4YS3D

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ys3D00
4J8XC 5AV8A 4YS3A 2NQBD 1P3AB 3KXBA 1ID3B 3AV1C 1P3PD 3W97C 1BH9A 3UTBC 3TU4A 3AZGC 5CPIB 3VH5W 3KUYC 3AYWB 4J8WD 4XZQB 1P3FC 3RELB 1HQ3A 5AV5D 1P34A 1AOIC 3MGRB 1P3OC 5DNMA 2AROB 3MVDA 5GXQC 2BYMA 5AV6D 3C1BB 5C3IC 4WU9D 2CV5D 4HGAB 3MNNC 1TZYA 5GSUC 3MGQA 4H9NB 4CAYA 1TAFB 1P3AC 1P3ID 3X1UC 3MGPB 3V9RB 2PYOA 5CPIC 5B32A 4XZQC 2HIOA 1S32A 3LELA 3MGRC 5BNXA 4J8VA 4LD9A 1M19D 5JRGB 5B33D 3AZMD 3B6FA 3UT9A 4QLCA 2L5AA 3LZ0B 5JA4B 4KUDB 4H9RB 5BT1D 3WA9D 3WAAD 3X1SC 4WZSB 1EQZB 5B2JB 2F8NB 4H9QA 5AVBD 5CP6A 5CPKD 3O62A 1KX4C 4YM6D 4J8XA 5JRGC 3REJB 3AZNB 3W97A 4X23C 3AV1A 1BH8B 3UTBA 5BO0B 5B40B 4J8UA 1B6WA 1HTAA 3LZ0C 3KWQA 5B1LC 3W96C 5B31B 4R8PC 2NZDB 4KUDC 1P3LA 4ZUXD 3REKC 1P3FA 3X1VA 3NQUB 1AOIA 4E45A 5BNVB 3AN2B 1EQZC 1R4VA 3VH6W 2CWEA 5B2JC 4Z5TB 5F99A 3B0CT 3UTAB 2YFWA 3REHD 3AZJB 3MNNA 1M1AB 5GSUA 3B6GB 3AV2C 1P34D 3REJC 4NE3A 1P3AA 5AY8B 1P3MB 1ID3A 2FJ7B 4NFTA 4AWLB 5B40C 5CPIA 5B0YB 1M18B 5B31C 3MGQD 3AYWA 4XZQA 5CPJD 3RELA 4H9PB 3MGRA 1KX5D 3WKJD 2AROA 3AZGB 3AZFC 1P3PB 3C1BA 3UTAC 3REID 1P3GC 4Z2MG 3KUYB 3AZJC 3AZLC 1M1AC 3B6GC 4J8WB 4CSRB 4H9NA 2HIOD 1P3OB 5AV5B 1S32D 1P3KD 5GXQB 3LELD 4J8VD 1TAFA 4LD9D 5AY8C 3MGPA 3V9RA 3B6FD 2FJ7C 3AZHD 1KX3C 3LZ1D 4AWLC 2CV5B 5GT0D 3A6ND 1WWIA 3AZKB 4KGCC 4XUJC 5DNND 5B24C 4Z2MH 2NQBC 3AZID 3X1UB 4G91B 2JSSA 4H9SC 1P3IB 5JRGA 1P3PC 2YFVB 2F8NK 1U35D 3R45A 4J8WC 3LZ0A 5JA4A 5AV5C 4KUDA 4H9RA 5AV6C 3AZMB 1EQZA 5GT3B 5B2JA 2F8NA 5G49B 2CV5C 3AZKC 4J8UD 3KWQD 1P3LD 4G91C 3X1SB 1P3FD 2RVQD 1P3IC 5BS7C 5B2IA 3X1VD 3WAAB 5B1MD 3REJA 3AZNA 5F99D 1BH8A 2IO5B 5BO0A 5B40A 1KX4B 5AV9D 5B31A 2NZDA 4JJND 1F66D 4YM6B 3WTPE 1M19C 3NQUA 3AZMC 5BNVA 4X23B 3AN2A 3MGSD 5GT3C 4WU8D 4Z5TA 1ID3D 3UTAA 5B1LB 3W96B 3NQJB 4R8PB 3LJAD 3AZJA 3AZED 1M1AA 3REKB 3B0CW 3B6GA 3AYWD 1P3BD 5E5AD 5BT1C 3RELD 4Z66D 3WA9C 3WAAC 3W99D 2AROD 1P3MA 5AY8A 4E44A 5AVCB 5AVBC 1ZLAD 3C1BD 2FJ7A 5B0ZD 2IO5C 3REHB 3AV2B 5B0YA 3C1CB 1M18A 3WTPB 5KDMB 3VH5A 4YM6C 4H9PA 3X1TD 3AFAD 3W98D 3AZGA 3MGPD 4KHAA 3KUYA 5AV8D 4YS3D 4CSRA 4J8WA 5CPJB 4NE5A 4ZUXC 1P3OA 5AV5A 5GXQA 3AZFB 1KX5B 3KXBD 3WKJB 3TU4D 5AVCC 1P3GB 3AZLB 3REIB 1JFIB 3REHC 2CV5A 1F1EA 3AZKA 3C1CC 1HQ3D 4M6BA 4EO5B 3WTPC 5DNMD 1H3OB 3MVDD 1P3KB 1P34C 3X1UA 4LD9B 1P3IA 5BS7A 1KX3B 1A7WA 2YFVA 3AZHB 4KGCB 1TZYD 3LZ1B 2F8ND 5GT0B 4XUJB 3A6NB 5B24B 5DNNB 5CPJC 2NQBB 3AZIB 1KX5C 1B67A 3WKJC 2PYOD 5B2ID 3AZMA 5GT3A 3REIC 3AZND 1U35B 2HUEC 5B32D 5G49A 5FUGB 4EO5C 4ZBJB 1P3KC 5B31D 5AV6B 2NZDD 3X1SA 1ULYA 3UT9D 4WU9B 4LD9C 3WAAA 3AN2D 3AZHC 3LZ1C 4Z5TD 4QLCD 5GT0C 3A6NC 5DNNC 1M1AD 1KX4A 3B0DB 1BFMA 4NE6A 3AZIC 4YM6A 5B1MB 4X23A 1P3MD 5AY8D 1U35C 5F99B 5CP6D 5B1LA 3W96A 3NQJA 3VH6A 4R8PA 3O62D 5B0YD 4ZBJC 3REKA 5AV9B 1M18D 4J8XD 1M19B 5B33B 4JJNB 1F66B 4WU9C 5CHLB 4WNNB 3AV1D 3MGSB 3W97D 4WU8B 3UTBD 3AZGD 5AVCA 1WWSA 3REHA 3LJAB 4J8UC 3KUYD 3AV2A 3AZEB 3KWQC 4H9OB 3C1CA 3B0DC 1P3BB 3WA9B 5E5AB 1AOID 5KDMA 3WTPA 1P3LC 1P3OD 2RVQC 4Z66B 3X1VC 5GXQD 3W99B 5B1MC 5AVBB 5F99C 1ZLAB 5B0ZB 3MNND 5CPKB 5GSUD 3AZKD 5AV9C 4UUZB 5B33C 4JJNC 5CPJA 1F66C 3X1TB 1P3AD 3AFAB 3AZFA 1KX5A 3X1UD 3WKJA 3MGSC 3W98B 4WU8C 1N1JB 1ID3C 1P3GA 5CPID 3AZLA 3REIA 1JFIA 3LJAC 3AZEC 4XZQD 4ZUXB 2BYKB 5AV8B 3AYWC 4YS3B 5E5AC 1P3BC 3MGRD 1Q9CA 3RELC 1H3OA 1P3KA 4Z66C 3W99C 3VH5T 3KXBB 2AROC 4G92B 1BH9B 3TU4B 1KX3A 1KU5A 1ZLAC 3C1BC 5B0ZC 5GT3D 3AZHA 4KGCA 5CPKC 3LZ1A 4XUJA 5GT0A 4HGAC 4WV4B 3R45B 5B24A 3A6NA 1HQ3B 1P34B 5DNNA 2NQBA 5DNMB 3MVDB 3X1TC 4H9SA 2BYMB 3AFAC 3AZIA 3X1SD 1P3PA 3B0BA 3W98C 3MGPC 1TZYB 1U35A 3MGQB 5FUGA 4CAYB 2F8NG 5AV8C 4YS3C 1KX4D 5JRGD 5AV6A 3KXBC 4G92C 4WU9A 3TU4C 5B2IB 2PYOB 2HUEB 4X23D 4DRBA 5B32B 3LZ0D 2HIOB 1HQ3C 5B1LD 5B32G 1S32B 4R8PD 3LELB 3W96D 5BNXB 4J8VB 5DNMC 4KUDD 3MVDC 3REKD 2F8NH 3B6FB 5B31G 3UT9B 1EQZD 5B2JD 5B1MA 3KSYA 4DRAA 1TZYC 5AVCD 4QLCB 3MGQC 3AV2D 5AV9A 3C1CD 1M19A 5B33A 4JJNA 3WTPD 1F66A 3REJD 2PYOC 5B2IC 4H9QB 4WNNA 3MGSA 4WU8A 3AZNC 5B32C 5B40D 2HIOC 5CP6B 1S32C 3LJAA 3LELC 3O62B 3AZEA 4J8VC 4H9OA 4J8XB 1P3BA 3WA9A 5E5AA 2NZDC 3B6FC 3UT9C 4Z66A 2LY8A 5AVBA 3AZFD 3W99A 3W97B 3AV1B 3AN2C 3UTAD 3UTBB 4Z5TC 4QLCC 4J8UB 1P3GD 1ZLAA 3AZJD 3AZLD 5B0ZA 3KWQB 5CPKA 4KHAB 3B6GD 3VH6T 1P3LB 1P3FB 3X1VB 4UUZA 1AOIB 3X1TA 3AFAA 3W98A 5C3IB 1P3MC 2FJ7D 1KX3D 1N1JA 2YFWB 3MNNB 5CP6C 4KGCD 5GSUB 3O62C 4XUJD 5B0YC 5B24D 4ZUXA 1M18C 2BYKA
chains in the Genus database with same CATH superfamily
4J8XC 5AV8A 4YS3A 2NQBD 1P3AB 2Y2MA 3KXBA 1ID3B 3AV1C 1P3PD 3W97C 1BH9A 3UTBC 3TU4A 3AZGC 5CPIB 2VQRA 3VH5W 4WJ3C 3KUYC 3AYWB 4J8WD 1T3UA 4XZQB 3FDDA 1P3FC 3RELB 1HQ3A 5AV5D 1P34A 1AOIC 3MGRB 1P3OC 5DNMA 2AROB 3MVDA 5GXQC 2BYMA 5AV6D 3C1BB 5C3IC 4WU9D 2DF4C 2CV5D 4HGAB 3MNNC 1TZYA 5GSUC 3MGQA 4H9NB 4CAYA 1TAFB 1P3AC 1P3ID 3X1UC 3MGPB 3V9RB 2PYOA 5CPIC 3H0RC 5B32A 2XD5A 4XZQC 2HIOA 2Y2LA 1S32A 3LELA 3MGRC 5BNXA 4J8VA 4LD9A 1M19D 5JRGB 5B33D 3AZMD 3B6FA 3UT9A 2Y2NA 2XD1A 1W2EA 4QLCA 2L5AA 3LZ0B 5JA4B 4KUDB 4H9RB 5BT1D 3WA9D 3WAAD 3X1SC 4WZSB 1EQZB 5B2JB 2F8NB 4H9QA 5AVBD 5CP6A 5CPKD 3O62A 1KX4C 4YM6D 4J8XA 5JRGC 3REJB 3AZNB 3W97A 4X23C 3AV1A 2ZM5A 1BH8B 3UTBA 5BO0B 5B40B 4J8UA 1B6WA 1HTAA 3LZ0C 3KWQA 5B1LC 3W96C 3A1IA 5B31B 4R8PC 2NZDB 4KUDC 1P3LA 4ZUXD 3REKC 1P3FA 3X1VA 3NQUB 1AOIA 4E45A 5BNVB 3AN2B 1EQZC 1R4VA 3VH6W 2CWEA 5B2JC 4Z5TB 5F99A 3B0CT 3UTAB 2YFWA 3REHD 3AZJB 3MNNA 1M1AB 5GSUA 3B6GB 3AV2C 2Y2IA 1P34D 3REJC 4NE3A 1P3AA 5AY8B 1P3MB 1ID3A 2Y2OA 2FJ7B 4NFTA 4AWLB 5B40C 5CPIA 2DQNC 5B0YB 2RIQA 1M18B 5B31C 3MGQD 3AYWA 4XZQA 5CPJD 3RELA 4H9PB 3MGRA 1KX5D 3WKJD 2AROA 2G5IC 2UWXA 3AZGB 3AZFC 1P3PB 3C1BA 3UTAC 3REID 1P3GC 4Z2MG 3KUYB 3AZJC 3AZLC 1M1AC 3B6GC 4J8WB 4CSRB 4H9NA 2HIOD 1P3OB 2G5HC 5AV5B 1S32D 1P3KD 5GXQB 3LELD 4J8VD 1TAFA 4LD9D 5AY8C 3MGPA 3V9RA 3B6FD 2FJ7C 3AZHD 1KX3C 3LZ1D 4AWLC 2CV5B 5GT0D 3A6ND 1WWIA 3AZKB 4KGCC 4XUJC 5DNND 5B24C 4Z2MH 2NQBC 3AZID 3X1UB 4G91B 2JSSA 4H9SC 1P3IB 5JRGA 1P3PC 2YFVB 2F8NK 1U35D 3R45A 1Z2CB 4J8WC 3LZ0A 5JA4A 5AV5C 2ZY3A 4KUDA 4H9RA 5AV6C 3AZMB 1EQZA 3A1KA 5GT3B 5B2JA 2F8NA 5G49B 2CV5C 3AZKC 4J8UD 3KWQD 1P3LD 4G91C 3X1SB 1P3FD 2RVQD 1P3IC 5BS7C 5B2IA 3X1VD 3WAAB 5B1MD 3REJA 3AZNA 5F99D 1BH8A 2IO5B 5BO0A 5B40A 2BG1A 1KX4B 5AV9D 5B31A 2NZDA 4JJND 1F66D 4YM6B 3WTPE 1M19C 3NQUA 3AZMC 5BNVA 4X23B 3AN2A 3MGSD 5GT3C 4WU8D 2Y2GA 4Z5TA 1ID3D 3UTAA 5B1LB 3W96B 3NQJB 4R8PB 3LJAD 3AZJA 3EPLA 3AZED 1M1AA 3REKB 3B0CW 3B6GA 3AYWD 1P3BD 5E5AD 5BT1C 3RELD 4Z66D 3WA9C 3WAAC 3W99D 2AROD 1P3MA 5AY8A 4E44A 5AVCB 5AVBC 1ZLAD 3C1BD 2FJ7A 5B0ZD 2IO5C 3REHB 3AV2B 2J8PA 5B0YA 1PZRA 3C1CB 1M18A 3P5JB 3WTPB 5KDMB 3VH5A 4YM6C 4H9PA 3X1TD 3AFAD 3W98D 3AZGA 3MGPD 4KHAA 3KUYA 5AV8D 4YS3D 4CSRA 4J8WA 5CPJB 4NE5A 4ZUXC 1P3OA 5AV5A 5GXQA 3AZFB 1KX5B 3KXBD 3WKJB 2JCHA 3TU4D 5AVCC 4UPKA 1P3GB 3AZLB 3REIB 1JFIB 3REHC 2CV5A 1F1EA 3AZKA 3C1CC 1HQ3D 4M6BA 4EO5B 3WTPC 5DNMD 1H3OB 3MVDD 1P3KB 3EPHA 1P34C 3X1UA 4LD9B 1P3IA 5BS7A 1KX3B 1A7WA 2YFVA 3AZHB 4KGCB 1TZYD 3LZ1B 2F8ND 5GT0B 4XUJB 3A6NB 5B24B 2Y2QA 3AL0C 5DNNB 5CPJC 2NQBB 3AZIB 1KX5C 1B67A 3WKJC 2PYOD 5B2ID 3AZMA 5GT3A 3REIC 3AZND 1U35B 2HUEC 5B32D 5G49A 5FUGB 4EO5C 4ZBJB 1P3KC 5B31D 5AV6B 2NZDD 3X1SA 1ULYA 3UT9D 4WU9B 4LD9C 3WAAA 3AN2D 3AZHC 3LZ1C 4Z5TD 4QLCD 5GT0C 3A6NC 5DNNC 1M1AD 1KX4A 3B0DB 1BFMA 4NE6A 3AZIC 4YM6A 5B1MB 4X23A 1P3MD 5AY8D 1U35C 5F99B 3EPJA 5CP6D 5B1LA 3W96A 3NQJA 3VH6A 4R8PA 3O62D 5B0YD 4ZBJC 3REKA 5AV9B 1M18D 4J8XD 1M19B 5B33B 4JJNB 1F66B 4WU9C 5CHLB 4WNNB 3AV1D 3MGSB 3W97D 4WU8B 3UTBD 3AZGD 5AVCA 1WWSA 3REHA 3LJAB 4J8UC 3KUYD 3AV2A 3AZEB 3KWQC 4H9OB 3C1CA 3B0DC 1P3BB 3WA9B 5E5AB 1AOID 5KDMA 3WTPA 1P3LC 1P3OD 2RVQC 4Z66B 3X1VC 5GXQD 3W99B 5B1MC 5AVBB 2Y2HA 5F99C 1ZLAB 3EPKA 5B0ZB 3MNND 5CPKB 5GSUD 2Y2PA 3AZKD 5AV9C 4UUZB 5B33C 4JJNC 5CPJA 1F66C 3X1TB 1P3AD 3AFAB 3AZFA 1KX5A 3X1UD 3WKJA 3MGSC 3W98B 4WU8C 1N1JB 1ID3C 1P3GA 5CPID 3AZLA 3REIA 1JFIA 3LJAC 3AZEC 4XZQD 4ZUXB 2BYKB 5AV8B 3AYWC 4YS3B 5E5AC 1P3BC 2F2AC 3MGRD 1Q9CA 3RELC 1H3OA 1P3KA 4Z66C 3W99C 3VH5T 3KXBB 2AROC 4G92B 1BH9B 3TU4B 1KX3A 1KU5A 1ZLAC 3H0LC 3C1BC 5B0ZC 5GT3D 3AZHA 4KGCA 5CPKC 3LZ1A 4XUJA 5GT0A 4HGAC 4WV4B 3R45B 5B24A 3A6NA 1HQ3B 3KFUG 1P34B 5DNNA 2NQBA 5DNMB 2ZY5A 3MVDB 2FFFB 4H9SA 3X1TC 2BYMB 3AFAC 3AZIA 2ZY2A 3X1SD 3B0BA 1P3PA 3W98C 3MGPC 1TZYB 1U35A 3MGQB 5FUGA 4CAYB 2F8NG 5AV8C 4YS3C 4DQYB 1KX4D 2Y2KA 5JRGD 5AV6A 3KXBC 4G92C 4WU9A 3TU4C 5B2IB 2PYOB 2HUEB 4X23D 3H0MC 3IP4C 4DRBA 5B32B 3LZ0D 2HIOB 1HQ3C 5B1LD 5B32G 1S32B 4R8PD 3LELB 3W96D 5BNXB 4J8VB 5DNMC 4KUDD 3MVDC 3REKD 2F8NH 3B6FB 5B31G 3UT9B 2Y2JA 1EQZD 5B2JD 5B1MA 3KSYA 4DRAA 2ZY4A 1TZYC 5AVCD 4QLCB 3MGQC 3AV2D 5AV9A 3C1CD 1M19A 5B33A 4JJNA 3WTPD 1F66A 3REJD 2PYOC 5B2IC 4H9QB 4WNNA 3MGSA 4WU8A 3AZNC 5B32C 5B40D 3F6TA 2HIOC 5CP6B 1S32C 3LJAA 3LELC 3O62B 3AZEA 4J8VC 4H9OA 4J8XB 1P3BA 3WA9A 5E5AA 2NZDC 3B6FC 3UT9C 4Z66A 2LY8A 5AVBA 3AZFD 3W99A 3W97B 3AV1B 3AN2C 3UTAD 3UTBB 2W8SA 4Z5TC 4QLCC 4J8UB 1P3GD 1ZLAA 3AZJD 3AZLD 5B0ZA 3KWQB 5CPKA 4KHAB 3B6GD 3EG5B 3VH6T 1P3LB 1P3FB 3X1VB 4UUZA 1AOIB 3X1TA 2JE5A 3AFAA 3W98A 5C3IB 1P3MC 2FJ7D 1KX3D 1N1JA 2YFWB 3MNNB 5CP6C 4KGCD 5GSUB 3O62C 4XUJD 5B0YC 5B24D 4ZUXA 1M18C 2BYKA
