4AWLB

The nf-y transcription factor is structurally and functionally a sequence specific histone
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
92
structure length
92
Chain Sequence
FREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
publication title Sequence-Specific Transcription Factor NF-Y Displays Histone-Like DNA Binding and H2B-Like Ubiquitination.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2012-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4awlB00
3B0CW 3WTPD 3LJAC 5B31G 5AY8A 5AV5C 3AV1B 4Z2MG 1KX3D 4ZBJC 4G92B 3AYWA 4J8UD 4KUDA 2FJ7C 5GXQA 4JJNB 5CPIA 5AV6D 4CAYA 1AOIB 3AZFD 3W97D 5AV8B 3W98C 3REKB 1F66B 1BH8B 3LZ1C 5CP6B 3AZLD 1KU5A 5DNNC 1P3IC 3B6GC 3TU4B 3MGSC 2F8NK 5B32C 4KUDD 1P3OA 5CPKD 5B1LC 3AZHB 4YS3A 1P3FC 3WKJB 3UTAA 5GT0C 3MGPC 3LELA 5E5AC 4ZUXC 3REIC 3MGRC 3W99A 5C3IC 3AZNC 3O62B 1R4VA 5DNMA 3A6NC 4AWLC 3WTPC 3X1SA 3AZGB 4J8XA 1ZLAD 4WNNB 3REHB 2PYOB 3R45A 1M18D 4DRAA 3X1TC 3AZEB 4YS3D 3X1VB 4KHAB 1ID3D 3WA9B 3UTAD 2NZDD 1P3PB 5GXQB 2BYKB 5CPIB 1EQZA 4CSRA 1P3BB 3WAAB 5GSUA 5AV6C 1P3LA 4G91C 5DNMD 1P3AD 5F99A 4KGCD 3AZIA 1M19D 1P3MC 1P34D 2RVQD 4NE3A 5AV5A 1S32D 1P3OB 2AROD 3UTBA 3LZ0C 3AZJD 4UUZA 1KX4C 1U35B 2F8NA 1KX5D 4Z66B 5AVBD 5CPKC 2FJ7A 1P3LD 3W99B 2CV5B 3LJAD 4H9PB 3W98A 1HQ3C 3LZ1A 5BNXB 5B31B 4EO5B 3X1SB 3X1UD 4R8PD 4XZQD 2YFWA 5B24A 3R45B 3KXBD 1P3IA 3B6GA 1P3KC 3MGSA 1P3GC 1ZLAC 3MGQA 3C1CC 2FJ7D 4XUJB 1ID3C 1EQZB 2NZDC 5B1LA 1P3FA 1TAFA 1TZYB 5GT0A 3MGPA 3REIA 5E5AA 4ZUXA 3MGRA 3AN2B 2HUEB 5JRGB 3NQJA 5B0YB 4DRBA 5BNVB 5DNND 3AZNA 3A6NA 2NQBB 5B32D 1JFIB 3WTPA 1M19C 2YFVA 3AZMB 3B0DC 5GT3D 2RVQC 3UTBB 4QLCC 3X1TA 5B1LD 3W96C 1P3FD 1S32C 1BFMA 1KX3A 5E5AD 2AROC 3MGRD 5FUGB 3AZJC 1KX5C 3AZKC 4LD9C 3AV2C 5AVBC 5AV6A 3A6ND 3AZFA 3W97A 3RELC 3KUYD 5BO0A 5AV9D 5B40C 3AV1D 4Z5TC 4WU9C 5B1MB 2YFWB 5B24B 3X1TD 3MGSB 3AZLA 3X1UC 4R8PC 4WU8B 4XZQC 3MNNC 3MGQB 4JJND 3KXBC 3WTPE 1H3OA 3LZ0A 4YM6D 3MVDC 1TAFB 5CPJB 5CPKA 3MGPB 1F66D 4ZUXB 5B33B 5CP6D 4J8WB 1P3MD 5B2JC 5BS7C 3KWQD 3TU4D 1HQ3A 2BYMA 1N1JB 4H9OB 3B6FC 4H9QA 5B0ZB 3LZ0D 1KX4D 1ZLAA 4X23B 5GT3C 3REJB 2F8NG 3C1CA 1M18A 1KX3B 4E44A 3AFAB 1ID3A 2NZDA 4J8UB 4Z2MH 5B2IB 1M1AB 3O62D 5AVCC 1HQ3D 3AZFB 3W97B 3AZGD 3REHD 1P3AA 1WWIA 5AY8B 1P3KD 3KUYC 3AZED 1P3GD 5AV9C 3AV1C 4KGCA 3WA9D 5B32G 1M19A 3C1CD 3AZLB 4G92C 1P34A 3AYWB 1H3OB 4J8VD 3W96A 4KUDB 1S32A 4JJNC 3WAAD 1P3BD 2AROA 5CPKB 3AZJA 4CAYB 4YM6C 1AOIC 1KX5A 5AV8C 4LD9A 3AV2A 3C1BD 5AVBA 3REKC 1F66C 5KDMA 2IO5B 5CP6C 3RELA 3LJAA 2HIOD 4Z5TA 4WU9A 3KWQC 3TU4C 1HTAA 4QLCD 4H9NA 3W96D 1U35D 4Z66D 1ZLAB 3X1UA 4R8PA 4XZQA 1M18B 3KXBA 1B6WA 3AZHC 4YS3B 3AZKD 4LD9D 3AV2D 1ID3B 5JA4A 3UTAB 3LELB 2CV5D 3UT9D 3RELD 5B40D 4Z5TD 5B31D 4WU9D 5B2JA 3O62C 5DNMB 1P3AB 3AZGC 4KGCB 4J8XB 3REHC 1BH9A 3MNND 2PYOC 1M19B 1A7WA 5DNNA 4XUJD 3B6FA 1P34B 3AZEC 1ULYA 5B32A 3X1VC 3WA9C 3MVDD 1P3PC 5GT3A 5GXQC 5CPIC 4J8VC 3AN2D 3WAAC 4CSRB 1P3BC 5JRGD 5GSUB 5B2JD 1P3LB 5F99B 5AVCA 3C1BC 3AZIB 3LJAB 3B6FD 3KUYA 4H9NB 5AV9A 5AV5B 2HIOC 3AV1A 1P3OC 4ZBJB 4UUZB 3KXBB 1U35C 2F8NB 4Z66C 4JJNA 2FJ7B 4YM6A 5AVCD 1AOIA 5AV8A 2CV5C 3UT9C 3REKA 3W98B 1F66A 1BH8A 3LZ1B 5CP6A 3VH5T 5B31C 4EO5C 3X1SC 1P3MA 3KWQA 5DNNB 1P3IB 3B6GB 3TU4A 5B32B 4XUJC 5CPJD 1KX4A 4M6BA 1AOID 3AZHA 5B1LB 5AV8D 1P3FB 1TZYC 5B33D 5GT0B 3REKD 3REIB 5E5AB 4J8WD 3MGRB 3AN2C 5G49A 2HUEC 5JRGC 3NQJB 5B0YC 5B0ZD 5C3IB 3O62A 3A6NB 3AZNB 2NQBC 4AWLB 3WTPB 3KUYB 1B67A 2YFVB 5AV9B 4X23D 3REJD 4WNNA 3REHA 3AZGA 3AZMC 2PYOA 5BT1C 2JSSA 3UTBC 1P3KA 3AZEA 3X1TB 3AZHD 1P3GA 3WKJD 3AFAD 4KHAA 3X1VA 3WA9A 1P3PA 5B2ID 3B0BA 2BYKA 4J8VA 1M1AD 4YM6B 4HGAC 1P3BA 3WAAA 4E45A 5AV6B 4G91B 5AY8D 5BO0B 3C1BA 2PYOD 1P3MB 5B1MC 3VH6T 2LY8A 5B24C 3AYWD 3KWQB 3X1VD 1P3PD 2HIOA 4WU8C 3MGQC 5GXQD 3VH6A 5CPID 4QLCA 3LZ0B 1KX4B 1U35A 1WWSA 4Z66A 5CPJC 4H9SC 3AZKA 5G49B 5B33C 2F8NH 2CV5A 5CHLB 4H9PA 4J8WC 3UT9A 3B0CT 5B40A 1HQ3B 5BNXA 2BYMB 5B31A 1P3OD 5B0ZC 4H9QB 1P3KB 4NFTA 1P3GB 4X23C 3REJC 3NQUA 3MNNA 3C1CB 4H9RA 1KX3C 4XUJA 3LELD 3WKJC 3AFAC 4J8VB 3W99D 3MVDA 4J8UC 2NZDB 1TZYA 3V9RA 5B2IC 2L5AA 1M1AC 2CWEA 3AN2A 3AZFC 3W97C 3X1SD 5JRGA 3C1BB 4J8XD 5B0YA 5BS7A 3VH5W 5BNVA 5AY8C 2NQBA 1JFIA 3AZLC 3AZMA 2HIOB 3B0DB 3AYWC 4QLCB 1EQZD 3W96B 4KUDC 1S32B 1TZYD 2AROB 5GSUD 5FUGA 3AZJB 1KX5B 5F99D 3AZKB 4LD9B 3AV2B 3AZID 5AVBB 5B0YD 5KDMB 3UT9B 2IO5C 1F1EA 2NQBD 3RELB 5AV5D 5B40B 3AZMD 4Z5TB 4WU9B 5BT1D 5B1MA 3UTBD 2F8ND 3X1UB 4R8PB 3NQUB 4WU8A 4XZQB 4WZSB 3MNNB 1M18C 4H9RB 4YS3C 3KSYA 4NE6A 3UTAC 5JA4B 3MVDB 3LELC 5CPJA 3W98D 3V9RB 4H9SA 3W99C 5B33A 3LZ1D 4J8WA 5B2JB 5B1MD 5B24D 5DNMC 1P3AC 3B6GD 1P3ID 1Q9CA 3VH6W 3MGSD 4KGCC 4J8XC 4WU8D 1BH9B 1N1JA 3MGQD 4H9OA 3B6FB 5B0ZA 1P34C 3VH5A 4X23A 3REJA 5GT3B 4NE5A 4WV4B 5GT0D 3MGPD 3REID 4ZUXD 1EQZC 3WKJA 3AFAA 4J8UA 5GSUC 5B2IA 4HGAB 1P3LC 5F99C 1M1AA 3AZND 3AZIC 5AVCB
