5AV6B

Human nucleosome core particle
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av6B00
4J8XA 4WU8A 3REKA 1KX5A 3REJB 4H9PA 2LY8A 5CPIC 1P3ID 2HUEB 3AZHA 4G92B 3AN2B 2CV5D 3C1BB 1P3LA 5B0ZA 1M19A 2NZDC 1P3IB 1TAFA 4ZUXB 3B6FD 4EO5C 4J8VC 5CPJD 5B40D 4HGAB 1U35B 1WWSA 5BNVB 2RVQD 5B24B 3TU4B 5B0YC 4ZUXA 2F8NA 4ZBJC 4H9RA 1S32B 5AV5A 1AOID 1P3IC 3AFAA 3VH5A 4J8WC 4J8UA 3R45A 1KX4C 3REIC 4KHAA 4QLCB 2RVQC 3W99A 3C1CA 1P3AB 5BNXB 3MGPB 3REHD 5B2IB 4J8VD 1KX3B 4LD9B 1AOIC 2CWEA 1B6WA 4J8XB 1TZYC 5F99A 1TZYB 3AYWD 1KX5B 3WTPA 5B2ID 1P3KB 3LZ0A 5DNNC 2FJ7D 3WAAC 4WNNA 3X1UC 3AV2B 5AV8C 4YM6A 4UUZA 3AYWB 1ID3C 3AZGD 4CAYA 3KWQD 1M19D 1P3LB 3B0BA 3W97B 4JJNA 5B2JD 5AVCC 5GXQA 5B32C 3AZLB 3WA9B 5B32G 3UTBA 1P3FA 5B2JB 5B24C 5GT3A 3MVDC 3X1TC 4HGAC 3AZGA 1U35C 3AZLD 3WA9D 5CPKD 1M18B 3W96B 4J8UB 4KHAB 4AWLB 5B32A 3AV1D 4QLCA 3KWQC 1P3OA 3C1CB 2YFWA 3MGPA 3AZFB 3A6NC 5B2JC 3B6FB 1KX3A 1H3OB 4WU9A 3O62D 5JA4B 1U35D 1WWIA 5KDMB 3AZLC 1HQ3B 3WA9C 2YFWB 3B0DC 3TU4D 3X1UB 3NQJA 3C1CD 3B0CT 3AV2C 3WAAB 4G91B 5E5AB 3AZFD 1P3KC 3AZJA 5B1LA 5KDMA 3X1TD 3MVDD 3UT9B 1EQZC 4Z5TA 1HQ3D 3A6NA 3LELD 5G49B 5JRGA 4YM6B 2AROD 5AV5D 5B1LB 3UT9A 3AZKB 2HIOD 3B6GD 1P3BA 4JJNB 2F8ND 1F66A 4NE5A 5BS7A 1P3BB 4Z5TC 1EQZB 3KUYA 3MGSA 1HQ3C 3VH5W 4XZQA 2PYOB 3AZID 5GSUC 3VH6A 5GT3B 5B0YB 1P3AC 3AZFC 5FUGA 1P3KD 1P3BD 1EQZD 3X1SB 1M18A 3KWQB 5CP6A 4AWLC 1ID3A 3AZFA 1BFMA 5B0ZC 5AV6D 3WKJB 1HQ3A 3AZGC 5B40C 5CPJC 1M1AD 3AZJD 5BS7C 3W98A 3WKJA 1AOIA 3REJC 3KXBA 1ZLAD 3UTAD 1P3BC 3REKC 4WU8C 5AVCA 4J8XC 5B0ZD 2L5AA 5AY8B 1M1AB 1ZLAA 1AOIB 5AV6C 3AV1B 3KXBB 5CHLB 4X23A 5B33B 3AZHD 1M1AC 3AZJC 4QLCD 5AV8B 1BH8A 4YM6C 1BH9A 1P3GB 3O62B 3KUYB 3LZ0C 3UTBD 5DNMB 5B0YA 5F99C 5FUGB 4YS3D 1P3FD 3RELD 1P3GD 1JFIB 4KUDC 4YS3A 3MGQD 5GT0A 5B2IC 3UTAC 4QLCC 3LELB 5DNND 4YM6D 4H9NA 3MNNC 4J8WB 3AV2D 3C1CC 1KX4B 4YS3B 3RELB 3REIA 3AZIA 3AZHC 1M19B 4J8WA 4J8UC 5F99D 3UTAA 1KX4A 3LELC 4YS3C 1P3FC 2NQBD 4H9QA 4KUDD 4G92C 3AN2C 5BNVA 5AVCD 5B31B 3AZIB 3AZMA 3LZ0D 1F1EA 3MNND 2HIOA 4H9QB 2F8NG 3B6GA 2NZDB 2BYMA 5CPKA 3RELC 1P3GC 3LZ1D 1Q9CA 3W99D 5AVCB 3MGQC 5B31D 1M1AA 4J8VA 3MNNB 3LZ1A 5CPKB 2F8NK 5GSUD 2NQBC 5AV6A 5B1MC 3AV1C 3W99B 4WV4B 3MNNA 3WTPC 1BH9B 3O62A 4Z2MG 4H9OA 5BO0A 5AV6B 3REJA 4KUDA 3W98C 3AN2D 3O62C 5JRGC 2CV5B 3MGSD 3B0DB 5B40A 5CPJA 5BO0B 3WTPB 1JFIA 1P3KA 5B1MD 4LD9C 3LZ1C 2NQBA 5B40B 5CPJB 5B0ZB 4G91C 5B31C 1P3IA 3AYWA 5CP6C 4CAYB 3RELA 2AROB 5AV5C 4Z2MH 3REJD 3AZHB 2HIOC 3B6GC 3REHA 1P3OC 2F8NB 2AROA 3C1BA 3VH5T 4Z66C 3LJAC 3UTBB 3AZMB 5GSUA 4Z5TD 3MGRA 1ULYA 1S32C 3WKJC 5JRGD 3AZIC 3MGSC 1U35A 2NZDA 2IO5B 4XUJD 1P3AD 3AZND 3MGPD 3TU4A 3MGRB 4J8VB 4LD9D 5BNXA 5GT0C 5B2IA 5GXQC 4WZSB 3AZKC 1S32D 3AZNB 4X23D 4E45A 3R45B 5B33C 5F99B 3B6FA 5BT1D 4KUDB 1P3AA 2CV5A 3WKJD 3AV2A 3NQJB 3X1UA 4WU8B 3REKB 3WAAA 4KGCA 4H9PB 4XZQC 5GXQD 3AZJB 3KUYC 1KX3C 4X23C 3MGPC 1F66C 4KGCB 1ZLAC 3REKD 4WU8D 5AY8C 4J8XD 4M6BA 5GXQB 3AZED 3KXBC 4WNNB 4DRAA 3UT9C 4E44A 1TAFB 2FJ7B 3W96C 2YFVB 5B33D 5B31G 4H9SA 1M18D 3W97A 1EQZA 3AZEB 5B24A 3AZGB 2PYOA 2FJ7A 1P3LD 3UTBC 3WTPD 3AZEC 5AVBB 1P3PB 2BYKA 4WU9C 1P3FB 3W98D 2PYOC 3W97C 1M18C 5AVBA 4H9SC 4WU9B 1P3PA 5CP6B 3W96A 1P3MC 1A7WA 3MVDB 3UT9D 3X1TB 4CSRB 5CPIB 3W96D 4J8UD 2JSSA 4WU9D 5CP6D 3AZMD 5B1LD 5GT3C 4Z5TB 1TZYA 3MVDA 3X1TA 5G49A 5JRGB 5DNMC 1H3OA 5JA4A 5CPID 3LZ0B 4XUJB 4R8PC 4UUZB 4Z66D 3LJAD 3W99C 3X1VD 4JJNC 2PYOD 1F66B 4XUJA 4R8PB 3A6NB 5B1LC 5GT3D 3AFAC 3B6FC 4XUJC 5B33A 1P34D 3AZNC 1KU5A 5AV9B 2YFVA 3V9RA 1R4VA 3X1SD 4R8PA 3AZLA 3AZEA 5DNNA 3WA9A 4R8PD 5GT0D 3X1SA 4ZBJB 3AZKD 4NE3A 5B2JA 3V9RB 4JJND 3MGSB 3KWQA 2BYKB 5GT0B 3B0CW 4KGCD 5B32B 3X1VA 3C1BC 1P3OB 1N1JA 5AVBC 1P3PC 1B67A 2IO5C 1KX3D 2HUEC 4CSRA 5CPIA 3UTAB 3X1SC 1TZYD 1P3OD 5AY8D 3AYWC 1ID3B 4KGCC 4NFTA 3KXBD 5E5AA 2CV5C 4ZUXC 2FJ7C 3KSYA 5AV8D 5AVBD 1P3PD 1ID3D 3W98B 5AV8A 3MGRD 1P3LC 3AZKA 3C1BD 5AV9A 1ZLAB 4ZUXD 5DNMA 5B1MA 4X23B 3MGQB 5DNNB 4XZQB 5BT1C 5B24D 4J8WD 1KX4D 1KX5C 1BH8B 3REID 3NQUB 3MGRC 1P3MD 4Z66A 3LJAA 1P3MA 4XZQD 3VH6T 3NQUA 3REHC 4NE6A 3KUYD 2NQBB 3REIB 4Z66B 3LJAB 3AZMC 4DRBA 3X1VB 1P3MB 3AN2A 1F66D 5DNMD 1N1JB 3A6ND 3LELA 4H9NB 5B31A 1P34B 5AV9D 3VH6W 3REHB 5C3IB 3X1UD 3TU4C 3X1VC 3WAAD 2BYMB 5E5AD 1P34A 5GSUB 5C3IC 1KX5D 3AFAD 1M19C 4H9RB 1P34C 1S32A 2AROC 5AV5B 4EO5B 5AV9C 5AY8A 2HIOB 3B6GB 3AFAB 5B32D 3AV1A 4H9OB 3WTPE 3W97D 1HTAA 2NZDD 3AZNA 3LZ1B 5B1MB 3MGQA 1P3GA 4LD9A 5CPKC 2F8NH 5B0YD 5E5AC
