  3X1V B;  2PYO C;  5B0Y B;  3C1B C;  1KU5 A;  3WTP E;  4J8X D;  2F8N G;  4QLC D;  1P3B B;  1HQ3 A;  3X1T A;  5GXQ A;  3KUY A;  3AN2 D;  4H9O A;  5DNM D;  3NQJ B;  2ZY2 A;  4H9P A;  3AZL A;  3AZE A;  3EPH A;  5AVC D;  1B6W A; 
#chains in the Genus database with same CATH homology
 5B40 A;  3AZE C;  1EQZ D;  4YS3 B;  5B40 C;  5BNV B;  5AVB D;  4J8U D;  1R4V A;  1S32 A;  4HGA C;  4KUD D;  1P3G B;  5CHL B;  1S32 C;  3MGQ A;  4Z66 D;  3LEL D;  1KX4 C;  3MGQ C;  2F8N D;  3EPL A;  4H9N B;  1M1A A;  3AZH A;  3MGR B;  1P3I A;  1M1A C;  3H0L C;  2HUE B;  3AZH C;  3LJA D;  1P3I C;  5KDM A;  3LZ1 B;  3A6N D;  3KXB D;  2CV5 A;  3W98 A;  4AWL B;  3W96 D;  4XZQ B;  1F1E A;  3W98 C;  3UTA D;  4KGC D;  2ARO B;  3R45 A;  2Y2N A;  4LD9 D;  3C1C A;  5AV9 D;  5E5A D;  3O62 A;  1P34 D;  1BH9 B;  3X1S A;  1M18 C;  5F99 A;  3X1S C;  1P3F D;  5AV8 D;  3REK A;  4ZUX D;  5JRG A;  1P3K C;  5AY8 A;  2PYO D;  3B6G D;  3WKJ B;  3REK C;  3B0D C;  5JRG C;  3C1B D;  3AN2 B;  5DNM B;  1U35 C;  4Z5T A;  2Y2P A;  2NZD B;  1TZY A;  1P3P B;  3W99 C;  2Y2H A;  4Z5T C;  3X1T D;  1WWI A;  5B24 A;  5AVC B;  4H9S C;  4H9Q A;  5B24 C;  1P3O A;  1EQZ B;  3WAA A;  3AZE D;  3UTB C;  4CSR A;  1N1J A;  5B40 D;  4E45 A;  4KUD B;  3MGP A;  3AZN A;  2F8N B;  3MGP C;  1S32 D;  3AZN C;  3AZJ A;  3WTP A;  4J8X A;  4WU8 C;  3KWQ A;  2BYK A;  1KX4 D;  3AZJ C;  3MGQ D;  3WTP C;  3A6N B;  5BNX B;  3W96 B;  1M1A D;  3FDD A;  3AZH D;  5BO0 B;  1W2E A;  5AV6 B;  1P3I D;  4KGC B;  3REH C;  2FJ7 A;  2NQB A;  4J8V C;  2FJ7 C;  2F8N H;  2L5A A;  3W98 D;  5E5A B;  5CP6 A;  4UUZ A;  1M19 A;  1Z2C B;  3C1C D;  4J8U A;  1P34 B;  1M19 C;  3AL0 C;  4WU9 C;  1JFI B;  1P3F B;  4Z66 A;  3WA9 B;  2PYO B;  3AFA A;  1M18 D;  2RVQ C;  3X1S D;  3AFA C;  1AOI A;  1P3K D;  5F99 D;  3REK D;  1AOI C;  5JRG D;  3MGS A;  1HQ3 B;  3X1T B;  5GXQ B;  3KUY B;  1U35 D;  3MGS C;  3AZK C;  1ID3 A;  2ZY3 A;  3W99 D;  1ID3 C;  4Z5T D;  5B31 C;  2HIO B;  2F8N K;  3AZG C;  4LD9 A;  5B2J C;  5BT1 C;  1TAF B;  3AZL B;  5B24 D;  3REL A;  2DF4 C;  3REL C;  5DNN B;  3UTB D;  3NQU A;  2DQN C;  5GT3 A;  2XD5 A;  4EO5 B;  3MNN A;  5CPJ C;  5GT3 C;  5B1M A;  3MNN C;  3B6G A;  3AZM C;  5B1M C;  5AV8 A;  3B6F B;  3MGP D;  3REJ B;  3AZN D;  5GSU B;  1P3L C;  3AZJ D;  5FUG A;  3WTP D;  5G49 A;  5BS7 C;  3KWQ D;  3AZH B;  3REI B;  3MVD B;  1ZLA A;  5KDM B;  5CPI A;  3AV1 A;  2CV5 B;  1ZLA C;  3W98 B;  5CPI C;  3REH D;  3AV1 C;  