5AV6B

Human nucleosome core particle
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 27
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av6B00
4ZBJC 4QLCB 3AZKD 4XUJA 2NZDA 1ID3C 1ZLAC 3REKD 3A6NA 2FJ7B 3MGSC 3KWQC 4YM6C 1P3IC 3MGRC 1P3KD 1S32C 5B31C 3LJAC 4CSRB 3MNNA 1AOID 5GXQD 3AFAB 5AVCC 1M19B 3UTAB 3W98C 3REHA 5B0ZA 1P3GC 3AFAA 4ZUXC 1ID3B 3WKJD 1ZLAB 3REID 3MGSB 4Z5TC 3C1CC 4YM6B 3V9RB 1P3IB 3UT9C 4NFTA 5B32D 5B33B 4NE5A 1S32B 5BS7A 1TZYA 5B31B 3LJAB 1H3OB 5CPIC 3AZNC 1P3IA 1JFIA 5AVCB 5B33A 2AROC 1KX3C 4LD9C 3W98B 1H3OA 4H9SA 5B40C 1P3GB 3AZKA 3C1BC 3REKA 3AZGD 3WA9C 3W96C 4ZUXB 5CPJC 4J8UD 3W97D 5AY8C 3W99A 3WTPD 4Z5TB 3C1CB 1P3OB 4J8XA 1P3KA 3AN2A 3AZNB 3KXBC 2BYMB 5CPIB 1P3OA 5B1LA 3REJB 3B6FC 1KX3B 5B0YC 3AZLC 1F66C 2BYMA 5B40B 3REJA 3WKJA 3WAAB 3WA9B 3W96B 3R45B 3AZMD 4Z66C 5B32A 3WAAA 4R8PA 3R45A 5BNVB 4E45A 2RVQC 3AYWD 2HIOC 3NQJA 4JJND 4UUZB 5B24D 4WU9B 3LELC 1P3BC 5BNVA 4KUDB 3B6FB 5GT0C 5B0YB 3AZLB 3AZJC 3X1TA 4UUZA 5B31G 3VH5T 3LZ0A 4WU9A 5CPKB 4KUDA 3W97A 5B0YA 5GSUC 3RELC 3VH5A 4Z66B 5CPKA 4J8WB 3B0CW 3MGQB 2BYKA 5CP6D 5B1MC 2HIOB 5DNND 1P3PB 4XZQC 4J8WA 3MGQA 1P3BB 1KX5B 5GT0B 1P3PA 3AZJB 3B0CT 3AV1D 1BFMA 1KX5A 5GT0A 1EQZC 3UTBC 3AZMA 5AV5C 3KUYD 5GSUB 3RELB 5JRGC 3AZFC 1P3AD 3AYWA 5B1MB 4XZQB 5E5AD 1M1AD 3X1VD 1P3MC 4CAYB 1BH8B 5B2JC 5DNMB 3KSYA 1BH9B 1EQZB 4CAYA 3UTBB 4DRBA 5DNMA 5AV5B 2YFWB 5JRGB 4XUJC 3AZFB 1P3FD 2NZDC 3A6NC 1P34D 3AZID 5BNXB 2YFWA 3O62D 3MNNC 2CWEA 2NQBD 1P3MB 5BNXA 3AV1A 2F8NB 5F99B 3REHC 5AV9A 5B0ZC 4Z2MG 2IO5C 4XUJB 5F99A 2PYOD 5G49A 1F1EA 5E5AA 5AV8B 4H9PA 5BS7C 1TZYC 3MNNB 1M19D 5B33C 5AV8A 1KU5A 1P3LB 4KGCD 4H9SC 3REHB 1TAFA 5B0ZB 3AZKC 5JA4B 1Q9CA 2IO5B 3REKC 3AZEA 1P3LA 1P34A 5GT3B 3W99C 4YM6D 3KWQD 5JA4A 3MGRD 4J8XC 1P3KC 3AN2C 3TU4A 3O62A 5GT3A 1JFIB 1TZYB 4X23D 5AVCD 1HQ3B 1P3OC 5B1LC 4NE6A 1HQ3A 3AZKB 2CV5D 4ZUXD 3REJC 3REKB 5B2ID 2F8NG 3B6GA 3WKJC 2PYOA 4H9NB 4Z5TD 3W99B 3UT9D 5AV6D 3WAAC 5B32C 4J8XB 4R8PC 1P3KB 3AN2B 4H9NA 1M18D 4H9RB 5GXQB 2AROD 5B1LB 1KX3D 4KGCA 4LD9D 1AOIA 4H9RA 5GXQA 5B40D 3X1TC 3LZ0C 3VH6W 3C1BD 4WU9C 3WA9D 3WKJB 4KUDC 5CPJD 1KX4D 3REIB 3W97C 5AY8D 4H9OA 5CPKC 5B32B 4R8PB 3REIA 5CHLB 3NQJB 4X23A 3VH6T 3KXBD 1B6WA 3AV2D 4J8WC 3VH5W 3MGQC 3B6FD 1F66D 1P3PC 2CV5A 3VH6A 3X1TB 3LZ1D 3LZ0B 5B2IA 1KX5C 3W97B 3AZMC 3NQUB 5AV6A 4Z66D 3AZGA 3MVDD 3AYWC 1M18A 4J8UA 2RVQD 2BYKB 2HIOD 1U35D 3WTPA 4J8VD 3NQUA 3LELD 1P3BD 3AZJD 1KX4A 4HGAB 3AZMB 5GSUD 5DNMC 1N1JA 3AYWB 1WWIA 2F8NK 5B32G 4JJNA 3X1UD 5B24A 3LZ1A 3AV1C 3X1SD 1EQZD 3UTBD 5AV9C 5AV5D 5JRGD 3MVDA 4YS3D 4WU8D 5F99C 1U35A 3AZHD 5AVBD 4J8VA 5E5AC 5CP6A 5DNNA 5B2JD 2F8ND 3MGPD 3AV1B 5AV8C 5AV9B 3KUYB 1P3AB 1P3FC 2NZDD 3AZEC 1P3LC 3A6ND 1P34C 5BO0A 3KUYA 4WZSB 4QLCD 1P3AA 5G49B 5E5AB 3TU4C 4G91C 3O62C 2FJ7D 2F8NH 4H9PB 5GT3C 3MNND 1M1AA 3X1SA 3X1VA 5B0ZD 3AFAD 1HQ3C 1TAFB 3UTAD 1P3FB 5BT1C 4WU8A 3B6GC 3AZHA 3AZEB 2PYOC 1B67A 1P34B 3AZIB 5C3IC 1P3FA 1ID3D 1ZLAD 3TU4B 4G91B 3O62B 3MGSD 2LY8A 3AZIA 3MGPA 1P3ID 1A7WA 5B33D 4KGCC 1S32D 5B31D 3LJAD 1AOIC 2NQBA 5GXQC 5KDMA 1ULYA 4KHAA 3B6GB 3W98D 2PYOB 3W99D 4QLCA 1P3GD 1HTAA 5C3IB 4J8XD 3AN2D 2FJ7A 3REIC 3WTPE 3B0BA 4X23C 3C1CD 1P3OD 5B1LD 4H9QB 4CSRA 4KGCB 4ZBJB 3AZND 1AOIB 1M19A 3UTAA 5CPID 2CV5C 4H9QA 5B2IC 3REJD 3KWQB 5AV6C 4H9OB 3MGRB 1ID3A 3AZGC 1ZLAA 3WAAD 4R8PD 1M18C 3W96D 4J8UC 3MGSA 3KWQA 4YM6A 3V9RA 3WTPC 4X23B 3MGRA 4M6BA 1S32A 5B31A 3LJAA 5AVCA 3X1TD 3LZ0D 4WU9D 2CV5B 4E44A 5B2IB 3W98A 1KX4C 4KUDD 5B0YD 3AZLD 1P3GA 3UT9B 5AV6B 4ZUXA 5CPKD 3AZGB 4HGAC 1M18B 4J8UB 4Z5TA 3C1CA 3WTPB 3UT9A 3B0DC 3AV2C 2AROB 4J8WD 4LD9B 4DRAA 3MGQD 3AZNA 5CPIA 1P3PD 4JJNC 3LZ1C 5B24C 3C1BB 2AROA 1KX3A 4LD9A 5CPJB 1KX4B 1KX5D 5GT0D 5B40A 5AY8B 3C1BA 3MVDC 3W96A 3WA9A 5CPJA 1N1JB 1U35C 2JSSA 5AY8A 4J8VC 4G92C 3KXBB 3RELD 3B0DB 3AV2B 5CP6C 4AWLC 5B1MD 5DNNC 4NE3A 3KXBA 1F66B 4JJNB 3LZ1B 5B24B 4Z2MH 4XZQD 3AV2A 3B6FA 2HUEC 3AZLA 1F66A 5DNMD 3MVDB 1U35B 4J8VB 3KUYC 4G92B 1P3AC 4Z66A 3AZFD 3LELB 4EO5C 5CP6B 2HIOA 4AWLB 5DNNB 3X1UC 5FUGB 3LELA 1P3BA 1M1AC 3X1SC 3X1VC 2HUEB 5AV9D 3AZJA 1P3MD 5FUGA 4YS3C 4WU8C 5F99D 3AZHC 5AVBC 5GSUA 4WNNB 3RELA 5BO0B 4WV4B 1WWSA 4XUJD 5B1MA 4EO5B 4WNNA 2L5AA 3AZIC 3X1UB 3MGPC 4XZQA 5AV8D 1M1AB 2YFVB 3X1SB 3X1VB 2NQBC 1BH8A 3X1UA 4YS3B 4WU8B 3AZED 1P3LD 2YFVA 1BH9A 1EQZA 3AZHB 3UTBA 5AVBB 3REHD 5AV5A 4QLCC 5JRGA 3AZFA 4YS3A 2FJ7C 3TU4D 5AVBA 5GT3D 5B2JB 3MGPB 1P3MA 3AFAC 1TZYD 1M19C 2NQBB 5B2JA 1R4VA 1HQ3D 3UTAC 2F8NA 5KDMB 5BT1D 2NZDB 3B6GD 3A6NB 4KHAB
