4YS3D

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ys3D00
3AZGD 5F99D 3AZJB 1S32A 3WKJD 2NQBC 3B6FB 1H3OA 1KX3D 5AV5D 5AV9B 3WAAD 3MGPC 3V9RB 4WU8C 2CWEA 1F1EA 3W96D 3MNNB 3LJAB 3X1SB 1HQ3D 1KX4D 5B0ZD 3WTPA 5CPKA 3WA9A 3AZNC 5GT3C 3AZHD 3W98D 3X1VD 5B2IB 5B33A 3X1TB 1P3AD 1AOID 2AROA 3WTPE 5B0YD 4X23A 5CPJB 4YS3C 3LZ0C 5AV8B 4J8UA 5E5AD 3AZLA 3AZFC 3NQUB 4XUJD 4EO5C 1P3BC 5GSUB 5BNXB 3AZJC 4JJNA 1Q9CA 1N1JA 5B40B 3KUYA 4KGCD 4QLCB 3B6FC 1M1AB 3MGRB 5AV9C 3W99D 5B24C 3MGQB 3KXBD 5AVBB 1ZLAD 3MNNC 5DNNA 4Z5TD 5B32B 3B6GB 1EQZA 3LZ1D 1P3KA 5GXQB 2IO5B 5B2IC 1P3OB 3X1TC 1TAFA 5DNMA 3O62A 3X1UA 3WTPD 3UTBB 5CPKD 3WA9D 5CPJC 5AV8C 4R8PD 4KHAA 5B33D 3AZGB 1F66B 3LELB 3AZKB 5GSUC 2AROD 4NE6A 5B40C 1KX5B 4J8WD 4QLCC 3REHA 1KX3B 5CP6B 4X23D 2HIOD 3TU4D 3MGQC 3AV1B 3REJD 4H9SA 5AVBC 4CAYB 4ZUXD 4J8UD 3AZLD 3NQJB 3MVDB 3C1CD 3AZEA 1P3MA 1JFIB 2FJ7B 1P3IA 4JJND 2YFWA 1A7WA 5B2JD 3KUYD 3AZHB 1P34D 4YM6C 3X1VB 2PYOA 5GXQC 3MGSA 5B1MD 1P3OC 3AFAA 5BT1D 5DNND 5B0YB 1KU5A 5AY8A 4M6BA 2CV5D 3UTBC 1P3KD 3W97D 3WKJA 3A6NC 5AV5A 3KWQA 5CPID 4Z66B 4Z2MG 3AZGC 1ID3D 2LY8A 3W96A 4H9OA 1F66C 3LELC 5AV6D 3AZKC 2BYKB 1KX4A 5B0ZA 1KX5C 1KX3C 4KUDD 3C1BD 5CP6C 3KXBB 3AV1C 2F8NB 1P3FB 3VH5T 3VH5W 3W98A 3RELD 5BO0B 3MVDC 1P3AA 3UTAD 1AOIA 2FJ7C 1S32B 1H3OB 5B31G 3AZHC 1M18D 1HTAA 2RVQC 5B0YC 4XUJA 1P3MD 3REIA 4J8VD 4KGCA 4LD9D 4J8XA 5B1LD 5B33B 4Z66C 3W99A 3AFAD 1ZLAA 4Z5TA 5AY8D 4X23B 3LZ1A 3KXBC 4XZQD 1U35A 1P3FC 4J8UB 1P3GB 3REKD 3AZLB 3KWQD 1TZYA 1P3LA 5AVCC 3AN2D 4JJNB 1S32C 1N1JB 3KUYB 3AV2D 5BS7A 3AYWB 5DNNB 4G92B 3B0CT 3B0CW 4R8PA 4H9QA 1EQZB 2NZDB 1P3PD 1P3KB 5B31D 4J8WA 1M19B 5B33C 1TAFB 2HIOA 5DNMB 3TU4A 3REJA 3O62B 