chains in the Genus database with same CATH superfamily
4J8XA 4WU8A 3REKA 1KX5A 2Y2MA 3REJB 4H9PA 4WJ3C 3P5JB 2LY8A 5CPIC 1P3ID 2HUEB 3AZHA 4G92B 3AN2B 2CV5D 3C1BB 1P3LA 5B0ZA 2Y2LA 1M19A 2NZDC 1P3IB 1TAFA 4ZUXB 3B6FD 4EO5C 4J8VC 5CPJD 5B40D 4HGAB 1U35B 1WWSA 5BNVB 2RVQD 5B24B 3TU4B 5B0YC 4ZUXA 2F8NA 4ZBJC 4H9RA 1S32B 5AV5A 1AOID 1P3IC 3AFAA 3VH5A 4J8WC 4J8UA 3R45A 1KX4C 3REIC 4KHAA 4QLCB 2RVQC 3W99A 3C1CA 1P3AB 5BNXB 3MGPB 3EPLA 3REHD 5B2IB 4J8VD 1KX3B 4LD9B 3IP4C 1AOIC 2CWEA 1B6WA 4J8XB 1TZYC 5F99A 1TZYB 3AYWD 1KX5B 3WTPA 5B2ID 1P3KB 3LZ0A 5DNNC 2FJ7D 3WAAC 4WNNA 3X1UC 2ZY4A 3AV2B 5AV8C 4YM6A 4UUZA 3AYWB 1ID3C 3AZGD 4CAYA 3KWQD 2FFFB 1M19D 1P3LB 3B0BA 3EG5B 3W97B 4JJNA 5B2JD 5AVCC 5GXQA 5B32C 2W8SA 3AZLB 3WA9B 5B32G 3UTBA 1P3FA 5B2JB 5B24C 5GT3A 3MVDC 3X1TC 4HGAC 3AZGA 1U35C 3AZLD 3WA9D 5CPKD 1M18B 3W96B 4J8UB 4KHAB 4AWLB 5B32A 3AV1D 4QLCA 3KWQC 1P3OA 2Y2OA 3H0LC 3C1CB 1Z2CB 2YFWA 3MGPA 3AZFB 3A6NC 5B2JC 3B6FB 1KX3A 1H3OB 4WU9A 3O62D 5JA4B 1U35D 1WWIA 5KDMB 3AZLC 1HQ3B 3WA9C 2YFWB 3B0DC 3TU4D 3X1UB 3NQJA 3C1CD 3B0CT 3AV2C 3WAAB 2JE5A 4G91B 5E5AB 3AZFD 1P3KC 3AZJA 5B1LA 5KDMA 3X1TD 3MVDD 3UT9B 1EQZC 4Z5TA 4UPKA 1HQ3D 3A6NA 3LELD 5G49B 5JRGA 4YM6B 2AROD 5AV5D 5B1LB 3UT9A 3AZKB 2HIOD 3B6GD 1P3BA 4JJNB 2F8ND 3A1KA 2JCHA 1F66A 4NE5A 5BS7A 1P3BB 4Z5TC 1EQZB 3KUYA 3MGSA 1HQ3C 3VH5W 4XZQA 2PYOB 3AZID 5GSUC 3VH6A 5GT3B 5B0YB 1P3AC 3AZFC 5FUGA 1P3KD 1P3BD 1EQZD 3X1SB 3KFUG 1M18A 3KWQB 5CP6A 4AWLC 3F6TA 1ID3A 3AZFA 1BFMA 5B0ZC 3EPHA 5AV6D 3WKJB 1HQ3A 3AZGC 5B40C 5CPJC 1M1AD 3AZJD 5BS7C 3W98A 3WKJA 1AOIA 3REJC 3KXBA 1ZLAD 3UTAD 1P3BC 3REKC 3EPJA 4WU8C 5AVCA 4J8XC 5B0ZD 2L5AA 5AY8B 1M1AB 1ZLAA 1AOIB 2F2AC 5AV6C 3AV1B 3KXBB 5CHLB 4X23A 5B33B 3AZHD 1M1AC 3AZJC 4QLCD 5AV8B 1BH8A 4YM6C 1BH9A 1P3GB 3O62B 3KUYB 2Y2NA 3LZ0C 3UTBD 5DNMB 5B0YA 5F99C 5FUGB 2UWXA 4YS3D 1P3FD 3RELD 1P3GD 1JFIB 4KUDC 4YS3A 3MGQD 5GT0A 5B2IC 3UTAC 4QLCC 3LELB 5DNND 4YM6D 4H9NA 3MNNC 2RIQA 2XD1A 4J8WB 3AV2D 3C1CC 1KX4B 4YS3B 3RELB 2G5HC 3REIA 3AZIA 3AZHC 1M19B 4J8WA 4J8UC 5F99D 3UTAA 1KX4A 3LELC 4YS3C 1P3FC 2NQBD 4H9QA 4KUDD 4G92C 3AN2C 5BNVA 5AVCD 5B31B 3AZIB 1W2EA 3AZMA 3LZ0D 1F1EA 3MNND 3A1IA 2HIOA 4H9QB 2F8NG 3B6GA 2NZDB 2BYMA 5CPKA 3RELC 1P3GC 1Q9CA 3W99D 3LZ1D 5AVCB 3MGQC 5B31D 1M1AA 4J8VA 3MNNB 3LZ1A 5CPKB 2F8NK 5GSUD 2NQBC 5AV6A 5B1MC 2DF4C 3AV1C 2DQNC 3W99B 4WV4B 3MNNA 3WTPC 1BH9B 3O62A 4Z2MG 4H9OA 5BO0A 5AV6B 3REJA 4KUDA 3W98C 3AN2D 3O62C 5JRGC 2CV5B 3MGSD 3B0DB 5B40A 5CPJA 5BO0B 3WTPB 1JFIA 1P3KA 5B1MD 4LD9C 3LZ1C 2NQBA 5B40B 5CPJB 5B0ZB 4G91C 5B31C 1P3IA 3AYWA 5CP6C 4CAYB 3RELA 2AROB 5AV5C 4Z2MH 3REJD 3AZHB 2HIOC 3B6GC 3REHA 1P3OC 2F8NB 2AROA 3C1BA 3H0MC 3VH5T 3AL0C 4DQYB 4Z66C 3LJAC 3UTBB 3AZMB 5GSUA 4Z5TD 3MGRA 1ULYA 2Y2IA 1S32C 3WKJC 5JRGD 3AZIC 3MGSC 1U35A 2NZDA 2IO5B 2Y2JA 4XUJD 1P3AD 3AZND 3MGPD 3TU4A 3MGRB 4J8VB 4LD9D 5BNXA 5GT0C 5B2IA 5GXQC 4WZSB 3AZKC 1S32D 3AZNB 4X23D 4E45A 3R45B 5B33C 5F99B 3B6FA 5BT1D 4KUDB 2Y2PA 1P3AA 2CV5A 3WKJD 3AV2A 3NQJB 3X1UA 4WU8B 3REKB 3WAAA 4KGCA 4H9PB 4XZQC 5GXQD 3AZJB 3KUYC 1KX3C 4X23C 3MGPC 1F66C 4KGCB 1ZLAC 2Y2KA 3REKD 4WU8D 2XD5A 5AY8C 4J8XD 4M6BA 5GXQB 3AZED 3KXBC 4WNNB 4DRAA 3UT9C 4E44A 1TAFB 2FJ7B 3W96C 2YFVB 5B33D 5B31G 2Y2QA 4H9SA 1M18D 3W97A 1EQZA 3AZEB 5B24A 3AZGB 2PYOA 2FJ7A 1P3LD 3UTBC 3WTPD 3AZEC 5AVBB 1P3PB 2BYKA 4WU9C 1P3FB 3W98D 3EPKA 2PYOC 3W97C 1M18C 5AVBA 4H9SC 4WU9B 1P3PA 5CP6B 3W96A 1P3MC 1A7WA 3MVDB 3UT9D 3X1TB 4CSRB 5CPIB 3W96D 2VQRA 4J8UD 2JSSA 2Y2HA 4WU9D 5CP6D 3AZMD 5B1LD 5GT3C 4Z5TB 1TZYA 3MVDA 3X1TA 5JRGB 5G49A 5DNMC 1H3OA 5JA4A 5CPID 3LZ0B 4XUJB 1PZRA 4R8PC 4UUZB 4Z66D 3LJAD 3W99C 3X1VD 4JJNC 2PYOD 1F66B 4XUJA 4R8PB 3A6NB 5B1LC 5GT3D 3AFAC 3B6FC 4XUJC 5B33A 1P34D 3AZNC 1KU5A 5AV9B 2YFVA 3V9RA 1R4VA 3X1SD 4R8PA 3AZLA 3AZEA 5DNNA 3WA9A 4R8PD 5GT0D 3X1SA 4ZBJB 3AZKD 4NE3A 5B2JA 3V9RB 4JJND 3MGSB 3KWQA 2BYKB 5GT0B 3B0CW 4KGCD 5B32B 3X1VA 3C1BC 1P3OB 1N1JA 5AVBC 1P3PC 1B67A 2IO5C 1KX3D 2HUEC 4CSRA 5CPIA 3UTAB 3X1SC 1TZYD 1P3OD 5AY8D 3AYWC 1ID3B 4KGCC 4NFTA 3KXBD 5E5AA 2CV5C 4ZUXC 2FJ7C 3KSYA 5AV8D 5AVBD 1P3PD 1ID3D 3W98B 5AV8A 3MGRD 1P3LC 3AZKA 3C1BD 2G5IC 5AV9A 1ZLAB 4ZUXD 5DNMA 5B1MA 4X23B 3MGQB 5DNNB 4XZQB 5BT1C 5B24D 4J8WD 1KX4D 1KX5C 1BH8B 3REID 3NQUB 3MGRC 1P3MD 2Y2GA 4Z66A 3LJAA 1P3MA 2J8PA 4XZQD 3VH6T 3NQUA 3REHC 4NE6A 3KUYD 2NQBB 2ZY2A 3REIB 4Z66B 3LJAB 3H0RC 4DRBA 3AZMC 3X1VB 1P3MB 3AN2A 1F66D 5DNMD 1N1JB 2BG1A 3A6ND 3LELA 4H9NB 5B31A 1P34B 2ZY3A 5AV9D 3VH6W 3REHB 5C3IB 3X1UD 3TU4C 3X1VC 1T3UA 2BYMB 3WAAD 5E5AD 1P34A 5GSUB 5C3IC 1KX5D 3AFAD 1M19C 4H9RB 2ZM5A 1P34C 1S32A 5AV5B 2AROC 4EO5B 5AV9C 5AY8A 2HIOB 3B6GB 3AFAB 5B32D 3AV1A 4H9OB 3WTPE 3W97D 1HTAA 2NZDD 3AZNA 3LZ1B 5B1MB 3MGQA 1P3GA 4LD9A 5CPKC 2F8NH 2ZY5A 5B0YD 5E5AC 3FDDA
chains in the Genus database with same CATH topology
4J8XA 4WU8A 3REKA 1KX5A 2Y2MA 3REJB 4H9PA 4WJ3C 3P5JB 2LY8A 5CPIC 1P3ID 2HUEB 3AZHA 4G92B 3AN2B 2CV5D 3C1BB 1P3LA 5B0ZA 2Y2LA 1M19A 2NZDC 1P3IB 1TAFA 4ZUXB 3B6FD 4EO5C 4J8VC 5CPJD 5B40D 4HGAB 1U35B 1WWSA 5BNVB 2RVQD 5B24B 3TU4B 5B0YC 4ZUXA 2F8NA 4ZBJC 4H9RA 1S32B 5AV5A 1AOID 1P3IC 3AFAA 3VH5A 4J8WC 4J8UA 3R45A 1KX4C 3REIC 4KHAA 4QLCB 2RVQC 3W99A 3C1CA 1P3AB 5BNXB 3MGPB 3EPLA 3REHD 5B2IB 4J8VD 1KX3B 4LD9B 3IP4C 1AOIC 2CWEA 1B6WA 4J8XB 1TZYC 5F99A 1TZYB 3AYWD 1KX5B 3WTPA 5B2ID 1P3KB 3LZ0A 5DNNC 2FJ7D 3WAAC 4WNNA 3X1UC 2ZY4A 3AV2B 5AV8C 4YM6A 4UUZA 3AYWB 1ID3C 3AZGD 4CAYA 3KWQD 2FFFB 1M19D 1P3LB 3B0BA 3EG5B 3W97B 4JJNA 5B2JD 5AVCC 5GXQA 5B32C 2W8SA 3AZLB 3WA9B 5B32G 3UTBA 1P3FA 5B2JB 5B24C 5GT3A 3MVDC 3X1TC 4HGAC 3AZGA 1U35C 3AZLD 3WA9D 5CPKD 1M18B 3W96B 4J8UB 4KHAB 4AWLB 5B32A 3AV1D 4QLCA 3KWQC 1P3OA 2Y2OA 3H0LC 3C1CB 1Z2CB 2YFWA 3MGPA 3AZFB 3A6NC 5B2JC 3B6FB 1KX3A 1H3OB 4WU9A 3O62D 5JA4B 1U35D 1WWIA 5KDMB 3AZLC 1HQ3B 3WA9C 2YFWB 3B0DC 3TU4D 3X1UB 3NQJA 3C1CD 3B0CT 3AV2C 3WAAB 2JE5A 4G91B 5E5AB 3AZFD 1P3KC 3AZJA 5B1LA 5KDMA 3X1TD 3MVDD 3UT9B 1EQZC 4Z5TA 4UPKA 1HQ3D 3A6NA 3LELD 5G49B 5JRGA 4YM6B 2AROD 5AV5D 5B1LB 3UT9A 3AZKB 2HIOD 3B6GD 1P3BA 4JJNB 2F8ND 3A1KA 2JCHA 1F66A 4NE5A 5BS7A 1P3BB 4Z5TC 1EQZB 3KUYA 3MGSA 1HQ3C 3VH5W 4XZQA 2PYOB 3AZID 5GSUC 3VH6A 5GT3B 5B0YB 1P3AC 3AZFC 5FUGA 1P3KD 1P3BD 1EQZD 3X1SB 3KFUG 1M18A 3KWQB 5CP6A 4AWLC 3F6TA 1ID3A 3AZFA 1BFMA 5B0ZC 3EPHA 5AV6D 3WKJB 1HQ3A 3AZGC 5B40C 5CPJC 1M1AD 3AZJD 5BS7C 3W98A 3WKJA 1AOIA 3REJC 3KXBA 1ZLAD 3UTAD 1P3BC 3REKC 3EPJA 4WU8C 5AVCA 4J8XC 5B0ZD 2L5AA 5AY8B 1M1AB 1ZLAA 1AOIB 2F2AC 5AV6C 3AV1B 3KXBB 5CHLB 4X23A 5B33B 3AZHD 1M1AC 3AZJC 4QLCD 5AV8B 1BH8A 4YM6C 1BH9A 1P3GB 3O62B 3KUYB 2Y2NA 3LZ0C 3UTBD 5DNMB 5B0YA 5F99C 5FUGB 2UWXA 4YS3D 1P3FD 3RELD 1P3GD 1JFIB 4KUDC 4YS3A 3MGQD 5GT0A 5B2IC 3UTAC 4QLCC 3LELB 5DNND 4YM6D 4H9NA 3MNNC 2RIQA 2XD1A 4J8WB 3AV2D 3C1CC 1KX4B 4YS3B 3RELB 2G5HC 3REIA 3AZIA 3AZHC 1M19B 4J8WA 4J8UC 5F99D 3UTAA 1KX4A 3LELC 4YS3C 1P3FC 2NQBD 4H9QA 4KUDD 4G92C 3AN2C 5BNVA 5AVCD 5B31B 3AZIB 1W2EA 3AZMA 3LZ0D 1F1EA 3MNND 3A1IA 2HIOA 4H9QB 2F8NG 3B6GA 2NZDB 2BYMA 5CPKA 3RELC 1P3GC 1Q9CA 3W99D 3LZ1D 5AVCB 3MGQC 5B31D 1M1AA 4J8VA 3MNNB 3LZ1A 5CPKB 2F8NK 5GSUD 2NQBC 5AV6A 5B1MC 2DF4C 3AV1C 2DQNC 3W99B 4WV4B 3MNNA 3WTPC 1BH9B 3O62A 4Z2MG 4H9OA 5BO0A 5AV6B 3REJA 4KUDA 3W98C 3AN2D 3O62C 5JRGC 2CV5B 3MGSD 3B0DB 5B40A 5CPJA 5BO0B 3WTPB 1JFIA 1P3KA 5B1MD 4LD9C 3LZ1C 2NQBA 5B40B 5CPJB 5B0ZB 4G91C 5B31C 1P3IA 3AYWA 5CP6C 4CAYB 3RELA 2AROB 5AV5C 4Z2MH 3REJD 3AZHB 2HIOC 3B6GC 3REHA 1P3OC 2F8NB 2AROA 3C1BA 3H0MC 3VH5T 3AL0C 4DQYB 4Z66C 3LJAC 3UTBB 3AZMB 5GSUA 4Z5TD 3MGRA 1ULYA 2Y2IA 1S32C 3WKJC 5JRGD 3AZIC 3MGSC 1U35A 2NZDA 2IO5B 2Y2JA 4XUJD 1P3AD 3AZND 3MGPD 3TU4A 3MGRB 4J8VB 4LD9D 5BNXA 5GT0C 5B2IA 5GXQC 4WZSB 3AZKC 1S32D 3AZNB 4X23D 4E45A 3R45B 5B33C 5F99B 3B6FA 5BT1D 4KUDB 2Y2PA 1P3AA 2CV5A 3WKJD 3AV2A 3NQJB 3X1UA 4WU8B 3REKB 3WAAA 4KGCA 4H9PB 4XZQC 5GXQD 3AZJB 3KUYC 1KX3C 4X23C 3MGPC 1F66C 4KGCB 1ZLAC 2Y2KA 3REKD 4WU8D 2XD5A 5AY8C 4J8XD 4M6BA 5GXQB 3AZED 3KXBC 4WNNB 4DRAA 3UT9C 4E44A 1TAFB 2FJ7B 3W96C 2YFVB 5B33D 5B31G 2Y2QA 4H9SA 1M18D 3W97A 1EQZA 3AZEB 5B24A 3AZGB 2PYOA 2FJ7A 1P3LD 3UTBC 3WTPD 3AZEC 5AVBB 1P3PB 2BYKA 4WU9C 1P3FB 3W98D 3EPKA 2PYOC 3W97C 1M18C 5AVBA 4H9SC 4WU9B 1P3PA 5CP6B 3W96A 1P3MC 1A7WA 3MVDB 3UT9D 3X1TB 4CSRB 5CPIB 3W96D 2VQRA 4J8UD 2JSSA 2Y2HA 4WU9D 5CP6D 3AZMD 5B1LD 5GT3C 4Z5TB 1TZYA 3MVDA 3X1TA 5JRGB 5G49A 5DNMC 1H3OA 5JA4A 5CPID 3LZ0B 4XUJB 1PZRA 4R8PC 4UUZB 4Z66D 3LJAD 3W99C 3X1VD 4JJNC 2PYOD 1F66B 4XUJA 4R8PB 3A6NB 5B1LC 5GT3D 3AFAC 3B6FC 4XUJC 5B33A 1P34D 3AZNC 1KU5A 5AV9B 2YFVA 3V9RA 1R4VA 3X1SD 4R8PA 3AZLA 3AZEA 5DNNA 3WA9A 4R8PD 5GT0D 3X1SA 4ZBJB 3AZKD 4NE3A 5B2JA 