5AV6B

Human nucleosome core particle
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av6B00
1AOIB 2AROC 3B6GA 3AFAA 5B0YB 1M1AD 3LZ0A 1HQ3C 1ZLAC 5AV5D 4UUZA 3AZLB 2YFVB 3B0CT 5BNVB 2AROB 2RVQC 2NZDA 3X1VA 3AZEA 3WAAA 4KGCA 5B1LC 4H9NB 4WU8A 4J8VB 1ZLAB 3UT9C 4Z5TD 3RELC 1ID3D 5GT3B 3UTBD 1P3AB 5GT0C 3AZKA 1N1JA 5BO0B 4XUJC 3B0DC 3LJAA 3X1UC 3KXBA 5B1LB 1P3PC 3UT9B 5DNNB 2IO5C 5AV8D 3MGSA 4JJNB 3AZIC 5GT0B 3W96D 3X1UB 3MGQD 3A6ND 2IO5B 3AZMA 1P3MD 4J8XA 3AZIB 1P3KA 4ZUXB 5B2IB 3X1SC 3UTAC 4J8WA 3B6FC 1BH9A 3AN2D 2F8NG 3REJD 3VH5T 3C1BC 3REHA 5B33D 4R8PA 3AFAC 1KX5B 3REKB 5B40A 3VH6W 5AVBC 4LD9C 5CPIA 3C1BB 3X1VC 3TU4A 1H3OB 3AV2A 3AYWB 1F66B 2LY8A 5B1MA 2HIOD 3X1TB 2JSSA 4H9QB 5AVBB 4J8VD 3W97B 3W98D 1TZYB 1P3FB 2F8ND 3R45A 5B0ZA 5B2JD 1EQZA 4YM6D 1P3AD 3AZNA 4WU9D 3AV1A 5KDMB 5CP6D 3C1CB 5B31C 1WWSA 3KWQC 5JRGA 5CPJC 4YS3B 1M18D 5GSUA 1P3KC 1TAFA 1AOIA 4ZUXD 5AV5C 3MGPD 4WZSB 4R8PC 4G92B 5B0YA 1P3BB 5E5AD 3AZLA 2YFVA 4XZQD 4HGAC 4CSRB 5BNVA 5B24B 3WTPD 1S32B 1M1AB 5CPIC 2AROA 5AV5B 4Z5TC 5B32B 5C3IC 1ID3C 3UTBC 4H9OB 1ZLAA 4X23D 5B1MC 2FJ7D 5CHLB 2BYMB 5GT3A 3REID 1U35D 4Z66D 1P3ID 5BO0A 4Z5TB 1P3GB 5AV8C 1WWIA 1ID3B 5B1LA 1KX4C 1BH8B 4KHAB 3UT9A 5DNNA 4JJNA 5AY8D 5GT0A 4XUJA 3A6NC 5AV8B 3X1UA 1P34C 2CV5B 4Z2MG 3B0CW 3VH6A 3AN2C 1P3OD 3W96B 5B32G 4ZBJC 3AZIA 3MGQB 3LZ0D 5BT1C 1P3MB 4NFTA 3AN2B 1KX5A 3MNND 3REJB 3REKA 3X1SA 3B6FA 3WA9D 5B33B 1P3BD 5JA4B 3AZHD 3LZ1D 3C1BA 5CPKD 5F99D 2HIOC 5B24D 1S32D 1H3OA 4J8VC 1F66A 3LJAD 1P3LB 5B32D 3KXBD 3LELD 4H9QA 3W97A 5GT3C 5AVBA 4YM6C 5BS7C 3MGRD 1P3AC 1P3FA 4LD9A 2HIOB 3AZGD 3W98B 5CP6C 1P3GD 5DNNC 2F8NB 4JJNC 5B2JB 4WV4B 3VH5W 4YM6B 5DNMD 4E44A 5KDMA 3C1CA 4WU9B 4J8XD 3NQJB 4KUDD 4J8WD 5AVCD 5BNXB 5CP6B 4CAYB 4ZUXC 5B2IC 2CV5D 3MGPC 2NQBD 3MVDD 5B31A 1M18B 3KWQA 4DRBA 4XZQC 5CPJA 3O62D 4G91C 1KX5C 3REKC 1JFIB 3MGPB 4J8UB 3W99D 3AV2D 4CSRA 3V9RB 3AZJD 5E5AB 5AV5A 4XZQB 1Q9CA 4G91B 3WTPE 3WTPB 4WNNA 1M19D 3AYWC 4H9OA 1F66C 3KUYD 1EQZD 3X1TC 3W97C 2BYMA 1TZYC 1P3FC 4X23B 5FUGB 1P3LD 1KX3D 4Z5TA 2FJ7B 2F8NK 3AV1D 1ID3A 1U35B 3REIB 3UTBA 4Z66B 1P3IB 1BH8A 5AV9D 5JRGD 3C1CC 1BFMA 5AV8A 1P3OC 5AY8B 4H9RB 1KX4A 4M6BA 4YS3C 3WKJB 4QLCD 2YFWB 3W96A 3MGQA 3A6NA 2CWEA 1P3OB 1P34A 3AZFD 3WA9C 3LZ0B 4G92C 3AN2A 1P3BC 4UUZB 1B67A 2PYOD 5F99C 5B33A 1HQ3D 5JA4A 5B24C 1S32C 1M1AC 3MNNB 4J8UD 1B6WA 5B32C 3VH5A 3WA9B 3KSYA 3LELC 2RVQD 3MGRC 3AZHB 3LZ1B 5CPKB 5F99B 5AV6D 4H9PB 1N1JB 3AZGC 3LJAB 3RELD 5G49B 1P3GC 2HIOA 3KXBB 3LELB 3MGRB 4H9NA 4J8VA 4XUJD 3W98A 3MGSB 5B2JA 1P3PD 4YM6A 5BS7A 3AZGB 1P3AA 2F8NH 4KUDC 4WU9A 5GXQD 2CV5C 2NQBC 5BNXA 5DNMB 5CP6A 3MVDC 2L5AA 3W96C 4J8XB 4KUDB 4J8WB 5AVCB 3MGQC 3WKJD 2HUEB 3O62C 3X1SD 1P3MC 3UTAD 3B6FD 3REHB 2NQBB 3MVDB 3B6GD 3REJC 1JFIA 4ZUXA 5B2IA 3AFAD 3MGPA 3O62B 5B33C 4EO5C 5E5AA 1M19C 4XZQA 3KUYC 3W99B 3AV2B 4NE6A 4LD9D 3WTPA 3AZJB 2NZDD 3X1VD 3AZED 3WAAD 1P3LC 1KX3C 4KGCD 4WU8D 4EO5B 1M19B 2BYKB 5FUGA 5B0ZB 3KUYB 1EQZB 2FJ7A 1ULYA 3AZKD 1U35A 3REIA 3AYWA 3W98C 1P3IA 1KX3B 3X1TA 5B2JC 3AV1B 1TZYA 3MGSD 4WU9C 5AV9B 4QLCC 5AY8A 5JRGB 5GSUB 2YFWA 5CPJD 3AZMD 3AZFC 1P3KD 1M18C 4QLCB 1P3OA 2PYOC 4YS3A 4AWLB 3REHD 4R8PD 4J8UC 3AZFB 1F1EA 1KU5A 5E5AC 3MNNA 5B40D 2PYOB 5AV6C 3WA9A 5CPID 1P3BA 1HQ3B 3WTPC 3AZHA 3LZ1A 3TU4D 5CPKA 5F99A 5B24A 1S32A 4H9PA 1M1AA 5B1MD 4X23C 5G49A 5B32A 4Z2MH 5AV6B 2FJ7C 3LELA 4NE3A 1U35C 3MGRA 3REIC 4Z66C 1P3IC 5B0ZD 3RELB 3AZND 1KX4D 5GXQC 3AZGA 4XUJB 3B0DB 1P3GA 4H9SC 5AY8C 1P3PB 5DNMA 4KHAA 3WKJC 1P34D 5GXQB 3NQUB 4KUDA 5AVCA 5GSUD 3B6GC 2CV5A 2NQBA 5BT1D 1AOID 3LZ0C 3MVDA 4E45A 3X1SB 3UTAB 3B6FB 5B0YD 3O62A 3B6GB 3AZLD 3MNNC 1P3MA 2NZDC 3AZEC 3WAAC 3AFAB 3W99A 4KGCC 2AROD 4WU8C 3REJA 3AZJA 3AZHC 3LZ1C 5CPKC 1ZLAD 4LD9B 3AZKC 1M19A 1HTAA 2BYKA 3LJAC 3AZEB 3X1VB 3WAAB 2NZDB 3KXBC 5GT3D 3KUYA 4KGCB 4WU8B 4DRAA 3MGSC 1P3LA 1KX3A 5B1LD 3AZKB 3UT9D 5DNND 4JJND 5AV9A 3VH6T 5GT0D 5DNMC 4NE5A 3X1UD 3AZMC 2F8NA 4J8XC 1R4VA 4J8WC 5AVCC 5B31B 2HUEC 3AZID 4QLCA 5B2ID 3NQJA 3KWQB 3REHC 5CPJB 3AZMB 1P3KB 4CAYA 1BH9B 5B40C 3AZFA 1KX5D 3REKD 1M18A 4R8PB 3TU4C 2PYOA 3W99C 3AV2C 4WNNB 1HQ3A 3C1BD 3AZJC 4J8UA 4HGAB 5B40B 3V9RA 3AYWD 5CPIB 1F66D 1A7WA 5B0ZC 3X1TD 3TU4B 3W97D 5AV6A 5C3IB 5B31G 5AVBD 3AZNC 1TZYD 3UTBB 1P3FD 1EQZC 5B1MB 3RELA 3AV1C 3R45B 4X23A 5AV9C 3AZNB 1KX4B 1P3PA 3C1CD 5JRGC 4Z66A 5GSUC 4YS3D 5GXQA 3NQUA 3A6NB 1AOIC 4H9SA 1P34B 4H9RA 3B0BA 5B31D 5B0YC 3WKJA 4ZBJB 4AWLC 3KWQD 3AZLC 1TAFB 3UTAA