chains in the Genus database with same CATH topology
4J8XC 5AV8A 4YS3A 2NQBD 1P3AB 2Y2MA 3KXBA 1ID3B 3AV1C 1P3PD 3W97C 1BH9A 3UTBC 3TU4A 3AZGC 5CPIB 2VQRA 3VH5W 4WJ3C 3KUYC 3AYWB 4J8WD 1T3UA 4XZQB 3FDDA 1P3FC 3RELB 1HQ3A 5AV5D 1P34A 1AOIC 3MGRB 1P3OC 5DNMA 2AROB 3MVDA 5GXQC 2BYMA 5AV6D 3C1BB 5C3IC 4WU9D 2DF4C 2CV5D 4HGAB 3MNNC 1TZYA 5GSUC 3MGQA 4H9NB 4CAYA 1TAFB 1P3AC 1P3ID 3X1UC 3MGPB 3V9RB 2PYOA 5CPIC 3H0RC 5B32A 2XD5A 4XZQC 2HIOA 2Y2LA 1S32A 3LELA 3MGRC 5BNXA 4J8VA 4LD9A 1M19D 5JRGB 5B33D 3AZMD 3B6FA 3UT9A 2Y2NA 2XD1A 1W2EA 4QLCA 2L5AA 3LZ0B 5JA4B 4KUDB 4H9RB 5BT1D 3WA9D 3WAAD 3X1SC 4WZSB 1EQZB 5B2JB 2F8NB 4H9QA 5AVBD 5CP6A 5CPKD 3O62A 1KX4C 4YM6D 4J8XA 5JRGC 3REJB 3AZNB 3W97A 4X23C 3AV1A 2ZM5A 1BH8B 3UTBA 5BO0B 5B40B 4J8UA 1B6WA 1HTAA 3LZ0C 3KWQA 5B1LC 3W96C 3A1IA 5B31B 4R8PC 2NZDB 4KUDC 1P3LA 4ZUXD 3REKC 1P3FA 3X1VA 3NQUB 1AOIA 4E45A 5BNVB 3AN2B 1EQZC 1R4VA 3VH6W 2CWEA 5B2JC 4Z5TB 5F99A 3B0CT 3UTAB 2YFWA 3REHD 3AZJB 3MNNA 1M1AB 5GSUA 3B6GB 3AV2C 2Y2IA 1P34D 3REJC 4NE3A 1P3AA 5AY8B 1P3MB 1ID3A 2Y2OA 2FJ7B 4NFTA 4AWLB 5B40C 5CPIA 2DQNC 5B0YB 2RIQA 1M18B 5B31C 3MGQD 3AYWA 4XZQA 5CPJD 3RELA 4H9PB 3MGRA 1KX5D 3WKJD 2AROA 2G5IC 2UWXA 3AZGB 3AZFC 1P3PB 3C1BA 3UTAC 3REID 1P3GC 4Z2MG 3KUYB 3AZJC 3AZLC 1M1AC 3B6GC 4J8WB 4CSRB 4H9NA 2HIOD 1P3OB 2G5HC 5AV5B 1S32D 1P3KD 5GXQB 3LELD 4J8VD 1TAFA 4LD9D 5AY8C 3MGPA 3V9RA 3B6FD 2FJ7C 3AZHD 1KX3C 3LZ1D 4AWLC 2CV5B 5GT0D 3A6ND 1WWIA 3AZKB 4KGCC 4XUJC 5DNND 5B24C 4Z2MH 2NQBC 3AZID 3X1UB 4G91B 2JSSA 4H9SC 1P3IB 5JRGA 1P3PC 2YFVB 2F8NK 1U35D 3R45A 1Z2CB 4J8WC 3LZ0A 5JA4A 5AV5C 2ZY3A 4KUDA 4H9RA 5AV6C 3AZMB 1EQZA 3A1KA 5GT3B 5B2JA 2F8NA 5G49B 2CV5C 3AZKC 4J8UD 3KWQD 1P3LD 4G91C 3X1SB 1P3FD 2RVQD 1P3IC 5BS7C 5B2IA 3X1VD 3WAAB 5B1MD 3REJA 3AZNA 5F99D 1BH8A 2IO5B 5BO0A 5B40A 2BG1A 1KX4B 5AV9D 5B31A 2NZDA 4JJND 1F66D 4YM6B 3WTPE 1M19C 3NQUA 3AZMC 5BNVA 4X23B 3AN2A 3MGSD 5GT3C 4WU8D 2Y2GA 4Z5TA 1ID3D 3UTAA 5B1LB 3W96B 3NQJB 4R8PB 3LJAD 3AZJA 3EPLA 3AZED 1M1AA 3REKB 3B0CW 3B6GA 3AYWD 1P3BD 5E5AD 5BT1C 3RELD 4Z66D 3WA9C 3WAAC 3W99D 2AROD 1P3MA 5AY8A 4E44A 5AVCB 5AVBC 1ZLAD 3C1BD 2FJ7A 5B0ZD 2IO5C 3REHB 3AV2B 2J8PA 5B0YA 1PZRA 3C1CB 1M18A 3P5JB 3WTPB 5KDMB 3VH5A 4YM6C 4H9PA 3X1TD 3AFAD 3W98D 3AZGA 3MGPD 4KHAA 3KUYA 5AV8D 4YS3D 4CSRA 4J8WA 5CPJB 4NE5A 4ZUXC 1P3OA 5AV5A 5GXQA 3AZFB 1KX5B 3KXBD 3WKJB 2JCHA 3TU4D 5AVCC 4UPKA 1P3GB 3AZLB 3REIB 1JFIB 3REHC 2CV5A 1F1EA 3AZKA 3C1CC 1HQ3D 4M6BA 4EO5B 3WTPC 5DNMD 1H3OB 3MVDD 1P3KB 3EPHA 1P34C 3X1UA 4LD9B 1P3IA 5BS7A 1KX3B 1A7WA 2YFVA 3AZHB 4KGCB 1TZYD 3LZ1B 2F8ND 5GT0B 4XUJB 3A6NB 5B24B 2Y2QA 3AL0C 5DNNB 5CPJC 2NQBB 3AZIB 1KX5C 1B67A 3WKJC 2PYOD 5B2ID 3AZMA 5GT3A 3REIC 3AZND 1U35B 2HUEC 5B32D 5G49A 5FUGB 4EO5C 4ZBJB 1P3KC 5B31D 5AV6B 2NZDD 3X1SA 1ULYA 3UT9D 4WU9B 4LD9C 3WAAA 3AN2D 3AZHC 3LZ1C 4Z5TD 4QLCD 5GT0C 3A6NC 5DNNC 1M1AD 1KX4A 3B0DB 1BFMA 4NE6A 3AZIC 4YM6A 5B1MB 4X23A 1P3MD 5AY8D 1U35C 5F99B 3EPJA 5CP6D 5B1LA 3W96A 3NQJA 3VH6A 4R8PA 3O62D 5B0YD 4ZBJC 3REKA 5AV9B 1M18D 4J8XD 1M19B 5B33B 4JJNB 1F66B 4WU9C 5CHLB 4WNNB 3AV1D 3MGSB 3W97D 4WU8B 3UTBD 3AZGD 5AVCA 1WWSA 3REHA 3LJAB 4J8UC 3KUYD 3AV2A 3AZEB 3KWQC 4H9OB 3C1CA 3B0DC 1P3BB 3WA9B 5E5AB 1AOID 5KDMA 3WTPA 1P3LC 1P3OD 2RVQC 4Z66B 3X1VC 5GXQD 3W99B 5B1MC 5AVBB 2Y2HA 5F99C 1ZLAB 3EPKA 5B0ZB 3MNND 5CPKB 5GSUD 2Y2PA 3AZKD 5AV9C 4UUZB 5B33C 4JJNC 5CPJA 1F66C 3X1TB 1P3AD 3AFAB 3AZFA 1KX5A 3X1UD 3WKJA 3MGSC 3W98B 4WU8C 1N1JB 1ID3C 1P3GA 5CPID 3AZLA 3REIA 1JFIA 3LJAC 3AZEC 4XZQD 4ZUXB 2BYKB 5AV8B 3AYWC 4YS3B 5E5AC 1P3BC 2F2AC 3MGRD 1Q9CA 3RELC 1H3OA 1P3KA 4Z66C 3W99C 3VH5T 3KXBB 2AROC 4G92B 1BH9B 3TU4B 1KX3A 1KU5A 1ZLAC 3H0LC 3C1BC 5B0ZC 5GT3D 3AZHA 4KGCA 5CPKC 3LZ1A 4XUJA 5GT0A 4HGAC 4WV4B 3R45B 5B24A 3A6NA 1HQ3B 3KFUG 1P34B 5DNNA 2NQBA 5DNMB 2ZY5A 3MVDB 2FFFB 4H9SA 3X1TC 2BYMB 3AFAC 3AZIA 2ZY2A 3X1SD 3B0BA 1P3PA 