chains in the Genus database with same CATH superfamily
4ZBJC 4QLCB 3AZKD 4XUJA 2NZDA 1ID3C 1ZLAC 3REKD 3A6NA 2FJ7B 3MGSC 3KWQC 2Y2JA 4YM6C 1P3IC 2G5HC 3MGRC 1P3KD 1S32C 5B31C 3LJAC 4CSRB 3MNNA 1AOID 5GXQD 3AFAB 5AVCC 1M19B 3UTAB 3W98C 3REHA 5B0ZA 1P3GC 3AFAA 4ZUXC 1ID3B 3WKJD 1ZLAB 3REID 3MGSB 4Z5TC 3C1CC 2VQRA 3V9RB 4YM6B 3UT9C 1P3IB 4NFTA 5B32D 5B33B 4NE5A 1S32B 5BS7A 1TZYA 5B31B 3LJAB 1H3OB 5CPIC 3AZNC 1P3IA 1JFIA 2J8PA 5AVCB 5B33A 2AROC 1KX3C 4LD9C 3W98B 1H3OA 4H9SA 5B40C 1P3GB 3AZKA 3C1BC 3REKA 3AZGD 3WA9C 3W96C 4ZUXB 5CPJC 4J8UD 3W97D 5AY8C 3W99A 3WTPD 4Z5TB 3C1CB 1P3OB 4J8XA 1P3KA 3AN2A 2Y2MA 3AZNB 3KXBC 2BYMB 5CPIB 1P3OA 5B1LA 3REJB 3B6FC 1KX3B 5B0YC 3AZLC 1F66C 2BYMA 5B40B 3REJA 3WKJA 3WAAB 3WA9B 3W96B 3R45B 3AZMD 2W8SA 4Z66C 5B32A 3WAAA 4R8PA 3R45A 5BNVB 4E45A 2RVQC 3AYWD 2HIOC 3NQJA 4JJND 4UUZB 5B24D 4WU9B 3LELC 1P3BC 5BNVA 4KUDB 3B6FB 5GT0C 5B0YB 3AZLB 2BG1A 3AZJC 3X1TA 4UUZA 5B31G 3VH5T 3LZ0A 4WU9A 5CPKB 4KUDA 3W97A 5B0YA 5GSUC 3RELC 3VH5A 4Z66B 5CPKA 4J8WB 3B0CW 3MGQB 2BYKA 5CP6D 5B1MC 2HIOB 5DNND 1P3PB 4XZQC 4J8WA 3MGQA 1P3BB 2JCHA 1KX5B 5GT0B 1P3PA 3AZJB 3A1IA 3B0CT 3AV1D 1BFMA 1KX5A 5GT0A 3H0RC 1EQZC 3UTBC 3AZMA 5AV5C 3KUYD 5GSUB 2JE5A 3RELB 5JRGC 3AZFC 1P3AD 3AYWA 5B1MB 4XZQB 5E5AD 1M1AD 3X1VD 1P3MC 4CAYB 1BH8B 5B2JC 5DNMB 3KSYA 1BH9B 1EQZB 4CAYA 3UTBB 4DRBA 5DNMA 5AV5B 2YFWB 5JRGB 4XUJC 3AZFB 1P3FD 2NZDC 3A6NC 3P5JB 1P34D 3AZID 5BNXB 2YFWA 3O62D 3MNNC 2CWEA 1PZRA 1P3MB 2NQBD 5BNXA 3AV1A 2F8NB 5F99B 3REHC 5AV9A 5B0ZC 4Z2MG 2IO5C 4XUJB 5F99A 2Y2OA 2PYOD 5G49A 1F1EA 5E5AA 5AV8B 4H9PA 5BS7C 1TZYC 3MNNB 1M19D 5B33C 5AV8A 1KU5A 1P3LB 4KGCD 4H9SC 3REHB 1TAFA 5B0ZB 3AZKC 5JA4B 1Q9CA 2IO5B 3REKC 3AZEA 1P3LA 1P34A 5GT3B 3W99C 4YM6D 3KWQD 5JA4A 3MGRD 4J8XC 1P3KC 3AN2C 3H0LC 3TU4A 3O62A 5GT3A 1JFIB 1TZYB 4X23D 5AVCD 1HQ3B 1P3OC 1W2EA 5B1LC 4NE6A 1HQ3A 2XD5A 3AZKB 2CV5D 4ZUXD 3REJC 2FFFB 5B2ID 3REKB 2F8NG 3B6GA 2PYOA 3WKJC 4H9NB 4Z5TD 3W99B 3UT9D 5AV6D 3WAAC 5B32C 4J8XB 4R8PC 1P3KB 3AN2B 4H9NA 1M18D 3EPHA 4H9RB 3KFUG 5GXQB 2Y2NA 2AROD 5B1LB 1KX3D 4KGCA 4LD9D 1AOIA 4H9RA 5GXQA 5B40D 3X1TC 3EPLA 3LZ0C 3VH6W 3C1BD 4WU9C 3WA9D 3WKJB 4KUDC 5CPJD 1KX4D 3REIB 3W97C 5AY8D 4H9OA 5CPKC 5B32B 4R8PB 3REIA 5CHLB 3NQJB 4X23A 3F6TA 3VH6T 3KXBD 1B6WA 3EPKA 3AV2D 4J8WC 3VH5W 3MGQC 3B6FD 2Y2PA 1T3UA 1P3PC 1F66D 2CV5A 3VH6A 3X1TB 3LZ1D 3LZ0B 5B2IA 1KX5C 3W97B 3AZMC 3NQUB 5AV6A 4Z66D 3AZGA 3MVDD 3AYWC 1M18A 4J8UA 2RVQD 2BYKB 2HIOD 3EG5B 1U35D 3WTPA 4J8VD 3NQUA 3LELD 1P3BD 3AZJD 2XD1A 1KX4A 4HGAB 3AZMB 5GSUD 2DF4C 5DNMC 2RIQA 1N1JA 3AYWB 1WWIA 2F2AC 1Z2CB 2F8NK 3H0MC 5B32G 3EPJA 2ZY3A 4JJNA 3X1UD 5B24A 3LZ1A 3AV1C 2Y2QA 3X1SD 1EQZD 3UTBD 5AV9C 5AV5D 5JRGD 3MVDA 4YS3D 4WU8D 5F99C 1U35A 3AZHD 5AVBD 4J8VA 5E5AC 5CP6A 5DNNA 5B2JD 2F8ND 3MGPD 3AV1B 5AV8C 5AV9B 3KUYB 1P3AB 1P3FC 2NZDD 2Y2HA 3AZEC 1P3LC 3A6ND 1P34C 5BO0A 3KUYA 4WZSB 4QLCD 1P3AA 5G49B 2Y2LA 5E5AB 3TU4C 4G91C 3O62C 2FJ7D 2F8NH 4H9PB 5GT3C 3MNND 1M1AA 3X1SA 3X1VA 5B0ZD 3AFAD 1HQ3C 1TAFB 3UTAD 1P3FB 5BT1C 4WU8A 3B6GC 3AZHA 3AZEB 2PYOC 1B67A 1P34B 3AZIB 5C3IC 1P3FA 1ID3D 1ZLAD 3TU4B 4G91B 3O62B 3MGSD 2LY8A 3AZIA 3MGPA 1P3ID 1A7WA 5B33D 4KGCC 1S32D 5B31D 3LJAD 1AOIC 2NQBA 5GXQC 5KDMA 1ULYA 4KHAA 3B6GB 3W98D 2PYOB 3W99D 4QLCA 1P3GD 1HTAA 5C3IB 4J8XD 3AN2D 2FJ7A 3REIC 3WTPE 3B0BA 4X23C 3C1CD 1P3OD 5B1LD 4H9QB 4CSRA 4KGCB 4ZBJB 3AZND 1AOIB 1M19A 3UTAA 5CPID 2CV5C 4H9QA 5B2IC 3REJD 2DQNC 3KWQB 2Y2KA 5AV6C 4H9OB 3MGRB 1ID3A 3AZGC 1ZLAA 3WAAD 4R8PD 1M18C 3W96D 4J8UC 3MGSA 3KWQA 4YM6A 3V9RA 3WTPC 4X23B 3MGRA 4M6BA 1S32A 5B31A 3LJAA 5AVCA 3X1TD 3LZ0D 4WU9D 2CV5B 3A1KA 4E44A 5B2IB 3W98A 1KX4C 4KUDD 4DQYB 5B0YD 3AZLD 1P3GA 3UT9B 5AV6B 4ZUXA 5CPKD 3AZGB 4HGAC 1M18B 2ZY4A 4J8UB 3AL0C 2G5IC 4Z5TA 3C1CA 3WTPB 3UT9A 3B0DC 3IP4C 3AV2C 2AROB 4J8WD 4LD9B 4DRAA 3MGQD 3AZNA 5CPIA 1P3PD 4JJNC 3LZ1C 5B24C 3C1BB 2AROA 1KX3A 4LD9A 2Y2IA 5CPJB 1KX4B 1KX5D 5GT0D 5B40A 5AY8B 3C1BA 3MVDC 3W96A 3WA9A 5CPJA 1N1JB 1U35C 2JSSA 5AY8A 4J8VC 4G92C 3KXBB 3RELD 3B0DB 3AV2B 2UWXA 3FDDA 5CP6C 4AWLC 5B1MD 5DNNC 4NE3A 3KXBA 2Y2GA 1F66B 4JJNB 3LZ1B 5B24B 4Z2MH 4XZQD 3AV2A 3B6FA 2HUEC 3AZLA 1F66A 4UPKA 5DNMD 3MVDB 1U35B 2ZY2A 4J8VB 3KUYC 4G92B 1P3AC 4Z66A 3AZFD 3LELB 4WJ3C 4EO5C 5CP6B 2HIOA 4AWLB 5DNNB 3X1UC 5FUGB 3LELA 1P3BA 1M1AC 3X1SC 3X1VC 2HUEB 5AV9D 3AZJA 1P3MD 5FUGA 4YS3C 4WU8C 5F99D 3AZHC 5AVBC 5GSUA 4WNNB 3RELA 5BO0B 4WV4B 1WWSA 4XUJD 5B1MA 4EO5B 4WNNA 2L5AA 3AZIC 3X1UB 3MGPC 4XZQA 2ZM5A 5AV8D 1M1AB 2YFVB 3X1SB 3X1VB 2NQBC 1BH8A 3X1UA 4YS3B 4WU8B 3AZED 1P3LD 2YFVA 1BH9A 1EQZA 3AZHB 3UTBA 5AVBB 3REHD 5AV5A 4QLCC 5JRGA 3AZFA 2ZY5A 4YS3A 2FJ7C 3TU4D 5AVBA 5GT3D 5B2JB 3MGPB 1P3MA 3AFAC 1TZYD 1M19C 2NQBB 5B2JA 1R4VA 1HQ3D 3UTAC 2F8NA 5KDMB 5BT1D 2NZDB 3B6GD 3A6NB 4KHAB