chains in the Genus database with same CATH superfamily
1AOIB 2AROC 3B6GA 3AFAA 5B0YB 3P5JB 1M1AD 3LZ0A 1HQ3C 1ZLAC 5AV5D 4UUZA 3FDDA 2YFVB 3AZLB 3B0CT 3F6TA 5BNVB 2AROB 2VQRA 2RVQC 2NZDA 3X1VA 3AZEA 2JCHA 3WAAA 4KGCA 5B1LC 4H9NB 4WU8A 4J8VB 1ZLAB 3UT9C 4Z5TD 3RELC 1ID3D 5GT3B 3UTBD 1P3AB 5GT0C 3AZKA 1N1JA 5BO0B 4XUJC 3B0DC 3LJAA 3X1UC 3KXBA 5B1LB 1P3PC 3UT9B 5DNNB 2IO5C 5AV8D 3MGSA 4JJNB 3AZIC 5GT0B 1T3UA 3W96D 3X1UB 1PZRA 3MGQD 3A6ND 2IO5B 3AZMA 1P3MD 3H0LC 4J8XA 3AZIB 1P3KA 4ZUXB 5B2IB 3X1SC 3UTAC 4J8WA 3B6FC 1BH9A 3AN2D 3EPHA 2F8NG 3REJD 3VH5T 3C1BC 3REHA 5B33D 4R8PA 3AFAC 1KX5B 3REKB 5B40A 3VH6W 5AVBC 4LD9C 5CPIA 3C1BB 3X1VC 3TU4A 1H3OB 3AV2A 3AYWB 1F66B 2LY8A 5B1MA 2HIOD 3X1TB 2JSSA 4H9QB 5AVBB 4J8VD 3W97B 3W98D 1TZYB 1P3FB 2F8ND 3R45A 5B0ZA 5B2JD 1EQZA 4YM6D 1P3AD 3AZNA 2Y2LA 4WU9D 3AV1A 5KDMB 5CP6D 3C1CB 5B31C 2BG1A 1WWSA 3KWQC 3EPJA 5JRGA 5CPJC 4YS3B 1M18D 5GSUA 1P3KC 1TAFA 3EPLA 1AOIA 4ZUXD 5AV5C 3MGPD 4WZSB 4R8PC 4G92B 5B0YA 1P3BB 2Y2PA 5E5AD 3AL0C 3AZLA 2YFVA 4XZQD 4HGAC 4CSRB 5BNVA 5B24B 3WTPD 1S32B 1M1AB 5CPIC 2AROA 5AV5B 4Z5TC 5B32B 5C3IC 1ID3C 3UTBC 4H9OB 1ZLAA 4X23D 5B1MC 2FJ7D 5CHLB 2BYMB 5GT3A 3REID 1U35D 4Z66D 1P3ID 5BO0A 4Z5TB 1P3GB 5AV8C 1WWIA 1ID3B 5B1LA 1KX4C 1BH8B 4KHAB 3UT9A 5DNNA 4JJNA 5AY8D 2Y2GA 5GT0A 4XUJA 3A6NC 5AV8B 3X1UA 1P34C 2CV5B 4Z2MG 3B0CW 3VH6A 3AN2C 1P3OD 3W96B 5B32G 4ZBJC 3AZIA 3MGQB 3LZ0D 5BT1C 1P3MB 4NFTA 3AN2B 1KX5A 3MNND 3REJB 3REKA 3X1SA 3B6FA 3WA9D 5B33B 4WJ3C 1P3BD 5JA4B 3AZHD 3LZ1D 3C1BA 5CPKD 5F99D 2HIOC 5B24D 1S32D 1H3OA 2ZY3A 4J8VC 1F66A 3LJAD 1P3LB 5B32D 3KXBD 3LELD 4H9QA 3W97A 5GT3C 5AVBA 4YM6C 5BS7C 3MGRD 1P3AC 1P3FA 4LD9A 2J8PA 2HIOB 3AZGD 3W98B 3H0MC 5CP6C 1P3GD 2Y2IA 5DNNC 2F8NB 4JJNC 5B2JB 4WV4B 3VH5W 4YM6B 5DNMD 4E44A 5KDMA 3C1CA 4WU9B 4J8XD 3NQJB 2DF4C 3H0RC 4J8WD 4KUDD 5AVCD 5BNXB 5CP6B 1W2EA 4CAYB 2ZY2A 4ZUXC 5B2IC 2CV5D 3MGPC 2NQBD 3MVDD 5B31A 1M18B 3KWQA 4DRBA 4XZQC 5CPJA 3O62D 4G91C 1KX5C 3REKC 2Y2HA 1JFIB 3MGPB 4J8UB 3W99D 3AV2D 4CSRA 3V9RB 3AZJD 1Z2CB 5E5AB 5AV5A 4XZQB 1Q9CA 4G91B 3WTPE 2JE5A 3WTPB 4WNNA 1M19D 3AYWC 4H9OA 1F66C 3KUYD 1EQZD 3X1TC 3W97C 2BYMA 1TZYC 1P3FC 4X23B 5FUGB 1P3LD 1KX3D 4Z5TA 2FJ7B 2F8NK 3AV1D 1ID3A 1U35B 3REIB 3UTBA 4Z66B 1P3IB 1BH8A 5AV9D 5JRGD 3C1CC 1BFMA 5AV8A 1P3OC 5AY8B 4H9RB 1KX4A 4M6BA 4YS3C 3WKJB 4QLCD 2YFWB 3W96A 3KFUG 3MGQA 3A6NA 2CWEA 1P3OB 3IP4C 1P34A 3AZFD 3WA9C 3LZ0B 4G92C 3AN2A 1P3BC 4UUZB 1B67A 2PYOD 5F99C 5B33A 1HQ3D 5JA4A 5B24C 1S32C 1M1AC 3MNNB 4J8UD 1B6WA 3A1KA 5B32C 3VH5A 3WA9B 3KSYA 3LELC 2RVQD 3MGRC 3AZHB 3LZ1B 5CPKB 5F99B 5AV6D 4H9PB 1N1JB 3AZGC 3LJAB 3RELD 5G49B 3EG5B 1P3GC 2HIOA 3KXBB 3LELB 3MGRB 4H9NA 4J8VA 4XUJD 2Y2MA 3W98A 3MGSB 2W8SA 5B2JA 1P3PD 4YM6A 5BS7A 3AZGB 1P3AA 2F8NH 4KUDC 4WU9A 5GXQD 2CV5C 2NQBC 5BNXA 5DNMB 5CP6A 4UPKA 3MVDC 2L5AA 3W96C 4J8XB 4KUDB 4J8WB 5AVCB 3MGQC 3WKJD 2HUEB 3O62C 3X1SD 1P3MC 3UTAD 3B6FD 3REHB 2NQBB 3MVDB 3B6GD 3REJC 1JFIA 4ZUXA 5B2IA 3AFAD 3MGPA 3O62B 5B33C 4EO5C 5E5AA 1M19C 2FFFB 4XZQA 3KUYC 3W99B 3AV2B 4NE6A 2XD1A 4LD9D 3WTPA 3AZJB 2NZDD 3X1VD 3AZED 3WAAD 1P3LC 1KX3C 4KGCD 4WU8D 4EO5B 1M19B 2BYKB 2XD5A 5FUGA 5B0ZB 3KUYB 1EQZB 2FJ7A 1ULYA 3AZKD 1U35A 3REIA 3AYWA 3W98C 1P3IA 1KX3B 3EPKA 3X1TA 5B2JC 3AV1B 1TZYA 3MGSD 4WU9C 5AV9B 4QLCC 5AY8A 5JRGB 5GSUB 2YFWA 2ZY5A 5CPJD 3AZMD 3AZFC 1P3KD 1M18C 4QLCB 1P3OA 2PYOC 4YS3A 4AWLB 3REHD 4R8PD 4J8UC 3AZFB 1F1EA 1KU5A 5E5AC 3MNNA 5B40D 2PYOB 5AV6C 3WA9A 5CPID 1P3BA 1HQ3B 3WTPC 4DQYB 3AZHA 3LZ1A 2ZM5A 3TU4D 5CPKA 5F99A 5B24A 1S32A 4H9PA 1M1AA 5B1MD 4X23C 5G49A 2ZY4A 5B32A 4Z2MH 5AV6B 2FJ7C 3LELA 4NE3A 1U35C 3MGRA 2Y2JA 3REIC 4Z66C 1P3IC 5B0ZD 3RELB 3AZND 1KX4D 5GXQC 3AZGA 4XUJB 3B0DB 1P3GA 4H9SC 5AY8C 1P3PB 2F2AC 5DNMA 4KHAA 3WKJC 1P34D 2Y2KA 2G5HC 2DQNC 3NQUB 5GXQB 5AVCA 5GSUD 4KUDA 3B6GC 2CV5A 2NQBA 5BT1D 3A1IA 1AOID 3LZ0C 3MVDA 4E45A 3X1SB 3UTAB 3B6FB 5B0YD 3O62A 3B6GB 3AZLD 3MNNC 1P3MA 2NZDC 3AZEC 3WAAC 3AFAB 3W99A 4KGCC 2AROD 4WU8C 3REJA 3AZJA 3AZHC 3LZ1C 5CPKC 1ZLAD 4LD9B 3AZKC 1M19A 2RIQA 1HTAA 2BYKA 3LJAC 3AZEB 3X1VB 3WAAB 2NZDB 3KXBC 5GT3D 3KUYA 4KGCB 4WU8B 2Y2OA 4DRAA 3MGSC 1P3LA 1KX3A 5B1LD 3AZKB 3UT9D 5DNND 4JJND 5AV9A 3VH6T 5GT0D 5DNMC 4NE5A 3X1UD 3AZMC 2F8NA 4J8XC 1R4VA 2Y2NA 4J8WC 5AVCC 5B31B 2HUEC 3AZID 4QLCA 5B2ID 3NQJA 3KWQB 3REHC 5CPJB 3AZMB 1P3KB 4CAYA 2G5IC 1BH9B 5B40C 3AZFA 1KX5D 3REKD 1M18A 4R8PB 3TU4C 2PYOA 3W99C 3AV2C 4WNNB 1HQ3A 3C1BD 3AZJC 4J8UA 4HGAB 5B40B 3V9RA 3AYWD 5CPIB 1F66D 2UWXA 1A7WA 5B0ZC 3X1TD 3TU4B 3W97D 5AV6A 5C3IB 5B31G 5AVBD 3AZNC 1TZYD 3UTBB 1P3FD 1EQZC 5B1MB 3RELA 3AV1C 3R45B 4X23A 5AV9C 3AZNB 1KX4B 1P3PA 3C1CD 5JRGC 4Z66A 5GSUC 4YS3D 5GXQA 3NQUA 3A6NB 1AOIC 2Y2QA 4H9SA 1P34B 4H9RA 3B0BA 5B31D 5B0YC 3WKJA 4ZBJB 4AWLC 3KWQD 3AZLC 1TAFB 3UTAA