3W98C 3MGPC 1TZYB 1U35A 3MGQB 5FUGA 4CAYB 2F8NG 5AV8C 4YS3C 4DQYB 1KX4D 2Y2KA 5JRGD 5AV6A 3KXBC 4G92C 4WU9A 3TU4C 5B2IB 2PYOB 2HUEB 4X23D 3H0MC 3IP4C 4DRBA 5B32B 3LZ0D 2HIOB 1HQ3C 5B1LD 5B32G 1S32B 4R8PD 3LELB 3W96D 5BNXB 4J8VB 5DNMC 4KUDD 3MVDC 3REKD 2F8NH 3B6FB 5B31G 3UT9B 2Y2JA 1EQZD 5B2JD 5B1MA 3KSYA 4DRAA 2ZY4A 1TZYC 5AVCD 4QLCB 3MGQC 3AV2D 5AV9A 3C1CD 1M19A 5B33A 4JJNA 3WTPD 1F66A 3REJD 2PYOC 5B2IC 4H9QB 4WNNA 3MGSA 4WU8A 3AZNC 5B32C 5B40D 3F6TA 2HIOC 5CP6B 1S32C 3LJAA 3LELC 3O62B 3AZEA 4J8VC 4H9OA 4J8XB 1P3BA 3WA9A 5E5AA 2NZDC 3B6FC 3UT9C 4Z66A 2LY8A 5AVBA 3AZFD 3W99A 3W97B 3AV1B 3AN2C 3UTAD 3UTBB 2W8SA 4Z5TC 4QLCC 4J8UB 1P3GD 1ZLAA 3AZJD 3AZLD 5B0ZA 3KWQB 5CPKA 4KHAB 3B6GD 3EG5B 3VH6T 1P3LB 1P3FB 3X1VB 4UUZA 1AOIB 3X1TA 2JE5A 3AFAA 3W98A 5C3IB 1P3MC 2FJ7D 1KX3D 1N1JA 2YFWB 3MNNB 5CP6C 4KGCD 5GSUB 3O62C 4XUJD 5B0YC 5B24D 4ZUXA 1M18C 2BYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8X C;  5AV8 A;  4YS3 A;  2NQB D;  1P3A B;  3KXB A;  1ID3 B;  3AV1 C;  1P3P D;  3W97 C;  1BH9 A;  3UTB C;  3TU4 A;  3AZG C;  5CPI B;  3VH5 W;  3KUY C;  3AYW B;  4J8W D;  4XZQ B;  1P3F C;  3REL B;  1HQ3 A;  5AV5 D;  1P34 A;  1AOI C;  3MGR B;  1P3O C;  5DNM A;  2ARO B;  3MVD A;  5GXQ C;  2BYM A;  5AV6 D;  3C1B B;  5C3I C;  4WU9 D;  2CV5 D;  4HGA B;  3MNN C;  1TZY A;  5GSU C;  3MGQ A;  4H9N B;  4CAY A;  1TAF B;  1P3A C;  1P3I D;  3X1U C;  3MGP B;  3V9R B;  2PYO A;  5CPI C;  5B32 A;  4XZQ C;  2HIO A;  1S32 A;  3LEL A;  3MGR C;  5BNX A;  4J8V A;  4LD9 A;  1M19 D;  5JRG B;  5B33 D;  3AZM D;  3B6F A;  3UT9 A;  4QLC A;  2L5A A;  3LZ0 B;  5JA4 B;  4KUD B;  4H9R B;  5BT1 D;  3WA9 D;  3WAA D;  3X1S C;  4WZS B;  1EQZ B;  5B2J B;  2F8N B;  4H9Q A;  5AVB D;  5CP6 A;  5CPK D;  3O62 A;  1KX4 C;  4YM6 D;  4J8X A;  5JRG C;  3REJ B;  3AZN B;  3W97 A;  4X23 C;  3AV1 A;  1BH8 B;  3UTB A;  5BO0 B;  5B40 B;  4J8U A;  1B6W A;  1HTA A;  3LZ0 C;  3KWQ A;  5B1L C;  3W96 C;  5B31 B;  4R8P C;  2NZD B;  4KUD C;  1P3L A;  4ZUX D;  3REK C;  1P3F A;  3X1V A;  3NQU B;  1AOI A;  4E45 A;  5BNV B;  3AN2 B;  1EQZ C;  1R4V A;  3VH6 W;  2CWE A;  5B2J C;  4Z5T B;  5F99 A;  3B0C T;  3UTA B;  2YFW A;  3REH D;  3AZJ B;  3MNN A;  1M1A B;  5GSU A;  3B6G B;  3AV2 C;  1P34 D;  3REJ C;  4NE3 A;  1P3A A;  5AY8 B;  1P3M B;  1ID3 A;  2FJ7 B;  4NFT A;  4AWL B;  5B40 C;  5CPI A;  5B0Y B;  1M18 B;  5B31 C;  3MGQ D;  3AYW A;  4XZQ A;  5CPJ D;  3REL A;  4H9P B;  3MGR A;  1KX5 D;  3WKJ D;  2ARO A;  3AZG B;  3AZF C;  1P3P B;  3C1B A;  3UTA C;  3REI D;  1P3G C;  4Z2M G;  3KUY B;  3AZJ C;  3AZL C;  1M1A C;  3B6G C;  4J8W B;  4CSR B;  4H9N A;  2HIO D;  1P3O B;  5AV5 B;  1S32 D;  1P3K D;  5GXQ B;  3LEL D;  4J8V D;  1TAF A;  4LD9 D;  5AY8 C;  3MGP A;  3V9R A;  3B6F D;  2FJ7 C;  3AZH D;  1KX3 C;  3LZ1 D;  4AWL C;  2CV5 B;  5GT0 D;  3A6N D;  1WWI A;  3AZK B;  4KGC C;  4XUJ C;  5DNN D;  5B24 C;  4Z2M H;  2NQB C;  3AZI D;  3X1U B;  4G91 B;  2JSS A;  4H9S C;  1P3I B;  5JRG A;  1P3P C;  2YFV B;  2F8N K;  1U35 D;  3R45 A;  4J8W C;  3LZ0 A;  5JA4 A;  5AV5 C;  4KUD A;  4H9R A;  5AV6 C;  3AZM B;  1EQZ A;  5GT3 B;  5B2J A;  2F8N A;  5G49 B;  2CV5 C;  3AZK C;  4J8U D;  3KWQ D;  1P3L D;  4G91 C;  3X1S B;  1P3F D;  2RVQ D;  1P3I C;  5BS7 C;  5B2I A;  3X1V D;  3WAA B;  5B1M D;  3REJ A;  3AZN A;  5F99 D;  1BH8 A;  2IO5 B;  5BO0 A;  5B40 A;  1KX4 B;  5AV9 D;  5B31 A;  2NZD A;  4JJN D;  1F66 D;  4YM6 B;  3WTP E;  1M19 C;  3NQU A;  3AZM C;  5BNV A;  4X23 B;  3AN2 A;  3MGS D;  5GT3 C;  4WU8 D;  4Z5T A;  1ID3 D;  3UTA A;  5B1L B;  3W96 B;  3NQJ B;  4R8P B;  3LJA D;  3AZJ A;  3AZE D;  1M1A A;  3REK B;  3B0C W;  3B6G A;  3AYW D;  1P3B D;  5E5A D;  5BT1 C;  3REL D;  4Z66 D;  3WA9 C;  3WAA C;  3W99 D;  2ARO D;  1P3M A;  5AY8 A;  4E44 A;  5AVC B;  5AVB C;  1ZLA D;  3C1B D;  2FJ7 A;  5B0Z D;  2IO5 C;  3REH B;  3AV2 B;  5B0Y A;  3C1C B;  1M18 A;  3WTP B;  5KDM B;  3VH5 A;  4YM6 C;  4H9P A;  3X1T D;  3AFA D;  3W98 D;  3AZG A;  3MGP D;  4KHA A;  3KUY A;  5AV8 D;  4YS3 D;  4CSR A;  4J8W A;  5CPJ B;  4NE5 A;  4ZUX C;  1P3O A;  5AV5 A;  5GXQ A;  3AZF B;  1KX5 B;  3KXB D;  3WKJ B;  3TU4 D;  5AVC C;  1P3G B;  3AZL B;  3REI B;  1JFI B;  3REH C;  2CV5 A;  1F1E A;  3AZK A;  3C1C C;  1HQ3 D;  4M6B A;  4EO5 B;  3WTP C;  5DNM D;  1H3O B;  3MVD D;  1P3K B;  1P34 C;  3X1U A;  4LD9 B;  1P3I A;  5BS7 A;  