chains in the Genus database with same CATH superfamily
3B0CW 3WTPD 3LJAC 5B31G 2ZY2A 5AY8A 5AV5C 3AV1B 2ZY5A 1W2EA 4Z2MG 1KX3D 4ZBJC 4G92B 3AYWA 2Y2PA 4J8UD 4KUDA 2FJ7C 5GXQA 4JJNB 5CPIA 5AV6D 4CAYA 1AOIB 3AZFD 3W97D 5AV8B 3W98C 3REKB 1F66B 1BH8B 3LZ1C 5CP6B 3AZLD 1KU5A 5DNNC 1P3IC 3B6GC 3TU4B 3MGSC 2F8NK 5B32C 4KUDD 1P3OA 5CPKD 2VQRA 5B1LC 3AZHB 4YS3A 1P3FC 3WKJB 3UTAA 5GT0C 3MGPC 3LELA 5E5AC 4ZUXC 3REIC 3MGRC 2Y2LA 3W99A 3H0RC 5C3IC 3H0MC 3O62B 1R4VA 5DNMA 3A6NC 3AZNC 4AWLC 3WTPC 2FFFB 3X1SA 4J8XA 3AZGB 1ZLAD 4WNNB 3REHB 2PYOB 3R45A 1M18D 4DRAA 3X1TC 3AZEB 4YS3D 3X1VB 4KHAB 1ID3D 3WA9B 3UTAD 2NZDD 1P3PB 5GXQB 2BYKB 5CPIB 1EQZA 2JE5A 2G5IC 4CSRA 1P3BB 3WAAB 5GSUA 5AV6C 1P3LA 4G91C 5DNMD 1P3AD 5F99A 4KGCD 3AZIA 1M19D 1P3MC 1P34D 2RVQD 4NE3A 5AV5A 1S32D 1P3OB 2AROD 3UTBA 3LZ0C 3AZJD 4UUZA 1KX4C 1U35B 2F8NA 1KX5D 4Z66B 5AVBD 5CPKC 2FJ7A 1P3LD 2UWXA 3W99B 2XD5A 2CV5B 3LJAD 4H9PB 3W98A 3H0LC 1HQ3C 3LZ1A 5BNXB 5B31B 4EO5B 3X1SB 3X1UD 4R8PD 2YFWA 5B24A 4XZQD 3R45B 3KXBD 1P3IA 3B6GA 1P3KC 3MGSA 1P3GC 1ZLAC 3MGQA 3C1CC 2FJ7D 4XUJB 1ID3C 1EQZB 2NZDC 5B1LA 1P3FA 1TAFA 1TZYB 5GT0A 3MGPA 3REIA 5E5AA 4ZUXA 3MGRA 3AN2B 2HUEB 5JRGB 3NQJA 5B0YB 4DRBA 5BNVB 5DNND 3AZNA 3A6NA 2NQBB 5B32D 1JFIB 3WTPA 1M19C 2YFVA 3AZMB 3B0DC 5GT3D 2RVQC 3UTBB 4QLCC 3X1TA 5B1LD 3W96C 1P3FD 1S32C 1BFMA 1KX3A 5E5AD 2AROC 3MGRD 5FUGB 3AZJC 2Y2JA 1KX5C 3AZKC 4LD9C 3AV2C 5AVBC 5AV6A 3A6ND 3AZFA 3W97A 3RELC 3KUYD 5BO0A 5AV9D 5B40C 3AV1D 4Z5TC 4WU9C 3P5JB 5B1MB 2YFWB 5B24B 3X1TD 3MGSB 3AZLA 3X1UC 4R8PC 4WU8B 4XZQC 3MNNC 3MGQB 4JJND 3KXBC 3WTPE 1H3OA 3LZ0A 4YM6D 3MVDC 1TAFB 5CPJB 5CPKA 3MGPB 2DQNC 1F66D 4ZUXB 5B33B 5CP6D 4J8WB 1P3MD 5B2JC 5BS7C 3KWQD 3TU4D 1HQ3A 2BYMA 1N1JB 4H9OB 3B6FC 4H9QA 5B0ZB 2DF4C 3LZ0D 1KX4D 1ZLAA 4X23B 5GT3C 3REJB 2F8NG 3C1CA 1M18A 1KX3B 3A1IA 4E44A 3AFAB 1ID3A 2NZDA 4J8UB 4Z2MH 5B2IB 1M1AB 3O62D 5AVCC 1HQ3D 3AZFB 3W97B 3AZGD 3REHD 1P3AA 1WWIA 5AY8B 1P3KD 3KUYC 3AZED 1P3GD 5AV9C 3AV1C 4KGCA 3KFUG 3WA9D 5B32G 1M19A 3C1CD 3AZLB 4G92C 1P34A 3AYWB 1H3OB 4J8VD 3W96A 4KUDB 1S32A 4JJNC 3WAAD 2Y2QA 1P3BD 2AROA 5CPKB 3AZJA 3EPJA 4CAYB 4YM6C 1AOIC 1KX5A 5AV8C 4LD9A 3AV2A 3C1BD 5AVBA 3REKC 1F66C 5KDMA 3A1KA 2IO5B 5CP6C 3RELA 3LJAA 3EPLA 2HIOD 4Z5TA 4WU9A 3KWQC 3TU4C 1HTAA 4QLCD 4H9NA 3W96D 1U35D 4Z66D 1ZLAB 3X1UA 4R8PA 4XZQA 1M18B 3KXBA 1B6WA 3AZHC 4YS3B 3AZKD 4LD9D 3AV2D 1ID3B 5JA4A 3UTAB 3LELB 2CV5D 3UT9D 2Y2IA 3RELD 5B40D 4Z5TD 5B31D 4WU9D 5B2JA 3O62C 1PZRA 5DNMB 1P3AB 3AZGC 4KGCB 4J8XB 3REHC 1BH9A 3MNND 2PYOC 1M19B 1A7WA 5DNNA 4XUJD 3B6FA 1P34B 3AZEC 1ULYA 5B32A 2XD1A 3X1VC 3WA9C 3MVDD 1P3PC 5GT3A 2JCHA 4DQYB 5GXQC 5CPIC 4J8VC 3AN2D 3WAAC 4CSRB 1P3BC 5JRGD 5GSUB 5B2JD 1P3LB 5F99B 5AVCA 3C1BC 3AZIB 3LJAB 3B6FD 3KUYA 4H9NB 5AV9A 5AV5B 2HIOC 3AV1A 1P3OC 4ZBJB 4UUZB 3KXBB 1U35C 2F8NB 4Z66C 1T3UA 4JJNA 2FJ7B 4YM6A 5AVCD 1AOIA 5AV8A 2CV5C 3UT9C 3REKA 3W98B 1F66A 1BH8A 3LZ1B 5CP6A 3IP4C 3VH5T 4EO5C 5B31C 3X1SC 1P3MA 3EPHA 3KWQA 5DNNB 1P3IB 3B6GB 3TU4A 5B32B 2Y2KA 3EPKA 4XUJC 5CPJD 3FDDA 1KX4A 4M6BA 1AOID 3AZHA 3F6TA 5B1LB 5AV8D 1P3FB 1TZYC 5B33D 5GT0B 3REKD 3REIB 5E5AB 4J8WD 3MGRB 3AN2C 5G49A 2HUEC 5JRGC 3NQJB 5B0YC 5B0ZD 2Y2OA 5C3IB 3O62A 3A6NB 3AZNB 2NQBC 4AWLB 3WTPB 3KUYB 1B67A 2YFVB 5AV9B 4X23D 3REJD 4WNNA 3REHA 3AZGA 3AZMC 2PYOA 5BT1C 2JSSA 3UTBC 1P3KA 3AZEA 3X1TB 3AZHD 1P3GA 3WKJD 3AFAD 4KHAA 3X1VA 3WA9A 1P3PA 2ZY3A 5B2ID 3B0BA 2BYKA 4J8VA 4UPKA 1M1AD 2F2AC 4YM6B 4HGAC 1P3BA 3WAAA 4E45A 5AV6B 4G91B 5AY8D 5BO0B 3C1BA 2PYOD 1P3MB 5B1MC 3VH6T 3EG5B 2LY8A 5B24C 2W8SA 3AYWD 3KWQB 3X1VD 2Y2HA 1P3PD 2HIOA 4WU8C 3MGQC 5GXQD 3VH6A 5CPID 4QLCA 3LZ0B 1KX4B 1U35A 1WWSA 4Z66A 5CPJC 4H9SC 3AZKA 5G49B 5B33C 2F8NH 2CV5A 5CHLB 4H9PA 4J8WC 3UT9A 3B0CT 5B40A 1HQ3B 5BNXA 2BYMB 2Y2NA 5B31A 1P3OD 5B0ZC 4H9QB 1P3KB 4NFTA 1P3GB 4X23C 3REJC 3NQUA 3MNNA 3C1CB 4H9RA 1KX3C 4XUJA 3LELD 3AL0C 3WKJC 3AFAC 4J8VB 3W99D 3MVDA 4J8UC 2NZDB 1TZYA 3V9RA 5B2IC 2L5AA 1M1AC 