4ZUXA 3X1UB 3C1CA 3REID 4X23C 5FUGB 1P34A 5B2JA 4KHAB 1P3GC 4J8XD 3AZLC 5B1MA 4G91B 3LJAC 4JJNC 3X1SC 2BYMB 3REHB 3AZMD 3AYWC 2CV5A 3W97A 1U35D 4WU9D 4WNNA 5DNNC 1P3BA 1WWIA 5CPIA 3AZEB 2JSSA 1TZYD 1P3MB 1P3LD 1EQZC 1ID3A 2NZDC 4HGAB 1P3IB 3V9RA 2YFWB 5AV6A 5B24A 1P3KC 2PYOB 4KUDA 5GT0A 3MGSB 3C1BA 1M19C 5DNMC 5JRGD 3AFAB 3O62C 3RELA 3X1UC 2NQBD 5AY8B 5F99B 3MGPD 3UTAA 4E44A 3WKJB 5CHLB 5AV5B 3WAAB 3KWQB 1M1AC 3MGRC 3R45A 2F8NK 4CSRA 3W96B 4H9OB 1M18A 4G91C 1HQ3B 3AZND 1KX4B 5GT3D 5B0ZB 2HUEB 3REHC 5B32C 3B6GC 3KSYA 4H9SC 3W98B 4J8VA 4LD9A 5B1LA 2IO5C 3AZEC 1P3AB 1P3MC 1AOIB 4HGAC 1P3IC 5KDMA 4YS3D 3LZ0D 2PYOC 1B67A 3AZFD 3MGSC 3UT9A 1BH9A 4NFTA 4XZQA 5E5AB 3REKA 1P3BD 3AZJD 4XUJB 3B6FD 3REIB 5AY8C 4H9PA 4YM6A 5F99C 5AV9D 3AN2A 3AZIA 5B24D 3WKJC 3AV2A 4KGCB 3MNND 3WAAC 5AV5C 3W99B 5GT0D 3W96C 1ZLAB 4Z5TB 1HQ3C 1KX4C 5B0ZC 2HUEC 4ZBJB 3A6NA 5JA4A 3VH6A 3LZ1B 1P3PA 1U35B 3X1TD 5B31A 3W98C 3X1VC 3AZKA 1TZYB 1P3LB 1KX5A 1P3AC 1AOIC 5CPJD 3WTPB 1B6WA 5CPKB 3WA9B 4R8PB 5E5AC 3B0DB 5GSUD 4H9QB 1BH8A 4UUZA 5B40D 4XUJC 4H9RA 4QLCD 2AROB 3MGQD 4J8WB 4KGCC 5AVBD 3AZMA 3W99C 2HIOB 3TU4B 3REJB 3UT9D 1ZLAC 4ZUXB 3VH6T 3VH6W 4WU9A 4Z5TC 3C1CB 4DRBA 4ZBJC 5BNVA 4YM6D 3LZ1C 3AZID 1P34B 5B2JB 1P3OD 1TZYC 5G49A 5B1MB 1P3LC 5JRGA 4H9NA 1P3FA 2NQBA 3WTPC 3A6ND 2CV5B 5CPKC 3MGPA 4WU8A 3WA9C 3W97B 5BO0A 4EO5B 5AVCA 4WNNB 1P3BB 4R8PC 1F66D 3LELD 3AZKD 3B0DC 5CPIB 2F8NH 1KX5D 1ID3B 5CP6D 5AV6B 5B24B 3AZNA 2AROC 3AV1D 4WV4B 5GT3A 4J8WC 4WZSB 4KUDB 5GT0B 3C1BB 2HIOC 3TU4C 3MVDD 3REJC 4ZUXC 2FJ7D 4J8UC 3RELB 3C1CC 3UTAB 1P34C 3KUYC 5B2JC 3LZ0A 4YS3A 2RVQD 3R45B 2YFVA 4CSRB 3AZFA 5B1MC 1R4VA 1M18B 5BT1C 4G92C 3AZJA 1P3GA 3B6FA 2CV5C 