chains in the Genus database with same CATH topology
1AOIB 2AROC 3B6GA 3AFAA 5B0YB 3P5JB 1M1AD 3LZ0A 1HQ3C 1ZLAC 5AV5D 4UUZA 3FDDA 2YFVB 3AZLB 3B0CT 3F6TA 5BNVB 2AROB 2VQRA 2RVQC 2NZDA 3X1VA 3AZEA 2JCHA 3WAAA 4KGCA 5B1LC 4H9NB 4WU8A 4J8VB 1ZLAB 3UT9C 4Z5TD 3RELC 1ID3D 5GT3B 3UTBD 1P3AB 5GT0C 3AZKA 1N1JA 5BO0B 4XUJC 3B0DC 3LJAA 3X1UC 3KXBA 5B1LB 1P3PC 3UT9B 5DNNB 2IO5C 5AV8D 3MGSA 4JJNB 3AZIC 5GT0B 1T3UA 3W96D 3X1UB 1PZRA 3MGQD 3A6ND 2IO5B 3AZMA 1P3MD 3H0LC 4J8XA 3AZIB 1P3KA 4ZUXB 5B2IB 3X1SC 3UTAC 4J8WA 3B6FC 1BH9A 3AN2D 3EPHA 2F8NG 3REJD 3VH5T 3C1BC 3REHA 5B33D 4R8PA 3AFAC 1KX5B 3REKB 5B40A 3VH6W 5AVBC 4LD9C 5CPIA 3C1BB 3X1VC 3TU4A 1H3OB 3AV2A 3AYWB 1F66B 2LY8A 5B1MA 2HIOD 3X1TB 2JSSA 4H9QB 5AVBB 4J8VD 3W97B 3W98D 1TZYB 1P3FB 2F8ND 3R45A 5B0ZA 5B2JD 1EQZA 4YM6D 1P3AD 3AZNA 2Y2LA 4WU9D 3AV1A 5KDMB 5CP6D 3C1CB 5B31C 2BG1A 1WWSA 3KWQC 3EPJA 5JRGA 5CPJC 4YS3B 1M18D 5GSUA 1P3KC 1TAFA 3EPLA 1AOIA 4ZUXD 5AV5C 3MGPD 4WZSB 4R8PC 4G92B 5B0YA 1P3BB 2Y2PA 5E5AD 3AL0C 3AZLA 2YFVA 4XZQD 4HGAC 4CSRB 5BNVA 5B24B 3WTPD 1S32B 1M1AB 5CPIC 2AROA 5AV5B 4Z5TC 5B32B 5C3IC 1ID3C 3UTBC 4H9OB 1ZLAA 4X23D 5B1MC 2FJ7D 5CHLB 2BYMB 5GT3A 3REID 1U35D 4Z66D 1P3ID 5BO0A 4Z5TB 1P3GB 5AV8C 1WWIA 1ID3B 5B1LA 1KX4C 1BH8B 4KHAB 3UT9A 5DNNA 4JJNA 5AY8D 2Y2GA 5GT0A 4XUJA 3A6NC 5AV8B 3X1UA 1P34C 2CV5B 4Z2MG 3B0CW 3VH6A 3AN2C 1P3OD 3W96B 5B32G 4ZBJC 3AZIA 3MGQB 3LZ0D 5BT1C 1P3MB 4NFTA 3AN2B 1KX5A 3MNND 3REJB 3REKA 3X1SA 3B6FA 3WA9D 5B33B 4WJ3C 1P3BD 5JA4B 3AZHD 3LZ1D 3C1BA 5CPKD 5F99D 2HIOC 5B24D 1S32D 1H3OA 2ZY3A 4J8VC 1F66A 3LJAD 1P3LB 5B32D 3KXBD 3LELD 4H9QA 3W97A 5GT3C 5AVBA 4YM6C 5BS7C 3MGRD 1P3AC 1P3FA 4LD9A 2J8PA 2HIOB 3AZGD 3W98B 3H0MC 5CP6C 1P3GD 2Y2IA 5DNNC 2F8NB 4JJNC 5B2JB 4WV4B 3VH5W 4YM6B 5DNMD 4E44A 5KDMA 3C1CA 4WU9B 4J8XD 3NQJB 2DF4C 3H0RC 4J8WD 4KUDD 5AVCD 5BNXB 5CP6B 1W2EA 4CAYB 2ZY2A 4ZUXC 5B2IC 2CV5D 3MGPC 2NQBD 3MVDD 5B31A 1M18B 3KWQA 4DRBA 4XZQC 5CPJA 3O62D 4G91C 1KX5C 3REKC 2Y2HA 1JFIB 3MGPB 4J8UB 3W99D 3AV2D 4CSRA 3V9RB 3AZJD 1Z2CB 5E5AB 5AV5A 4XZQB 1Q9CA 4G91B 3WTPE 2JE5A 3WTPB 4WNNA 1M19D 3AYWC 4H9OA 1F66C 3KUYD 1EQZD 3X1TC 3W97C 2BYMA 1TZYC 1P3FC 4X23B 5FUGB 1P3LD 1KX3D 4Z5TA 2FJ7B 2F8NK 3AV1D 1ID3A 1U35B 3REIB 3UTBA 4Z66B 1P3IB 1BH8A 5AV9D 5JRGD 3C1CC 1BFMA 5AV8A 1P3OC 5AY8B 4H9RB 1KX4A 4M6BA 4YS3C 3WKJB 4QLCD 2YFWB 3W96A 3KFUG 3MGQA 3A6NA 2CWEA 1P3OB 3IP4C 1P34A 3AZFD 3WA9C 3LZ0B 4G92C 3AN2A 1P3BC 4UUZB 1B67A 2PYOD 5F99C 5B33A 1HQ3D 5JA4A 5B24C 1S32C 1M1AC 3MNNB 4J8UD 1B6WA 3A1KA 5B32C 3VH5A 3WA9B 3KSYA 3LELC 2RVQD 3MGRC 3AZHB 3LZ1B 5CPKB 5F99B 5AV6D 4H9PB 1N1JB 3AZGC 3LJAB 3RELD 5G49B 3EG5B 1P3GC 2HIOA 3KXBB 3LELB 3MGRB 4H9NA 4J8VA 4XUJD 2Y2MA 3W98A 3MGSB 2W8SA 5B2JA 1P3PD 4YM6A 5BS7A 3AZGB 1P3AA 2F8NH 4KUDC 4WU9A 5GXQD 2CV5C 2NQBC 5BNXA 5DNMB 5CP6A 4UPKA 3MVDC 2L5AA 3W96C 4J8XB 4KUDB 4J8WB 5AVCB 3MGQC 3WKJD 2HUEB 3O62C 3X1SD 1P3MC 3UTAD 3B6FD 3REHB 2NQBB 3MVDB 3B6GD 3REJC 1JFIA 4ZUXA 5B2IA 3AFAD 3MGPA 3O62B 5B33C 4EO5C 5E5AA 1M19C 2FFFB 4XZQA 3KUYC 3W99B 3AV2B 4NE6A 2XD1A 4LD9D 3WTPA 3AZJB 2NZDD 3X1VD 3AZED 3WAAD 1P3LC 1KX3C 4KGCD 4WU8D 4EO5B 1M19B 2BYKB 2XD5A 5FUGA 5B0ZB 3KUYB 1EQZB 2FJ7A 1ULYA 3AZKD 1U35A 3REIA 3AYWA 3W98C 1P3IA 1KX3B 3EPKA 3X1TA 5B2JC 3AV1B 1TZYA 3MGSD 4WU9C 5AV9B 4QLCC 5AY8A 5JRGB 5GSUB 2YFWA 2ZY5A 5CPJD 3AZMD 3AZFC 1P3KD 1M18C 4QLCB 1P3OA 2PYOC 4YS3A 4AWLB 3REHD 4R8PD 4J8UC 3AZFB 1F1EA 1KU5A 5E5AC 3MNNA 5B40D 2PYOB 5AV6C 3WA9A 5CPID 1P3BA 1HQ3B 3WTPC 4DQYB 3AZHA 3LZ1A 2ZM5A 3TU4D 5CPKA 5F99A 5B24A 1S32A 4H9PA 1M1AA 5B1MD 4X23C 5G49A 2ZY4A 5B32A 4Z2MH 5AV6B 2FJ7C 3LELA 4NE3A 1U35C 3MGRA 2Y2JA 3REIC 4Z66C 1P3IC 5B0ZD 3RELB 3AZND 1KX4D 5GXQC 3AZGA 4XUJB 3B0DB 1P3GA 4H9SC 5AY8C 1P3PB 2F2AC 5DNMA 4KHAA 3WKJC 1P34D 2Y2KA 2G5HC 2DQNC 3NQUB 5GXQB 5AVCA 5GSUD 4KUDA 3B6GC 2CV5A 2NQBA 5BT1D 3A1IA 1AOID 3LZ0C 