3V9RB 4JJND 3MGSB 3KWQA 2BYKB 5GT0B 3B0CW 4KGCD 5B32B 3X1VA 3C1BC 1P3OB 1N1JA 5AVBC 1P3PC 1B67A 2IO5C 1KX3D 2HUEC 4CSRA 5CPIA 3UTAB 3X1SC 1TZYD 1P3OD 5AY8D 3AYWC 1ID3B 4KGCC 4NFTA 3KXBD 5E5AA 2CV5C 4ZUXC 2FJ7C 3KSYA 5AV8D 5AVBD 1P3PD 1ID3D 3W98B 5AV8A 3MGRD 1P3LC 3AZKA 3C1BD 2G5IC 5AV9A 1ZLAB 4ZUXD 5DNMA 5B1MA 4X23B 3MGQB 5DNNB 4XZQB 5BT1C 5B24D 4J8WD 1KX4D 1KX5C 1BH8B 3REID 3NQUB 3MGRC 1P3MD 2Y2GA 4Z66A 3LJAA 1P3MA 2J8PA 4XZQD 3VH6T 3NQUA 3REHC 4NE6A 3KUYD 2NQBB 2ZY2A 3REIB 4Z66B 3LJAB 3H0RC 4DRBA 3AZMC 3X1VB 1P3MB 3AN2A 1F66D 5DNMD 1N1JB 2BG1A 3A6ND 3LELA 4H9NB 5B31A 1P34B 2ZY3A 5AV9D 3VH6W 3REHB 5C3IB 3X1UD 3TU4C 3X1VC 1T3UA 2BYMB 3WAAD 5E5AD 1P34A 5GSUB 5C3IC 1KX5D 3AFAD 1M19C 4H9RB 2ZM5A 1P34C 1S32A 5AV5B 2AROC 4EO5B 5AV9C 5AY8A 2HIOB 3B6GB 3AFAB 5B32D 3AV1A 4H9OB 3WTPE 3W97D 1HTAA 2NZDD 3AZNA 3LZ1B 5B1MB 3MGQA 1P3GA 4LD9A 5CPKC 2F8NH 2ZY5A 5B0YD 5E5AC 3FDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8X A;  4WU8 A;  3REK A;  1KX5 A;  3REJ B;  4H9P A;  2LY8 A;  5CPI C;  1P3I D;  2HUE B;  3AZH A;  4G92 B;  3AN2 B;  2CV5 D;  3C1B B;  1P3L A;  5B0Z A;  1M19 A;  2NZD C;  1P3I B;  1TAF A;  4ZUX B;  3B6F D;  4EO5 C;  4J8V C;  5CPJ D;  5B40 D;  4HGA B;  1U35 B;  1WWS A;  5BNV B;  2RVQ D;  5B24 B;  3TU4 B;  5B0Y C;  4ZUX A;  2F8N A;  4ZBJ C;  4H9R A;  1S32 B;  5AV5 A;  1AOI D;  1P3I C;  3AFA A;  3VH5 A;  4J8W C;  4J8U A;  3R45 A;  1KX4 C;  3REI C;  4KHA A;  4QLC B;  2RVQ C;  3W99 A;  3C1C A;  1P3A B;  5BNX B;  3MGP B;  3REH D;  5B2I B;  4J8V D;  1KX3 B;  4LD9 B;  1AOI C;  2CWE A;  1B6W A;  4J8X B;  1TZY C;  5F99 A;  1TZY B;  3AYW D;  1KX5 B;  3WTP A;  5B2I D;  1P3K B;  3LZ0 A;  5DNN C;  2FJ7 D;  3WAA C;  4WNN A;  3X1U C;  3AV2 B;  5AV8 C;  4YM6 A;  4UUZ A;  3AYW B;  1ID3 C;  3AZG D;  4CAY A;  3KWQ D;  1M19 D;  1P3L B;  3B0B A;  3W97 B;  4JJN A;  5B2J D;  5AVC C;  5GXQ A;  5B32 C;  3AZL B;  3WA9 B;  5B32 G;  3UTB A;  1P3F A;  5B2J B;  5B24 C;  5GT3 A;  3MVD C;  3X1T C;  4HGA C;  3AZG A;  1U35 C;  3AZL D;  3WA9 D;  5CPK D;  1M18 B;  3W96 B;  4J8U B;  4KHA B;  4AWL B;  5B32 A;  3AV1 D;  4QLC A;  3KWQ C;  1P3O A;  3C1C B;  2YFW A;  3MGP A;  3AZF B;  3A6N C;  5B2J C;  3B6F B;  1KX3 A;  1H3O B;  4WU9 A;  3O62 D;  5JA4 B;  1U35 D;  1WWI A;  5KDM B;  3AZL C;  1HQ3 B;  3WA9 C;  2YFW B;  3B0D C;  3TU4 D;  3X1U B;  3NQJ A;  3C1C D;  3B0C T;  3AV2 C;  3WAA B;  4G91 B;  5E5A B;  3AZF D;  1P3K C;  3AZJ A;  5B1L A;  5KDM A;  3X1T D;  3MVD D;  3UT9 B;  1EQZ C;  4Z5T A;  1HQ3 D;  3A6N A;  3LEL D;  5G49 B;  5JRG A;  4YM6 B;  2ARO D;  5AV5 D;  5B1L B;  3UT9 A;  3AZK B;  2HIO D;  3B6G D;  1P3B A;  4JJN B;  2F8N D;  1F66 A;  4NE5 A;  5BS7 A;  1P3B B;  4Z5T C;  1EQZ B;  3KUY A;  3MGS A;  1HQ3 C;  3VH5 W;  4XZQ A;  2PYO B;  3AZI D;  5GSU C;  3VH6 A;  5GT3 B;  5B0Y B;  1P3A C;  3AZF C;  5FUG A;  1P3K D;  1P3B D;  1EQZ D;  3X1S B;  1M18 A;  3KWQ B;  5CP6 A;  4AWL C;  1ID3 A;  3AZF A;  1BFM A;  5B0Z C;  5AV6 D;  3WKJ B;  1HQ3 A;  3AZG C;  5B40 C;  5CPJ C;  1M1A D;  3AZJ D;  5BS7 C;  3W98 A;  3WKJ A;  1AOI A;  3REJ C;  3KXB A;  1ZLA D;  3UTA D;  1P3B C;  3REK C;  4WU8 C;  5AVC A;  4J8X C;  5B0Z D;  2L5A A;  5AY8 B;  1M1A B;  1ZLA A;  1AOI B;  5AV6 C;  3AV1 B;  3KXB B;  5CHL B;  4X23 A;  5B33 B;  3AZH D;  1M1A C;  3AZJ C;  4QLC D;  5AV8 B;  1BH8 A;  4YM6 C;  1BH9 A;  1P3G B;  3O62 B;  3KUY B;  3LZ0 C;  3UTB D;  5DNM B;  5B0Y A;  5F99 C;  5FUG B;  4YS3 D;  1P3F D;  3REL D;  1P3G D;  1JFI B;  4KUD C;  4YS3 A;  3MGQ D;  5GT0 A;  5B2I C;  3UTA C;  4QLC C;  3LEL B;  5DNN D;  4YM6 D;  4H9N A;  3MNN C;  4J8W B;  3AV2 D;  3C1C C;  1KX4 B;  4YS3 B;  3REL B;  3REI A;  3AZI A;  3AZH C;  1M19 B;  4J8W A;  4J8U C;  5F99 D;  3UTA A;  1KX4 A;  3LEL C;  4YS3 C;  1P3F C;  2NQB D;  4H9Q A;  4KUD D;  4G92 C;  3AN2 C;  5BNV A;  5AVC D;  5B31 B;  3AZI B;  3AZM A;  3LZ0 D;  1F1E A;  3MNN D;  2HIO A;  4H9Q B;  2F8N G;  3B6G A;  2NZD B;  2BYM A;  5CPK A;  3REL C;  1P3G C;  3LZ1 D;  1Q9C A;  3W99 D;  5AVC B;  3MGQ C;  5B31 D;  1M1A A;  4J8V A;  3MNN B;  3LZ1 A;  5CPK B;  2F8N K;  5GSU D;  2NQB C;  5AV6 A;  5B1M C;  3AV1 C;  3W99 B;  4WV4 B;  3MNN A;  3WTP C;  1BH9 B;  3O62 A;  4Z2M G;  4H9O A;  5BO0 A;  5AV6 B;  3REJ A;  4KUD A;  3W98 C;  3AN2 D;  3O62 C;  5JRG C;  2CV5 B;  3MGS D;  3B0D B;  5B40 A;  5CPJ A;  5BO0 B;  3WTP B;  1JFI A;  1P3K