chains in the Genus database with same CATH topology
4ZBJC 4QLCB 3AZKD 4XUJA 2NZDA 1ID3C 1ZLAC 3REKD 3A6NA 2FJ7B 3MGSC 3KWQC 2Y2JA 4YM6C 1P3IC 2G5HC 3MGRC 1P3KD 1S32C 5B31C 3LJAC 4CSRB 3MNNA 1AOID 5GXQD 3AFAB 5AVCC 1M19B 3UTAB 3W98C 3REHA 5B0ZA 1P3GC 3AFAA 4ZUXC 1ID3B 3WKJD 1ZLAB 3REID 3MGSB 4Z5TC 3C1CC 2VQRA 3V9RB 4YM6B 3UT9C 1P3IB 4NFTA 5B32D 5B33B 4NE5A 1S32B 5BS7A 1TZYA 5B31B 3LJAB 1H3OB 5CPIC 3AZNC 1P3IA 1JFIA 2J8PA 5AVCB 5B33A 2AROC 1KX3C 4LD9C 3W98B 1H3OA 4H9SA 5B40C 1P3GB 3AZKA 3C1BC 3REKA 3AZGD 3WA9C 3W96C 4ZUXB 5CPJC 4J8UD 3W97D 5AY8C 3W99A 3WTPD 4Z5TB 3C1CB 1P3OB 4J8XA 1P3KA 3AN2A 2Y2MA 3AZNB 3KXBC 2BYMB 5CPIB 1P3OA 5B1LA 3REJB 3B6FC 1KX3B 5B0YC 3AZLC 1F66C 2BYMA 5B40B 3REJA 3WKJA 3WAAB 3WA9B 3W96B 3R45B 3AZMD 2W8SA 4Z66C 5B32A 3WAAA 4R8PA 3R45A 5BNVB 4E45A 2RVQC 3AYWD 2HIOC 3NQJA 4JJND 4UUZB 5B24D 4WU9B 3LELC 1P3BC 5BNVA 4KUDB 3B6FB 5GT0C 5B0YB 3AZLB 2BG1A 3AZJC 3X1TA 4UUZA 5B31G 3VH5T 3LZ0A 4WU9A 5CPKB 4KUDA 3W97A 5B0YA 5GSUC 3RELC 3VH5A 4Z66B 5CPKA 4J8WB 3B0CW 3MGQB 2BYKA 5CP6D 5B1MC 2HIOB 5DNND 1P3PB 4XZQC 4J8WA 3MGQA 1P3BB 2JCHA 1KX5B 5GT0B 1P3PA 3AZJB 3A1IA 3B0CT 3AV1D 1BFMA 1KX5A 5GT0A 3H0RC 1EQZC 3UTBC 3AZMA 5AV5C 3KUYD 5GSUB 2JE5A 3RELB 5JRGC 3AZFC 1P3AD 3AYWA 5B1MB 4XZQB 5E5AD 1M1AD 3X1VD 1P3MC 4CAYB 1BH8B 5B2JC 5DNMB 3KSYA 1BH9B 1EQZB 4CAYA 3UTBB 4DRBA 5DNMA 5AV5B 2YFWB 5JRGB 4XUJC 3AZFB 1P3FD 2NZDC 3A6NC 3P5JB 1P34D 3AZID 5BNXB 2YFWA 3O62D 3MNNC 2CWEA 1PZRA 1P3MB 2NQBD 5BNXA 3AV1A 2F8NB 5F99B 3REHC 5AV9A 5B0ZC 4Z2MG 2IO5C 4XUJB 5F99A 2Y2OA 2PYOD 5G49A 1F1EA 5E5AA 5AV8B 4H9PA 5BS7C 1TZYC 3MNNB 1M19D 5B33C 5AV8A 1KU5A 1P3LB 4KGCD 4H9SC 3REHB 1TAFA 5B0ZB 3AZKC 5JA4B 1Q9CA 2IO5B 3REKC 3AZEA 1P3LA 1P34A 5GT3B 3W99C 4YM6D 3KWQD 5JA4A 3MGRD 4J8XC 1P3KC 3AN2C 3H0LC 3TU4A 3O62A 5GT3A 1JFIB 1TZYB 4X23D 5AVCD 1HQ3B 1P3OC 1W2EA 5B1LC 4NE6A 1HQ3A 2XD5A 3AZKB 2CV5D 4ZUXD 3REJC 2FFFB 5B2ID 3REKB 2F8NG 3B6GA 2PYOA 3WKJC 4H9NB 4Z5TD 3W99B 3UT9D 5AV6D 3WAAC 5B32C 4J8XB 4R8PC 1P3KB 3AN2B 4H9NA 1M18D 3EPHA 4H9RB 3KFUG 5GXQB 2Y2NA 2AROD 5B1LB 1KX3D 4KGCA 4LD9D 1AOIA 4H9RA 5GXQA 5B40D 3X1TC 3EPLA 3LZ0C 3VH6W 3C1BD 4WU9C 3WA9D 3WKJB 4KUDC 5CPJD 1KX4D 3REIB 3W97C 5AY8D 4H9OA 5CPKC 5B32B 4R8PB 3REIA 5CHLB 3NQJB 4X23A 3F6TA 3VH6T 3KXBD 1B6WA 3EPKA 3AV2D 4J8WC 3VH5W 3MGQC 3B6FD 2Y2PA 1T3UA 1P3PC 1F66D 2CV5A 3VH6A 3X1TB 3LZ1D 3LZ0B 5B2IA 1KX5C 3W97B 3AZMC 3NQUB 5AV6A 4Z66D 3AZGA 3MVDD 3AYWC 1M18A 4J8UA 2RVQD 2BYKB 2HIOD 3EG5B 1U35D 3WTPA 4J8VD 3NQUA 3LELD 1P3BD 3AZJD 2XD1A 1KX4A 4HGAB 3AZMB 5GSUD 2DF4C 5DNMC 2RIQA 1N1JA 3AYWB 1WWIA 2F2AC 1Z2CB 2F8NK 3H0MC 5B32G 3EPJA 2ZY3A 4JJNA 3X1UD 5B24A 3LZ1A 3AV1C 2Y2QA 3X1SD 1EQZD 3UTBD 5AV9C 5AV5D 5JRGD 3MVDA 4YS3D 4WU8D 5F99C 1U35A 3AZHD 5AVBD 4J8VA 5E5AC 5CP6A 5DNNA 5B2JD 2F8ND 3MGPD 3AV1B 5AV8C 5AV9B 3KUYB 1P3AB 1P3FC 2NZDD 2Y2HA 3AZEC 1P3LC 3A6ND 1P34C 5BO0A 3KUYA 4WZSB 4QLCD 1P3AA 5G49B 2Y2LA 5E5AB 3TU4C 4G91C 3O62C 2FJ7D 2F8NH 4H9PB 5GT3C 3MNND 1M1AA 3X1SA 3X1VA 5B0ZD 3AFAD 1HQ3C 1TAFB 3UTAD 1P3FB 5BT1C 4WU8A 3B6GC 3AZHA 3AZEB 2PYOC 1B67A 1P34B 3AZIB 5C3IC 1P3FA 1ID3D 1ZLAD 3TU4B 4G91B 3O62B 3MGSD 2LY8A 3AZIA 3MGPA 1P3ID 1A7WA 5B33D 4KGCC 1S32D 5B31D 3LJAD 1AOIC 2NQBA 5GXQC 5KDMA 1ULYA 4KHAA 3B6GB 3W98D 2PYOB 3W99D 4QLCA 1P3GD 1HTAA 5C3IB 4J8XD 3AN2D 2FJ7A 3REIC 3WTPE 3B0BA 4X23C 3C1CD 1P3OD 5B1LD 4H9QB 4CSRA 4KGCB 4ZBJB 3AZND 1AOIB 1M19A 3UTAA 5CPID 2CV5C 4H9QA 5B2IC 3REJD 2DQNC 3KWQB 2Y2KA 5AV6C 4H9OB 3MGRB 1ID3A 3AZGC 1ZLAA 3WAAD 4R8PD 1M18C 3W96D 4J8UC 3MGSA 3KWQA 4YM6A 3V9RA 3WTPC 4X23B 3MGRA 4M6BA 1S32A 5B31A 3LJAA 5AVCA 3X1TD 3LZ0D 4WU9D 2CV5B 3A1KA 4E44A 5B2IB 3W98A 1KX4C 4KUDD 4DQYB 5B0YD 3AZLD 1P3GA 3UT9B 5AV6B 4ZUXA 5CPKD 3AZGB 4HGAC 1M18B 2ZY4A 4J8UB 3AL0C 2G5IC 4Z5TA 3C1CA 3WTPB 3UT9A 3B0DC 3IP4C 3AV2C 2AROB 4J8WD 4LD9B 