2CWEA 3AN2A 3AZFC 3W97C 3X1SD 5JRGA 3C1BB 4J8XD 5B0YA 2Y2GA 5BS7A 3VH5W 5BNVA 5AY8C 2NQBA 1JFIA 2RIQA 2BG1A 3AZLC 3AZMA 2HIOB 3B0DB 2ZM5A 3AYWC 4QLCB 1EQZD 3W96B 4KUDC 1S32B 1TZYD 2AROB 5GSUD 4WJ3C 5FUGA 3AZJB 1KX5B 5F99D 2ZY4A 3AZKB 4LD9B 3AV2B 1Z2CB 3AZID 5AVBB 5B0YD 5KDMB 3UT9B 2IO5C 1F1EA 2NQBD 3RELB 5AV5D 5B40B 3AZMD 4Z5TB 4WU9B 5BT1D 5B1MA 3UTBD 2F8ND 3X1UB 4WU8A 3NQUB 4WZSB 4XZQB 4R8PB 3MNNB 1M18C 4H9RB 4YS3C 3KSYA 4NE6A 3UTAC 5JA4B 3MVDB 3LELC 2J8PA 5CPJA 3W98D 3V9RB 4H9SA 2Y2MA 3W99C 5B33A 3LZ1D 4J8WA 5B2JB 5B1MD 5B24D 5DNMC 1P3AC 3B6GD 1P3ID 1Q9CA 3VH6W 3MGSD 4KGCC 4J8XC 4WU8D 1BH9B 1N1JA 3MGQD 4H9OA 3B6FB 5B0ZA 1P34C 3VH5A 4X23A 3REJA 5GT3B 4NE5A 2G5HC 4WV4B 5GT0D 3MGPD 3REID 4ZUXD 1EQZC 3WKJA 3AFAA 4J8UA 5GSUC 5B2IA 4HGAB 1P3LC 5F99C 1M1AA 3AZND 3AZIC 5AVCB
chains in the Genus database with same CATH topology
3B0CW 3WTPD 3LJAC 5B31G 2ZY2A 5AY8A 5AV5C 3AV1B 2ZY5A 1W2EA 4Z2MG 1KX3D 4ZBJC 4G92B 3AYWA 2Y2PA 4J8UD 4KUDA 2FJ7C 5GXQA 4JJNB 5CPIA 5AV6D 4CAYA 1AOIB 3AZFD 3W97D 5AV8B 3W98C 3REKB 1F66B 1BH8B 3LZ1C 5CP6B 3AZLD 1KU5A 5DNNC 1P3IC 3B6GC 3TU4B 3MGSC 2F8NK 5B32C 4KUDD 1P3OA 5CPKD 2VQRA 5B1LC 3AZHB 4YS3A 1P3FC 3WKJB 3UTAA 5GT0C 3MGPC 3LELA 5E5AC 4ZUXC 3REIC 3MGRC 2Y2LA 3W99A 3H0RC 5C3IC 3H0MC 3O62B 1R4VA 5DNMA 3A6NC 3AZNC 4AWLC 3WTPC 2FFFB 3X1SA 4J8XA 3AZGB 1ZLAD 4WNNB 3REHB 2PYOB 3R45A 1M18D 4DRAA 3X1TC 3AZEB 4YS3D 3X1VB 4KHAB 1ID3D 3WA9B 3UTAD 2NZDD 1P3PB 5GXQB 2BYKB 5CPIB 1EQZA 2JE5A 2G5IC 4CSRA 1P3BB 3WAAB 5GSUA 5AV6C 1P3LA 4G91C 5DNMD 1P3AD 5F99A 4KGCD 3AZIA 1M19D 1P3MC 1P34D 2RVQD 4NE3A 5AV5A 1S32D 1P3OB 2AROD 3UTBA 3LZ0C 3AZJD 4UUZA 1KX4C 1U35B 2F8NA 1KX5D 4Z66B 5AVBD 5CPKC 2FJ7A 1P3LD 2UWXA 3W99B 2XD5A 2CV5B 3LJAD 4H9PB 3W98A 3H0LC 1HQ3C 3LZ1A 5BNXB 5B31B 4EO5B 3X1SB 3X1UD 4R8PD 2YFWA 5B24A 4XZQD 3R45B 3KXBD 1P3IA 3B6GA 1P3KC 3MGSA 1P3GC 1ZLAC 3MGQA 3C1CC 2FJ7D 4XUJB 1ID3C 1EQZB 2NZDC 5B1LA 1P3FA 1TAFA 1TZYB 5GT0A 3MGPA 3REIA 5E5AA 4ZUXA 3MGRA 3AN2B 2HUEB 5JRGB 3NQJA 5B0YB 4DRBA 5BNVB 5DNND 3AZNA 3A6NA 2NQBB 5B32D 1JFIB 3WTPA 1M19C 2YFVA 3AZMB 3B0DC 5GT3D 2RVQC 3UTBB 4QLCC 3X1TA 5B1LD 3W96C 1P3FD 1S32C 1BFMA 1KX3A 5E5AD 2AROC 3MGRD 5FUGB 3AZJC 2Y2JA 1KX5C 3AZKC 4LD9C 3AV2C 5AVBC 5AV6A 3A6ND 3AZFA 3W97A 3RELC 3KUYD 5BO0A 5AV9D 5B40C 3AV1D 4Z5TC 4WU9C 3P5JB 5B1MB 2YFWB 5B24B 3X1TD 3MGSB 3AZLA 3X1UC 4R8PC 4WU8B 4XZQC 3MNNC 3MGQB 4JJND 3KXBC 3WTPE 1H3OA 3LZ0A 4YM6D 3MVDC 1TAFB 5CPJB 5CPKA 3MGPB 2DQNC 1F66D 4ZUXB 5B33B 5CP6D 4J8WB 1P3MD 5B2JC 5BS7C 3KWQD 3TU4D 1HQ3A 2BYMA 1N1JB 4H9OB 3B6FC 4H9QA 5B0ZB 2DF4C 3LZ0D 1KX4D 1ZLAA 4X23B 5GT3C 3REJB 2F8NG 3C1CA 1M18A 1KX3B 3A1IA 4E44A 3AFAB 1ID3A 2NZDA 4J8UB 4Z2MH 5B2IB 1M1AB 3O62D 5AVCC 1HQ3D 3AZFB 3W97B 3AZGD 3REHD 1P3AA 1WWIA 5AY8B 1P3KD 3KUYC 3AZED 1P3GD 5AV9C 3AV1C 4KGCA 3KFUG 3WA9D 5B32G 1M19A 3C1CD 3AZLB 4G92C 1P34A 3AYWB 1H3OB 4J8VD 3W96A 4KUDB 1S32A 4JJNC 3WAAD 2Y2QA 1P3BD 2AROA 5CPKB 3AZJA 3EPJA 4CAYB 4YM6C 1AOIC 1KX5A 5AV8C 4LD9A 3AV2A 3C1BD 5AVBA 3REKC 1F66C 5KDMA 3A1KA 2IO5B 5CP6C 3RELA 3LJAA 3EPLA 2HIOD 4Z5TA 4WU9A 3KWQC 3TU4C 1HTAA 4QLCD 4H9NA 3W96D 1U35D 4Z66D 1ZLAB 3X1UA 4R8PA 4XZQA 1M18B 3KXBA 1B6WA 3AZHC 4YS3B 3AZKD 4LD9D 3AV2D 1ID3B 5JA4A 3UTAB 3LELB 2CV5D 3UT9D 2Y2IA 3RELD 5B40D 4Z5TD 5B31D 4WU9D 5B2JA 3O62C 1PZRA 5DNMB 1P3AB 3AZGC 4KGCB 4J8XB 3REHC 1BH9A 3MNND 2PYOC 1M19B 1A7WA 5DNNA 4XUJD 3B6FA 1P34B 3AZEC 1ULYA 5B32A 2XD1A 3X1VC 3WA9C 3MVDD 1P3PC 5GT3A 2JCHA 4DQYB 5GXQC 5CPIC 4J8VC 3AN2D 3WAAC 4CSRB 1P3BC 5JRGD 5GSUB 5B2JD 1P3LB 5F99B 5AVCA 3C1BC 3AZIB 3LJAB 3B6FD 3KUYA 4H9NB 5AV9A 5AV5B 2HIOC 3AV1A 1P3OC 4ZBJB 4UUZB 3KXBB 1U35C 2F8NB 4Z66C 1T3UA 4JJNA 2FJ7B 4YM6A 5AVCD 1AOIA 5AV8A 2CV5C 3UT9C 3REKA 3W98B 1F66A 1BH8A 3LZ1B 5CP6A 3IP4C 3VH5T 4EO5C 5B31C 3X1SC 1P3MA 3EPHA 3KWQA 5DNNB 1P3IB 3B6GB 3TU4A 5B32B 2Y2KA 3EPKA 4XUJC 5CPJD 3FDDA 1KX4A 4M6BA 1AOID 3AZHA 3F6TA 5B1LB 5AV8D 1P3FB 1TZYC 5B33D 5GT0B 3REKD 3REIB 5E5AB 4J8WD 3MGRB 3AN2C 5G49A 2HUEC 5JRGC 3NQJB 5B0YC 5B0ZD 2Y2OA 5C3IB 3O62A 3A6NB 3AZNB 2NQBC 4AWLB 3WTPB 3KUYB 1B67A 2YFVB 5AV9B 4X23D 3REJD 4WNNA 3REHA 3AZGA 3AZMC 2PYOA 5BT1C 2JSSA 3UTBC 1P3KA 3AZEA 3X1TB 3AZHD 1P3GA 3WKJD 3AFAD 4KHAA 3X1VA 3WA9A 1P3PA 2ZY3A 5B2ID 3B0BA 2BYKA 4J8VA 4UPKA 1M1AD 2F2AC 4YM6B 4HGAC 1P3BA 3WAAA 4E45A 5AV6B 4G91B 5AY8D 5BO0B 3C1BA 2PYOD 1P3MB 5B1MC 3VH6T 3EG5B 2LY8A 5B24C 2W8SA 3AYWD 3KWQB 3X1VD 2Y2HA 1P3PD 2HIOA 4WU8C 