3MVDA 4E45A 3X1SB 3UTAB 3B6FB 5B0YD 3O62A 3B6GB 3AZLD 3MNNC 1P3MA 2NZDC 3AZEC 3WAAC 3AFAB 3W99A 4KGCC 2AROD 4WU8C 3REJA 3AZJA 3AZHC 3LZ1C 5CPKC 1ZLAD 4LD9B 3AZKC 1M19A 2RIQA 1HTAA 2BYKA 3LJAC 3AZEB 3X1VB 3WAAB 2NZDB 3KXBC 5GT3D 3KUYA 4KGCB 4WU8B 2Y2OA 4DRAA 3MGSC 1P3LA 1KX3A 5B1LD 3AZKB 3UT9D 5DNND 4JJND 5AV9A 3VH6T 5GT0D 5DNMC 4NE5A 3X1UD 3AZMC 2F8NA 4J8XC 1R4VA 2Y2NA 4J8WC 5AVCC 5B31B 2HUEC 3AZID 4QLCA 5B2ID 3NQJA 3KWQB 3REHC 5CPJB 3AZMB 1P3KB 4CAYA 2G5IC 1BH9B 5B40C 3AZFA 1KX5D 3REKD 1M18A 4R8PB 3TU4C 2PYOA 3W99C 3AV2C 4WNNB 1HQ3A 3C1BD 3AZJC 4J8UA 4HGAB 5B40B 3V9RA 3AYWD 5CPIB 1F66D 2UWXA 1A7WA 5B0ZC 3X1TD 3TU4B 3W97D 5AV6A 5C3IB 5B31G 5AVBD 3AZNC 1TZYD 3UTBB 1P3FD 1EQZC 5B1MB 3RELA 3AV1C 3R45B 4X23A 5AV9C 3AZNB 1KX4B 1P3PA 3C1CD 5JRGC 4Z66A 5GSUC 4YS3D 5GXQA 3NQUA 3A6NB 1AOIC 2Y2QA 4H9SA 1P34B 4H9RA 3B0BA 5B31D 5B0YC 3WKJA 4ZBJB 4AWLC 3KWQD 3AZLC 1TAFB 3UTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOI B;  2ARO C;  3B6G A;  3AFA A;  5B0Y B;  1M1A D;  3LZ0 A;  1HQ3 C;  1ZLA C;  5AV5 D;  4UUZ A;  3AZL B;  2YFV B;  3B0C T;  5BNV B;  2ARO B;  2RVQ C;  2NZD A;  3X1V A;  3AZE A;  3WAA A;  4KGC A;  5B1L C;  4H9N B;  4WU8 A;  4J8V B;  1ZLA B;  3UT9 C;  4Z5T D;  3REL C;  1ID3 D;  5GT3 B;  3UTB D;  1P3A B;  5GT0 C;  3AZK A;  1N1J A;  5BO0 B;  4XUJ C;  3B0D C;  3LJA A;  3X1U C;  3KXB A;  5B1L B;  1P3P C;  3UT9 B;  5DNN B;  2IO5 C;  5AV8 D;  3MGS A;  4JJN B;  3AZI C;  5GT0 B;  3W96 D;  3X1U B;  3MGQ D;  3A6N D;  2IO5 B;  3AZM A;  1P3M D;  4J8X A;  3AZI B;  1P3K A;  4ZUX B;  5B2I B;  3X1S C;  3UTA C;  4J8W A;  3B6F C;  1BH9 A;  3AN2 D;  2F8N G;  3REJ D;  3VH5 T;  3C1B C;  3REH A;  5B33 D;  4R8P A;  3AFA C;  1KX5 B;  3REK B;  5B40 A;  3VH6 W;  5AVB C;  4LD9 C;  5CPI A;  3C1B B;  3X1V C;  3TU4 A;  1H3O B;  3AV2 A;  3AYW B;  1F66 B;  2LY8 A;  5B1M A;  2HIO D;  3X1T B;  2JSS A;  4H9Q B;  5AVB B;  4J8V D;  3W97 B;  3W98 D;  1TZY B;  1P3F B;  2F8N D;  3R45 A;  5B0Z A;  5B2J D;  1EQZ A;  4YM6 D;  1P3A D;  3AZN A;  4WU9 D;  3AV1 A;  5KDM B;  5CP6 D;  3C1C B;  5B31 C;  1WWS A;  3KWQ C;  5JRG A;  5CPJ C;  4YS3 B;  1M18 D;  5GSU A;  1P3K C;  1TAF A;  1AOI A;  4ZUX D;  5AV5 C;  3MGP D;  4WZS B;  4R8P C;  4G92 B;  5B0Y A;  1P3B B;  5E5A D;  3AZL A;  2YFV A;  4XZQ D;  4HGA C;  4CSR B;  5BNV A;  5B24 B;  3WTP D;  1S32 B;  1M1A B;  5CPI C;  2ARO A;  5AV5 B;  4Z5T C;  5B32 B;  5C3I C;  1ID3 C;  3UTB C;  4H9O B;  1ZLA A;  4X23 D;  5B1M C;  2FJ7 D;  5CHL B;  2BYM B;  5GT3 A;  3REI D;  1U35 D;  4Z66 D;  1P3I D;  5BO0 A;  4Z5T B;  1P3G B;  5AV8 C;  1WWI A;  1ID3 B;  5B1L A;  1KX4 C;  1BH8 B;  4KHA B;  3UT9 A;  5DNN A;  4JJN A;  5AY8 D;  5GT0 A;  4XUJ A;  3A6N C;  5AV8 B;  3X1U A;  1P34 C;  2CV5 B;  4Z2M G;  3B0C W;  3VH6 A;  3AN2 C;  1P3O D;  3W96 B;  5B32 G;  4ZBJ C;  3AZI A;  3MGQ B;  3LZ0 D;  5BT1 C;  1P3M B;  4NFT A;  3AN2 B;  1KX5 A;  3MNN D;  3REJ B;  3REK A;  3X1S A;  3B6F A;  3WA9 D;  5B33 B;  1P3B D;  5JA4 B;  3AZH D;  3LZ1 D;  3C1B A;  5CPK D;  5F99 D;  2HIO C;  5B24 D;  1S32 D;  1H3O A;  4J8V C;  1F66 A;  3LJA D;  1P3L B;  5B32 D;  3KXB D;  3LEL D;  4H9Q A;  3W97 A;  5GT3 C;  5AVB A;  4YM6 C;  5BS7 C;  3MGR D;  1P3A C;  1P3F A;  4LD9 A;  2HIO B;  3AZG D;  3W98 B;  5CP6 C;  1P3G D;  5DNN C;  2F8N B;  4JJN C;  5B2J B;  4WV4 B;  3VH5 W;  4YM6 B;  5DNM D;  4E44 A;  5KDM A;  3C1C A;  4WU9 B;  4J8X D;  3NQJ B;  4KUD D;  4J8W D;  5AVC D;  5BNX B;  5CP6 B;  4CAY B;  4ZUX C;  5B2I C;  2CV5 D;  3MGP C;  2NQB D;  3MVD D;  5B31 A;  1M18 B;  3KWQ A;  4DRB A;  4XZQ C;  5CPJ A;  3O62 D;  4G91 C;  1KX5 C;  3REK C;  1JFI B;  3MGP B;  4J8U B;  3W99 D;  3AV2 D;  4CSR A;  3V9R B;  3AZJ D;  5E5A B;  5AV5 A;  4XZQ B;  1Q9C A;  4G91 B;  3WTP E;  3WTP B;  4WNN A;  1M19 D;  3AYW C;  4H9O A;  1F66 C;  3KUY D;  1EQZ D;  3X1T C;  3W97 C;  2BYM A;  1TZY C;  1P3F C;  4X23 B;  5FUG B;  1P3L D;  1KX3 D;  4Z5T A;  2FJ7 B;  2F8N K;  3AV1 D;  1ID3 A;  1U35 B;  3REI B;  3UTB A;  4Z66 B;  1P3I B;  1BH8 A;  5AV9 D;  5JRG D;  3C1C C;  1BFM A;  5AV8 A;  1P3O C;  5AY8 B;  4H9R B;  1KX4 A;  4M6B A;  4YS3 C;  3WKJ B;  4QLC D;  2YFW B;  3W96 A;  3MGQ A;  3A6N A;  2CWE A;  1P3O B;  1P34 A;  3AZF D;  3WA9 C;  3LZ0 B;  4G92 C;  3AN2 A;  1P3B C;  4UUZ B;  1B67 A;  2PYO D;  5F99 C;  5B33 A;  1HQ3 D;  5JA4 A;  5B24 C;  1S32 C;  1M1A C;  3MNN B;  4J8U