4DRAA 3MGQD 3AZNA 5CPIA 1P3PD 4JJNC 3LZ1C 5B24C 3C1BB 2AROA 1KX3A 4LD9A 2Y2IA 5CPJB 1KX4B 1KX5D 5GT0D 5B40A 5AY8B 3C1BA 3MVDC 3W96A 3WA9A 5CPJA 1N1JB 1U35C 2JSSA 5AY8A 4J8VC 4G92C 3KXBB 3RELD 3B0DB 3AV2B 2UWXA 3FDDA 5CP6C 4AWLC 5B1MD 5DNNC 4NE3A 3KXBA 2Y2GA 1F66B 4JJNB 3LZ1B 5B24B 4Z2MH 4XZQD 3AV2A 3B6FA 2HUEC 3AZLA 1F66A 4UPKA 5DNMD 3MVDB 1U35B 2ZY2A 4J8VB 3KUYC 4G92B 1P3AC 4Z66A 3AZFD 3LELB 4WJ3C 4EO5C 5CP6B 2HIOA 4AWLB 5DNNB 3X1UC 5FUGB 3LELA 1P3BA 1M1AC 3X1SC 3X1VC 2HUEB 5AV9D 3AZJA 1P3MD 5FUGA 4YS3C 4WU8C 5F99D 3AZHC 5AVBC 5GSUA 4WNNB 3RELA 5BO0B 4WV4B 1WWSA 4XUJD 5B1MA 4EO5B 4WNNA 2L5AA 3AZIC 3X1UB 3MGPC 4XZQA 2ZM5A 5AV8D 1M1AB 2YFVB 3X1SB 3X1VB 2NQBC 1BH8A 3X1UA 4YS3B 4WU8B 3AZED 1P3LD 2YFVA 1BH9A 1EQZA 3AZHB 3UTBA 5AVBB 3REHD 5AV5A 4QLCC 5JRGA 3AZFA 2ZY5A 4YS3A 2FJ7C 3TU4D 5AVBA 5GT3D 5B2JB 3MGPB 1P3MA 3AFAC 1TZYD 1M19C 2NQBB 5B2JA 1R4VA 1HQ3D 3UTAC 2F8NA 5KDMB 5BT1D 2NZDB 3B6GD 3A6NB 4KHAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZBJ C;  4QLC B;  3AZK D;  4XUJ A;  2NZD A;  1ID3 C;  1ZLA C;  3REK D;  3A6N A;  2FJ7 B;  3MGS C;  3KWQ C;  4YM6 C;  1P3I C;  3MGR C;  1P3K D;  1S32 C;  5B31 C;  3LJA C;  4CSR B;  3MNN A;  1AOI D;  5GXQ D;  3AFA B;  5AVC C;  1M19 B;  3UTA B;  3W98 C;  3REH A;  5B0Z A;  1P3G C;  3AFA A;  4ZUX C;  1ID3 B;  3WKJ D;  1ZLA B;  3REI D;  3MGS B;  4Z5T C;  3C1C C;  4YM6 B;  3V9R B;  1P3I B;  3UT9 C;  4NFT A;  5B32 D;  5B33 B;  4NE5 A;  1S32 B;  5BS7 A;  1TZY A;  5B31 B;  3LJA B;  1H3O B;  5CPI C;  3AZN C;  1P3I A;  1JFI A;  5AVC B;  5B33 A;  2ARO C;  1KX3 C;  4LD9 C;  3W98 B;  1H3O A;  4H9S A;  5B40 C;  1P3G B;  3AZK A;  3C1B C;  3REK A;  3AZG D;  3WA9 C;  3W96 C;  4ZUX B;  5CPJ C;  4J8U D;  3W97 D;  5AY8 C;  3W99 A;  3WTP D;  4Z5T B;  3C1C B;  1P3O B;  4J8X A;  1P3K A;  3AN2 A;  3AZN B;  3KXB C;  2BYM B;  5CPI B;  1P3O A;  5B1L A;  3REJ B;  3B6F C;  1KX3 B;  5B0Y C;  3AZL C;  1F66 C;  2BYM A;  5B40 B;  3REJ A;  3WKJ A;  3WAA B;  3WA9 B;  3W96 B;  3R45 B;  3AZM D;  4Z66 C;  5B32 A;  3WAA A;  4R8P A;  3R45 A;  5BNV B;  4E45 A;  2RVQ C;  3AYW D;  2HIO C;  3NQJ A;  4JJN D;  4UUZ B;  5B24 D;  4WU9 B;  3LEL C;  1P3B C;  5BNV A;  4KUD B;  3B6F B;  5GT0 C;  5B0Y B;  3AZL B;  3AZJ C;  3X1T A;  4UUZ A;  5B31 G;  3VH5 T;  3LZ0 A;  4WU9 A;  5CPK B;  4KUD A;  3W97 A;  5B0Y A;  5GSU C;  3REL C;  3VH5 A;  4Z66 B;  5CPK A;  4J8W B;  3B0C W;  3MGQ B;  2BYK A;  5CP6 D;  5B1M C;  2HIO B;  5DNN D;  1P3P B;  4XZQ C;  4J8W A;  3MGQ A;  1P3B B;  1KX5 B;  5GT0 B;  1P3P A;  3AZJ B;  3B0C T;  3AV1 D;  1BFM A;  1KX5 A;  5GT0 A;  1EQZ C;  3UTB C;  3AZM A;  5AV5 C;  3KUY D;  5GSU B;  3REL B;  5JRG C;  3AZF C;  1P3A D;  3AYW A;  5B1M B;  4XZQ B;  5E5A D;  1M1A D;  3X1V D;  1P3M C;  4CAY B;  1BH8 B;  5B2J C;  5DNM B;  3KSY A;  1BH9 B;  1EQZ B;  4CAY A;  3UTB B;  4DRB A;  5DNM A;  5AV5 B;  2YFW B;  5JRG B;  4XUJ C;  3AZF B;  1P3F D;  2NZD C;  3A6N C;  1P34 D;  3AZI D;  5BNX B;  2YFW A;  3O62 D;  3MNN C;  2CWE A;  2NQB D;  1P3M B;  5BNX A;  3AV1 A;  2F8N B;  5F99 B;  3REH C;  5AV9 A;  5B0Z C;  4Z2M G;  2IO5 C;  4XUJ B;  5F99 A;  2PYO D;  5G49 A;  1F1E A;  5E5A A;  5AV8 B;  4H9P A;  5BS7 C;  1TZY C;  3MNN B;  1M19 D;  5B33 C;  5AV8 A;  1KU5 A;  1P3L B;  4KGC D;  4H9S C;  3REH B;  1TAF A;  5B0Z B;  3AZK C;  5JA4 B;  1Q9C A;  2IO5 B;  3REK C;  3AZE A;  1P3L A;  1P34 A;  5GT3 B;  3W99 C;  4YM6 D;  3KWQ D;  5JA4 A;  3MGR D;  4J8X C;  1P3K C;  3AN2 C;  3TU4 A;  3O62 A;  5GT3 A;  1JFI B;  1TZY B;  4X23 D;  5AVC D;  1HQ3 B;  1P3O C;  5B1L C;  4NE6 A;  1HQ3 A;  3AZK B;  2CV5 D;  4ZUX D;  3REJ C;  3REK B;  5B2I D;  2F8N G;  3B6G A;  3WKJ C;  2PYO A;  4H9N B;  4Z5T D;  3W99 B;  3UT9 D;  5AV6 D;  3WAA C;  5B32 C;  4J8X B;  4R8P C;  1P3K B;  3AN2 B;  4H9N A;  1M18 D;  4H9R B;  5GXQ B;  2ARO D;  5B1L B;  1KX3 D;  4KGC A;  4LD9 D;  1AOI A;  4H9R A;  5GXQ A;  5B40 D;  3X1T C;  3LZ0 C;  3VH6 W;  3C1B D;  4WU9 C;  3WA9 D;  3WKJ B;  4KUD C;  5CPJ D;  1KX4 D;  3REI B;  3W97 C;  5AY8 D;  4H9O A;  5CPK C;  5B32 B;  4R8P B;  3REI A;  5CHL B;  3NQJ B;  4X23 A;  3VH6 T;  3KXB D;  1B6W A;  3AV2 D;  4J8W C;  3VH5 W;  3MGQ C;  3B6F D;  1F66 D;  1P3P C;  2CV5 A;  3VH6 A;  3X1T B;  3LZ1 D;  3LZ0 B;  5B2I A;  1KX5 C;  3W97 B;  3AZM C;  3NQU B;  5AV6 A;  4Z66 D;  3AZG A;  3MVD D;  3AYW C;  1M18 A;  4J8U A;  2RVQ D;  2BYK B;  2HIO