5AV9A 4Z66D 3W97C 4J8VB 4LD9B 3MNNA 3LJAA 5C3IB 5B1LB 3X1SA 5CPIC 1ID3C 3AYWA 5KDMB 5AV6C 2F8ND 1P3FD 4KUDC 5GT0C 3C1BC 4WU8D 3UT9B 1BH9B 4XZQB 5B2IA 5AVCD 3X1TA 2NZDA 2L5AA 3REKB 3RELC 1S32D 4YM6B 4H9PB 3UTAC 3AN2B 3AZIB 1M19A 3AV2B 5CPJA 5AV8A 4E45A 3NQUA 1M18C 5GSUA 5FUGA 5BNXA 3A6NB 5B40A 5JA4B 4QLCA 4AWLB 1M1AA 3MGRA 1P3PB 4NE3A 5B31B 3MGQA 4J8VC 4LD9C 5AVBA 4NE5A 5C3IC 5B1LC 2BYMA 5B32G 5B32A 3B6GA 3AFAC 1P3GD 5GXQA 3UT9C 4XZQC 1P3OA 3VH5A 3REKC 4J8XB 3LJAD 1BH8B 4UUZB 3X1SD 3KWQC 4H9RB 3AYWD 3AN2C 3AZIC 3UTBA 3AV2C 3AZMB 5B2ID 1EQZD 3AZGA 4WU9B 2NZDD 5F99A 1F66A 3LELA 5BNVB 1KX3A 3WAAA 4AWLC 1P3PC 3B0BA 5CP6A 1M19D 5DNMD 3AV1A 5B31C 1WWSA 3O62D 4CAYA 5AV8D 1HQ3A 5G49B 3X1UD 5JRGB 3NQJA 3MVDA 1JFIA 2FJ7A 4Z2MH 4H9NB 2NQBB 3AZHA 3REIC 3MGPB 4WU8B 3MGRD 3X1VA 1M1AD 5AVCB 4J8XC 3REHD 5B32D 5B0YA 3B6GD 1BFMA 3AZNB 1ULYA 5GT3B 3AZMC 5E5AA 5GXQD 4DRAA 4Z66A 3AZED 1U35C 4WU9C 1P3ID 2BYKA 2PYOD 3UTBD 3MGSD 3LZ0B 3KXBA 4YS3B 2F8NG 2F8NA 5BS7C 2YFVB 3AZFB 5JRGC
chains in the Genus database with same CATH superfamily
3AZGD 5F99D 3AZJB 1S32A 3WKJD 2NQBC 3B6FB 1H3OA 1KX3D 5AV5D 5AV9B 3WAAD 3MGPC 3V9RB 4WU8C 2CWEA 1F1EA 3W96D 3MNNB 3LJAB 3X1SB 1HQ3D 1KX4D 5B0ZD 3WTPA 5CPKA 2W8SA 3WA9A 3AZNC 5GT3C 3AZHD 3W98D 3X1VD 5B2IB 2FFFB 5B33A 3X1TB 1P3AD 1AOID 4DQYB 2AROA 3WTPE 5B0YD 4X23A 5CPJB 4YS3C 3LZ0C 5AV8B 4J8UA 5E5AD 3AZLA 3AZFC 3NQUB 4XUJD 4EO5C 1P3BC 5GSUB 1T3UA 5BNXB 3AZJC 4JJNA 1Q9CA 1N1JA 5B40B 3KUYA 4KGCD 4QLCB 3B6FC 1M1AB 3MGRB 5AV9C 3W99D 5B24C 3MGQB 3KXBD 5AVBB 1ZLAD 3MNNC 5DNNA 4Z5TD 5B32B 3B6GB 1EQZA 3LZ1D 1W2EA 1P3KA 2ZY3A 5GXQB 2IO5B 5B2IC 1P3OB 3X1TC 2Y2HA 1TAFA 5DNMA 3O62A 3X1UA 3WTPD 3UTBB 5CPKD 