D;  1B6W A;  5B32 C;  3VH5 A;  3WA9 B;  3KSY A;  3LEL C;  2RVQ D;  3MGR C;  3AZH B;  3LZ1 B;  5CPK B;  5F99 B;  5AV6 D;  4H9P B;  1N1J B;  3AZG C;  3LJA B;  3REL D;  5G49 B;  1P3G C;  2HIO A;  3KXB B;  3LEL B;  3MGR B;  4H9N A;  4J8V A;  4XUJ D;  3W98 A;  3MGS B;  5B2J A;  1P3P D;  4YM6 A;  5BS7 A;  3AZG B;  1P3A A;  2F8N H;  4KUD C;  4WU9 A;  5GXQ D;  2CV5 C;  2NQB C;  5BNX A;  5DNM B;  5CP6 A;  3MVD C;  2L5A A;  3W96 C;  4J8X B;  4KUD B;  4J8W B;  5AVC B;  3MGQ C;  3WKJ D;  2HUE B;  3O62 C;  3X1S D;  1P3M C;  3UTA D;  3B6F D;  3REH B;  2NQB B;  3MVD B;  3B6G D;  3REJ C;  1JFI A;  4ZUX A;  5B2I A;  3AFA D;  3MGP A;  3O62 B;  5B33 C;  4EO5 C;  5E5A A;  1M19 C;  4XZQ A;  3KUY C;  3W99 B;  3AV2 B;  4NE6 A;  4LD9 D;  3WTP A;  3AZJ B;  2NZD D;  3X1V D;  3AZE D;  3WAA D;  1P3L C;  1KX3 C;  4KGC D;  4WU8 D;  4EO5 B;  1M19 B;  2BYK B;  5FUG A;  5B0Z B;  3KUY B;  1EQZ B;  2FJ7 A;  1ULY A;  3AZK D;  1U35 A;  3REI A;  3AYW A;  3W98 C;  1P3I A;  1KX3 B;  3X1T A;  5B2J C;  3AV1 B;  1TZY A;  3MGS D;  4WU9 C;  5AV9 B;  4QLC C;  5AY8 A;  5JRG B;  5GSU B;  2YFW A;  5CPJ D;  3AZM D;  3AZF C;  1P3K D;  1M18 C;  4QLC B;  1P3O A;  2PYO C;  4YS3 A;  4AWL B;  3REH D;  4R8P D;  4J8U C;  3AZF B;  1F1E A;  1KU5 A;  5E5A C;  3MNN A;  5B40 D;  2PYO B;  5AV6 C;  3WA9 A;  5CPI D;  1P3B A;  1HQ3 B;  3WTP C;  3AZH A;  3LZ1 A;  3TU4 D;  5CPK A;  5F99 A;  5B24 A;  1S32 A;  4H9P A;  1M1A A;  5B1M D;  4X23 C;  5G49 A;  5B32 A;  4Z2M H;  5AV6 B;  2FJ7 C;  3LEL A;  4NE3 A;  1U35 C;  3MGR A;  3REI C;  4Z66 C;  1P3I C;  5B0Z D;  3REL B;  3AZN D;  1KX4 D;  5GXQ C;  3AZG A;  4XUJ B;  3B0D B;  1P3G A;  4H9S C;  5AY8 C;  1P3P B;  5DNM A;  4KHA A;  3WKJ C;  1P34 D;  5GXQ B;  3NQU B;  4KUD A;  5AVC A;  5GSU D;  3B6G C;  2CV5 A;  2NQB A;  5BT1 D;  1AOI D;  3LZ0 C;  3MVD A;  4E45 A;  3X1S B;  3UTA B;  3B6F B;  5B0Y D;  3O62 A;  3B6G B;  3AZL D;  3MNN C;  1P3M A;  2NZD C;  3AZE C;  3WAA C;  3AFA B;  3W99 A;  4KGC C;  2ARO D;  4WU8 C;  3REJ A;  3AZJ A;  3AZH C;  3LZ1 C;  5CPK C;  1ZLA D;  4LD9 B;  3AZK C;  1M19 A;  1HTA A;  2BYK A;  3LJA C;  3AZE B;  3X1V B;  3WAA B;  2NZD B;  3KXB C;  5GT3 D;  3KUY A;  4KGC B;  4WU8 B;  4DRA A;  3MGS C;  1P3L A;  1KX3 A;  5B1L D;  3AZK B;  3UT9 D;  5DNN D;  4JJN D;  5AV9 A;  3VH6 T;  5GT0 D;  5DNM C;  4NE5 A;  3X1U D;  3AZM C;  2F8N A;  4J8X C;  1R4V A;  4J8W C;  5AVC C;  5B31 B;  2HUE C;  3AZI D;  4QLC A;  5B2I D;  3NQJ A;  3KWQ B;  3REH C;  5CPJ B;  3AZM B;  1P3K B;  4CAY A;  1BH9 B;  5B40 C;  3AZF A;  1KX5 D;  3REK D;  1M18 A;  4R8P B;  3TU4 C;  2PYO A;  3W99 C;  3AV2 C;  4WNN B;  1HQ3 A;  3C1B D;  3AZJ C;  4J8U A;  4HGA B;  5B40 B;  3V9R A;  3AYW D;  5CPI B;  1F66 D;  1A7W A;  5B0Z C;  3X1T D;  3TU4 B;  3W97 D;  5AV6 A;  5C3I B;  5B31 G;  5AVB D;  3AZN C;  1TZY D;  3UTB B;  1P3F D;  1EQZ C;  5B1M B;  3REL A;  3AV1 C;  3R45 B;  4X23 A;  5AV9 C;  3AZN B;  1KX4 B;  1P3P A;  3C1C D;  5JRG C;  4Z66 A;  5GSU C;  4YS3 D;  5GXQ A;  3NQU A;  3A6N B;  1AOI C;  4H9S A;  1P34 B;  4H9R A;  3B0B A;  5B31 D;  5B0Y C;  3WKJ A;  4ZBJ B;  4AWL C;  3KWQ D;  3AZL C;  1TAF B;  3UTA A; 
#chains in the Genus database with same CATH topology
 1AOI B;  2ARO C;  3B6G A;  3AFA A;  5B0Y B;  3P5J B;  1M1A D;  3LZ0 A;  1HQ3 C;  1ZLA C;  5AV5 D;  4UUZ A;  3FDD A;  2YFV B;  3AZL B;  3B0C T;  3F6T A;  5BNV B;  2ARO B;  2VQR A;  2RVQ C;  2NZD A;  3X1V A;  3AZE A;  2JCH A;  3WAA A;  4KGC A;  5B1L C;  4H9N B;  4WU8 A;  4J8V B;  1ZLA B;  3UT9 C;  4Z5T D;  3REL C;  1ID3 D;  5GT3 B;  3UTB D;  1P3A B;  5GT0 C;  3AZK A;  1N1J A;  5BO0 B;  4XUJ C;  3B0D C;  3LJA A;  3X1U C;  3KXB A;  5B1L B;  1P3P C;  3UT9 B;  5DNN B;  2IO5 C;  5AV8 D;  3MGS A;  4JJN B;  3AZI C;  5GT0 B;  1T3U A;  3W96 D;  3X1U B;  1PZR A;  3MGQ D;  3A6N D;  2IO5 B;  3AZM A;  1P3M D;  3H0L C;  4J8X A;  3AZI B;  1P3K A;  4ZUX B;  5B2I B;  3X1S C;  3UTA C;  4J8W A;  3B6F C;  1BH9 A;  3AN2 D;  3EPH A;  2F8N G;  3REJ D;  3VH5 T;  3C1B C;  3REH A;  5B33 D;  4R8P A;  3AFA C;  1KX5 B;  3REK B;  5B40 A;  3VH6 W;  5AVB C;  4LD9 C;  5CPI A;  3C1B B;  3X1V C;  3TU4 A;  1H3O B;  3AV2 A;  3AYW B;  1F66 B;  2LY8 A;  5B1M A;  2HIO D;  3X1T B;  2JSS A;  4H9Q B;  5AVB B;  4J8V D;  3W97 B;  3W98 D;  1TZY B;  1P3F B;  2F8N D;  3R45 A;  5B0Z A;  5B2J D;  1EQZ A;  4YM6 D;  1P3A D;  3AZN A;  2Y2L