A;  5B1M D;  4LD9 C;  3LZ1 C;  2NQB A;  5B40 B;  5CPJ B;  5B0Z B;  4G91 C;  5B31 C;  1P3I A;  3AYW A;  5CP6 C;  4CAY B;  3REL A;  2ARO B;  5AV5 C;  4Z2M H;  3REJ D;  3AZH B;  2HIO C;  3B6G C;  3REH A;  1P3O C;  2F8N B;  2ARO A;  3C1B A;  3VH5 T;  4Z66 C;  3LJA C;  3UTB B;  3AZM B;  5GSU A;  4Z5T D;  3MGR A;  1ULY A;  1S32 C;  3WKJ C;  5JRG D;  3AZI C;  3MGS C;  1U35 A;  2NZD A;  2IO5 B;  4XUJ D;  1P3A D;  3AZN D;  3MGP D;  3TU4 A;  3MGR B;  4J8V B;  4LD9 D;  5BNX A;  5GT0 C;  5B2I A;  5GXQ C;  4WZS B;  3AZK C;  1S32 D;  3AZN B;  4X23 D;  4E45 A;  3R45 B;  5B33 C;  5F99 B;  3B6F A;  5BT1 D;  4KUD B;  1P3A A;  2CV5 A;  3WKJ D;  3AV2 A;  3NQJ B;  3X1U A;  4WU8 B;  3REK B;  3WAA A;  4KGC A;  4H9P B;  4XZQ C;  5GXQ D;  3AZJ B;  3KUY C;  1KX3 C;  4X23 C;  3MGP C;  1F66 C;  4KGC B;  1ZLA C;  3REK D;  4WU8 D;  5AY8 C;  4J8X D;  4M6B A;  5GXQ B;  3AZE D;  3KXB C;  4WNN B;  4DRA A;  3UT9 C;  4E44 A;  1TAF B;  2FJ7 B;  3W96 C;  2YFV B;  5B33 D;  5B31 G;  4H9S A;  1M18 D;  3W97 A;  1EQZ A;  3AZE B;  5B24 A;  3AZG B;  2PYO A;  2FJ7 A;  1P3L D;  3UTB C;  3WTP D;  3AZE C;  5AVB B;  1P3P B;  2BYK A;  4WU9 C;  1P3F B;  3W98 D;  2PYO C;  3W97 C;  1M18 C;  5AVB A;  4H9S C;  4WU9 B;  1P3P A;  5CP6 B;  3W96 A;  1P3M C;  1A7W A;  3MVD B;  3UT9 D;  3X1T B;  4CSR B;  5CPI B;  3W96 D;  4J8U D;  2JSS A;  4WU9 D;  5CP6 D;  3AZM D;  5B1L D;  5GT3 C;  4Z5T B;  1TZY A;  3MVD A;  3X1T A;  5G49 A;  5JRG B;  5DNM C;  1H3O A;  5JA4 A;  5CPI D;  3LZ0 B;  4XUJ B;  4R8P C;  4UUZ B;  4Z66 D;  3LJA D;  3W99 C;  3X1V D;  4JJN C;  2PYO D;  1F66 B;  4XUJ A;  4R8P B;  3A6N B;  5B1L C;  5GT3 D;  3AFA C;  3B6F C;  4XUJ C;  5B33 A;  1P34 D;  3AZN C;  1KU5 A;  5AV9 B;  2YFV A;  3V9R A;  1R4V A;  3X1S D;  4R8P A;  3AZL A;  3AZE A;  5DNN A;  3WA9 A;  4R8P D;  5GT0 D;  3X1S A;  4ZBJ B;  3AZK D;  4NE3 A;  5B2J A;  3V9R B;  4JJN D;  3MGS B;  3KWQ A;  2BYK B;  5GT0 B;  3B0C W;  4KGC D;  5B32 B;  3X1V A;  3C1B C;  1P3O B;  1N1J A;  5AVB C;  1P3P C;  1B67 A;  2IO5 C;  1KX3 D;  2HUE C;  4CSR A;  5CPI A;  3UTA B;  3X1S C;  1TZY D;  1P3O D;  5AY8 D;  3AYW C;  1ID3 B;  4KGC C;  4NFT A;  3KXB D;  5E5A A;  2CV5 C;  4ZUX C;  2FJ7 C;  3KSY A;  5AV8 D;  5AVB D;  1P3P D;  1ID3 D;  3W98 B;  5AV8 A;  3MGR D;  1P3L C;  3AZK A;  3C1B D;  5AV9 A;  1ZLA B;  4ZUX D;  5DNM A;  5B1M A;  4X23 B;  3MGQ B;  5DNN B;  4XZQ B;  5BT1 C;  5B24 D;  4J8W D;  1KX4 D;  1KX5 C;  1BH8 B;  3REI D;  3NQU B;  3MGR C;  1P3M D;  4Z66 A;  3LJA A;  1P3M A;  4XZQ D;  3VH6 T;  3NQU A;  3REH C;  4NE6 A;  3KUY D;  2NQB B;  3REI B;  4Z66 B;  3LJA B;  3AZM C;  4DRB A;  3X1V B;  1P3M B;  3AN2 A;  1F66 D;  5DNM D;  1N1J B;  3A6N D;  3LEL A;  4H9N B;  5B31 A;  1P34 B;  5AV9 D;  3VH6 W;  3REH B;  5C3I B;  3X1U D;  3TU4 C;  3X1V C;  3WAA D;  2BYM B;  5E5A D;  1P34 A;  5GSU B;  5C3I C;  1KX5 D;  3AFA D;  1M19 C;  4H9R B;  1P34 C;  1S32 A;  2ARO C;  5AV5 B;  4EO5 B;  5AV9 C;  5AY8 A;  2HIO B;  3B6G B;  3AFA B;  5B32 D;  3AV1 A;  4H9O B;  3WTP E;  3W97 D;  1HTA A;  2NZD D;  3AZN A;  3LZ1 B;  5B1M B;  3MGQ A;  1P3G A;  4LD9 A;  5CPK C;  2F8N H;  5B0Y D;  5E5A C; 
#chains in the Genus database with same CATH topology
 4J8X A;  4WU8 A;  3REK A;  1KX5 A;  2Y2M A;  3REJ B;  4H9P A;  4WJ3 C;  3P5J B;  2LY8 A;  5CPI C;  1P3I D;  2HUE B;  3AZH A;  4G92 B;  3AN2 B;  2CV5 D;  3C1B B;  1P3L A;  5B0Z A;  2Y2L A;  1M19 A;  2NZD C;  1P3I B;  1TAF A;  4ZUX B;  3B6F D;  4EO5 C;  4J8V C;  5CPJ D;  5B40 D;  4HGA B;  1U35 B;  1WWS A;  5BNV B;  2RVQ D;  5B24 B;  3TU4 B;  5B0Y C;  4ZUX A;  2F8N A;  4ZBJ C;  4H9R A;  1S32 B;  5AV5 A;  1AOI D;  1P3I C;  3AFA A;  3VH5 A;  4J8W C;  4J8U A;  3R45 A;  1KX4 C;  3REI C;  4KHA A;  4QLC B;  2RVQ C;  3W99 A;  3C1C A;  1P3A B;  5BNX B;  3MGP B;  3EPL A;  3REH D;  5B2I B;  4J8V D;  1KX3 B;  4LD9 B;  3IP4 C;  1AOI C;  2CWE A;  1B6W A;  4J8X B;  1TZY C;  5F99 A;  1TZY B;  3AYW D;  1KX5 B;  3WTP A;  5B2I D;  1P3K B;  3LZ0 A;  5DNN C;  2FJ7 D;  3WAA C;  4WNN A;  3X1U C;  2ZY4 A;  3AV2 B;  5AV8 C;  4YM6 A;  4UUZ A;  3AYW B;  1ID3 C;  3AZG D;  4CAY A;  3KWQ D;  2FFF B;  1M19 D;  1P3L B;  3B0B A;  3EG5 B;  3W97 B;  4JJN A;  5B2J D;  5AVC C;  5GXQ A;  5B32 C;  2W8S A;  3AZL B;  3WA9 B;  5B32 G;  3UTB A;  1P3F A;  5B2J B;  5B24 C;  5GT3 A;  3MVD C;  3X1T C;  4HGA C;  3AZG A;  1U35 C;  3AZL