3WA9D 5CPJC 5AV8C 4R8PD 4KHAA 5B33D 3AZGB 1F66B 1Z2CB 3LELB 3AZKB 5GSUC 2AROD 4NE6A 5B40C 1KX5B 4J8WD 4QLCC 3REHA 1KX3B 2Y2JA 5CP6B 4X23D 2HIOD 3TU4D 3MGQC 3AV1B 3REJD 4H9SA 5AVBC 4CAYB 4ZUXD 4J8UD 3AZLD 2Y2NA 3NQJB 3MVDB 3C1CD 3AZEA 1P3MA 1JFIB 2FJ7B 1P3IA 4JJND 2YFWA 1A7WA 5B2JD 3KUYD 3AZHB 1P34D 4YM6C 3X1VB 2PYOA 5GXQC 3A1IA 3MGSA 5B1MD 1P3OC 3AFAA 5BT1D 1PZRA 5DNND 5B0YB 1KU5A 5AY8A 4M6BA 3EPLA 3UTBC 2CV5D 1P3KD 3W97D 3WKJA 3A6NC 5AV5A 3KWQA 5CPID 4Z66B 4Z2MG 3AZGC 1ID3D 2LY8A 3W96A 4H9OA 1F66C 3LELC 5AV6D 3AZKC 2BYKB 1KX4A 5B0ZA 1KX5C 1KX3C 4KUDD 3C1BD 5CP6C 3KXBB 3AV1C 2F8NB 1P3FB 3VH5T 3VH5W 3W98A 3RELD 2JE5A 5BO0B 3MVDC 1P3AA 3UTAD 1AOIA 2FJ7C 1S32B 1H3OB 5B31G 3AZHC 2Y2GA 1M18D 1HTAA 2RVQC 5B0YC 4XUJA 1P3MD 3REIA 3A1KA 3EPJA 4J8VD 4KGCA 4LD9D 4J8XA 5B1LD 5B33B 4Z66C 3W99A 3AFAD 1ZLAA 4Z5TA 5AY8D 4X23B 2Y2LA 3LZ1A 3KXBC 4XZQD 1U35A 1P3FC 4J8UB 1P3GB 3REKD 3AZLB 3KWQD 1TZYA 1P3LA 5AVCC 3AN2D 4JJNB 1S32C 1N1JB 3KUYB 3AV2D 4WJ3C 5BS7A 3AYWB 5DNNB 4G92B 3B0CT 3B0CW 4R8PA 4H9QA 1EQZB 2NZDB 2JCHA 1P3PD 1P3KB 2J8PA 5B31D 4J8WA 1M19B 5B33C 1TAFB 2HIOA 5DNMB 3TU4A 3REJA 3O62B 3FDDA 4ZUXA 3X1UB 3H0RC 3C1CA 3REID 4X23C 5FUGB 1P34A 5B2JA 4KHAB 1P3GC 4J8XD 3AZLC 5B1MA 4G91B 3LJAC 4JJNC 3X1SC 2BYMB 2ZY4A 3REHB 3AZMD 3AYWC 3F6TA 2CV5A 3W97A 1U35D 4WU9D 4WNNA 5DNNC 1P3BA 1WWIA 5CPIA 3AZEB 2JSSA 1TZYD 1P3MB 1P3LD 1EQZC 1ID3A 2NZDC 4HGAB 1P3IB 3V9RA 2YFWB 5AV6A 5B24A 1P3KC 2PYOB 4KUDA 5GT0A 3MGSB 3C1BA 1M19C 5DNMC 5JRGD 3AFAB 3O62C 3EPKA 3RELA 3X1UC 2NQBD 5AY8B 5F99B 3MGPD 3UTAA 4E44A 3WKJB 5CHLB 5AV5B 3WAAB 3KWQB 1M1AC 3MGRC 3R45A 2F8NK 4CSRA 3W96B 4H9OB 1M18A 4G91C 1HQ3B 2Y2MA 3AZND 1KX4B 5GT3D 5B0ZB 2HUEB 3REHC 