A;  4WU9 D;  3AV1 A;  5KDM B;  5CP6 D;  3C1C B;  5B31 C;  2BG1 A;  1WWS A;  3KWQ C;  3EPJ A;  5JRG A;  5CPJ C;  4YS3 B;  1M18 D;  5GSU A;  1P3K C;  1TAF A;  3EPL A;  1AOI A;  4ZUX D;  5AV5 C;  3MGP D;  4WZS B;  4R8P C;  4G92 B;  5B0Y A;  1P3B B;  2Y2P A;  5E5A D;  3AL0 C;  3AZL A;  2YFV A;  4XZQ D;  4HGA C;  4CSR B;  5BNV A;  5B24 B;  3WTP D;  1S32 B;  1M1A B;  5CPI C;  2ARO A;  5AV5 B;  4Z5T C;  5B32 B;  5C3I C;  1ID3 C;  3UTB C;  4H9O B;  1ZLA A;  4X23 D;  5B1M C;  2FJ7 D;  5CHL B;  2BYM B;  5GT3 A;  3REI D;  1U35 D;  4Z66 D;  1P3I D;  5BO0 A;  4Z5T B;  1P3G B;  5AV8 C;  1WWI A;  1ID3 B;  5B1L A;  1KX4 C;  1BH8 B;  4KHA B;  3UT9 A;  5DNN A;  4JJN A;  5AY8 D;  2Y2G A;  5GT0 A;  4XUJ A;  3A6N C;  5AV8 B;  3X1U A;  1P34 C;  2CV5 B;  4Z2M G;  3B0C W;  3VH6 A;  3AN2 C;  1P3O D;  3W96 B;  5B32 G;  4ZBJ C;  3AZI A;  3MGQ B;  3LZ0 D;  5BT1 C;  1P3M B;  4NFT A;  3AN2 B;  1KX5 A;  3MNN D;  3REJ B;  3REK A;  3X1S A;  3B6F A;  3WA9 D;  5B33 B;  4WJ3 C;  1P3B D;  5JA4 B;  3AZH D;  3LZ1 D;  3C1B A;  5CPK D;  5F99 D;  2HIO C;  5B24 D;  1S32 D;  1H3O A;  2ZY3 A;  4J8V C;  1F66 A;  3LJA D;  1P3L B;  5B32 D;  3KXB D;  3LEL D;  4H9Q A;  3W97 A;  5GT3 C;  5AVB A;  4YM6 C;  5BS7 C;  3MGR D;  1P3A C;  1P3F A;  4LD9 A;  2J8P A;  2HIO B;  3AZG D;  3W98 B;  3H0M C;  5CP6 C;  1P3G D;  2Y2I A;  5DNN C;  2F8N B;  4JJN C;  5B2J B;  4WV4 B;  3VH5 W;  4YM6 B;  5DNM D;  4E44 A;  5KDM A;  3C1C A;  4WU9 B;  4J8X D;  3NQJ B;  2DF4 C;  3H0R C;  4J8W D;  4KUD D;  5AVC D;  5BNX B;  5CP6 B;  1W2E A;  4CAY B;  2ZY2 A;  4ZUX C;  5B2I C;  2CV5 D;  3MGP C;  2NQB D;  3MVD D;  5B31 A;  1M18 B;  3KWQ A;  4DRB A;  4XZQ C;  5CPJ A;  3O62 D;  4G91 C;  1KX5 C;  3REK C;  2Y2H A;  1JFI B;  3MGP B;  4J8U B;  3W99 D;  3AV2 D;  4CSR A;  3V9R B;  3AZJ D;  1Z2C B;  5E5A B;  5AV5 A;  4XZQ B;  1Q9C A;  4G91 B;  3WTP E;  2JE5 A;  3WTP B;  4WNN A;  1M19 D;  3AYW C;  4H9O A;  1F66 C;  3KUY D;  1EQZ D;  3X1T C;  3W97 C;  2BYM A;  1TZY C;  1P3F C;  4X23 B;  5FUG B;  1P3L D;  1KX3 D;  4Z5T A;  2FJ7 B;  2F8N K;  3AV1 D;  1ID3 A;  1U35 B;  3REI B;  3UTB A;  4Z66 B;  1P3I B;  1BH8 A;  5AV9 D;  5JRG D;  3C1C C;  1BFM A;  5AV8 A;  1P3O C;  5AY8 B;  4H9R B;  1KX4 A;  4M6B A;  4YS3 C;  3WKJ B;  4QLC D;  2YFW B;  3W96 A;  3KFU G;  3MGQ A;  3A6N A;  2CWE A;  1P3O B;  3IP4 C;  1P34 A;  3AZF D;  3WA9 C;  3LZ0 B;  4G92 C;  3AN2 A;  1P3B C;  4UUZ B;  1B67 A;  2PYO D;  5F99 C;  5B33 A;  1HQ3 D;  5JA4 A;  5B24 C;  1S32 C;  1M1A C;  3MNN B;  4J8U D;  1B6W A;  3A1K A;  5B32 C;  3VH5 A;  3WA9 B;  3KSY A;  3LEL C;  2RVQ D;  3MGR C;  3AZH B;  3LZ1 B;  5CPK B;  5F99 B;  5AV6 D;  4H9P B;  1N1J B;  3AZG C;  3LJA B;  3REL D;  5G49 B;  3EG5 B;  1P3G C;  2HIO A;  3KXB B;  3LEL B;  3MGR B;  4H9N A;  4J8V A;  4XUJ D;  2Y2M A;  3W98 A;  3MGS B;  2W8S A;  5B2J A;  1P3P D;  4YM6 A;  5BS7 A;  3AZG B;  1P3A A;  2F8N H;  4KUD C;  4WU9 A;  5GXQ D;  2CV5 C;  2NQB C;  5BNX A;  5DNM B;  5CP6 A;  4UPK A;  3MVD C;  2L5A A;  3W96 C;  4J8X B;  4KUD B;  4J8W B;  5AVC B;  3MGQ C;  3WKJ D;  2HUE B;  3O62 C;  3X1S D;  1P3M C;  3UTA D;  3B6F D;  3REH B;  2NQB B;  3MVD B;  3B6G D;  3REJ C;  1JFI A;  4ZUX A;  5B2I A;  3AFA D;  3MGP A;  3O62 B;  5B33 C;  4EO5 C;  5E5A A;  1M19 C;  2FFF B;  4XZQ A;  3KUY C;  3W99 B;  3AV2 B;  4NE6 A;  2XD1 A;  4LD9 D;  3WTP A;  3AZJ B;  2NZD D;  3X1V D;  3AZE D;  3WAA D;  1P3L C;  1KX3 C;  4KGC D;  4WU8 D;  4EO5 B;  1M19 B;  2BYK B;  2XD5 A;  5FUG A;  5B0Z B;  3KUY B;  1EQZ B;  2FJ7 A;  1ULY A;  3AZK D;  1U35 A;  3REI A;  3AYW A;  3W98 C;  1P3I A;  1KX3 B;  3EPK A;  3X1T A;  5B2J C;  3AV1 B;  1TZY A;  3MGS D;  4WU9 C;  5AV9 B;  4QLC C;  5AY8 A;  5JRG B;  5GSU B;  2YFW A;  2ZY5 A;  5CPJ D;  3AZM D;  3AZF C;  1P3K D;  1M18 C;  4QLC B;  1P3O A;  2PYO C;  4YS3 A;  4AWL B;  3REH D;  4R8P D;  4J8U C;  3AZF B;  1F1E A;  1KU5 A;  5E5A C;  3MNN A;  5B40 D;  2PYO B;  5AV6 C;  3WA9 A;  5CPI D;  1P3B A;  1HQ3 B;  3WTP C;  4DQY B;  3AZH A;  3LZ1 A;  2ZM5 A;  3TU4 D;  5CPK A;  5F99 A;  5B24 A;  1S32 A;  4H9P A;  1M1A A;  5B1M D;  4X23 C;  5G49 A;  2ZY4 A;  5B32 A;  4Z2M H;  5AV6 B;  2FJ7 C;  3LEL A;  4NE3 A;  1U35 C;  3MGR A;  2Y2J A;  3REI C;  4Z66 C;  1P3I C;  5B0Z D;  3REL B;  3AZN D;  1KX4 D;  5GXQ C;  3AZG A;  4XUJ B;  3B0D B;  1P3G A;  4H9S C;  5AY8 C;  1P3P B;  2F2A C;  5DNM