D;  3WA9 D;  5CPK D;  1M18 B;  3W96 B;  4J8U B;  4KHA B;  4AWL B;  5B32 A;  3AV1 D;  4QLC A;  3KWQ C;  1P3O A;  2Y2O A;  3H0L C;  3C1C B;  1Z2C B;  2YFW A;  3MGP A;  3AZF B;  3A6N C;  5B2J C;  3B6F B;  1KX3 A;  1H3O B;  4WU9 A;  3O62 D;  5JA4 B;  1U35 D;  1WWI A;  5KDM B;  3AZL C;  1HQ3 B;  3WA9 C;  2YFW B;  3B0D C;  3TU4 D;  3X1U B;  3NQJ A;  3C1C D;  3B0C T;  3AV2 C;  3WAA B;  2JE5 A;  4G91 B;  5E5A B;  3AZF D;  1P3K C;  3AZJ A;  5B1L A;  5KDM A;  3X1T D;  3MVD D;  3UT9 B;  1EQZ C;  4Z5T A;  4UPK A;  1HQ3 D;  3A6N A;  3LEL D;  5G49 B;  5JRG A;  4YM6 B;  2ARO D;  5AV5 D;  5B1L B;  3UT9 A;  3AZK B;  2HIO D;  3B6G D;  1P3B A;  4JJN B;  2F8N D;  3A1K A;  2JCH A;  1F66 A;  4NE5 A;  5BS7 A;  1P3B B;  4Z5T C;  1EQZ B;  3KUY A;  3MGS A;  1HQ3 C;  3VH5 W;  4XZQ A;  2PYO B;  3AZI D;  5GSU C;  3VH6 A;  5GT3 B;  5B0Y B;  1P3A C;  3AZF C;  5FUG A;  1P3K D;  1P3B D;  1EQZ D;  3X1S B;  3KFU G;  1M18 A;  3KWQ B;  5CP6 A;  4AWL C;  3F6T A;  1ID3 A;  3AZF A;  1BFM A;  5B0Z C;  3EPH A;  5AV6 D;  3WKJ B;  1HQ3 A;  3AZG C;  5B40 C;  5CPJ C;  1M1A D;  3AZJ D;  5BS7 C;  3W98 A;  3WKJ A;  1AOI A;  3REJ C;  3KXB A;  1ZLA D;  3UTA D;  1P3B C;  3REK C;  3EPJ A;  4WU8 C;  5AVC A;  4J8X C;  5B0Z D;  2L5A A;  5AY8 B;  1M1A B;  1ZLA A;  1AOI B;  2F2A C;  5AV6 C;  3AV1 B;  3KXB B;  5CHL B;  4X23 A;  5B33 B;  3AZH D;  1M1A C;  3AZJ C;  4QLC D;  5AV8 B;  1BH8 A;  4YM6 C;  1BH9 A;  1P3G B;  3O62 B;  3KUY B;  2Y2N A;  3LZ0 C;  3UTB D;  5DNM B;  5B0Y A;  5F99 C;  5FUG B;  2UWX A;  4YS3 D;  1P3F D;  3REL D;  1P3G D;  1JFI B;  4KUD C;  4YS3 A;  3MGQ D;  5GT0 A;  5B2I C;  3UTA C;  4QLC C;  3LEL B;  5DNN D;  4YM6 D;  4H9N A;  3MNN C;  2RIQ A;  2XD1 A;  4J8W B;  3AV2 D;  3C1C C;  1KX4 B;  4YS3 B;  3REL B;  2G5H C;  3REI A;  3AZI A;  3AZH C;  1M19 B;  4J8W A;  4J8U C;  5F99 D;  3UTA A;  1KX4 A;  3LEL C;  4YS3 C;  1P3F C;  2NQB D;  4H9Q A;  4KUD D;  4G92 C;  3AN2 C;  5BNV A;  5AVC D;  5B31 B;  3AZI B;  1W2E A;  3AZM A;  3LZ0 D;  1F1E A;  3MNN D;  3A1I A;  2HIO A;  4H9Q B;  2F8N G;  3B6G A;  2NZD B;  2BYM A;  5CPK A;  3REL C;  1P3G C;  1Q9C A;  3W99 D;  3LZ1 D;  5AVC B;  3MGQ C;  5B31 D;  1M1A A;  4J8V A;  3MNN B;  3LZ1 A;  5CPK B;  2F8N K;  5GSU D;  2NQB C;  5AV6 A;  5B1M C;  2DF4 C;  3AV1 C;  2DQN C;  3W99 B;  4WV4 B;  3MNN A;  3WTP C;  1BH9 B;  3O62 A;  4Z2M G;  4H9O A;  5BO0 A;  5AV6 B;  3REJ A;  4KUD A;  3W98 C;  3AN2 D;  3O62 C;  5JRG C;  2CV5 B;  3MGS D;  3B0D B;  5B40 A;  5CPJ A;  5BO0 B;  3WTP B;  1JFI A;  1P3K A;  5B1M D;  4LD9 C;  3LZ1 C;  2NQB A;  5B40 B;  5CPJ B;  5B0Z B;  4G91 C;  5B31 C;  1P3I A;  3AYW A;  5CP6 C;  4CAY B;  3REL A;  2ARO B;  5AV5 C;  4Z2M H;  3REJ D;  3AZH B;  2HIO C;  3B6G C;  3REH A;  1P3O C;  2F8N B;  2ARO A;  3C1B A;  3H0M C;  3VH5 T;  3AL0 C;  4DQY B;  4Z66 C;  3LJA C;  3UTB B;  3AZM B;  5GSU A;  4Z5T D;  3MGR A;  1ULY A;  2Y2I A;  1S32 C;  3WKJ C;  5JRG D;  3AZI C;  3MGS C;  1U35 A;  2NZD A;  2IO5 B;  2Y2J A;  4XUJ D;  1P3A D;  3AZN D;  3MGP D;  3TU4 A;  3MGR B;  4J8V B;  4LD9 D;  5BNX A;  5GT0 C;  5B2I A;  5GXQ C;  4WZS B;  3AZK C;  1S32 D;  3AZN B;  4X23 D;  4E45 A;  3R45 B;  5B33 C;  5F99 B;  3B6F A;  5BT1 D;  4KUD B;  2Y2P A;  1P3A A;  2CV5 A;  3WKJ D;  3AV2 A;  3NQJ B;  3X1U A;  4WU8 B;  3REK B;  3WAA A;  4KGC A;  4H9P B;  4XZQ C;  5GXQ D;  3AZJ B;  3KUY C;  1KX3 C;  4X23 C;  3MGP C;  1F66 C;  4KGC B;  1ZLA C;  2Y2K A;  3REK D;  4WU8 D;  2XD5 A;  5AY8 C;  4J8X D;  4M6B A;  5GXQ B;  3AZE D;  3KXB C;  4WNN B;  4DRA A;  3UT9 C;  4E44 A;  1TAF B;  2FJ7 B;  3W96 C;  2YFV B;  5B33 D;  5B31 G;  2Y2Q A;  4H9S A;  1M18 D;  3W97 A;  1EQZ A;  3AZE B;  5B24 A;  3AZG B;  2PYO A;  2FJ7 A;  1P3L D;  3UTB C;  3WTP D;  3AZE C;  5AVB B;  1P3P B;  2BYK A;  4WU9 C;  1P3F B;  3W98 D;  3EPK A;  2PYO C;  3W97 C;  1M18 C;  5AVB A;  4H9S C;  4WU9 B;  1P3P A;  5CP6 B;  3W96 A;  1P3M C;  1A7W A;  3MVD B;  3UT9 D;  3X1T B;  4CSR B;  5CPI B;  3W96 D;  2VQR A;  4J8U D;  2JSS A;  2Y2H A;  4WU9 D;  5CP6 D;  3AZM D;  5B1L D;  5GT3 C;  4Z5T B;  1TZY A;  3MVD A;  3X1T A;  5JRG B;  5G49 A;  5DNM C;  1H3O A;  5JA4 A;  5CPI D;  3LZ0 B;  4XUJ B;  1PZR A;  4R8P C;  4UUZ B;  4Z66 D;  3LJA D;  3W99 C;  3X1V D;  4JJN C;  2PYO D;  1F66 B;  4XUJ A;  4R8P B;  3A6N B;  5B1L C;  5GT3 D;  3AFA C;  3B6F C;  4XUJ C;  5B33 A;  1P34 D;  3AZN