1KX3 B;  1A7W A;  2YFV A;  3AZH B;  4KGC B;  1TZY D;  3LZ1 B;  2F8N D;  5GT0 B;  4XUJ B;  3A6N B;  5B24 B;  5DNN B;  5CPJ C;  2NQB B;  3AZI B;  1KX5 C;  1B67 A;  3WKJ C;  2PYO D;  5B2I D;  3AZM A;  5GT3 A;  3REI C;  3AZN D;  1U35 B;  2HUE C;  5B32 D;  5G49 A;  5FUG B;  4EO5 C;  4ZBJ B;  1P3K C;  5B31 D;  5AV6 B;  2NZD D;  3X1S A;  1ULY A;  3UT9 D;  4WU9 B;  4LD9 C;  3WAA A;  3AN2 D;  3AZH C;  3LZ1 C;  4Z5T D;  4QLC D;  5GT0 C;  3A6N C;  5DNN C;  1M1A D;  1KX4 A;  3B0D B;  1BFM A;  4NE6 A;  3AZI C;  4YM6 A;  5B1M B;  4X23 A;  1P3M D;  5AY8 D;  1U35 C;  5F99 B;  5CP6 D;  5B1L A;  3W96 A;  3NQJ A;  3VH6 A;  4R8P A;  3O62 D;  5B0Y D;  4ZBJ C;  3REK A;  5AV9 B;  1M18 D;  4J8X D;  1M19 B;  5B33 B;  4JJN B;  1F66 B;  4WU9 C;  5CHL B;  4WNN B;  3AV1 D;  3MGS B;  3W97 D;  4WU8 B;  3UTB D;  3AZG D;  5AVC A;  1WWS A;  3REH A;  3LJA B;  4J8U C;  3KUY D;  3AV2 A;  3AZE B;  3KWQ C;  4H9O B;  3C1C A;  3B0D C;  1P3B B;  3WA9 B;  5E5A B;  1AOI D;  5KDM A;  3WTP A;  1P3L C;  1P3O D;  2RVQ C;  4Z66 B;  3X1V C;  5GXQ D;  3W99 B;  5B1M C;  5AVB B;  5F99 C;  1ZLA B;  5B0Z B;  3MNN D;  5CPK B;  5GSU D;  3AZK D;  5AV9 C;  4UUZ B;  5B33 C;  4JJN C;  5CPJ A;  1F66 C;  3X1T B;  1P3A D;  3AFA B;  3AZF A;  1KX5 A;  3X1U D;  3WKJ A;  3MGS C;  3W98 B;  4WU8 C;  1N1J B;  1ID3 C;  1P3G A;  5CPI D;  3AZL A;  3REI A;  1JFI A;  3LJA C;  3AZE C;  4XZQ D;  4ZUX B;  2BYK B;  5AV8 B;  3AYW C;  4YS3 B;  5E5A C;  1P3B C;  3MGR D;  1Q9C A;  3REL C;  1H3O A;  1P3K A;  4Z66 C;  3W99 C;  3VH5 T;  3KXB B;  2ARO C;  4G92 B;  1BH9 B;  3TU4 B;  1KX3 A;  1KU5 A;  1ZLA C;  3C1B C;  5B0Z C;  5GT3 D;  3AZH A;  4KGC A;  5CPK C;  3LZ1 A;  4XUJ A;  5GT0 A;  4HGA C;  4WV4 B;  3R45 B;  5B24 A;  3A6N A;  1HQ3 B;  1P34 B;  5DNN A;  2NQB A;  5DNM B;  3MVD B;  3X1T C;  4H9S A;  2BYM B;  3AFA C;  3AZI A;  3X1S D;  1P3P A;  3B0B A;  3W98 C;  3MGP C;  1TZY B;  1U35 A;  3MGQ B;  5FUG A;  4CAY B;  2F8N G;  5AV8 C;  4YS3 C;  1KX4 D;  5JRG D;  5AV6 A;  3KXB C;  4G92 C;  4WU9 A;  3TU4 C;  5B2I B;  2PYO B;  2HUE B;  4X23 D;  4DRB A;  5B32 B;  3LZ0 D;  2HIO B;  1HQ3 C;  5B1L D;  5B32 G;  1S32 B;  4R8P D;  3LEL B;  3W96 D;  5BNX B;  4J8V B;  5DNM C;  4KUD D;  3MVD C;  3REK D;  2F8N H;  3B6F B;  5B31 G;  3UT9 B;  1EQZ D;  5B2J D;  5B1M A;  3KSY A;  4DRA A;  1TZY C;  5AVC D;  4QLC B;  3MGQ C;  3AV2 D;  5AV9 A;  3C1C D;  1M19 A;  5B33 A;  4JJN A;  3WTP D;  1F66 A;  3REJ D;  2PYO C;  5B2I C;  4H9Q B;  4WNN A;  3MGS A;  4WU8 A;  3AZN C;  5B32 C;  5B40 D;  2HIO C;  5CP6 B;  1S32 C;  3LJA A;  3LEL C;  3O62 B;  3AZE A;  4J8V C;  4H9O A;  4J8X B;  1P3B A;  3WA9 A;  5E5A A;  2NZD C;  3B6F C;  3UT9 C;  4Z66 A;  2LY8 A;  5AVB A;  3AZF D;  3W99 A;  3W97 B;  3AV1 B;  3AN2 C;  3UTA D;  3UTB B;  4Z5T C;  4QLC C;  4J8U B;  1P3G D;  1ZLA A;  3AZJ D;  3AZL D;  5B0Z A;  3KWQ B;  5CPK A;  4KHA B;  3B6G D;  3VH6 T;  1P3L B;  1P3F B;  3X1V B;  4UUZ A;  1AOI B;  3X1T A;  3AFA A;  3W98 A;  5C3I B;  1P3M C;  2FJ7 D;  1KX3 D;  1N1J A;  2YFW B;  3MNN B;  5CP6 C;  4KGC D;  5GSU B;  3O62 C;  4XUJ D;  5B0Y C;  5B24 D;  4ZUX A;  1M18 C;  2BYK A; 
#chains in the Genus database with same CATH topology
 4J8X C;  5AV8 A;  4YS3 A;  2NQB D;  1P3A B;  2Y2M A;  3KXB A;  1ID3 B;  3AV1 C;  1P3P D;  3W97 C;  1BH9 A;  3UTB C;  3TU4 A;  3AZG C;  5CPI B;  2VQR A;  3VH5 W;  4WJ3 C;  3KUY C;  3AYW B;  4J8W D;  1T3U A;  4XZQ B;  3FDD A;  1P3F C;  3REL B;  1HQ3 A;  5AV5 D;  1P34 A;  1AOI C;  3MGR B;  1P3O C;  5DNM A;  2ARO B;  3MVD A;  5GXQ C;  2BYM A;  5AV6 D;  3C1B B;  5C3I C;  4WU9 D;  2DF4 C;  2CV5 D;  4HGA B;  3MNN C;  1TZY A;  5GSU C;  3MGQ A;  4H9N B;  4CAY A;  1TAF B;  1P3A C;  1P3I D;  3X1U C;  3MGP B;  3V9R B;  2PYO A;  5CPI C;  3H0R C;  5B32 A;  2XD5 A;  4XZQ C;  2HIO A;  2Y2L A;  1S32 A;  3LEL A;  3MGR C;  5BNX A;  4J8V A;  4LD9 A;  1M19 D;  5JRG B;  5B33 D;  3AZM D;  3B6F A;  3UT9 A;  2Y2N A;  2XD1 A;  1W2E A;  4QLC A;  2L5A A;  3LZ0 B;  5JA4 B;  4KUD B;  4H9R B;  5BT1 D;  3WA9 D;  3WAA D;  3X1S C;  4WZS B;  1EQZ B;  5B2J B;  2F8N B;  4H9Q A;  5AVB D;  5CP6 A;  5CPK D;  3O62 A;  1KX4 C;  4YM6 D;  4J8X A;  5JRG C;  3REJ B;  3AZN B;  3W97 A;  4X23 C;  3AV1 A;  2ZM5 A;  1BH8 B;  3UTB A;  5BO0 B;  5B40 B;  4J8U A;  1B6W A;  1HTA A;  3LZ0 C;  3KWQ A;  5B1L C;  3W96 C;  3A1I A;  5B31 B;  4R8P C;  2NZD B;  