A;  4KHA A;  3WKJ C;  1P34 D;  2Y2K A;  2G5H C;  2DQN C;  3NQU B;  5GXQ B;  5AVC A;  5GSU D;  4KUD A;  3B6G C;  2CV5 A;  2NQB A;  5BT1 D;  3A1I A;  1AOI D;  3LZ0 C;  3MVD A;  4E45 A;  3X1S B;  3UTA B;  3B6F B;  5B0Y D;  3O62 A;  3B6G B;  3AZL D;  3MNN C;  1P3M A;  2NZD C;  3AZE C;  3WAA C;  3AFA B;  3W99 A;  4KGC C;  2ARO D;  4WU8 C;  3REJ A;  3AZJ A;  3AZH C;  3LZ1 C;  5CPK C;  1ZLA D;  4LD9 B;  3AZK C;  1M19 A;  2RIQ A;  1HTA A;  2BYK A;  3LJA C;  3AZE B;  3X1V B;  3WAA B;  2NZD B;  3KXB C;  5GT3 D;  3KUY A;  4KGC B;  4WU8 B;  2Y2O A;  4DRA A;  3MGS C;  1P3L A;  1KX3 A;  5B1L D;  3AZK B;  3UT9 D;  5DNN D;  4JJN D;  5AV9 A;  3VH6 T;  5GT0 D;  5DNM C;  4NE5 A;  3X1U D;  3AZM C;  2F8N A;  4J8X C;  1R4V A;  2Y2N A;  4J8W C;  5AVC C;  5B31 B;  2HUE C;  3AZI D;  4QLC A;  5B2I D;  3NQJ A;  3KWQ B;  3REH C;  5CPJ B;  3AZM B;  1P3K B;  4CAY A;  2G5I C;  1BH9 B;  5B40 C;  3AZF A;  1KX5 D;  3REK D;  1M18 A;  4R8P B;  3TU4 C;  2PYO A;  3W99 C;  3AV2 C;  4WNN B;  1HQ3 A;  3C1B D;  3AZJ C;  4J8U A;  4HGA B;  5B40 B;  3V9R A;  3AYW D;  5CPI B;  1F66 D;  2UWX A;  1A7W A;  5B0Z C;  3X1T D;  3TU4 B;  3W97 D;  5AV6 A;  5C3I B;  5B31 G;  5AVB D;  3AZN C;  1TZY D;  3UTB B;  1P3F D;  1EQZ C;  5B1M B;  3REL A;  3AV1 C;  3R45 B;  4X23 A;  5AV9 C;  3AZN B;  1KX4 B;  1P3P A;  3C1C D;  5JRG C;  4Z66 A;  5GSU C;  4YS3 D;  5GXQ A;  3NQU A;  3A6N B;  1AOI C;  2Y2Q A;  4H9S A;  1P34 B;  4H9R A;  3B0B A;  5B31 D;  5B0Y C;  3WKJ A;  4ZBJ B;  4AWL C;  3KWQ D;  3AZL C;  1TAF B;  3UTA A; 
#chains in the Genus database with same CATH homology
 1AOI B;  2ARO C;  3B6G A;  3AFA A;  5B0Y B;  3P5J B;  1M1A D;  3LZ0 A;  1HQ3 C;  1ZLA C;  5AV5 D;  4UUZ A;  3FDD A;  2YFV B;  3AZL B;  3B0C T;  3F6T A;  5BNV B;  2ARO B;  2VQR A;  2RVQ C;  2NZD A;  3X1V A;  3AZE A;  2JCH A;  3WAA A;  4KGC A;  5B1L C;  4H9N B;  4WU8 A;  4J8V B;  1ZLA B;  3UT9 C;  4Z5T D;  3REL C;  1ID3 D;  5GT3 B;  3UTB D;  1P3A B;  5GT0 C;  3AZK A;  1N1J A;  5BO0 B;  4XUJ C;  3B0D C;  3LJA A;  3X1U C;  3KXB A;  5B1L B;  1P3P C;  3UT9 B;  5DNN B;  2IO5 C;  5AV8 D;  3MGS A;  4JJN B;  3AZI C;  5GT0 B;  1T3U A;  3W96 D;  3X1U B;  1PZR A;  3MGQ D;  3A6N D;  2IO5 B;  3AZM A;  1P3M D;  3H0L C;  4J8X A;  3AZI B;  1P3K A;  4ZUX B;  5B2I B;  3X1S C;  3UTA C;  4J8W A;  3B6F C;  1BH9 A;  3AN2 D;  3EPH A;  2F8N G;  3REJ D;  3VH5 T;  3C1B C;  3REH A;  5B33 D;  4R8P A;  3AFA C;  1KX5 B;  3REK B;  5B40 A;  3VH6 W;  5AVB C;  4LD9 C;  5CPI A;  3C1B B;  3X1V C;  3TU4 A;  1H3O B;  3AV2 A;  3AYW B;  1F66 B;  2LY8 A;  5B1M A;  2HIO D;  3X1T B;  2JSS A;  4H9Q B;  5AVB B;  4J8V D;  3W97 B;  3W98 D;  1TZY B;  1P3F B;  2F8N D;  3R45 A;  5B0Z A;  5B2J D;  1EQZ A;  4YM6 D;  1P3A D;  3AZN A;  2Y2L A;  4WU9 D;  3AV1 A;  5KDM B;  5CP6 D;  3C1C B;  5B31 C;  2BG1 A;  1WWS A;  3KWQ C;  3EPJ A;  5JRG A;  5CPJ C;  4YS3 B;  1M18 D;  5GSU A;  1P3K C;  1TAF A;  3EPL A;  1AOI A;  4ZUX D;  5AV5 C;  3MGP D;  4WZS B;  4R8P C;  4G92 B;  5B0Y A;  1P3B B;  2Y2P A;  5E5A D;  3AL0 C;  3AZL A;  2YFV A;  4XZQ D;  4HGA C;  4CSR B;  5BNV A;  5B24 B;  3WTP D;  1S32 B;  1M1A B;  5CPI C;  2ARO A;  5AV5 B;  4Z5T C;  5B32 B;  5C3I C;  1ID3 C;  3UTB C;  4H9O B;  1ZLA A;  4X23 D;  5B1M C;  2FJ7 D;  5CHL B;  2BYM B;  5GT3 A;  3REI D;  1U35 D;  4Z66 D;  1P3I D;  5BO0 A;  4Z5T B;  1P3G B;  5AV8 C;  1WWI A;  1ID3 B;  5B1L A;  1KX4 C;  1BH8 B;  4KHA B;  3UT9 A;  5DNN A;  4JJN A;  5AY8 D;  2Y2G A;  5GT0 A;  4XUJ A;  3A6N C;  5AV8 B;  3X1U A;  1P34 C;  2CV5 B;  4Z2M G;  3B0C W;  3VH6 A;  3AN2 C;  1P3O D;  3W96 B;  5B32 G;  4ZBJ C;  3AZI A;  3MGQ B;  3LZ0 D;  5BT1 C;  1P3M B;  4NFT A;  3AN2 B;  1KX5 A;  3MNN D;  3REJ B;  3REK A;  3X1S A;  3B6F A;  3WA9 D;  5B33 B;  4WJ3 C;  1P3B D;  5JA4 B;  3AZH D;  3LZ1 D;  3C1B A;  5CPK D;  5F99 D;  2HIO C;  5B24 D;  1S32 D;  1H3O A;  2ZY3 A;  4J8V C;  1F66 A;  3LJA D;  1P3L B;  5B32 D;  3KXB D;  3LEL D;  4H9Q A;  3W97 A;  5GT3 C;  5AVB A;  4YM6 C;  5BS7 C;  3MGR D;  1P3A C;  1P3F A;  4LD9 A;  2J8P A;  2HIO B;  3AZG D;  3W98 B;  3H0M C;  5CP6 C;  1P3G D;  2Y2I A;  5DNN C;  2F8N B;  4JJN C;  5B2J B;  4WV4 B;  3VH5 W;  4YM6 B;  5DNM D;  4E44 A;  5KDM A;  3C1C A;  4WU9 B;  4J8X D;  3NQJ B;  2DF4 C;  3H0R C;  4J8W D;  4KUD D;  5AVC D;  5BNX B;  5CP6 B;  1W2E A;  4CAY B;  2ZY2 A;  4ZUX C;  5B2I C;  2CV5 