C;  1KU5 A;  5AV9 B;  2YFV A;  3V9R A;  1R4V A;  3X1S D;  4R8P A;  3AZL A;  3AZE A;  5DNN A;  3WA9 A;  4R8P D;  5GT0 D;  3X1S A;  4ZBJ B;  3AZK D;  4NE3 A;  5B2J A;  3V9R B;  4JJN D;  3MGS B;  3KWQ A;  2BYK B;  5GT0 B;  3B0C W;  4KGC D;  5B32 B;  3X1V A;  3C1B C;  1P3O B;  1N1J A;  5AVB C;  1P3P C;  1B67 A;  2IO5 C;  1KX3 D;  2HUE C;  4CSR A;  5CPI A;  3UTA B;  3X1S C;  1TZY D;  1P3O D;  5AY8 D;  3AYW C;  1ID3 B;  4KGC C;  4NFT A;  3KXB D;  5E5A A;  2CV5 C;  4ZUX C;  2FJ7 C;  3KSY A;  5AV8 D;  5AVB D;  1P3P D;  1ID3 D;  3W98 B;  5AV8 A;  3MGR D;  1P3L C;  3AZK A;  3C1B D;  2G5I C;  5AV9 A;  1ZLA B;  4ZUX D;  5DNM A;  5B1M A;  4X23 B;  3MGQ B;  5DNN B;  4XZQ B;  5BT1 C;  5B24 D;  4J8W D;  1KX4 D;  1KX5 C;  1BH8 B;  3REI D;  3NQU B;  3MGR C;  1P3M D;  2Y2G A;  4Z66 A;  3LJA A;  1P3M A;  2J8P A;  4XZQ D;  3VH6 T;  3NQU A;  3REH C;  4NE6 A;  3KUY D;  2NQB B;  2ZY2 A;  3REI B;  4Z66 B;  3LJA B;  3H0R C;  4DRB A;  3AZM C;  3X1V B;  1P3M B;  3AN2 A;  1F66 D;  5DNM D;  1N1J B;  2BG1 A;  3A6N D;  3LEL A;  4H9N B;  5B31 A;  1P34 B;  2ZY3 A;  5AV9 D;  3VH6 W;  3REH B;  5C3I B;  3X1U D;  3TU4 C;  3X1V C;  1T3U A;  2BYM B;  3WAA D;  5E5A D;  1P34 A;  5GSU B;  5C3I C;  1KX5 D;  3AFA D;  1M19 C;  4H9R B;  2ZM5 A;  1P34 C;  1S32 A;  5AV5 B;  2ARO C;  4EO5 B;  5AV9 C;  5AY8 A;  2HIO B;  3B6G B;  3AFA B;  5B32 D;  3AV1 A;  4H9O B;  3WTP E;  3W97 D;  1HTA A;  2NZD D;  3AZN A;  3LZ1 B;  5B1M B;  3MGQ A;  1P3G A;  4LD9 A;  5CPK C;  2F8N H;  2ZY5 A;  5B0Y D;  5E5A C;  3FDD A; 
#chains in the Genus database with same CATH homology
 4J8X A;  4WU8 A;  3REK A;  1KX5 A;  2Y2M A;  3REJ B;  4H9P A;  4WJ3 C;  3P5J B;  2LY8 A;  5CPI C;  1P3I D;  2HUE B;  3AZH A;  4G92 B;  3AN2 B;  2CV5 D;  3C1B B;  1P3L A;  5B0Z A;  2Y2L A;  1M19 A;  2NZD C;  1P3I B;  1TAF A;  4ZUX B;  3B6F D;  4EO5 C;  4J8V C;  5CPJ D;  5B40 D;  4HGA B;  1U35 B;  1WWS A;  5BNV B;  2RVQ D;  5B24 B;  3TU4 B;  5B0Y C;  4ZUX A;  2F8N A;  4ZBJ C;  4H9R A;  1S32 B;  5AV5 A;  1AOI D;  1P3I C;  3AFA A;  3VH5 A;  4J8W C;  4J8U A;  3R45 A;  1KX4 C;  3REI C;  4KHA A;  4QLC B;  2RVQ C;  3W99 A;  3C1C A;  1P3A B;  5BNX B;  3MGP B;  3EPL A;  3REH D;  5B2I B;  4J8V D;  1KX3 B;  4LD9 B;  3IP4 C;  1AOI C;  2CWE A;  1B6W A;  4J8X B;  1TZY C;  5F99 A;  1TZY B;  3AYW D;  1KX5 B;  3WTP A;  5B2I D;  1P3K B;  3LZ0 A;  5DNN C;  2FJ7 D;  3WAA C;  4WNN A;  3X1U C;  2ZY4 A;  3AV2 B;  5AV8 C;  4YM6 A;  4UUZ A;  3AYW B;  1ID3 C;  3AZG D;  4CAY A;  3KWQ D;  2FFF B;  1M19 D;  1P3L B;  3B0B A;  3EG5 B;  3W97 B;  4JJN A;  5B2J D;  5AVC C;  5GXQ A;  5B32 C;  2W8S A;  3AZL B;  3WA9 B;  5B32 G;  3UTB A;  1P3F A;  5B2J B;  5B24 C;  5GT3 A;  3MVD C;  3X1T C;  4HGA C;  3AZG A;  1U35 C;  3AZL D;  3WA9 D;  5CPK D;  1M18 B;  3W96 B;  4J8U B;  4KHA B;  4AWL B;  5B32 A;  3AV1 D;  4QLC A;  3KWQ C;  1P3O A;  2Y2O A;  3H0L C;  3C1C B;  1Z2C B;  2YFW A;  3MGP A;  3AZF B;  3A6N C;  5B2J C;  3B6F B;  1KX3 A;  1H3O B;  4WU9 A;  3O62 D;  5JA4 B;  1U35 D;  1WWI A;  5KDM B;  3AZL C;  1HQ3 B;  3WA9 C;  2YFW B;  3B0D C;  3TU4 D;  3X1U B;  3NQJ A;  3C1C D;  3B0C T;  3AV2 C;  3WAA B;  2JE5 A;  4G91 B;  5E5A B;  3AZF D;  1P3K C;  3AZJ A;  5B1L A;  5KDM A;  3X1T D;  3MVD D;  3UT9 B;  1EQZ C;  4Z5T A;  4UPK A;  1HQ3 D;  3A6N A;  3LEL D;  5G49 B;  5JRG A;  4YM6 B;  2ARO D;  5AV5 D;  5B1L B;  3UT9 A;  3AZK B;  2HIO D;  3B6G D;  1P3B A;  4JJN B;  2F8N D;  3A1K A;  2JCH A;  1F66 A;  4NE5 A;  5BS7 A;  1P3B B;  4Z5T C;  1EQZ B;  3KUY A;  3MGS A;  1HQ3 C;  3VH5 W;  4XZQ A;  2PYO B;  3AZI D;  5GSU C;  3VH6 A;  5GT3 B;  5B0Y B;  1P3A C;  3AZF C;  5FUG A;  1P3K D;  1P3B D;  1EQZ D;  3X1S B;  3KFU G;  1M18 A;  3KWQ B;  5CP6 A;  4AWL C;  3F6T A;  1ID3 A;  3AZF A;  1BFM A;  5B0Z C;  3EPH A;  5AV6 D;  3WKJ B;  1HQ3 A;  3AZG C;  5B40 C;  5CPJ C;  1M1A D;  3AZJ D;  5BS7 C;  3W98 A;  3WKJ A;  1AOI A;  3REJ C;  3KXB A;  1ZLA D;  3UTA D;  1P3B C;  3REK C;  3EPJ A;  4WU8 C;  5AVC A;  4J8X C;  5B0Z D;  2L5A A;  5AY8 B;  1M1A B;  1ZLA A;  1AOI B;  2F2A C;  5AV6 C;  3AV1 B;  3KXB B;  5CHL B;  4X23 A;  5B33 B;  3AZH D;  1M1A C;  3AZJ C;  4QLC D;  5AV8 B;  1BH8 A;  4YM6 C;  1BH9 A;  1P3G B;  3O62 B;  3KUY B;  2Y2N A;  3LZ0 C;  3UTB D;  5DNM B;  5B0Y A;  5F99 C;  5FUG B;  2UWX A;  4YS3 D;  1P3F D;  3REL D;  1P3G D;  1JFI B;  4KUD C;  4YS3 