3MGQC 5GXQD 3VH6A 5CPID 4QLCA 3LZ0B 1KX4B 1U35A 1WWSA 4Z66A 5CPJC 4H9SC 3AZKA 5G49B 5B33C 2F8NH 2CV5A 5CHLB 4H9PA 4J8WC 3UT9A 3B0CT 5B40A 1HQ3B 5BNXA 2BYMB 2Y2NA 5B31A 1P3OD 5B0ZC 4H9QB 1P3KB 4NFTA 1P3GB 4X23C 3REJC 3NQUA 3MNNA 3C1CB 4H9RA 1KX3C 4XUJA 3LELD 3AL0C 3WKJC 3AFAC 4J8VB 3W99D 3MVDA 4J8UC 2NZDB 1TZYA 3V9RA 5B2IC 2L5AA 1M1AC 2CWEA 3AN2A 3AZFC 3W97C 3X1SD 5JRGA 3C1BB 4J8XD 5B0YA 2Y2GA 5BS7A 3VH5W 5BNVA 5AY8C 2NQBA 1JFIA 2RIQA 2BG1A 3AZLC 3AZMA 2HIOB 3B0DB 2ZM5A 3AYWC 4QLCB 1EQZD 3W96B 4KUDC 1S32B 1TZYD 2AROB 5GSUD 4WJ3C 5FUGA 3AZJB 1KX5B 5F99D 2ZY4A 3AZKB 4LD9B 3AV2B 1Z2CB 3AZID 5AVBB 5B0YD 5KDMB 3UT9B 2IO5C 1F1EA 2NQBD 3RELB 5AV5D 5B40B 3AZMD 4Z5TB 4WU9B 5BT1D 5B1MA 3UTBD 2F8ND 3X1UB 4WU8A 3NQUB 4WZSB 4XZQB 4R8PB 3MNNB 1M18C 4H9RB 4YS3C 3KSYA 4NE6A 3UTAC 5JA4B 3MVDB 3LELC 2J8PA 5CPJA 3W98D 3V9RB 4H9SA 2Y2MA 3W99C 5B33A 3LZ1D 4J8WA 5B2JB 5B1MD 5B24D 5DNMC 1P3AC 3B6GD 1P3ID 1Q9CA 3VH6W 3MGSD 4KGCC 4J8XC 4WU8D 1BH9B 1N1JA 3MGQD 4H9OA 3B6FB 5B0ZA 1P34C 3VH5A 4X23A 3REJA 5GT3B 4NE5A 2G5HC 4WV4B 5GT0D 3MGPD 3REID 4ZUXD 1EQZC 3WKJA 3AFAA 4J8UA 5GSUC 5B2IA 4HGAB 1P3LC 5F99C 1M1AA 3AZND 3AZIC 5AVCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0C W;  3WTP D;  3LJA C;  5B31 G;  5AY8 A;  5AV5 C;  3AV1 B;  4Z2M G;  1KX3 D;  4ZBJ C;  4G92 B;  3AYW A;  4J8U D;  4KUD A;  2FJ7 C;  5GXQ A;  4JJN B;  5CPI A;  5AV6 D;  4CAY A;  1AOI B;  3AZF D;  3W97 D;  5AV8 B;  3W98 C;  3REK B;  1F66 B;  1BH8 B;  3LZ1 C;  5CP6 B;  3AZL D;  1KU5 A;  5DNN C;  1P3I C;  3B6G C;  3TU4 B;  3MGS C;  2F8N K;  5B32 C;  4KUD D;  1P3O A;  5CPK D;  5B1L C;  3AZH B;  4YS3 A;  1P3F C;  3WKJ B;  3UTA A;  5GT0 C;  3MGP C;  3LEL A;  5E5A C;  4ZUX C;  3REI C;  3MGR C;  3W99 A;  5C3I C;  3AZN C;  3O62 B;  1R4V A;  5DNM A;  3A6N C;  4AWL C;  3WTP C;  3X1S A;  3AZG B;  4J8X A;  1ZLA D;  4WNN B;  3REH B;  2PYO B;  3R45 A;  1M18 D;  4DRA A;  3X1T C;  3AZE B;  4YS3 D;  3X1V B;  4KHA B;  1ID3 D;  3WA9 B;  3UTA D;  2NZD D;  1P3P B;  5GXQ B;  2BYK B;  5CPI B;  1EQZ A;  4CSR A;  1P3B B;  3WAA B;  5GSU A;  5AV6 C;  1P3L A;  4G91 C;  5DNM D;  1P3A D;  5F99 A;  4KGC D;  3AZI A;  1M19 D;  1P3M C;  1P34 D;  2RVQ D;  4NE3 A;  5AV5 A;  1S32 D;  1P3O B;  2ARO D;  3UTB A;  3LZ0 C;  3AZJ D;  4UUZ A;  1KX4 C;  1U35 B;  2F8N A;  1KX5 D;  4Z66 B;  5AVB D;  5CPK C;  2FJ7 A;  1P3L D;  3W99 B;  2CV5 B;  3LJA D;  4H9P B;  3W98 A;  1HQ3 C;  3LZ1 A;  5BNX B;  5B31 B;  4EO5 B;  3X1S B;  3X1U D;  4R8P D;  4XZQ D;  2YFW A;  5B24 A;  3R45 B;  3KXB D;  1P3I A;  3B6G A;  1P3K C;  3MGS A;  1P3G C;  1ZLA C;  3MGQ A;  3C1C C;  2FJ7 D;  4XUJ B;  1ID3 C;  1EQZ B;  2NZD C;  5B1L A;  1P3F A;  1TAF A;  1TZY B;  5GT0 A;  3MGP A;  3REI A;  5E5A A;  4ZUX A;  3MGR A;  3AN2 B;  2HUE B;  5JRG B;  3NQJ A;  5B0Y B;  4DRB A;  5BNV B;  5DNN D;  3AZN A;  3A6N A;  2NQB B;  5B32 D;  1JFI B;  3WTP A;  1M19 C;  2YFV A;  3AZM B;  3B0D C;  5GT3 D;  2RVQ C;  3UTB B;  4QLC C;  3X1T A;  5B1L D;  3W96 C;  1P3F D;  1S32 C;  1BFM A;  1KX3 A;  5E5A D;  2ARO C;  3MGR D;  5FUG B;  3AZJ C;  1KX5 C;  3AZK C;  4LD9 C;  3AV2 C;  5AVB C;  5AV6 A;  3A6N D;  3AZF A;  3W97 A;  3REL C;  3KUY D;  5BO0 A;  5AV9 D;  5B40 C;  3AV1 D;  4Z5T C;  4WU9 C;  5B1M B;  2YFW B;  5B24 B;  3X1T D;  3MGS B;  3AZL A;  3X1U C;  4R8P C;  4WU8 B;  4XZQ C;  3MNN C;  3MGQ B;  4JJN D;  3KXB C;  3WTP E;  1H3O A;  3LZ0 A;  4YM6 D;  3MVD C;  1TAF B;  5CPJ B;  5CPK A;  3MGP B;  1F66 D;  4ZUX B;  5B33 B;  5CP6 D;  4J8W B;  1P3M D;  5B2J C;  5BS7 C;  3KWQ D;  3TU4 D;  1HQ3 A;  2BYM A;  1N1J B;  4H9O B;  3B6F C;  4H9Q A;  5B0Z B;  3LZ0 D;  1KX4 D;  1ZLA A;  4X23 B;  5GT3 C;  3REJ B;  2F8N G;  3C1C A;  1M18 A;  1KX3 B;  4E44 A;  3AFA B;  1ID3 A;  2NZD A;  4J8U B;  4Z2M H;  5B2I B;  1M1A B;  3O62 D;  5AVC C;  1HQ3 D;  3AZF B;  3W97 B;  3AZG D;  3REH D;  1P3A A;  1WWI A;  5AY8 B;  1P3K D;  3KUY C;  3AZE D;  1P3G D;  5AV9 C;  3AV1 C;  4KGC A;  3WA9 D;  5B32 G;  1M19 A;  3C1C D;  3AZL B;  4G92 C;  1P34 A;  3AYW B;  1H3O B;  4J8V D;  3W96 A;  4KUD B;  1S32 A;  4JJN C;  3WAA D;  1P3B D;  2ARO A;  5CPK B;  3AZJ A;  4CAY B;  4YM6 C;  1AOI C;  1KX5 A;  5AV8 C;  4LD9 A;  3AV2 A;  3C1B D;  5AVB A;  3REK C;  1F66 C;  5KDM A;  2IO5 B;  5CP6 C;  3REL A;  3LJA A;  2HIO D;  4Z5T A;  4WU9 A;  3KWQ C;  3TU4 C;  1HTA A;  4QLC D;  4H9N A;  3W96 D;  1U35 D;  4Z66 D;  1ZLA B;  3X1U A;  4R8P A;  4XZQ A;  1M18 B;  3KXB A;  1B6W A;  3AZH C;  4YS3 B;  3AZK D;  4LD9 D;  3AV2 D;  1ID3 B;  5JA4 A;  3UTA B;  3LEL B;  2CV5 D;  3UT9 D;  3REL D;  5B40 D;  4Z5T D;  5B31 D;  4WU9 D;  5B2J A;  3O62 C;  5DNM B;  1P3A B;  3AZG C;  4KGC B;  4J8X B;  3REH C;  1BH9 A;  3MNN D;  2PYO C;  1M19 B;  1A7W A;  5DNN A;  4XUJ D;  3B6F A;  1P34 B;  3AZE C;  1ULY A;  5B32 A;  3X1V C;  3WA9 C;  3MVD D;  1P3P C;  5GT3 A;  5GXQ C;  5CPI C;  4J8V C;  3AN2 D;  3WAA C;  4CSR B;  1P3B C;  5JRG D;  5GSU B;  5B2J D;  1P3L B;  5F99 B;  5AVC A;  3C1B C;  3AZI B;  3LJA B;  3B6F D;  3KUY A;  4H9N B;  5AV9 A;  5AV5 B;  2HIO C;  3AV1 A;  1P3O C;  4ZBJ B;  4UUZ B;  3KXB B;  1U35 C;  2F8N B;  4Z66 C;  4JJN A;  2FJ7 B;  4YM6 A;  5AVC D;  1AOI A;  5AV8 A;  2CV5 C;  3UT9 C;  3REK A;  3W98 B;  1F66 A;  1BH8 A;  3LZ1 B;  5CP6 A;  3VH5 T;  5B31 C;  4EO5 C;  3X1S C;  1P3M A;  3KWQ A;  5DNN B;  1P3I B;  3B6G B;  3TU4 A;  5B32 B;  4XUJ C;  5CPJ D;  1KX4 A;  4M6B A;  1AOI D;  3AZH A;  5B1L B;  5AV8 D;  1P3F B;  1TZY C;  5B33 D;  5GT0 B;  3REK D;  3REI B;  5E5A B;  4J8W D;  3MGR B;  3AN2 C;  5G49 A;  2HUE C;  5JRG C;  3NQJ B;  5B0Y C;  5B0Z D;  5C3I B;  3O62 A;  3A6N B;  3AZN B;  2NQB C;  4AWL B;  3WTP B;  3KUY B;  1B67 A;  2YFV B;  5AV9 B;  4X23 D;  3REJ D;  4WNN A;  3REH A;  3AZG A;  3AZM C;  2PYO A;  5BT1 C;  2JSS A;  3UTB C;  1P3K A;  3AZE A;  3X1T B;  3AZH D;  1P3G A;  3WKJ D;  3AFA D;  4KHA A;  3X1V A;  3WA9 A;  1P3P A;  5B2I D;  3B0B A;  2BYK A;  4J8V A;  1M1A D;  4YM6 B;  4HGA C;  1P3B A;  3WAA A;  4E45 A;  5AV6 B;  4G91 B;  5AY8 D;  5BO0 B;  3C1B A;  2PYO D;  1P3M B;  5B1M C;  3VH6 T;  2LY8 A;  5B24 C;  3AYW D;  3KWQ B;  3X1V D;  1P3P D;  2HIO A;  4WU8 C;  3MGQ C;  5GXQ D;  3VH6 A;  5CPI D;  4QLC A;  3LZ0 B;  1KX4 B;  1U35 A;  1WWS A;  4Z66 A;  5CPJ C;  4H9S C;  3AZK A;  5G49 B;  5B33 C;  2F8N H;  2CV5 A;  5CHL B;  4H9P A;  4J8W C;  3UT9 A;  3B0C T;  5B40 A;  1HQ3 B;  5BNX A;  2BYM B;  5B31 A;  1P3O D;  5B0Z C;  4H9Q B;  1P3K B;  4NFT A;  1P3G B;  4X23 C;  3REJ C;  3NQU A;  3MNN A;  3C1C B;  4H9R A;  1KX3 C;  4XUJ A;  3LEL D;  3WKJ C;  3AFA C;  4J8V B;  3W99 D;  3MVD A;  4J8U C;  2NZD B;  1TZY A;  3V9R A;  5B2I C;  2L5A A;  1M1A C;  2CWE A;  3AN2 A;  3AZF C;  3W97 C;  3X1S D;  5JRG A;  3C1B B;  4J8X D;  5B0Y A;  5BS7 A;  3VH5 W;  5BNV A;  5AY8 C;  2NQB A;  1JFI A;  3AZL C;  3AZM A;  2HIO B;  3B0D B;  3AYW C;  4QLC B;  1EQZ D;  3W96 B;  4KUD C;  1S32 B;  1TZY D;  2ARO B;  5GSU D;  5FUG A;  3AZJ B;  1KX5 B;  5F99 D;  3AZK B;  4LD9 B;  3AV2 B;  3AZI D;  5AVB B;  5B0Y D;  5KDM B;  3UT9 B;  2IO5 C;  1F1E A;  2NQB D;  3REL B;  5AV5 D;  5B40 B;  3AZM D;  4Z5T B;  4WU9 B;  5BT1 D;  5B1M A;  3UTB D;  2F8N D;  3X1U B;  4R8P B;  3NQU B;  4WU8 A;  4XZQ B;  4WZS B;  3MNN B;  1M18 C;  4H9R B;  4YS3 C;  3KSY A;  4NE6 A;  3UTA C;  5JA4 B;  3MVD B;  3LEL C;  5CPJ A;  3W98 D;  3V9R B;  4H9S A;  3W99 C;  5B33 A;  3LZ1 D;  4J8W A;  5B2J B;  5B1M D;  5B24 D;  5DNM C;  1P3A C;  3B6G D;  1P3I D;  1Q9C A;  3VH6 W;  3MGS D;  4KGC C;  4J8X C;  4WU8 D;  1BH9 B;  1N1J A;  3MGQ D;  4H9O A;  3B6F B;  5B0Z A;  1P34 C;  3VH5 A;  4X23 A;  3REJ A;  5GT3 B;  4NE5 A;  4WV4 B;  5GT0 D;  3MGP D;  3REI D;  4ZUX D;  1EQZ C;  3WKJ A;  3AFA A;  4J8U A;  5GSU C;  5B2I A;  4HGA B;  1P3L C;  5F99 C;  1M1A A;  3AZN D;  3AZI C;  5AVC B; 
#chains in the Genus database with same CATH topology
 3B0C W;  3WTP D;  3LJA C;  5B31 G;  2ZY2 A;  5AY8 A;  5AV5 C;  3AV1 B;  2ZY5 A;  1W2E A;  4Z2M G;  1KX3 D;  4ZBJ C;  4G92 B;  3AYW A;  2Y2P A;  4J8U D;  4KUD A;  2FJ7 C;  5GXQ A;  4JJN B;  5CPI A;  5AV6 D;  4CAY A;  1AOI B;  3AZF D;  3W97 D;  5AV8 B;  3W98 C;  3REK B;  1F66 B;  1BH8 B;  3LZ1 C;  5CP6 B;  3AZL D;  1KU5 A;  5DNN C;  1P3I C;  3B6G C;  3TU4 B;  3MGS C;  2F8N K;  5B32 C;  4KUD D;  1P3O A;  5CPK D;  2VQR A;  5B1L C;  3AZH B;  4YS3 A;  1P3F C;  3WKJ B;  3UTA A;  5GT0 C;  3MGP C;  3LEL A;  5E5A C;  4ZUX C;  3REI C;  3MGR C;  2Y2L A;  3W99 A;  3H0R C;  5C3I C;  3H0M C;  3O62 B;  1R4V A;  5DNM A;  3A6N C;  3AZN C;  4AWL C;  3WTP C;  2FFF B;  3X1S A;  4J8X A;  3AZG B;  1ZLA D;  4WNN B;  3REH B;  2PYO B;  3R45 A;  1M18 D;  4DRA A;  3X1T C;  3AZE B;  4YS3 D;  3X1V B;  4KHA B;  1ID3 D;  3WA9 B;  3UTA D;  2NZD D;  1P3P B;  5GXQ B;  2BYK B;  5CPI B;  1EQZ A;  2JE5 A;  2G5I C;  4CSR A;  1P3B B;  3WAA B;  5GSU A;  5AV6 C;  1P3L A;  4G91 C;  