4J8V D;  2FJ7 D;  2NQB D;  3TU4 C;  4R8P A;  3AYW A;  3C1C B;  4R8P C;  3AYW C;  1BH8 A;  5CP6 D;  1P3M A;  1M19 D;  3O62 B;  1Q9C A;  4J8W B;  1P3M C;  5C3I C;  4X23 A;  4X23 C;  4WU9 D;  3AZF A;  1ULY A;  3A1I A;  1KX4 A;  5F99 B;  3AZF C;  3REK B;  5JRG B;  2RVQ D;  4XUJ A;  4H9R B;  5AY8 B;  4YM6 C;  3AFA D;  2ZY5 A;  4XUJ C;  2G5H C;  1AOI D;  1BFM A;  1TZY B;  5B32 A;  5AV5 A;  4E44 A;  3MGS D;  3AZI A;  5B32 C;  3AZK D;  1ID3 D;  5AV5 C;  5B24 B;  5B31 D;  1WWS A;  3X1U A;  3AZI C;  3AZG D;  4H9Q B;  1P3O B;  5B2J D;  1H3O A;  5BT1 D;  3X1U C;  1KX3 B;  4JJN B;  5B1L C;  2IO5 B;  4G92 B;  3VH6 A;  3WAA B;  4CSR B;  3REL D;  3LZ0 C;  3B0B A;  3H0R C;  2Y2J A;  5CPJ D;  5GT3 D;  1M18 A;  2YFW A;  3AZN B;  5B0Z C;  3MNN D;  3X1V A;  3UT9 A;  5CPK A;  4CAY B;  5B1M D;  1P3K A;  3X1V C;  3UT9 C;  4J8X B;  5B0Y C;  5CPK C;  3KWQ B;  4QLC B;  3KSY A;  1P3B A;  4G91 B;  1U35 A;  1P3B C;  3P5J B;  2XD1 A;  3W99 A;  3NQJ A;  1F66 A;  5GT0 A;  1F66 C;  2FJ7 B;  2NQB B;  1ZLA D;  4H9S A;  5GT0 C;  5CPI D;  3AV1 D;  2FFF B;  2W8S A;  5B32 G;  4WNN B;  4NFT A;  5CP6 B;  4UUZ B;  3TU4 D;  3UTB A;  1M19 B;  5JA4 B;  4YS3 C;  5AVB B;  4R8P D;  3AYW D;  4J8U B;  1HTA A;  1P3G A;  1P3M D;  1P3G C;  4Z66 B;  4X23 D;  5B33 A;  3LEL B;  4H9N A;  3H0M C;  4WU8 A;  5B33 C;  3AZF D;  3VH5 A;  2BYM A;  3MGR C;  3LJA B;  3A1K A;  3V9R A;  4XUJ D;  2HUE C;  3KXB B;  1ID3 B;  3LZ1 C;  2Y2L A;  3REH A;  4AWL C;  3UTA B;  4DQY B;  4J8V A;  5B32 D;  4LD9 B;  5AV5 D;  3AZI D;  2ARO C;  3W97 A;  1KX5 A;  5AV9 B;  4Z2M G;  3X1U D;  3W97 C;  1KX5 C;  5B1L D;  3NQU B;  2ZY4 A;  3AV2 A;  3MNN B;  4WU9 A;  3LZ0 D;  3AV2 C;  3B6G B;  5AV8 B;  4ZUX B;  5B0Z D;  3WKJ A;  2YFV B;  3WKJ C;  3X1V D;  3C1B B;  3UT9 D;  5B0Y D;  3B0C W;  5CPK D;  2NZD A;  1P3P A;  5G49 B;  5DNM C;  1P3B D;  3AZK A;  1P3P C;  2NZD C;  4NE5 A;  5B31 A;  3AV1 B;  4H9O B;  3AZG A;  1F66 D;  5B2J A;  4H9P B;  5GT0 D;  2BG1 A;  3AZE B;  1PZR A;  5B40 B;  1BH8 B;  5B2I A;  5CPJ A;  5B2I C;  4HGA B;  1S32 B;  3AZM A;  2J8P A;  1P3G D;  1KX4 B;  3B0C T;  3MGQ B;  1P3L A;  1T3U A;  4DRA A;  5B33 D;  4XUJ B;  4WU8 D;  5BS7 A;  3A6N C;  1M1A B;  5BO0 A;  3MGR D;  3W96 C;  1P3I B;  4KHA A;  5B32 B;  5AV6 C;  4NE6 A;  3LZ1 D;  1P3A A;  2JSS A;  1P3A C;  2JE5 A;  3X1U B;  3TU4 A;  2ARO D;  1H3O B;  3IP4 C;  3VH6 W;  3R45 B;  5B31 G;  3W97 D;  1KX5 D;  2UWX A;  1B67 A;  4DRB A;  3KFU G;  