4KUD C;  1P3L A;  4ZUX D;  3REK C;  1P3F A;  3X1V A;  3NQU B;  1AOI A;  4E45 A;  5BNV B;  3AN2 B;  1EQZ C;  1R4V A;  3VH6 W;  2CWE A;  5B2J C;  4Z5T B;  5F99 A;  3B0C T;  3UTA B;  2YFW A;  3REH D;  3AZJ B;  3MNN A;  1M1A B;  5GSU A;  3B6G B;  3AV2 C;  2Y2I A;  1P34 D;  3REJ C;  4NE3 A;  1P3A A;  5AY8 B;  1P3M B;  1ID3 A;  2Y2O A;  2FJ7 B;  4NFT A;  4AWL B;  5B40 C;  5CPI A;  2DQN C;  5B0Y B;  2RIQ A;  1M18 B;  5B31 C;  3MGQ D;  3AYW A;  4XZQ A;  5CPJ D;  3REL A;  4H9P B;  3MGR A;  1KX5 D;  3WKJ D;  2ARO A;  2G5I C;  2UWX A;  3AZG B;  3AZF C;  1P3P B;  3C1B A;  3UTA C;  3REI D;  1P3G C;  4Z2M G;  3KUY B;  3AZJ C;  3AZL C;  1M1A C;  3B6G C;  4J8W B;  4CSR B;  4H9N A;  2HIO D;  1P3O B;  2G5H C;  5AV5 B;  1S32 D;  1P3K D;  5GXQ B;  3LEL D;  4J8V D;  1TAF A;  4LD9 D;  5AY8 C;  3MGP A;  3V9R A;  3B6F D;  2FJ7 C;  3AZH D;  1KX3 C;  3LZ1 D;  4AWL C;  2CV5 B;  5GT0 D;  3A6N D;  1WWI A;  3AZK B;  4KGC C;  4XUJ C;  5DNN D;  5B24 C;  4Z2M H;  2NQB C;  3AZI D;  3X1U B;  4G91 B;  2JSS A;  4H9S C;  1P3I B;  5JRG A;  1P3P C;  2YFV B;  2F8N K;  1U35 D;  3R45 A;  1Z2C B;  4J8W C;  3LZ0 A;  5JA4 A;  5AV5 C;  2ZY3 A;  4KUD A;  4H9R A;  5AV6 C;  3AZM B;  1EQZ A;  3A1K A;  5GT3 B;  5B2J A;  2F8N A;  5G49 B;  2CV5 C;  3AZK C;  4J8U D;  3KWQ D;  1P3L D;  4G91 C;  3X1S B;  1P3F D;  2RVQ D;  1P3I C;  5BS7 C;  5B2I A;  3X1V D;  3WAA B;  5B1M D;  3REJ A;  3AZN A;  5F99 D;  1BH8 A;  2IO5 B;  5BO0 A;  5B40 A;  2BG1 A;  1KX4 B;  5AV9 D;  5B31 A;  2NZD A;  4JJN D;  1F66 D;  4YM6 B;  3WTP E;  1M19 C;  3NQU A;  3AZM C;  5BNV A;  4X23 B;  3AN2 A;  3MGS D;  5GT3 C;  4WU8 D;  2Y2G A;  4Z5T A;  1ID3 D;  3UTA A;  5B1L B;  3W96 B;  3NQJ B;  4R8P B;  3LJA D;  3AZJ A;  3EPL A;  3AZE D;  1M1A A;  3REK B;  3B0C W;  3B6G A;  3AYW D;  1P3B D;  5E5A D;  5BT1 C;  3REL D;  4Z66 D;  3WA9 C;  3WAA C;  3W99 D;  2ARO D;  1P3M A;  5AY8 A;  4E44 A;  5AVC B;  5AVB C;  1ZLA D;  3C1B D;  2FJ7 A;  5B0Z D;  2IO5 C;  3REH B;  3AV2 B;  2J8P A;  5B0Y A;  1PZR A;  3C1C B;  1M18 A;  3P5J B;  3WTP B;  5KDM B;  3VH5 A;  4YM6 C;  4H9P A;  3X1T D;  3AFA D;  3W98 D;  3AZG A;  3MGP D;  4KHA A;  3KUY A;  5AV8 D;  4YS3 D;  4CSR A;  4J8W A;  5CPJ B;  4NE5 A;  4ZUX C;  1P3O A;  5AV5 A;  5GXQ A;  3AZF B;  1KX5 B;  3KXB D;  3WKJ B;  2JCH A;  3TU4 D;  5AVC C;  4UPK A;  1P3G B;  3AZL B;  3REI B;  1JFI B;  3REH C;  2CV5 A;  1F1E A;  3AZK A;  3C1C C;  1HQ3 D;  4M6B A;  4EO5 B;  3WTP C;  5DNM D;  1H3O B;  3MVD D;  1P3K B;  3EPH A;  1P34 C;  3X1U A;  4LD9 B;  1P3I A;  5BS7 A;  1KX3 B;  1A7W A;  2YFV A;  3AZH B;  4KGC B;  1TZY D;  3LZ1 B;  2F8N D;  5GT0 B;  4XUJ B;  3A6N B;  5B24 B;  2Y2Q A;  3AL0 C;  5DNN B;  5CPJ C;  2NQB B;  3AZI B;  1KX5 C;  1B67 A;  3WKJ C;  2PYO D;  5B2I D;  3AZM A;  5GT3 A;  3REI C;  3AZN D;  1U35 B;  2HUE C;  5B32 D;  5G49 A;  5FUG B;  4EO5 C;  4ZBJ B;  1P3K C;  5B31 D;  5AV6 B;  2NZD D;  3X1S A;  1ULY A;  3UT9 D;  4WU9 B;  4LD9 C;  3WAA A;  3AN2 D;  3AZH C;  3LZ1 C;  4Z5T D;  4QLC D;  5GT0 C;  3A6N C;  5DNN C;  1M1A D;  1KX4 A;  3B0D B;  1BFM A;  4NE6 A;  3AZI C;  4YM6 A;  5B1M B;  4X23 A;  1P3M D;  5AY8 D;  1U35 C;  5F99 B;  3EPJ A;  5CP6 D;  5B1L A;  3W96 A;  3NQJ A;  3VH6 A;  4R8P A;  3O62 D;  5B0Y D;  4ZBJ C;  3REK A;  5AV9 B;  1M18 D;  4J8X D;  1M19 B;  5B33 B;  4JJN B;  1F66 B;  4WU9 C;  5CHL B;  4WNN B;  3AV1 D;  3MGS B;  3W97 D;  4WU8 B;  3UTB D;  3AZG D;  5AVC A;  1WWS A;  3REH A;  3LJA B;  4J8U C;  3KUY D;  3AV2 A;  3AZE B;  3KWQ C;  4H9O B;  3C1C A;  3B0D C;  1P3B B;  3WA9 B;  5E5A B;  1AOI D;  5KDM A;  3WTP A;  1P3L C;  1P3O D;  2RVQ C;  4Z66 B;  3X1V C;  5GXQ D;  3W99 B;  5B1M C;  5AVB B;  2Y2H A;  5F99 C;  1ZLA B;  3EPK A;  5B0Z B;  3MNN D;  5CPK B;  5GSU D;  2Y2P A;  3AZK D;  5AV9 C;  4UUZ B;  5B33 C;  4JJN C;  5CPJ A;  1F66 C;  3X1T B;  1P3A D;  3AFA B;  3AZF A;  1KX5 A;  3X1U D;  3WKJ A;  3MGS C;  3W98 B;  4WU8 C;  1N1J B;  1ID3 C;  1P3G A;  5CPI D;  3AZL A;  3REI A;  1JFI A;  3LJA C;  3AZE C;  4XZQ D;  4ZUX B;  2BYK B;  5AV8 B;  3AYW C;  4YS3 B;  5E5A C;  1P3B C;  2F2A C;  3MGR D;  1Q9C A;  3REL C;  1H3O A;  1P3K A;  4Z66 C;  3W99 C;  3VH5 T;  3KXB B;  2ARO C;  4G92 B;  1BH9 B;  3TU4 B;  1KX3 A;  1KU5 A;  1ZLA C;  3H0L C;  3C1B C;  5B0Z C;  5GT3 D;  3AZH A;  4KGC A;  5CPK C;  3LZ1 A;  4XUJ A;  5GT0 A;  4HGA C;  4WV4 B;  3R45 