D;  1U35 D;  3WTP A;  4J8V D;  3NQU A;  3LEL D;  1P3B D;  3AZJ D;  1KX4 A;  4HGA B;  3AZM B;  5GSU D;  5DNM C;  1N1J A;  3AYW B;  1WWI A;  2F8N K;  5B32 G;  4JJN A;  3X1U D;  5B24 A;  3LZ1 A;  3AV1 C;  3X1S D;  1EQZ D;  3UTB D;  5AV9 C;  5AV5 D;  5JRG D;  3MVD A;  4YS3 D;  4WU8 D;  5F99 C;  1U35 A;  3AZH D;  5AVB D;  4J8V A;  5E5A C;  5CP6 A;  5DNN A;  5B2J D;  2F8N D;  3MGP D;  3AV1 B;  5AV8 C;  5AV9 B;  3KUY B;  1P3A B;  1P3F C;  2NZD D;  3AZE C;  1P3L C;  3A6N D;  1P34 C;  5BO0 A;  3KUY A;  4WZS B;  4QLC D;  1P3A A;  5G49 B;  5E5A B;  3TU4 C;  4G91 C;  3O62 C;  2FJ7 D;  2F8N H;  4H9P B;  5GT3 C;  3MNN D;  1M1A A;  3X1S A;  3X1V A;  5B0Z D;  3AFA D;  1HQ3 C;  1TAF B;  3UTA D;  1P3F B;  5BT1 C;  4WU8 A;  3B6G C;  3AZH A;  3AZE B;  2PYO C;  1B67 A;  1P34 B;  3AZI B;  5C3I C;  1P3F A;  1ID3 D;  1ZLA D;  3TU4 B;  4G91 B;  3O62 B;  3MGS D;  2LY8 A;  3AZI A;  3MGP A;  1P3I D;  1A7W A;  5B33 D;  4KGC C;  1S32 D;  5B31 D;  3LJA D;  1AOI C;  2NQB A;  5GXQ C;  5KDM A;  1ULY A;  4KHA A;  3B6G B;  3W98 D;  2PYO B;  3W99 D;  4QLC A;  1P3G D;  1HTA A;  5C3I B;  4J8X D;  3AN2 D;  2FJ7 A;  3REI C;  3WTP E;  3B0B A;  4X23 C;  3C1C D;  1P3O D;  5B1L D;  4H9Q B;  4CSR A;  4KGC B;  4ZBJ B;  3AZN D;  1AOI B;  1M19 A;  3UTA A;  5CPI D;  2CV5 C;  4H9Q A;  5B2I C;  3REJ D;  3KWQ B;  5AV6 C;  4H9O B;  3MGR B;  1ID3 A;  3AZG C;  1ZLA A;  3WAA D;  4R8P D;  1M18 C;  3W96 D;  4J8U C;  3MGS A;  3KWQ A;  4YM6 A;  3V9R A;  3WTP C;  4X23 B;  3MGR A;  4M6B A;  1S32 A;  5B31 A;  3LJA A;  5AVC A;  3X1T D;  3LZ0 D;  4WU9 D;  2CV5 B;  4E44 A;  5B2I B;  3W98 A;  1KX4 C;  4KUD D;  5B0Y D;  3AZL D;  1P3G A;  3UT9 B;  5AV6 B;  4ZUX A;  5CPK D;  3AZG B;  4HGA C;  1M18 B;  4J8U B;  4Z5T A;  3C1C A;  3WTP B;  3UT9 A;  3B0D C;  3AV2 C;  2ARO B;  4J8W D;  4LD9 B;  4DRA A;  3MGQ D;  3AZN A;  5CPI A;  1P3P D;  4JJN C;  3LZ1 C;  5B24 C;  3C1B B;  2ARO A;  1KX3 A;  4LD9 A;  5CPJ B;  1KX4 B;  1KX5 D;  5GT0 D;  5B40 A;  5AY8 B;  3C1B A;  3MVD C;  3W96 A;  3WA9 A;  5CPJ A;  1N1J B;  1U35 C;  2JSS A;  5AY8 A;  4J8V C;  4G92 C;  3KXB B;  3REL D;  3B0D B;  3AV2 B;  5CP6 C;  4AWL C;  5B1M D;  5DNN C;  4NE3 A;  3KXB A;  1F66 B;  4JJN B;  3LZ1 B;  5B24 B;  4Z2M H;  4XZQ D;  3AV2 A;  3B6F A;  2HUE C;  3AZL A;  1F66 A;  5DNM D;  3MVD B;  1U35 B;  4J8V B;  3KUY C;  4G92 B;  1P3A C;  4Z66 A;  3AZF D;  3LEL B;  4EO5 C;  5CP6 B;  2HIO A;  4AWL B;  5DNN B;  3X1U C;  5FUG B;  3LEL A;  1P3B A;  1M1A C;  3X1S C;  3X1V C;  2HUE B;  5AV9 D;  3AZJ A;  1P3M D;  5FUG A;  4YS3 C;  4WU8 C;  5F99 D;  3AZH C;  5AVB C;  5GSU A;  4WNN B;  3REL A;  5BO0 B;  4WV4 B;  1WWS A;  4XUJ D;  5B1M A;  4EO5 B;  4WNN A;  2L5A A;  3AZI C;  3X1U B;  3MGP C;  4XZQ A;  5AV8 D;  1M1A B;  2YFV B;  3X1S B;  3X1V B;  2NQB C;  1BH8 A;  3X1U A;  4YS3 B;  4WU8 B;  3AZE D;  1P3L D;  2YFV A;  1BH9 A;  1EQZ A;  3AZH B;  3UTB A;  5AVB B;  3REH D;  5AV5 A;  4QLC C;  5JRG A;  3AZF A;  4YS3 A;  2FJ7 C;  3TU4 D;  5AVB A;  5GT3 D;  5B2J B;  3MGP B;  1P3M A;  3AFA C;  1TZY D;  1M19 C;  2NQB B;  5B2J A;  1R4V A;  1HQ3 D;  3UTA C;  2F8N A;  5KDM B;  5BT1 D;  2NZD B;  3B6G D;  3A6N B;  4KHA B; 
#chains in the Genus database with same CATH topology
 4ZBJ C;  4QLC B;  3AZK D;  4XUJ A;  2NZD A;  1ID3 C;  1ZLA C;  3REK D;  3A6N A;  2FJ7 B;  3MGS C;  3KWQ C;  2Y2J A;  4YM6 C;  1P3I C;  2G5H C;  3MGR C;  1P3K D;  1S32 C;  5B31 C;  3LJA C;  4CSR B;  3MNN A;  1AOI D;  5GXQ D;  3AFA B;  5AVC C;  1M19 B;  3UTA B;  3W98 C;  3REH A;  5B0Z A;  1P3G C;  3AFA A;  4ZUX C;  1ID3 B;  3WKJ D;  1ZLA B;  3REI D;  3MGS B;  4Z5T C;  3C1C C;  2VQR A;  3V9R B;  4YM6 B;  3UT9 C;  1P3I B;  4NFT A;  5B32 D;  5B33 B;  4NE5 A;  1S32 B;  5BS7 A;  1TZY A;  5B31 B;  3LJA B;  1H3O B;  5CPI C;  3AZN C;  1P3I A;  1JFI A;  2J8P A;  5AVC B;  5B33 A;  2ARO C;  1KX3 C;  4LD9 C;  3W98 B;  1H3O A;  4H9S A;  5B40 C;  1P3G B;  3AZK A;  3C1B C;  3REK A;  3AZG D;  3WA9 C;  3W96 C;  4ZUX B;  5CPJ C;  4J8U D;  3W97 D;  5AY8 C;  3W99 A;  3WTP D;  4Z5T B;  3C1C B;  1P3O B;  4J8X A;  1P3K A;  3AN2 A;  2Y2M A;  3AZN B;  3KXB C;  2BYM B;  5CPI B;  1P3O A;  5B1L A;  3REJ B;  3B6F C;  1KX3 B;  5B0Y C;  3AZL C;  1F66 C;  2BYM A;  5B40 B;  3REJ A;  3WKJ A;  3WAA B;  3WA9 B;  3W96 B;  3R45 B;  3AZM D;  2W8S A;  4Z66 C;  5B32 A;  3WAA A;  4R8P A;  3R45 A;  5BNV B;  