1M18 B;  3WA9 C;  2YFW B;  3AV2 D;  3UT9 B;  5CPK B;  2VQR A;  3X1S B;  1P3K B;  4YM6 A;  3B0D B;  3WKJ D;  4WZS B;  4NE3 A;  1U35 B;  1HQ3 C;  3X1T C;  5GXQ C;  3W99 B;  3KUY C;  1F66 B;  2HIO A;  4Z5T B;  1P3P D;  2NZD D;  5GT0 B;  2HIO C;  1TAF A;  3VH6 T;  3AZL C;  5B1L A;  5DNN A;  3UTB B;  5DNN C;  1N1J B;  3LZ0 A;  4EO5 C;  5B2I D;  4ZBJ C;  5B0Z A;  4Z2M H;  3B6F A;  3MGP B;  3REJ A;  3VH5 W;  5B33 B;  2G5I C;  5GSU A;  3B6F C;  4WU8 B;  5B0Y A;  3REJ C;  3AZM D;  3AZJ B;  5GSU C;  3WTP B;  2BYM B;  2BYK B;  3REI A;  3MVD A;  1P3L D;  2F2A C;  2Y2K A;  3V9R B;  3REI C;  3MVD C;  3REH B;  2CV5 C;  5AV6 D;  4J8V B;  3EG5 B;  1P3A D;  3W97 B;  3C1C C;  1KX5 B;  4YS3 A;  2CWE A;  4J8W A;  5BNV A;  3O62 C;  4J8W C;  3AV2 B;  4WU9 B;  3VH5 T;  2Y2O A;  2Y2M A;  3WA9 D;  2Y2Q A;  5F99 C;  4H9R A;  3AFA B;  5AY8 C;  3MGR A;  1AOI B;  4YM6 D;  3LZ1 A;  3MGS B;  1HQ3 D;  1TZY C;  3AZK B;  5GXQ D;  3KUY D;  2RIQ A;  4XZQ A;  5B31 B;  3AZG B;  2HIO D;  2ARO A;  4XZQ C;  5B2J B;  1KX3 A;  4JJN A;  1P3O C;  3AZL D;  1KX3 C;  4JJN C;  3REL B;  2IO5 C;  3WAA C;  4G92 C;  1A7W A;  5B2I B;  5DNN D;  3EPJ A;  1BH9 A;  5CPJ B;  5GT3 B;  4UPK A;  4CAY A;  3AZM B;  5B1M B;  4QLC A;  3B6F D;  4J8X C;  1P3L B;  3KWQ C;  4QLC C;  3REJ D;  4WJ3 C;  5GSU D;  3AN2 A;  5DNM A;  4G91 C;  5FUG B;  3AN2 C;  2Y2G A;  3MVD D;  4KHA B;  3REI D;  1ZLA B;  1P3A B;  5CPI B;  5AVC A;  2NQB C;  2CV5 D;  4WNN A;  1EQZ A;  5AVC C;  3TU4 B;  1EQZ C;  5CP6 C;  5JA4 A;  5AVB A;  4R8P B;  3AYW B;  5AVB C;  4J8U C;  4KUD A;  4YS3 D;  1P3M B;  5C3I B;  3O62 D;  4J8W D;  4KUD C;  3LEL A;  4X23 B;  2F8N A;  4Z66 C;  3LEL C;  3AZF B;  4YM6 B;  3LJA A;  2Y2I A;  5AY8 D;  3A6N A;  3F6T A;  5BNX A;  3KXB A;  3LJA C;  3W96 A;  3KXB C;  5AV6 A;  3UTA A;  4KGC A;  1TZY D;  3UTA C;  4KGC C;  5AV5 B;  3AZI B;  4LD9 C;  4M6B A;  5AV9 A;  5E5A A;  4XZQ D;  1P3O D;  5AV9 C;  2JCH A;  5E5A C;  5B1L B;  4WV4 B;  1KX3 D;  4JJN D;  1P34 A;  3WAA D;  2LY8 A;  1P34 C;  3LZ0 B;  4ZBJ B;  1JFI A;  1P3F A;  3WA9 A;  4ZUX A;  5B0Z B;  2PYO A;  2YFV A;  3B6G C;  1P3F C;  5AV8 C;  4ZUX C;  3EPK A;  2ZM5 A;  3C1B A;  3X1V B;  2PYO C;  5B0Y B;  3C1B C;  1KU5 A;  3WTP E;  4J8X D;  2F8N G;  4QLC D;  1P3B B;  1HQ3 A;  3X1T A;  5GXQ A;  3KUY A;  3AN2 D;  4H9O A;  5DNM D;  3NQJ B;  2ZY2 A;  4H9P A;  3AZL A;  3AZE A;  3EPH A;  5AVC D;  1B6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...