B;  5B24 A;  3A6N A;  1HQ3 B;  3KFU G;  1P34 B;  5DNN A;  2NQB A;  5DNM B;  2ZY5 A;  3MVD B;  2FFF B;  4H9S A;  3X1T C;  2BYM B;  3AFA C;  3AZI A;  2ZY2 A;  3X1S D;  3B0B A;  1P3P A;  3W98 C;  3MGP C;  1TZY B;  1U35 A;  3MGQ B;  5FUG A;  4CAY B;  2F8N G;  5AV8 C;  4YS3 C;  4DQY B;  1KX4 D;  2Y2K A;  5JRG D;  5AV6 A;  3KXB C;  4G92 C;  4WU9 A;  3TU4 C;  5B2I B;  2PYO B;  2HUE B;  4X23 D;  3H0M C;  3IP4 C;  4DRB A;  5B32 B;  3LZ0 D;  2HIO B;  1HQ3 C;  5B1L D;  5B32 G;  1S32 B;  4R8P D;  3LEL B;  3W96 D;  5BNX B;  4J8V B;  5DNM C;  4KUD D;  3MVD C;  3REK D;  2F8N H;  3B6F B;  5B31 G;  3UT9 B;  2Y2J A;  1EQZ D;  5B2J D;  5B1M A;  3KSY A;  4DRA A;  2ZY4 A;  1TZY C;  5AVC D;  4QLC B;  3MGQ C;  3AV2 D;  5AV9 A;  3C1C D;  1M19 A;  5B33 A;  4JJN A;  3WTP D;  1F66 A;  3REJ D;  2PYO C;  5B2I C;  4H9Q B;  4WNN A;  3MGS A;  4WU8 A;  3AZN C;  5B32 C;  5B40 D;  3F6T A;  2HIO C;  5CP6 B;  1S32 C;  3LJA A;  3LEL C;  3O62 B;  3AZE A;  4J8V C;  4H9O A;  4J8X B;  1P3B A;  3WA9 A;  5E5A A;  2NZD C;  3B6F C;  3UT9 C;  4Z66 A;  2LY8 A;  5AVB A;  3AZF D;  3W99 A;  3W97 B;  3AV1 B;  3AN2 C;  3UTA D;  3UTB B;  2W8S A;  4Z5T C;  4QLC C;  4J8U B;  1P3G D;  1ZLA A;  3AZJ D;  3AZL D;  5B0Z A;  3KWQ B;  5CPK A;  4KHA B;  3B6G D;  3EG5 B;  3VH6 T;  1P3L B;  1P3F B;  3X1V B;  4UUZ A;  1AOI B;  3X1T A;  2JE5 A;  3AFA A;  3W98 A;  5C3I B;  1P3M C;  2FJ7 D;  1KX3 D;  1N1J A;  2YFW B;  3MNN B;  5CP6 C;  4KGC D;  5GSU B;  3O62 C;  4XUJ D;  5B0Y C;  5B24 D;  4ZUX A;  1M18 C;  2BYK A; 
#chains in the Genus database with same CATH homology
 4J8X C;  5AV8 A;  4YS3 A;  2NQB D;  1P3A B;  2Y2M A;  3KXB A;  1ID3 B;  3AV1 C;  1P3P D;  3W97 C;  1BH9 A;  3UTB C;  3TU4 A;  3AZG C;  5CPI B;  2VQR A;  3VH5 W;  4WJ3 C;  3KUY C;  3AYW B;  4J8W D;  1T3U A;  4XZQ B;  3FDD A;  1P3F C;  3REL B;  1HQ3 A;  5AV5 D;  1P34 A;  1AOI C;  3MGR B;  1P3O C;  5DNM A;  2ARO B;  3MVD A;  5GXQ C;  2BYM A;  5AV6 D;  3C1B B;  5C3I C;  4WU9 D;  2DF4 C;  2CV5 D;  4HGA B;  3MNN C;  1TZY A;  5GSU C;  3MGQ A;  4H9N B;  4CAY A;  1TAF B;  1P3A C;  1P3I D;  3X1U C;  3MGP B;  3V9R B;  2PYO A;  5CPI C;  3H0R C;  5B32 A;  2XD5 A;  4XZQ C;  2HIO A;  2Y2L A;  1S32 A;  3LEL A;  3MGR C;  5BNX A;  4J8V A;  4LD9 A;  1M19 D;  5JRG B;  5B33 D;  3AZM D;  3B6F A;  3UT9 A;  2Y2N A;  2XD1 A;  1W2E A;  4QLC A;  2L5A A;  3LZ0 B;  5JA4 B;  4KUD B;  4H9R B;  5BT1 D;  3WA9 D;  3WAA D;  3X1S C;  4WZS B;  1EQZ B;  5B2J B;  2F8N B;  4H9Q A;  5AVB D;  5CP6 A;  5CPK D;  3O62 A;  1KX4 C;  4YM6 D;  4J8X A;  5JRG C;  3REJ B;  3AZN B;  3W97 A;  4X23 C;  3AV1 A;  2ZM5 A;  1BH8 B;  3UTB A;  5BO0 B;  5B40 B;  4J8U A;  1B6W A;  1HTA A;  3LZ0 C;  3KWQ A;  5B1L C;  3W96 C;  3A1I A;  5B31 B;  4R8P C;  2NZD B;  4KUD C;  1P3L A;  4ZUX D;  3REK C;  1P3F A;  3X1V A;  3NQU B;  1AOI A;  4E45 A;  5BNV B;  3AN2 B;  1EQZ C;  1R4V A;  3VH6 W;  2CWE A;  5B2J C;  4Z5T B;  5F99 A;  3B0C T;  3UTA B;  2YFW A;  3REH D;  3AZJ B;  3MNN A;  1M1A B;  5GSU A;  3B6G B;  3AV2 C;  2Y2I A;  1P34 D;  3REJ C;  4NE3 A;  1P3A A;  5AY8 B;  1P3M B;  1ID3 A;  2Y2O A;  2FJ7 B;  4NFT A;  4AWL B;  5B40 C;  5CPI A;  2DQN C;  5B0Y B;  2RIQ A;  1M18 B;  5B31 C;  3MGQ D;  3AYW A;  4XZQ A;  5CPJ D;  3REL A;  4H9P B;  3MGR A;  1KX5 D;  3WKJ D;  2ARO A;  2G5I C;  2UWX A;  3AZG B;  3AZF C;  1P3P B;  3C1B A;  3UTA C;  3REI D;  1P3G C;  4Z2M G;  3KUY B;  3AZJ C;  3AZL C;  1M1A C;  3B6G C;  4J8W B;  4CSR B;  4H9N A;  2HIO D;  1P3O B;  2G5H C;  5AV5 B;  1S32 D;  1P3K D;  5GXQ B;  3LEL D;  4J8V D;  1TAF A;  4LD9 D;  5AY8 C;  3MGP A;  3V9R A;  3B6F D;  2FJ7 C;  3AZH D;  1KX3 C;  3LZ1 D;  4AWL C;  2CV5 B;  5GT0 D;  3A6N D;  1WWI A;  3AZK B;  4KGC C;  4XUJ C;  5DNN D;  5B24 C;  4Z2M H;  2NQB C;  3AZI D;  3X1U B;  4G91 B;  2JSS A;  4H9S C;  1P3I B;  5JRG A;  1P3P C;  2YFV B;  2F8N K;  1U35 D;  3R45 A;  1Z2C B;  4J8W C;  3LZ0 A;  5JA4 A;  5AV5 C;  2ZY3 A;  4KUD A;  4H9R A;  5AV6 C;  3AZM B;  1EQZ A;  3A1K A;  5GT3 B;  5B2J A;  2F8N A;  5G49 B;  2CV5 C;  3AZK C;  4J8U D;  3KWQ D;  1P3L D;  4G91 C;  3X1S B;  1P3F D;  2RVQ D;  1P3I C;  5BS7 C;  5B2I A;  3X1V D;  3WAA B;  5B1M D;  3REJ A;  3AZN A;  5F99 D;  1BH8 A;  2IO5 B;  5BO0 A;  5B40 A;  2BG1 A;  1KX4 B;  5AV9 D;  5B31 A;  2NZD A;  4JJN D;  1F66 D;  4YM6 B;  3WTP E;  1M19 C;  3NQU A;  3AZM C;  5BNV A;  