4E45 A;  2RVQ C;  3AYW D;  2HIO C;  3NQJ A;  4JJN D;  4UUZ B;  5B24 D;  4WU9 B;  3LEL C;  1P3B C;  5BNV A;  4KUD B;  3B6F B;  5GT0 C;  5B0Y B;  3AZL B;  2BG1 A;  3AZJ C;  3X1T A;  4UUZ A;  5B31 G;  3VH5 T;  3LZ0 A;  4WU9 A;  5CPK B;  4KUD A;  3W97 A;  5B0Y A;  5GSU C;  3REL C;  3VH5 A;  4Z66 B;  5CPK A;  4J8W B;  3B0C W;  3MGQ B;  2BYK A;  5CP6 D;  5B1M C;  2HIO B;  5DNN D;  1P3P B;  4XZQ C;  4J8W A;  3MGQ A;  1P3B B;  2JCH A;  1KX5 B;  5GT0 B;  1P3P A;  3AZJ B;  3A1I A;  3B0C T;  3AV1 D;  1BFM A;  1KX5 A;  5GT0 A;  3H0R C;  1EQZ C;  3UTB C;  3AZM A;  5AV5 C;  3KUY D;  5GSU B;  2JE5 A;  3REL B;  5JRG C;  3AZF C;  1P3A D;  3AYW A;  5B1M B;  4XZQ B;  5E5A D;  1M1A D;  3X1V D;  1P3M C;  4CAY B;  1BH8 B;  5B2J C;  5DNM B;  3KSY A;  1BH9 B;  1EQZ B;  4CAY A;  3UTB B;  4DRB A;  5DNM A;  5AV5 B;  2YFW B;  5JRG B;  4XUJ C;  3AZF B;  1P3F D;  2NZD C;  3A6N C;  3P5J B;  1P34 D;  3AZI D;  5BNX B;  2YFW A;  3O62 D;  3MNN C;  2CWE A;  1PZR A;  1P3M B;  2NQB D;  5BNX A;  3AV1 A;  2F8N B;  5F99 B;  3REH C;  5AV9 A;  5B0Z C;  4Z2M G;  2IO5 C;  4XUJ B;  5F99 A;  2Y2O A;  2PYO D;  5G49 A;  1F1E A;  5E5A A;  5AV8 B;  4H9P A;  5BS7 C;  1TZY C;  3MNN B;  1M19 D;  5B33 C;  5AV8 A;  1KU5 A;  1P3L B;  4KGC D;  4H9S C;  3REH B;  1TAF A;  5B0Z B;  3AZK C;  5JA4 B;  1Q9C A;  2IO5 B;  3REK C;  3AZE A;  1P3L A;  1P34 A;  5GT3 B;  3W99 C;  4YM6 D;  3KWQ D;  5JA4 A;  3MGR D;  4J8X C;  1P3K C;  3AN2 C;  3H0L C;  3TU4 A;  3O62 A;  5GT3 A;  1JFI B;  1TZY B;  4X23 D;  5AVC D;  1HQ3 B;  1P3O C;  1W2E A;  5B1L C;  4NE6 A;  1HQ3 A;  2XD5 A;  3AZK B;  2CV5 D;  4ZUX D;  3REJ C;  2FFF B;  5B2I D;  3REK B;  2F8N G;  3B6G A;  2PYO A;  3WKJ C;  4H9N B;  4Z5T D;  3W99 B;  3UT9 D;  5AV6 D;  3WAA C;  5B32 C;  4J8X B;  4R8P C;  1P3K B;  3AN2 B;  4H9N A;  1M18 D;  3EPH A;  4H9R B;  3KFU G;  5GXQ B;  2Y2N A;  2ARO D;  5B1L B;  1KX3 D;  4KGC A;  4LD9 D;  1AOI A;  4H9R A;  5GXQ A;  5B40 D;  3X1T C;  3EPL A;  3LZ0 C;  3VH6 W;  3C1B D;  4WU9 C;  3WA9 D;  3WKJ B;  4KUD C;  5CPJ D;  1KX4 D;  3REI B;  3W97 C;  5AY8 D;  4H9O A;  5CPK C;  5B32 B;  4R8P B;  3REI A;  5CHL B;  3NQJ B;  4X23 A;  3F6T A;  3VH6 T;  3KXB D;  1B6W A;  3EPK A;  3AV2 D;  4J8W C;  3VH5 W;  3MGQ C;  3B6F D;  2Y2P A;  1T3U A;  1P3P C;  1F66 D;  2CV5 A;  3VH6 A;  3X1T B;  3LZ1 D;  3LZ0 B;  5B2I A;  1KX5 C;  3W97 B;  3AZM C;  3NQU B;  5AV6 A;  4Z66 D;  3AZG A;  3MVD D;  3AYW C;  1M18 A;  4J8U A;  2RVQ D;  2BYK B;  2HIO D;  3EG5 B;  1U35 D;  3WTP A;  4J8V D;  3NQU A;  3LEL D;  1P3B D;  3AZJ D;  2XD1 A;  1KX4 A;  4HGA B;  3AZM B;  5GSU D;  2DF4 C;  5DNM C;  2RIQ A;  1N1J A;  3AYW B;  1WWI A;  2F2A C;  1Z2C B;  2F8N K;  3H0M C;  5B32 G;  3EPJ A;  2ZY3 A;  4JJN A;  3X1U D;  5B24 A;  3LZ1 A;  3AV1 C;  2Y2Q A;  3X1S D;  1EQZ D;  3UTB D;  5AV9 C;  5AV5 D;  5JRG D;  3MVD A;  4YS3 D;  4WU8 D;  5F99 C;  1U35 A;  3AZH D;  5AVB D;  4J8V A;  5E5A C;  5CP6 A;  5DNN A;  5B2J D;  2F8N D;  3MGP D;  3AV1 B;  5AV8 C;  5AV9 B;  3KUY B;  1P3A B;  1P3F C;  2NZD D;  2Y2H A;  3AZE C;  1P3L C;  3A6N D;  1P34 C;  5BO0 A;  3KUY A;  4WZS B;  4QLC D;  1P3A A;  5G49 B;  2Y2L A;  5E5A B;  3TU4 C;  4G91 C;  3O62 C;  2FJ7 D;  2F8N H;  4H9P B;  5GT3 C;  3MNN D;  1M1A A;  3X1S A;  3X1V A;  5B0Z D;  3AFA D;  1HQ3 C;  1TAF B;  3UTA D;  1P3F B;  5BT1 C;  4WU8 A;  3B6G C;  3AZH A;  3AZE B;  2PYO C;  1B67 A;  1P34 B;  3AZI B;  5C3I C;  1P3F A;  1ID3 D;  1ZLA D;  3TU4 B;  4G91 B;  3O62 B;  3MGS D;  2LY8 A;  3AZI A;  3MGP A;  1P3I D;  1A7W A;  5B33 D;  4KGC C;  1S32 D;  5B31 D;  3LJA D;  1AOI C;  2NQB A;  5GXQ C;  5KDM A;  1ULY A;  4KHA A;  3B6G B;  3W98 D;  2PYO B;  3W99 D;  4QLC A;  1P3G D;  1HTA A;  5C3I B;  4J8X D;  3AN2 D;  2FJ7 A;  3REI C;  3WTP E;  3B0B A;  4X23 C;  3C1C D;  1P3O D;  5B1L D;  4H9Q B;  4CSR A;  4KGC B;  4ZBJ B;  3AZN D;  1AOI B;  1M19 A;  3UTA A;  5CPI D;  2CV5 C;  4H9Q A;  5B2I C;  3REJ D;  2DQN C;  3KWQ B;  2Y2K A;  5AV6 C;  4H9O B;  3MGR B;  1ID3 A;  3AZG C;  1ZLA A;  3WAA D;  4R8P D;  1M18 C;  3W96 D;  4J8U C;  3MGS A;  3KWQ A;  4YM6 A;  3V9R A;  3WTP C;  4X23 B;  3MGR A;  4M6B A;  1S32 A;  5B31 A;  3LJA A;  5AVC A;  3X1T D;  3LZ0 D;  4WU9 D;  2CV5 B;  3A1K A;  4E44 A;  5B2I B;  3W98 A;  1KX4 C;  4KUD D;  4DQY B;  5B0Y D;  3AZL D;  1P3G A;  3UT9 B;  5AV6 B;  4ZUX A;  5CPK D;  3AZG B;  4HGA C;  1M18 B;  