A;  3MGQ D;  5GT0 A;  5B2I C;  3UTA C;  4QLC C;  3LEL B;  5DNN D;  4YM6 D;  4H9N A;  3MNN C;  2RIQ A;  2XD1 A;  4J8W B;  3AV2 D;  3C1C C;  1KX4 B;  4YS3 B;  3REL B;  2G5H C;  3REI A;  3AZI A;  3AZH C;  1M19 B;  4J8W A;  4J8U C;  5F99 D;  3UTA A;  1KX4 A;  3LEL C;  4YS3 C;  1P3F C;  2NQB D;  4H9Q A;  4KUD D;  4G92 C;  3AN2 C;  5BNV A;  5AVC D;  5B31 B;  3AZI B;  1W2E A;  3AZM A;  3LZ0 D;  1F1E A;  3MNN D;  3A1I A;  2HIO A;  4H9Q B;  2F8N G;  3B6G A;  2NZD B;  2BYM A;  5CPK A;  3REL C;  1P3G C;  1Q9C A;  3W99 D;  3LZ1 D;  5AVC B;  3MGQ C;  5B31 D;  1M1A A;  4J8V A;  3MNN B;  3LZ1 A;  5CPK B;  2F8N K;  5GSU D;  2NQB C;  5AV6 A;  5B1M C;  2DF4 C;  3AV1 C;  2DQN C;  3W99 B;  4WV4 B;  3MNN A;  3WTP C;  1BH9 B;  3O62 A;  4Z2M G;  4H9O A;  5BO0 A;  5AV6 B;  3REJ A;  4KUD A;  3W98 C;  3AN2 D;  3O62 C;  5JRG C;  2CV5 B;  3MGS D;  3B0D B;  5B40 A;  5CPJ A;  5BO0 B;  3WTP B;  1JFI A;  1P3K A;  5B1M D;  4LD9 C;  3LZ1 C;  2NQB A;  5B40 B;  5CPJ B;  5B0Z B;  4G91 C;  5B31 C;  1P3I A;  3AYW A;  5CP6 C;  4CAY B;  3REL A;  2ARO B;  5AV5 C;  4Z2M H;  3REJ D;  3AZH B;  2HIO C;  3B6G C;  3REH A;  1P3O C;  2F8N B;  2ARO A;  3C1B A;  3H0M C;  3VH5 T;  3AL0 C;  4DQY B;  4Z66 C;  3LJA C;  3UTB B;  3AZM B;  5GSU A;  4Z5T D;  3MGR A;  1ULY A;  2Y2I A;  1S32 C;  3WKJ C;  5JRG D;  3AZI C;  3MGS C;  1U35 A;  2NZD A;  2IO5 B;  2Y2J A;  4XUJ D;  1P3A D;  3AZN D;  3MGP D;  3TU4 A;  3MGR B;  4J8V B;  4LD9 D;  5BNX A;  5GT0 C;  5B2I A;  5GXQ C;  4WZS B;  3AZK C;  1S32 D;  3AZN B;  4X23 D;  4E45 A;  3R45 B;  5B33 C;  5F99 B;  3B6F A;  5BT1 D;  4KUD B;  2Y2P A;  1P3A A;  2CV5 A;  3WKJ D;  3AV2 A;  3NQJ B;  3X1U A;  4WU8 B;  3REK B;  3WAA A;  4KGC A;  4H9P B;  4XZQ C;  5GXQ D;  3AZJ B;  3KUY C;  1KX3 C;  4X23 C;  3MGP C;  1F66 C;  4KGC B;  1ZLA C;  2Y2K A;  3REK D;  4WU8 D;  2XD5 A;  5AY8 C;  4J8X D;  4M6B A;  5GXQ B;  3AZE D;  3KXB C;  4WNN B;  4DRA A;  3UT9 C;  4E44 A;  1TAF B;  2FJ7 B;  3W96 C;  2YFV B;  5B33 D;  5B31 G;  2Y2Q A;  4H9S A;  1M18 D;  3W97 A;  1EQZ A;  3AZE B;  5B24 A;  3AZG B;  2PYO A;  2FJ7 A;  1P3L D;  3UTB C;  3WTP D;  3AZE C;  5AVB B;  1P3P B;  2BYK A;  4WU9 C;  1P3F B;  3W98 D;  3EPK A;  2PYO C;  3W97 C;  1M18 C;  5AVB A;  4H9S C;  4WU9 B;  1P3P A;  5CP6 B;  3W96 A;  1P3M C;  1A7W A;  3MVD B;  3UT9 D;  3X1T B;  4CSR B;  5CPI B;  3W96 D;  2VQR A;  4J8U D;  2JSS A;  2Y2H A;  4WU9 D;  5CP6 D;  3AZM D;  5B1L D;  5GT3 C;  4Z5T B;  1TZY A;  3MVD A;  3X1T A;  5JRG B;  5G49 A;  5DNM C;  1H3O A;  5JA4 A;  5CPI D;  3LZ0 B;  4XUJ B;  1PZR A;  4R8P C;  4UUZ B;  4Z66 D;  3LJA D;  3W99 C;  3X1V D;  4JJN C;  2PYO D;  1F66 B;  4XUJ A;  4R8P B;  3A6N B;  5B1L C;  5GT3 D;  3AFA C;  3B6F C;  4XUJ C;  5B33 A;  1P34 D;  3AZN C;  1KU5 A;  5AV9 B;  2YFV A;  3V9R A;  1R4V A;  3X1S D;  4R8P A;  3AZL A;  3AZE A;  5DNN A;  3WA9 A;  4R8P D;  5GT0 D;  3X1S A;  4ZBJ B;  3AZK D;  4NE3 A;  5B2J A;  3V9R B;  4JJN D;  3MGS B;  3KWQ A;  2BYK B;  5GT0 B;  3B0C W;  4KGC D;  5B32 B;  3X1V A;  3C1B C;  1P3O B;  1N1J A;  5AVB C;  1P3P C;  1B67 A;  2IO5 C;  1KX3 D;  2HUE C;  4CSR A;  5CPI A;  3UTA B;  3X1S C;  1TZY D;  1P3O D;  5AY8 D;  3AYW C;  1ID3 B;  4KGC C;  4NFT A;  3KXB D;  5E5A A;  2CV5 C;  4ZUX C;  2FJ7 C;  3KSY A;  5AV8 D;  5AVB D;  1P3P D;  1ID3 D;  3W98 B;  5AV8 A;  3MGR D;  1P3L C;  3AZK A;  3C1B D;  2G5I C;  5AV9 A;  1ZLA B;  4ZUX D;  5DNM A;  5B1M A;  4X23 B;  3MGQ B;  5DNN B;  4XZQ B;  5BT1 C;  5B24 D;  4J8W D;  1KX4 D;  1KX5 C;  1BH8 B;  3REI D;  3NQU B;  3MGR C;  1P3M D;  2Y2G A;  4Z66 A;  3LJA A;  1P3M A;  2J8P A;  4XZQ D;  3VH6 T;  3NQU A;  3REH C;  4NE6 A;  3KUY D;  2NQB B;  2ZY2 A;  3REI B;  4Z66 B;  3LJA B;  3H0R C;  4DRB A;  3AZM C;  3X1V B;  1P3M B;  3AN2 A;  1F66 D;  5DNM D;  1N1J B;  2BG1 A;  3A6N D;  3LEL A;  4H9N B;  5B31 A;  1P34 B;  2ZY3 A;  5AV9 D;  3VH6 W;  3REH B;  5C3I B;  3X1U D;  3TU4 C;  3X1V C;  1T3U A;  2BYM B;  3WAA D;  5E5A D;  1P34 A;  5GSU B;  5C3I C;  1KX5 D;  3AFA D;  1M19 C;  4H9R B;  2ZM5 A;  1P34 C;  1S32 A;  5AV5 B;  2ARO C;  4EO5 B;  5AV9 C;  5AY8 A;  2HIO B;  3B6G B;  3AFA B;  5B32 D;  3AV1 A;  4H9O B;  3WTP E;  3W97 D;  1HTA A;  2NZD D;  3AZN A;  3LZ1 B;  5B1M B;  3MGQ A;  1P3G A;  4LD9 A;  5CPK C;  2F8N H;  2ZY5 A;  5B0Y D;  5E5A C;  3FDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...