5B32C 3B6GC 3KSYA 4H9SC 3W98B 4J8VA 2DQNC 4LD9A 2F2AC 5B1LA 2IO5C 3H0LC 3AZEC 1P3AB 1P3MC 1AOIB 4HGAC 1P3IC 2RIQA 5KDMA 4YS3D 3LZ0D 2PYOC 1B67A 3KFUG 3AZFD 3MGSC 3UT9A 1BH9A 4NFTA 4XZQA 5E5AB 3REKA 1P3BD 3AZJD 4XUJB 3B6FD 3REIB 5AY8C 4H9PA 4YM6A 3EPHA 5F99C 5AV9D 3AN2A 3AZIA 5B24D 3WKJC 3AV2A 4KGCB 2Y2PA 3MNND 2BG1A 3WAAC 5AV5C 3W99B 5GT0D 3W96C 1ZLAB 4Z5TB 1HQ3C 1KX4C 5B0ZC 2HUEC 4ZBJB 3A6NA 5JA4A 3VH6A 3LZ1B 2XD5A 1P3PA 1U35B 3X1TD 5B31A 3W98C 3X1VC 3AZKA 1TZYB 1P3LB 1KX5A 1P3AC 1AOIC 5CPJD 3WTPB 1B6WA 3H0MC 5CPKB 3WA9B 4R8PB 5E5AC 3B0DB 5GSUD 4H9QB 1BH8A 4UUZA 5B40D 4XUJC 4H9RA 4QLCD 2AROB 3MGQD 4J8WB 4KGCC 5AVBD 3AZMA 3W99C 2HIOB 3TU4B 3REJB 3UT9D 1ZLAC 4ZUXB 3VH6T 3VH6W 4WU9A 4Z5TC 3C1CB 4DRBA 4ZBJC 5BNVA 4YM6D 3LZ1C 3AZID 1P34B 5B2JB 1P3OD 1TZYC 5G49A 5B1MB 1P3LC 3IP4C 5JRGA 4H9NA 1P3FA 2NQBA 3WTPC 3A6ND 2CV5B 5CPKC 3MGPA 4WU8A 3WA9C 3W97B 5BO0A 4EO5B 5AVCA 4WNNB 1P3BB 2XD1A 4R8PC 1F66D 3LELD 3AZKD 3B0DC 5CPIB 2F8NH 1KX5D 1ID3B 5CP6D 5AV6B 5B24B 3AZNA 2AROC 3AV1D 4WV4B 5GT3A 4J8WC 4WZSB 4KUDB 5GT0B 3C1BB 2Y2KA 2HIOC 3TU4C 3MVDD 3REJC 4ZUXC 2FJ7D 4J8UC 3RELB 3C1CC 3UTAB 1P34C 3KUYC 5B2JC 3LZ0A 4YS3A 2RVQD 3R45B 2YFVA 2Y2IA 4CSRB 3AZFA 5B1MC 1R4VA 1M18B 5BT1C 4G92C 2DF4C 3AZJA 1P3GA 3B6FA 2CV5C 5AV9A 4Z66D 3W97C 4J8VB 4LD9B 3MNNA 3LJAA 5C3IB 5B1LB 3X1SA 5CPIC 1ID3C 3AYWA 5KDMB 5AV6C 2F8ND 1P3FD 2Y2QA 4KUDC 5GT0C 3C1BC 4WU8D 3UT9B 1BH9B 4XZQB 5B2IA 5AVCD 3X1TA 2NZDA 2G5IC 2L5AA 3REKB 3RELC 1S32D 4YM6B 4H9PB 3EG5B 3UTAC 3AN2B 3AZIB 1M19A 3AV2B 5CPJA 5AV8A 4E45A 3NQUA 1M18C 5GSUA 5FUGA 5BNXA 3A6NB 5B40A 5JA4B 4QLCA 2VQRA 4AWLB 1M1AA 3MGRA 1P3PB 3P5JB 4NE3A 5B31B 3MGQA 4J8VC 4LD9C 5AVBA 4NE5A 5C3IC 5B1LC 