4X23 B;  3AN2 A;  3MGS D;  5GT3 C;  4WU8 D;  2Y2G A;  4Z5T A;  1ID3 D;  3UTA A;  5B1L B;  3W96 B;  3NQJ B;  4R8P B;  3LJA D;  3AZJ A;  3EPL A;  3AZE D;  1M1A A;  3REK B;  3B0C W;  3B6G A;  3AYW D;  1P3B D;  5E5A D;  5BT1 C;  3REL D;  4Z66 D;  3WA9 C;  3WAA C;  3W99 D;  2ARO D;  1P3M A;  5AY8 A;  4E44 A;  5AVC B;  5AVB C;  1ZLA D;  3C1B D;  2FJ7 A;  5B0Z D;  2IO5 C;  3REH B;  3AV2 B;  2J8P A;  5B0Y A;  1PZR A;  3C1C B;  1M18 A;  3P5J B;  3WTP B;  5KDM B;  3VH5 A;  4YM6 C;  4H9P A;  3X1T D;  3AFA D;  3W98 D;  3AZG A;  3MGP D;  4KHA A;  3KUY A;  5AV8 D;  4YS3 D;  4CSR A;  4J8W A;  5CPJ B;  4NE5 A;  4ZUX C;  1P3O A;  5AV5 A;  5GXQ A;  3AZF B;  1KX5 B;  3KXB D;  3WKJ B;  2JCH A;  3TU4 D;  5AVC C;  4UPK A;  1P3G B;  3AZL B;  3REI B;  1JFI B;  3REH C;  2CV5 A;  1F1E A;  3AZK A;  3C1C C;  1HQ3 D;  4M6B A;  4EO5 B;  3WTP C;  5DNM D;  1H3O B;  3MVD D;  1P3K B;  3EPH A;  1P34 C;  3X1U A;  4LD9 B;  1P3I A;  5BS7 A;  1KX3 B;  1A7W A;  2YFV A;  3AZH B;  4KGC B;  1TZY D;  3LZ1 B;  2F8N D;  5GT0 B;  4XUJ B;  3A6N B;  5B24 B;  2Y2Q A;  3AL0 C;  5DNN B;  5CPJ C;  2NQB B;  3AZI B;  1KX5 C;  1B67 A;  3WKJ C;  2PYO D;  5B2I D;  3AZM A;  5GT3 A;  3REI C;  3AZN D;  1U35 B;  2HUE C;  5B32 D;  5G49 A;  5FUG B;  4EO5 C;  4ZBJ B;  1P3K C;  5B31 D;  5AV6 B;  2NZD D;  3X1S A;  1ULY A;  3UT9 D;  4WU9 B;  4LD9 C;  3WAA A;  3AN2 D;  3AZH C;  3LZ1 C;  4Z5T D;  4QLC D;  5GT0 C;  3A6N C;  5DNN C;  1M1A D;  1KX4 A;  3B0D B;  1BFM A;  4NE6 A;  3AZI C;  4YM6 A;  5B1M B;  4X23 A;  1P3M D;  5AY8 D;  1U35 C;  5F99 B;  3EPJ A;  5CP6 D;  5B1L A;  3W96 A;  3NQJ A;  3VH6 A;  4R8P A;  3O62 D;  5B0Y D;  4ZBJ C;  3REK A;  5AV9 B;  1M18 D;  4J8X D;  1M19 B;  5B33 B;  4JJN B;  1F66 B;  4WU9 C;  5CHL B;  4WNN B;  3AV1 D;  3MGS B;  3W97 D;  4WU8 B;  3UTB D;  3AZG D;  5AVC A;  1WWS A;  3REH A;  3LJA B;  4J8U C;  3KUY D;  3AV2 A;  3AZE B;  3KWQ C;  4H9O B;  3C1C A;  3B0D C;  1P3B B;  3WA9 B;  5E5A B;  1AOI D;  5KDM A;  3WTP A;  1P3L C;  1P3O D;  2RVQ C;  4Z66 B;  3X1V C;  5GXQ D;  3W99 B;  5B1M C;  5AVB B;  2Y2H A;  5F99 C;  1ZLA B;  3EPK A;  5B0Z B;  3MNN D;  5CPK B;  5GSU D;  2Y2P A;  3AZK D;  5AV9 C;  4UUZ B;  5B33 C;  4JJN C;  5CPJ A;  1F66 C;  3X1T B;  1P3A D;  3AFA B;  3AZF A;  1KX5 A;  3X1U D;  3WKJ A;  3MGS C;  3W98 B;  4WU8 C;  1N1J B;  1ID3 C;  1P3G A;  5CPI D;  3AZL A;  3REI A;  1JFI A;  3LJA C;  3AZE C;  4XZQ D;  4ZUX B;  2BYK B;  5AV8 B;  3AYW C;  4YS3 B;  5E5A C;  1P3B C;  2F2A C;  3MGR D;  1Q9C A;  3REL C;  1H3O A;  1P3K A;  4Z66 C;  3W99 C;  3VH5 T;  3KXB B;  2ARO C;  4G92 B;  1BH9 B;  3TU4 B;  1KX3 A;  1KU5 A;  1ZLA C;  3H0L C;  3C1B C;  5B0Z C;  5GT3 D;  3AZH A;  4KGC A;  5CPK C;  3LZ1 A;  4XUJ A;  5GT0 A;  4HGA C;  4WV4 B;  3R45 B;  5B24 A;  3A6N A;  1HQ3 B;  3KFU G;  1P34 B;  5DNN A;  2NQB A;  5DNM B;  2ZY5 A;  3MVD B;  2FFF B;  4H9S A;  3X1T C;  2BYM B;  3AFA C;  3AZI A;  2ZY2 A;  3X1S D;  3B0B A;  1P3P A;  3W98 C;  3MGP C;  1TZY B;  1U35 A;  3MGQ B;  5FUG A;  4CAY B;  2F8N G;  5AV8 C;  4YS3 C;  4DQY B;  1KX4 D;  2Y2K A;  5JRG D;  5AV6 A;  3KXB C;  4G92 C;  4WU9 A;  3TU4 C;  5B2I B;  2PYO B;  2HUE B;  4X23 D;  3H0M C;  3IP4 C;  4DRB A;  5B32 B;  3LZ0 D;  2HIO B;  1HQ3 C;  5B1L D;  5B32 G;  1S32 B;  4R8P D;  3LEL B;  3W96 D;  5BNX B;  4J8V B;  5DNM C;  4KUD D;  3MVD C;  3REK D;  2F8N H;  3B6F B;  5B31 G;  3UT9 B;  2Y2J A;  1EQZ D;  5B2J D;  5B1M A;  3KSY A;  4DRA A;  2ZY4 A;  1TZY C;  5AVC D;  4QLC B;  3MGQ C;  3AV2 D;  5AV9 A;  3C1C D;  1M19 A;  5B33 A;  4JJN A;  3WTP D;  1F66 A;  3REJ D;  2PYO C;  5B2I C;  4H9Q B;  4WNN A;  3MGS A;  4WU8 A;  3AZN C;  5B32 C;  5B40 D;  3F6T A;  2HIO C;  5CP6 B;  1S32 C;  3LJA A;  3LEL C;  3O62 B;  3AZE A;  4J8V C;  4H9O A;  4J8X B;  1P3B A;  3WA9 A;  5E5A A;  2NZD C;  3B6F C;  3UT9 C;  4Z66 A;  2LY8 A;  5AVB A;  3AZF D;  3W99 A;  3W97 B;  3AV1 B;  3AN2 C;  3UTA D;  3UTB B;  2W8S A;  4Z5T C;  4QLC C;  4J8U B;  1P3G D;  1ZLA A;  3AZJ D;  3AZL D;  5B0Z A;  3KWQ B;  5CPK A;  4KHA B;  3B6G D;  3EG5 B;  3VH6 T;  1P3L B;  1P3F B;  3X1V B;  4UUZ A;  1AOI B;  3X1T A;  2JE5 A;  3AFA A;  3W98 A;  5C3I B;  1P3M C;  2FJ7 D;  1KX3 D;  1N1J A;  2YFW B;  3MNN B;  5CP6 C;  4KGC D;  5GSU B;  3O62 C;  4XUJ D;  5B0Y C;  5B24 D;  4ZUX A;  1M18 C;  2BYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...