2ZY4 A;  4J8U B;  3AL0 C;  2G5I C;  4Z5T A;  3C1C A;  3WTP B;  3UT9 A;  3B0D C;  3IP4 C;  3AV2 C;  2ARO B;  4J8W D;  4LD9 B;  4DRA A;  3MGQ D;  3AZN A;  5CPI A;  1P3P D;  4JJN C;  3LZ1 C;  5B24 C;  3C1B B;  2ARO A;  1KX3 A;  4LD9 A;  2Y2I A;  5CPJ B;  1KX4 B;  1KX5 D;  5GT0 D;  5B40 A;  5AY8 B;  3C1B A;  3MVD C;  3W96 A;  3WA9 A;  5CPJ A;  1N1J B;  1U35 C;  2JSS A;  5AY8 A;  4J8V C;  4G92 C;  3KXB B;  3REL D;  3B0D B;  3AV2 B;  2UWX A;  3FDD A;  5CP6 C;  4AWL C;  5B1M D;  5DNN C;  4NE3 A;  3KXB A;  2Y2G A;  1F66 B;  4JJN B;  3LZ1 B;  5B24 B;  4Z2M H;  4XZQ D;  3AV2 A;  3B6F A;  2HUE C;  3AZL A;  1F66 A;  4UPK A;  5DNM D;  3MVD B;  1U35 B;  2ZY2 A;  4J8V B;  3KUY C;  4G92 B;  1P3A C;  4Z66 A;  3AZF D;  3LEL B;  4WJ3 C;  4EO5 C;  5CP6 B;  2HIO A;  4AWL B;  5DNN B;  3X1U C;  5FUG B;  3LEL A;  1P3B A;  1M1A C;  3X1S C;  3X1V C;  2HUE B;  5AV9 D;  3AZJ A;  1P3M D;  5FUG A;  4YS3 C;  4WU8 C;  5F99 D;  3AZH C;  5AVB C;  5GSU A;  4WNN B;  3REL A;  5BO0 B;  4WV4 B;  1WWS A;  4XUJ D;  5B1M A;  4EO5 B;  4WNN A;  2L5A A;  3AZI C;  3X1U B;  3MGP C;  4XZQ A;  2ZM5 A;  5AV8 D;  1M1A B;  2YFV B;  3X1S B;  3X1V B;  2NQB C;  1BH8 A;  3X1U A;  4YS3 B;  4WU8 B;  3AZE D;  1P3L D;  2YFV A;  1BH9 A;  1EQZ A;  3AZH B;  3UTB A;  5AVB B;  3REH D;  5AV5 A;  4QLC C;  5JRG A;  3AZF A;  2ZY5 A;  4YS3 A;  2FJ7 C;  3TU4 D;  5AVB A;  5GT3 D;  5B2J B;  3MGP B;  1P3M A;  3AFA C;  1TZY D;  1M19 C;  2NQB B;  5B2J A;  1R4V A;  1HQ3 D;  3UTA C;  2F8N A;  5KDM B;  5BT1 D;  2NZD B;  3B6G D;  3A6N B;  4KHA B; 
#chains in the Genus database with same CATH homology
 4ZBJ C;  4QLC B;  3AZK D;  4XUJ A;  2NZD A;  1ID3 C;  1ZLA C;  3REK D;  3A6N A;  2FJ7 B;  3MGS C;  3KWQ C;  2Y2J A;  4YM6 C;  1P3I C;  2G5H C;  3MGR C;  1P3K D;  1S32 C;  5B31 C;  3LJA C;  4CSR B;  3MNN A;  1AOI D;  5GXQ D;  3AFA B;  5AVC C;  1M19 B;  3UTA B;  3W98 C;  3REH A;  5B0Z A;  1P3G C;  3AFA A;  4ZUX C;  1ID3 B;  3WKJ D;  1ZLA B;  3REI D;  3MGS B;  4Z5T C;  3C1C C;  2VQR A;  3V9R B;  4YM6 B;  3UT9 C;  1P3I B;  4NFT A;  5B32 D;  5B33 B;  4NE5 A;  1S32 B;  5BS7 A;  1TZY A;  5B31 B;  3LJA B;  1H3O B;  5CPI C;  3AZN C;  1P3I A;  1JFI A;  2J8P A;  5AVC B;  5B33 A;  2ARO C;  1KX3 C;  4LD9 C;  3W98 B;  1H3O A;  4H9S A;  5B40 C;  1P3G B;  3AZK A;  3C1B C;  3REK A;  3AZG D;  3WA9 C;  3W96 C;  4ZUX B;  5CPJ C;  4J8U D;  3W97 D;  5AY8 C;  3W99 A;  3WTP D;  4Z5T B;  3C1C B;  1P3O B;  4J8X A;  1P3K A;  3AN2 A;  2Y2M A;  3AZN B;  3KXB C;  2BYM B;  5CPI B;  1P3O A;  5B1L A;  3REJ B;  3B6F C;  1KX3 B;  5B0Y C;  3AZL C;  1F66 C;  2BYM A;  5B40 B;  3REJ A;  3WKJ A;  3WAA B;  3WA9 B;  3W96 B;  3R45 B;  3AZM D;  2W8S A;  4Z66 C;  5B32 A;  3WAA A;  4R8P A;  3R45 A;  5BNV B;  4E45 A;  2RVQ C;  3AYW D;  2HIO C;  3NQJ A;  4JJN D;  4UUZ B;  5B24 D;  4WU9 B;  3LEL C;  1P3B C;  5BNV A;  4KUD B;  3B6F B;  5GT0 C;  5B0Y B;  3AZL B;  2BG1 A;  3AZJ C;  3X1T A;  4UUZ A;  5B31 G;  3VH5 T;  3LZ0 A;  4WU9 A;  5CPK B;  4KUD A;  3W97 A;  5B0Y A;  5GSU C;  3REL C;  3VH5 A;  4Z66 B;  5CPK A;  4J8W B;  3B0C W;  3MGQ B;  2BYK A;  5CP6 D;  5B1M C;  2HIO B;  5DNN D;  1P3P B;  4XZQ C;  4J8W A;  3MGQ A;  1P3B B;  2JCH A;  1KX5 B;  5GT0 B;  1P3P A;  3AZJ B;  3A1I A;  3B0C T;  3AV1 D;  1BFM A;  1KX5 A;  5GT0 A;  3H0R C;  1EQZ C;  3UTB C;  3AZM A;  5AV5 C;  3KUY D;  5GSU B;  2JE5 A;  3REL B;  5JRG C;  3AZF C;  1P3A D;  3AYW A;  5B1M B;  4XZQ B;  5E5A D;  1M1A D;  3X1V D;  1P3M C;  4CAY B;  1BH8 B;  5B2J C;  5DNM B;  3KSY A;  1BH9 B;  1EQZ B;  4CAY A;  3UTB B;  4DRB A;  5DNM A;  5AV5 B;  2YFW B;  5JRG B;  4XUJ C;  3AZF B;  1P3F D;  2NZD C;  3A6N C;  3P5J B;  1P34 D;  3AZI D;  5BNX B;  2YFW A;  3O62 D;  3MNN C;  2CWE A;  1PZR A;  1P3M B;  2NQB D;  5BNX A;  3AV1 A;  2F8N B;  5F99 B;  3REH C;  5AV9 A;  5B0Z C;  4Z2M G;  2IO5 C;  4XUJ B;  5F99 A;  2Y2O A;  2PYO D;  5G49 A;  1F1E A;  5E5A A;  5AV8 B;  4H9P A;  5BS7 C;  1TZY C;  3MNN B;  1M19 D;  5B33 C;  5AV8 A;  1KU5 A;  1P3L B;  4KGC D;  4H9S C;  3REH B;  1TAF A;  5B0Z B;  3AZK C;  5JA4 B;  1Q9C A;  2IO5 B;  3REK C;  3AZE A;  1P3L A;  1P34 A;  5GT3 B;  3W99 C;  4YM6 D;  3KWQ D;  5JA4 A;  3MGR D;  4J8X C;  1P3K C;  3AN2 C;  3H0L C;  3TU4 A;  3O62 A;  5GT3 A;  1JFI B;  1TZY B;  4X23 D;  5AVC D;  1HQ3 B;  1P3O C;  1W2E A;  5B1L C;  4NE6 A;  1HQ3 A;  2XD5 A;  3AZK B;  2CV5 