5DNM D;  1P3A D;  5F99 A;  4KGC D;  3AZI A;  1M19 D;  1P3M C;  1P34 D;  2RVQ D;  4NE3 A;  5AV5 A;  1S32 D;  1P3O B;  2ARO D;  3UTB A;  3LZ0 C;  3AZJ D;  4UUZ A;  1KX4 C;  1U35 B;  2F8N A;  1KX5 D;  4Z66 B;  5AVB D;  5CPK C;  2FJ7 A;  1P3L D;  2UWX A;  3W99 B;  2XD5 A;  2CV5 B;  3LJA D;  4H9P B;  3W98 A;  3H0L C;  1HQ3 C;  3LZ1 A;  5BNX B;  5B31 B;  4EO5 B;  3X1S B;  3X1U D;  4R8P D;  2YFW A;  5B24 A;  4XZQ D;  3R45 B;  3KXB D;  1P3I A;  3B6G A;  1P3K C;  3MGS A;  1P3G C;  1ZLA C;  3MGQ A;  3C1C C;  2FJ7 D;  4XUJ B;  1ID3 C;  1EQZ B;  2NZD C;  5B1L A;  1P3F A;  1TAF A;  1TZY B;  5GT0 A;  3MGP A;  3REI A;  5E5A A;  4ZUX A;  3MGR A;  3AN2 B;  2HUE B;  5JRG B;  3NQJ A;  5B0Y B;  4DRB A;  5BNV B;  5DNN D;  3AZN A;  3A6N A;  2NQB B;  5B32 D;  1JFI B;  3WTP A;  1M19 C;  2YFV A;  3AZM B;  3B0D C;  5GT3 D;  2RVQ C;  3UTB B;  4QLC C;  3X1T A;  5B1L D;  3W96 C;  1P3F D;  1S32 C;  1BFM A;  1KX3 A;  5E5A D;  2ARO C;  3MGR D;  5FUG B;  3AZJ C;  2Y2J A;  1KX5 C;  3AZK C;  4LD9 C;  3AV2 C;  5AVB C;  5AV6 A;  3A6N D;  3AZF A;  3W97 A;  3REL C;  3KUY D;  5BO0 A;  5AV9 D;  5B40 C;  3AV1 D;  4Z5T C;  4WU9 C;  3P5J B;  5B1M B;  2YFW B;  5B24 B;  3X1T D;  3MGS B;  3AZL A;  3X1U C;  4R8P C;  4WU8 B;  4XZQ C;  3MNN C;  3MGQ B;  4JJN D;  3KXB C;  3WTP E;  1H3O A;  3LZ0 A;  4YM6 D;  3MVD C;  1TAF B;  5CPJ B;  5CPK A;  3MGP B;  2DQN C;  1F66 D;  4ZUX B;  5B33 B;  5CP6 D;  4J8W B;  1P3M D;  5B2J C;  5BS7 C;  3KWQ D;  3TU4 D;  1HQ3 A;  2BYM A;  1N1J B;  4H9O B;  3B6F C;  4H9Q A;  5B0Z B;  2DF4 C;  3LZ0 D;  1KX4 D;  1ZLA A;  4X23 B;  5GT3 C;  3REJ B;  2F8N G;  3C1C A;  1M18 A;  1KX3 B;  3A1I A;  4E44 A;  3AFA B;  1ID3 A;  2NZD A;  4J8U B;  4Z2M H;  5B2I B;  1M1A B;  3O62 D;  5AVC C;  1HQ3 D;  3AZF B;  3W97 B;  3AZG D;  3REH D;  1P3A A;  1WWI A;  5AY8 B;  1P3K D;  3KUY C;  3AZE D;  1P3G D;  5AV9 C;  3AV1 C;  4KGC A;  3KFU G;  3WA9 D;  5B32 G;  1M19 A;  3C1C D;  3AZL B;  4G92 C;  1P34 A;  3AYW B;  1H3O B;  4J8V D;  3W96 A;  4KUD B;  1S32 A;  4JJN C;  3WAA D;  2Y2Q A;  1P3B D;  2ARO A;  5CPK B;  3AZJ A;  3EPJ A;  4CAY B;  4YM6 C;  1AOI C;  1KX5 A;  5AV8 C;  4LD9 A;  3AV2 A;  3C1B D;  5AVB A;  3REK C;  1F66 C;  5KDM A;  3A1K A;  2IO5 B;  5CP6 C;  3REL A;  3LJA A;  3EPL A;  2HIO D;  4Z5T A;  4WU9 A;  3KWQ C;  3TU4 C;  1HTA A;  4QLC D;  4H9N A;  3W96 D;  1U35 D;  4Z66 D;  1ZLA B;  3X1U A;  4R8P A;  4XZQ A;  1M18 B;  3KXB A;  1B6W A;  3AZH C;  4YS3 B;  3AZK D;  4LD9 D;  3AV2 D;  1ID3 B;  5JA4 A;  3UTA B;  3LEL B;  2CV5 D;  3UT9 D;  2Y2I A;  3REL D;  5B40 D;  4Z5T D;  5B31 D;  4WU9 D;  5B2J A;  3O62 C;  1PZR A;  5DNM B;  1P3A B;  3AZG C;  4KGC B;  4J8X B;  3REH C;  1BH9 A;  3MNN D;  2PYO C;  1M19 B;  1A7W A;  5DNN A;  4XUJ D;  3B6F A;  1P34 B;  3AZE C;  1ULY A;  5B32 A;  2XD1 A;  3X1V C;  3WA9 C;  3MVD D;  1P3P C;  5GT3 A;  2JCH A;  4DQY B;  5GXQ C;  5CPI C;  4J8V C;  3AN2 D;  3WAA C;  4CSR B;  1P3B C;  5JRG D;  5GSU B;  5B2J D;  1P3L B;  5F99 B;  5AVC A;  3C1B C;  3AZI B;  3LJA B;  3B6F D;  3KUY A;  4H9N B;  5AV9 A;  5AV5 B;  2HIO C;  3AV1 A;  1P3O C;  4ZBJ B;  4UUZ B;  3KXB B;  1U35 C;  2F8N B;  4Z66 C;  1T3U A;  4JJN A;  2FJ7 B;  4YM6 A;  5AVC D;  1AOI A;  5AV8 A;  2CV5 C;  3UT9 C;  3REK A;  3W98 B;  1F66 A;  1BH8 A;  3LZ1 B;  5CP6 A;  3IP4 C;  3VH5 T;  4EO5 C;  5B31 C;  3X1S C;  1P3M A;  3EPH A;  3KWQ A;  5DNN B;  1P3I B;  3B6G B;  3TU4 A;  5B32 B;  2Y2K A;  3EPK A;  4XUJ C;  5CPJ D;  3FDD A;  1KX4 A;  4M6B A;  1AOI D;  3AZH A;  3F6T A;  5B1L B;  5AV8 D;  1P3F B;  1TZY C;  5B33 D;  5GT0 B;  3REK D;  3REI B;  5E5A B;  4J8W D;  3MGR B;  3AN2 C;  5G49 A;  2HUE C;  5JRG C;  3NQJ B;  5B0Y C;  5B0Z D;  2Y2O A;  5C3I B;  3O62 A;  3A6N B;  3AZN B;  2NQB C;  4AWL B;  3WTP B;  3KUY B;  1B67 A;  2YFV B;  5AV9 B;  4X23 D;  3REJ D;  4WNN A;  3REH A;  3AZG A;  3AZM C;  2PYO A;  5BT1 C;  2JSS A;  3UTB C;  1P3K A;  3AZE A;  3X1T B;  3AZH D;  1P3G A;  3WKJ D;  3AFA D;  4KHA A;  3X1V A;  3WA9 A;  1P3P A;  2ZY3 A;  5B2I D;  3B0B A;  2BYK A;  4J8V A;  4UPK A;  1M1A D;  2F2A C;  4YM6 B;  4HGA C;  1P3B A;  3WAA A;  4E45 A;  5AV6 B;  4G91 B;  5AY8 D;  5BO0 B;  3C1B A;  2PYO D;  1P3M B;  5B1M C;  3VH6 T;  3EG5 B;  2LY8 A;  5B24 C;  2W8S A;  3AYW D;  3KWQ B;  3X1V D;  2Y2H A;  1P3P D;  2HIO A;  4WU8 C;  3MGQ C;  5GXQ D;  3VH6 A;  5CPI D;  4QLC A;  3LZ0 B;  1KX4 B;  1U35 A;  1WWS A;  4Z66 A;  5CPJ C;  4H9S C;  3AZK A;  5G49 B;  5B33 C;  2F8N H;  2CV5 A;  5CHL B;  4H9P A;  4J8W C;  3UT9 A;  3B0C T;  5B40 A;  1HQ3 B;  5BNX A;  2BYM B;  2Y2N A;  5B31 A;  1P3O D;  5B0Z C;  4H9Q B;  1P3K B;  4NFT A;  1P3G B;  4X23 C;  3REJ C;  3NQU A;  3MNN A;  3C1C B;  4H9R A;  1KX3 C;  4XUJ A;  3LEL D;  3AL0 C;  3WKJ C;  3AFA C;  4J8V B;  3W99 D;  3MVD A;  4J8U C;  2NZD B;  1TZY A;  3V9R A;  5B2I C;  2L5A A;  1M1A C;  2CWE A;  3AN2 A;  3AZF C;  3W97 C;  3X1S D;  5JRG A;  3C1B B;  4J8X D;  5B0Y A;  2Y2G A;  5BS7 A;  3VH5 W;  5BNV A;  5AY8 C;  2NQB A;  1JFI A;  2RIQ A;  2BG1 A;  3AZL C;  3AZM A;  2HIO B;  3B0D B;  2ZM5 A;  3AYW C;  4QLC B;  1EQZ D;  3W96 B;  4KUD C;  1S32 B;  1TZY D;  2ARO B;  5GSU D;  4WJ3 C;  5FUG A;  3AZJ B;  1KX5 B;  5F99 D;  2ZY4 A;  3AZK B;  4LD9 B;  3AV2 B;  1Z2C B;  3AZI D;  5AVB B;  5B0Y D;  5KDM B;  3UT9 B;  2IO5 C;  1F1E A;  2NQB D;  3REL B;  5AV5 D;  5B40 B;  3AZM D;  4Z5T B;  4WU9 B;  5BT1 D;  5B1M A;  3UTB D;  2F8N D;  3X1U B;  4WU8 A;  3NQU B;  4WZS B;  4XZQ B;  4R8P B;  3MNN B;  1M18 C;  4H9R B;  4YS3 C;  3KSY A;  4NE6 A;  3UTA C;  5JA4 B;  3MVD B;  3LEL C;  2J8P A;  5CPJ A;  3W98 D;  3V9R B;  4H9S A;  2Y2M A;  3W99 C;  5B33 A;  3LZ1 D;  4J8W A;  5B2J B;  5B1M D;  5B24 D;  5DNM C;  1P3A C;  3B6G D;  1P3I D;  1Q9C A;  3VH6 W;  3MGS D;  4KGC C;  4J8X C;  4WU8 D;  1BH9 B;  1N1J A;  3MGQ D;  4H9O A;  3B6F B;  5B0Z A;  1P34 C;  3VH5 A;  4X23 A;  3REJ A;  5GT3 B;  4NE5 A;  2G5H C;  4WV4 B;  5GT0 D;  3MGP D;  3REI D;  4ZUX D;  1EQZ C;  3WKJ A;  3AFA A;  4J8U A;  5GSU C;  5B2I A;  4HGA B;  1P3L C;  5F99 C;  1M1A A;  3AZN D;  3AZI C;  5AVC B; 
#chains in the Genus database with same CATH homology
 3B0C W;  3WTP D;  3LJA C;  5B31 G;  2ZY2 A;  5AY8 A;  5AV5 C;  3AV1 B;  2ZY5 A;  1W2E A;  4Z2M G;  1KX3 D;  4ZBJ C;  4G92 B;  3AYW A;  2Y2P A;  4J8U D;  4KUD A;  2FJ7 C;  5GXQ A;  4JJN B;  5CPI A;  5AV6 D;  4CAY A;  1AOI B;  3AZF D;  3W97 D;  5AV8 B;  3W98 C;  3REK B;  1F66 B;  1BH8 B;  3LZ1 C;  5CP6 B;  3AZL D;  1KU5 A;  5DNN C;  1P3I C;  3B6G C;  3TU4 B;  3MGS C;  2F8N K;  5B32 C;  4KUD D;  1P3O A;  5CPK D;  2VQR A;  5B1L C;  3AZH B;  4YS3 A;  1P3F C;  3WKJ B;  3UTA A;  5GT0 C;  3MGP C;  3LEL A;  5E5A C;  4ZUX C;  3REI C;  3MGR C;  2Y2L A;  3W99 A;  3H0R C;  5C3I C;  3H0M C;  3O62 B;  1R4V A;  5DNM A;  3A6N C;  3AZN C;  4AWL C;  3WTP C;  2FFF B;  3X1S A;  4J8X A;  3AZG B;  1ZLA D;  4WNN B;  3REH B;  2PYO B;  3R45 A;  1M18 D;  4DRA A;  3X1T C;  3AZE B;  4YS3 D;  3X1V B;  4KHA B;  1ID3 D;  3WA9 B;  3UTA D;  2NZD D;  1P3P B;  5GXQ B;  2BYK B;  5CPI B;  1EQZ A;  2JE5 A;  2G5I C;  4CSR A;  1P3B B;  3WAA B;  5GSU A;  5AV6 C;  1P3L A;  4G91 C;  5DNM D;  1P3A D;  5F99 A;  4KGC D;  3AZI A;  1M19 D;  1P3M C;  1P34 D;  2RVQ D;  4NE3 A;  5AV5 A;  1S32 D;  1P3O B;  2ARO D;  3UTB A;  3LZ0 C;  3AZJ D;  4UUZ A;  1KX4 C;  1U35 B;  2F8N A;  1KX5 D;  4Z66 B;  5AVB D;  5CPK C;  2FJ7 A;  1P3L D;  2UWX A;  3W99 B;  2XD5 A;  2CV5 B;  3LJA D;  4H9P B;  3W98 A;  3H0L C;  1HQ3 C;  3LZ1 A;  5BNX B;  5B31 B;  4EO5 B;  3X1S B;  3X1U D;  4R8P D;  2YFW A;  5B24 A;  4XZQ D;  3R45 B;  3KXB D;  1P3I A;  3B6G A;  1P3K C;  3MGS A;  1P3G C;  1ZLA C;  3MGQ A;  3C1C C;  2FJ7 D;  4XUJ B;  1ID3 C;  1EQZ B;  2NZD C;  5B1L A;  1P3F A;  1TAF A;  1TZY B;  5GT0 A;  3MGP A;  3REI A;  5E5A A;  4ZUX A;  3MGR A;  3AN2 B;  2HUE B;  5JRG B;  3NQJ A;  5B0Y B;  4DRB A;  5BNV B;  5DNN D;  3AZN A;  3A6N A;  2NQB B;  5B32 D;  1JFI B;  3WTP A;  1M19 C;  2YFV A;  3AZM B;  3B0D C;  5GT3 D;  2RVQ C;  3UTB B;  4QLC C;  3X1T A;  5B1L D;  3W96 C;  1P3F D;  1S32 C;  1BFM A;  1KX3 A;  5E5A D;  2ARO C;  3MGR D;  5FUG B;  3AZJ C;  2Y2J A;  1KX5 C;  3AZK C;  4LD9 C;  3AV2 C;  5AVB C;  5AV6 A;  3A6N D;  3AZF A;  3W97 A;  3REL C;  3KUY D;  5BO0 A;  5AV9 D;  5B40 C;  3AV1 D;  4Z5T C;  4WU9 C;  3P5J B;  5B1M B;  2YFW B;  5B24 B;  3X1T D;  3MGS B;  3AZL A;  3X1U C;  4R8P C;  4WU8 B;  4XZQ C;  3MNN C;  3MGQ B;  4JJN D;  3KXB C;  3WTP E;  1H3O A;  3LZ0 A;  4YM6 D;  3MVD C;  1TAF B;  5CPJ B;  5CPK A;  3MGP B;  2DQN C;  1F66 D;  4ZUX B;  5B33 B;  5CP6 D;  4J8W B;  1P3M D;  5B2J C;  5BS7 C;  3KWQ D;  3TU4 D;  1HQ3 A;  2BYM A;  1N1J B;  4H9O B;  3B6F C;  4H9Q A;  5B0Z B;  2DF4 C;  3LZ0 D;  1KX4 D;  1ZLA A;  4X23 B;  5GT3 C;  3REJ B;  2F8N G;  3C1C A;  1M18 A;  1KX3 B;  3A1I A;  4E44 A;  3AFA B;  1ID3 A;  2NZD A;  