D;  3MGP C;  2NQB D;  3MVD D;  5B31 A;  1M18 B;  3KWQ A;  4DRB A;  4XZQ C;  5CPJ A;  3O62 D;  4G91 C;  1KX5 C;  3REK C;  2Y2H A;  1JFI B;  3MGP B;  4J8U B;  3W99 D;  3AV2 D;  4CSR A;  3V9R B;  3AZJ D;  1Z2C B;  5E5A B;  5AV5 A;  4XZQ B;  1Q9C A;  4G91 B;  3WTP E;  2JE5 A;  3WTP B;  4WNN A;  1M19 D;  3AYW C;  4H9O A;  1F66 C;  3KUY D;  1EQZ D;  3X1T C;  3W97 C;  2BYM A;  1TZY C;  1P3F C;  4X23 B;  5FUG B;  1P3L D;  1KX3 D;  4Z5T A;  2FJ7 B;  2F8N K;  3AV1 D;  1ID3 A;  1U35 B;  3REI B;  3UTB A;  4Z66 B;  1P3I B;  1BH8 A;  5AV9 D;  5JRG D;  3C1C C;  1BFM A;  5AV8 A;  1P3O C;  5AY8 B;  4H9R B;  1KX4 A;  4M6B A;  4YS3 C;  3WKJ B;  4QLC D;  2YFW B;  3W96 A;  3KFU G;  3MGQ A;  3A6N A;  2CWE A;  1P3O B;  3IP4 C;  1P34 A;  3AZF D;  3WA9 C;  3LZ0 B;  4G92 C;  3AN2 A;  1P3B C;  4UUZ B;  1B67 A;  2PYO D;  5F99 C;  5B33 A;  1HQ3 D;  5JA4 A;  5B24 C;  1S32 C;  1M1A C;  3MNN B;  4J8U D;  1B6W A;  3A1K A;  5B32 C;  3VH5 A;  3WA9 B;  3KSY A;  3LEL C;  2RVQ D;  3MGR C;  3AZH B;  3LZ1 B;  5CPK B;  5F99 B;  5AV6 D;  4H9P B;  1N1J B;  3AZG C;  3LJA B;  3REL D;  5G49 B;  3EG5 B;  1P3G C;  2HIO A;  3KXB B;  3LEL B;  3MGR B;  4H9N A;  4J8V A;  4XUJ D;  2Y2M A;  3W98 A;  3MGS B;  2W8S A;  5B2J A;  1P3P D;  4YM6 A;  5BS7 A;  3AZG B;  1P3A A;  2F8N H;  4KUD C;  4WU9 A;  5GXQ D;  2CV5 C;  2NQB C;  5BNX A;  5DNM B;  5CP6 A;  4UPK A;  3MVD C;  2L5A A;  3W96 C;  4J8X B;  4KUD B;  4J8W B;  5AVC B;  3MGQ C;  3WKJ D;  2HUE B;  3O62 C;  3X1S D;  1P3M C;  3UTA D;  3B6F D;  3REH B;  2NQB B;  3MVD B;  3B6G D;  3REJ C;  1JFI A;  4ZUX A;  5B2I A;  3AFA D;  3MGP A;  3O62 B;  5B33 C;  4EO5 C;  5E5A A;  1M19 C;  2FFF B;  4XZQ A;  3KUY C;  3W99 B;  3AV2 B;  4NE6 A;  2XD1 A;  4LD9 D;  3WTP A;  3AZJ B;  2NZD D;  3X1V D;  3AZE D;  3WAA D;  1P3L C;  1KX3 C;  4KGC D;  4WU8 D;  4EO5 B;  1M19 B;  2BYK B;  2XD5 A;  5FUG A;  5B0Z B;  3KUY B;  1EQZ B;  2FJ7 A;  1ULY A;  3AZK D;  1U35 A;  3REI A;  3AYW A;  3W98 C;  1P3I A;  1KX3 B;  3EPK A;  3X1T A;  5B2J C;  3AV1 B;  1TZY A;  3MGS D;  4WU9 C;  5AV9 B;  4QLC C;  5AY8 A;  5JRG B;  5GSU B;  2YFW A;  2ZY5 A;  5CPJ D;  3AZM D;  3AZF C;  1P3K D;  1M18 C;  4QLC B;  1P3O A;  2PYO C;  4YS3 A;  4AWL B;  3REH D;  4R8P D;  4J8U C;  3AZF B;  1F1E A;  1KU5 A;  5E5A C;  3MNN A;  5B40 D;  2PYO B;  5AV6 C;  3WA9 A;  5CPI D;  1P3B A;  1HQ3 B;  3WTP C;  4DQY B;  3AZH A;  3LZ1 A;  2ZM5 A;  3TU4 D;  5CPK A;  5F99 A;  5B24 A;  1S32 A;  4H9P A;  1M1A A;  5B1M D;  4X23 C;  5G49 A;  2ZY4 A;  5B32 A;  4Z2M H;  5AV6 B;  2FJ7 C;  3LEL A;  4NE3 A;  1U35 C;  3MGR A;  2Y2J A;  3REI C;  4Z66 C;  1P3I C;  5B0Z D;  3REL B;  3AZN D;  1KX4 D;  5GXQ C;  3AZG A;  4XUJ B;  3B0D B;  1P3G A;  4H9S C;  5AY8 C;  1P3P B;  2F2A C;  5DNM A;  4KHA A;  3WKJ C;  1P34 D;  2Y2K A;  2G5H C;  2DQN C;  3NQU B;  5GXQ B;  5AVC A;  5GSU D;  4KUD A;  3B6G C;  2CV5 A;  2NQB A;  5BT1 D;  3A1I A;  1AOI D;  3LZ0 C;  3MVD A;  4E45 A;  3X1S B;  3UTA B;  3B6F B;  5B0Y D;  3O62 A;  3B6G B;  3AZL D;  3MNN C;  1P3M A;  2NZD C;  3AZE C;  3WAA C;  3AFA B;  3W99 A;  4KGC C;  2ARO D;  4WU8 C;  3REJ A;  3AZJ A;  3AZH C;  3LZ1 C;  5CPK C;  1ZLA D;  4LD9 B;  3AZK C;  1M19 A;  2RIQ A;  1HTA A;  2BYK A;  3LJA C;  3AZE B;  3X1V B;  3WAA B;  2NZD B;  3KXB C;  5GT3 D;  3KUY A;  4KGC B;  4WU8 B;  2Y2O A;  4DRA A;  3MGS C;  1P3L A;  1KX3 A;  5B1L D;  3AZK B;  3UT9 D;  5DNN D;  4JJN D;  5AV9 A;  3VH6 T;  5GT0 D;  5DNM C;  4NE5 A;  3X1U D;  3AZM C;  2F8N A;  4J8X C;  1R4V A;  2Y2N A;  4J8W C;  5AVC C;  5B31 B;  2HUE C;  3AZI D;  4QLC A;  5B2I D;  3NQJ A;  3KWQ B;  3REH C;  5CPJ B;  3AZM B;  1P3K B;  4CAY A;  2G5I C;  1BH9 B;  5B40 C;  3AZF A;  1KX5 D;  3REK D;  1M18 A;  4R8P B;  3TU4 C;  2PYO A;  3W99 C;  3AV2 C;  4WNN B;  1HQ3 A;  3C1B D;  3AZJ C;  4J8U A;  4HGA B;  5B40 B;  3V9R A;  3AYW D;  5CPI B;  1F66 D;  2UWX A;  1A7W A;  5B0Z C;  3X1T D;  3TU4 B;  3W97 D;  5AV6 A;  5C3I B;  5B31 G;  5AVB D;  3AZN C;  1TZY D;  3UTB B;  1P3F D;  1EQZ C;  5B1M B;  3REL A;  3AV1 C;  3R45 B;  4X23 A;  5AV9 C;  3AZN B;  1KX4 B;  1P3P A;  3C1C D;  5JRG C;  4Z66 A;  5GSU C;  4YS3 D;  5GXQ A;  3NQU A;  3A6N B;  1AOI C;  2Y2Q A;  4H9S A;  1P34 B;  4H9R A;  3B0B A;  5B31 D;  5B0Y C;  3WKJ A;  4ZBJ B;  4AWL C;  3KWQ D;  3AZL C;  1TAF B;  3UTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...