D;  4ZUX D;  3REJ C;  2FFF B;  5B2I D;  3REK B;  2F8N G;  3B6G A;  2PYO A;  3WKJ C;  4H9N B;  4Z5T D;  3W99 B;  3UT9 D;  5AV6 D;  3WAA C;  5B32 C;  4J8X B;  4R8P C;  1P3K B;  3AN2 B;  4H9N A;  1M18 D;  3EPH A;  4H9R B;  3KFU G;  5GXQ B;  2Y2N A;  2ARO D;  5B1L B;  1KX3 D;  4KGC A;  4LD9 D;  1AOI A;  4H9R A;  5GXQ A;  5B40 D;  3X1T C;  3EPL A;  3LZ0 C;  3VH6 W;  3C1B D;  4WU9 C;  3WA9 D;  3WKJ B;  4KUD C;  5CPJ D;  1KX4 D;  3REI B;  3W97 C;  5AY8 D;  4H9O A;  5CPK C;  5B32 B;  4R8P B;  3REI A;  5CHL B;  3NQJ B;  4X23 A;  3F6T A;  3VH6 T;  3KXB D;  1B6W A;  3EPK A;  3AV2 D;  4J8W C;  3VH5 W;  3MGQ C;  3B6F D;  2Y2P A;  1T3U A;  1P3P C;  1F66 D;  2CV5 A;  3VH6 A;  3X1T B;  3LZ1 D;  3LZ0 B;  5B2I A;  1KX5 C;  3W97 B;  3AZM C;  3NQU B;  5AV6 A;  4Z66 D;  3AZG A;  3MVD D;  3AYW C;  1M18 A;  4J8U A;  2RVQ D;  2BYK B;  2HIO D;  3EG5 B;  1U35 D;  3WTP A;  4J8V D;  3NQU A;  3LEL D;  1P3B D;  3AZJ D;  2XD1 A;  1KX4 A;  4HGA B;  3AZM B;  5GSU D;  2DF4 C;  5DNM C;  2RIQ A;  1N1J A;  3AYW B;  1WWI A;  2F2A C;  1Z2C B;  2F8N K;  3H0M C;  5B32 G;  3EPJ A;  2ZY3 A;  4JJN A;  3X1U D;  5B24 A;  3LZ1 A;  3AV1 C;  2Y2Q A;  3X1S D;  1EQZ D;  3UTB D;  5AV9 C;  5AV5 D;  5JRG D;  3MVD A;  4YS3 D;  4WU8 D;  5F99 C;  1U35 A;  3AZH D;  5AVB D;  4J8V A;  5E5A C;  5CP6 A;  5DNN A;  5B2J D;  2F8N D;  3MGP D;  3AV1 B;  5AV8 C;  5AV9 B;  3KUY B;  1P3A B;  1P3F C;  2NZD D;  2Y2H A;  3AZE C;  1P3L C;  3A6N D;  1P34 C;  5BO0 A;  3KUY A;  4WZS B;  4QLC D;  1P3A A;  5G49 B;  2Y2L A;  5E5A B;  3TU4 C;  4G91 C;  3O62 C;  2FJ7 D;  2F8N H;  4H9P B;  5GT3 C;  3MNN D;  1M1A A;  3X1S A;  3X1V A;  5B0Z D;  3AFA D;  1HQ3 C;  1TAF B;  3UTA D;  1P3F B;  5BT1 C;  4WU8 A;  3B6G C;  3AZH A;  3AZE B;  2PYO C;  1B67 A;  1P34 B;  3AZI B;  5C3I C;  1P3F A;  1ID3 D;  1ZLA D;  3TU4 B;  4G91 B;  3O62 B;  3MGS D;  2LY8 A;  3AZI A;  3MGP A;  1P3I D;  1A7W A;  5B33 D;  4KGC C;  1S32 D;  5B31 D;  3LJA D;  1AOI C;  2NQB A;  5GXQ C;  5KDM A;  1ULY A;  4KHA A;  3B6G B;  3W98 D;  2PYO B;  3W99 D;  4QLC A;  1P3G D;  1HTA A;  5C3I B;  4J8X D;  3AN2 D;  2FJ7 A;  3REI C;  3WTP E;  3B0B A;  4X23 C;  3C1C D;  1P3O D;  5B1L D;  4H9Q B;  4CSR A;  4KGC B;  4ZBJ B;  3AZN D;  1AOI B;  1M19 A;  3UTA A;  5CPI D;  2CV5 C;  4H9Q A;  5B2I C;  3REJ D;  2DQN C;  3KWQ B;  2Y2K A;  5AV6 C;  4H9O B;  3MGR B;  1ID3 A;  3AZG C;  1ZLA A;  3WAA D;  4R8P D;  1M18 C;  3W96 D;  4J8U C;  3MGS A;  3KWQ A;  4YM6 A;  3V9R A;  3WTP C;  4X23 B;  3MGR A;  4M6B A;  1S32 A;  5B31 A;  3LJA A;  5AVC A;  3X1T D;  3LZ0 D;  4WU9 D;  2CV5 B;  3A1K A;  4E44 A;  5B2I B;  3W98 A;  1KX4 C;  4KUD D;  4DQY B;  5B0Y D;  3AZL D;  1P3G A;  3UT9 B;  5AV6 B;  4ZUX A;  5CPK D;  3AZG B;  4HGA C;  1M18 B;  2ZY4 A;  4J8U B;  3AL0 C;  2G5I C;  4Z5T A;  3C1C A;  3WTP B;  3UT9 A;  3B0D C;  3IP4 C;  3AV2 C;  2ARO B;  4J8W D;  4LD9 B;  4DRA A;  3MGQ D;  3AZN A;  5CPI A;  1P3P D;  4JJN C;  3LZ1 C;  5B24 C;  3C1B B;  2ARO A;  1KX3 A;  4LD9 A;  2Y2I A;  5CPJ B;  1KX4 B;  1KX5 D;  5GT0 D;  5B40 A;  5AY8 B;  3C1B A;  3MVD C;  3W96 A;  3WA9 A;  5CPJ A;  1N1J B;  1U35 C;  2JSS A;  5AY8 A;  4J8V C;  4G92 C;  3KXB B;  3REL D;  3B0D B;  3AV2 B;  2UWX A;  3FDD A;  5CP6 C;  4AWL C;  5B1M D;  5DNN C;  4NE3 A;  3KXB A;  2Y2G A;  1F66 B;  4JJN B;  3LZ1 B;  5B24 B;  4Z2M H;  4XZQ D;  3AV2 A;  3B6F A;  2HUE C;  3AZL A;  1F66 A;  4UPK A;  5DNM D;  3MVD B;  1U35 B;  2ZY2 A;  4J8V B;  3KUY C;  4G92 B;  1P3A C;  4Z66 A;  3AZF D;  3LEL B;  4WJ3 C;  4EO5 C;  5CP6 B;  2HIO A;  4AWL B;  5DNN B;  3X1U C;  5FUG B;  3LEL A;  1P3B A;  1M1A C;  3X1S C;  3X1V C;  2HUE B;  5AV9 D;  3AZJ A;  1P3M D;  5FUG A;  4YS3 C;  4WU8 C;  5F99 D;  3AZH C;  5AVB C;  5GSU A;  4WNN B;  3REL A;  5BO0 B;  4WV4 B;  1WWS A;  4XUJ D;  5B1M A;  4EO5 B;  4WNN A;  2L5A A;  3AZI C;  3X1U B;  3MGP C;  4XZQ A;  2ZM5 A;  5AV8 D;  1M1A B;  2YFV B;  3X1S B;  3X1V B;  2NQB C;  1BH8 A;  3X1U A;  4YS3 B;  4WU8 B;  3AZE D;  1P3L D;  2YFV A;  1BH9 A;  1EQZ A;  3AZH B;  3UTB A;  5AVB B;  3REH D;  5AV5 A;  4QLC C;  5JRG A;  3AZF A;  2ZY5 A;  4YS3 A;  2FJ7 C;  3TU4 D;  5AVB A;  5GT3 D;  5B2J B;  3MGP B;  1P3M A;  3AFA C;  1TZY D;  1M19 C;  2NQB B;  5B2J A;  1R4V A;  1HQ3 D;  3UTA C;  2F8N A;  5KDM B;  5BT1 D;  2NZD B;  3B6G D;  3A6N B;  4KHA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...