4J8U B;  4Z2M H;  5B2I B;  1M1A B;  3O62 D;  5AVC C;  1HQ3 D;  3AZF B;  3W97 B;  3AZG D;  3REH D;  1P3A A;  1WWI A;  5AY8 B;  1P3K D;  3KUY C;  3AZE D;  1P3G D;  5AV9 C;  3AV1 C;  4KGC A;  3KFU G;  3WA9 D;  5B32 G;  1M19 A;  3C1C D;  3AZL B;  4G92 C;  1P34 A;  3AYW B;  1H3O B;  4J8V D;  3W96 A;  4KUD B;  1S32 A;  4JJN C;  3WAA D;  2Y2Q A;  1P3B D;  2ARO A;  5CPK B;  3AZJ A;  3EPJ A;  4CAY B;  4YM6 C;  1AOI C;  1KX5 A;  5AV8 C;  4LD9 A;  3AV2 A;  3C1B D;  5AVB A;  3REK C;  1F66 C;  5KDM A;  3A1K A;  2IO5 B;  5CP6 C;  3REL A;  3LJA A;  3EPL A;  2HIO D;  4Z5T A;  4WU9 A;  3KWQ C;  3TU4 C;  1HTA A;  4QLC D;  4H9N A;  3W96 D;  1U35 D;  4Z66 D;  1ZLA B;  3X1U A;  4R8P A;  4XZQ A;  1M18 B;  3KXB A;  1B6W A;  3AZH C;  4YS3 B;  3AZK D;  4LD9 D;  3AV2 D;  1ID3 B;  5JA4 A;  3UTA B;  3LEL B;  2CV5 D;  3UT9 D;  2Y2I A;  3REL D;  5B40 D;  4Z5T D;  5B31 D;  4WU9 D;  5B2J A;  3O62 C;  1PZR A;  5DNM B;  1P3A B;  3AZG C;  4KGC B;  4J8X B;  3REH C;  1BH9 A;  3MNN D;  2PYO C;  1M19 B;  1A7W A;  5DNN A;  4XUJ D;  3B6F A;  1P34 B;  3AZE C;  1ULY A;  5B32 A;  2XD1 A;  3X1V C;  3WA9 C;  3MVD D;  1P3P C;  5GT3 A;  2JCH A;  4DQY B;  5GXQ C;  5CPI C;  4J8V C;  3AN2 D;  3WAA C;  4CSR B;  1P3B C;  5JRG D;  5GSU B;  5B2J D;  1P3L B;  5F99 B;  5AVC A;  3C1B C;  3AZI B;  3LJA B;  3B6F D;  3KUY A;  4H9N B;  5AV9 A;  5AV5 B;  2HIO C;  3AV1 A;  1P3O C;  4ZBJ B;  4UUZ B;  3KXB B;  1U35 C;  2F8N B;  4Z66 C;  1T3U A;  4JJN A;  2FJ7 B;  4YM6 A;  5AVC D;  1AOI A;  5AV8 A;  2CV5 C;  3UT9 C;  3REK A;  3W98 B;  1F66 A;  1BH8 A;  3LZ1 B;  5CP6 A;  3IP4 C;  3VH5 T;  4EO5 C;  5B31 C;  3X1S C;  1P3M A;  3EPH A;  3KWQ A;  5DNN B;  1P3I B;  3B6G B;  3TU4 A;  5B32 B;  2Y2K A;  3EPK A;  4XUJ C;  5CPJ D;  3FDD A;  1KX4 A;  4M6B A;  1AOI D;  3AZH A;  3F6T A;  5B1L B;  5AV8 D;  1P3F B;  1TZY C;  5B33 D;  5GT0 B;  3REK D;  3REI B;  5E5A B;  4J8W D;  3MGR B;  3AN2 C;  5G49 A;  2HUE C;  5JRG C;  3NQJ B;  5B0Y C;  5B0Z D;  2Y2O A;  5C3I B;  3O62 A;  3A6N B;  3AZN B;  2NQB C;  4AWL B;  3WTP B;  3KUY B;  1B67 A;  2YFV B;  5AV9 B;  4X23 D;  3REJ D;  4WNN A;  3REH A;  3AZG A;  3AZM C;  2PYO A;  5BT1 C;  2JSS A;  3UTB C;  1P3K A;  3AZE A;  3X1T B;  3AZH D;  1P3G A;  3WKJ D;  3AFA D;  4KHA A;  3X1V A;  3WA9 A;  1P3P A;  2ZY3 A;  5B2I D;  3B0B A;  2BYK A;  4J8V A;  4UPK A;  1M1A D;  2F2A C;  4YM6 B;  4HGA C;  1P3B A;  3WAA A;  4E45 A;  5AV6 B;  4G91 B;  5AY8 D;  5BO0 B;  3C1B A;  2PYO D;  1P3M B;  5B1M C;  3VH6 T;  3EG5 B;  2LY8 A;  5B24 C;  2W8S A;  3AYW D;  3KWQ B;  3X1V D;  2Y2H A;  1P3P D;  2HIO A;  4WU8 C;  3MGQ C;  5GXQ D;  3VH6 A;  5CPI D;  4QLC A;  3LZ0 B;  1KX4 B;  1U35 A;  1WWS A;  4Z66 A;  5CPJ C;  4H9S C;  3AZK A;  5G49 B;  5B33 C;  2F8N H;  2CV5 A;  5CHL B;  4H9P A;  4J8W C;  3UT9 A;  3B0C T;  5B40 A;  1HQ3 B;  5BNX A;  2BYM B;  2Y2N A;  5B31 A;  1P3O D;  5B0Z C;  4H9Q B;  1P3K B;  4NFT A;  1P3G B;  4X23 C;  3REJ C;  3NQU A;  3MNN A;  3C1C B;  4H9R A;  1KX3 C;  4XUJ A;  3LEL D;  3AL0 C;  3WKJ C;  3AFA C;  4J8V B;  3W99 D;  3MVD A;  4J8U C;  2NZD B;  1TZY A;  3V9R A;  5B2I C;  2L5A A;  1M1A C;  2CWE A;  3AN2 A;  3AZF C;  3W97 C;  3X1S D;  5JRG A;  3C1B B;  4J8X D;  5B0Y A;  2Y2G A;  5BS7 A;  3VH5 W;  5BNV A;  5AY8 C;  2NQB A;  1JFI A;  2RIQ A;  2BG1 A;  3AZL C;  3AZM A;  2HIO B;  3B0D B;  2ZM5 A;  3AYW C;  4QLC B;  1EQZ D;  3W96 B;  4KUD C;  1S32 B;  1TZY D;  2ARO B;  5GSU D;  4WJ3 C;  5FUG A;  3AZJ B;  1KX5 B;  5F99 D;  2ZY4 A;  3AZK B;  4LD9 B;  3AV2 B;  1Z2C B;  3AZI D;  5AVB B;  5B0Y D;  5KDM B;  3UT9 B;  2IO5 C;  1F1E A;  2NQB D;  3REL B;  5AV5 D;  5B40 B;  3AZM D;  4Z5T B;  4WU9 B;  5BT1 D;  5B1M A;  3UTB D;  2F8N D;  3X1U B;  4WU8 A;  3NQU B;  4WZS B;  4XZQ B;  4R8P B;  3MNN B;  1M18 C;  4H9R B;  4YS3 C;  3KSY A;  4NE6 A;  3UTA C;  5JA4 B;  3MVD B;  3LEL C;  2J8P A;  5CPJ A;  3W98 D;  3V9R B;  4H9S A;  2Y2M A;  3W99 C;  5B33 A;  3LZ1 D;  4J8W A;  5B2J B;  5B1M D;  5B24 D;  5DNM C;  1P3A C;  3B6G D;  1P3I D;  1Q9C A;  3VH6 W;  3MGS D;  4KGC C;  4J8X C;  4WU8 D;  1BH9 B;  1N1J A;  3MGQ D;  4H9O A;  3B6F B;  5B0Z A;  1P34 C;  3VH5 A;  4X23 A;  3REJ A;  5GT3 B;  4NE5 A;  2G5H C;  4WV4 B;  5GT0 D;  3MGP D;  3REI D;  4ZUX D;  1EQZ C;  3WKJ A;  3AFA A;  4J8U A;  5GSU C;  5B2I A;  4HGA B;  1P3L C;  5F99 C;  1M1A A;  3AZN D;  3AZI C;  5AVC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...