2BYMA 5B32G 5B32A 3B6GA 3AFAC 1P3GD 5GXQA 3UT9C 4XZQC 1P3OA 3VH5A 2ZY2A 3REKC 4J8XB 3LJAD 1BH8B 4UUZB 3X1SD 3KWQC 4H9RB 3AYWD 2ZY5A 3AN2C 3AZIC 3UTBA 3AV2C 2Y2OA 3AZMB 5B2ID 1EQZD 3AZGA 4WU9B 2NZDD 5F99A 1F66A 3LELA 5BNVB 1KX3A 3WAAA 4AWLC 2UWXA 1P3PC 3B0BA 5CP6A 1M19D 5DNMD 3AV1A 5B31C 1WWSA 3O62D 4CAYA 5AV8D 1HQ3A 5G49B 3X1UD 3AL0C 5JRGB 2G5HC 3NQJA 3MVDA 1JFIA 2FJ7A 4Z2MH 4H9NB 2NQBB 3AZHA 3REIC 3MGPB 4WU8B 3MGRD 3X1VA 1M1AD 5AVCB 4J8XC 4UPKA 3REHD 5B32D 5B0YA 3B6GD 1BFMA 3AZNB 1ULYA 5GT3B 3AZMC 5E5AA 5GXQD 4DRAA 4Z66A 3AZED 1U35C 2ZM5A 4WU9C 1P3ID 2BYKA 2PYOD 3UTBD 3MGSD 3LZ0B 3KXBA 4YS3B 2F8NG 2F8NA 5BS7C 2YFVB 3AZFB 5JRGC
chains in the Genus database with same CATH topology
3AZGD 5F99D 3AZJB 1S32A 3WKJD 2NQBC 3B6FB 1H3OA 1KX3D 5AV5D 5AV9B 3WAAD 3MGPC 3V9RB 4WU8C 2CWEA 1F1EA 3W96D 3MNNB 3LJAB 3X1SB 1HQ3D 1KX4D 5B0ZD 3WTPA 5CPKA 2W8SA 3WA9A 3AZNC 5GT3C 3AZHD 3W98D 3X1VD 5B2IB 2FFFB 5B33A 3X1TB 1P3AD 1AOID 4DQYB 2AROA 3WTPE 5B0YD 4X23A 5CPJB 4YS3C 3LZ0C 5AV8B 4J8UA 5E5AD 3AZLA 3AZFC 3NQUB 4XUJD 4EO5C 1P3BC 5GSUB 1T3UA 5BNXB 3AZJC 4JJNA 1Q9CA 1N1JA 5B40B 3KUYA 4KGCD 4QLCB 3B6FC 1M1AB 3MGRB 5AV9C 3W99D 5B24C 3MGQB 3KXBD 5AVBB 1ZLAD 3MNNC 5DNNA 4Z5TD 5B32B 3B6GB 1EQZA 3LZ1D 1W2EA 1P3KA 2ZY3A 5GXQB 2IO5B 5B2IC 1P3OB 3X1TC 2Y2HA 1TAFA 5DNMA 3O62A 3X1UA 3WTPD 3UTBB 5CPKD 3WA9D 5CPJC 5AV8C 4R8PD 4KHAA 5B33D 3AZGB 1F66B 1Z2CB 3LELB 3AZKB 5GSUC 2AROD 4NE6A 5B40C 1KX5B 4J8WD 4QLCC 3REHA 1KX3B 2Y2JA 5CP6B 4X23D 2HIOD 3TU4D 3MGQC 3AV1B 3REJD 4H9SA 5AVBC 4CAYB 4ZUXD 4J8UD 3AZLD 2Y2NA 3NQJB 3MVDB 3C1CD 3AZEA 1P3MA 1JFIB 2FJ7B 1P3IA 4JJND 2YFWA 1A7WA 5B2JD 3KUYD 3AZHB 1P34D 4YM6C 3X1VB 2PYOA 5GXQC 3A1IA 3MGSA 5B1MD 1P3OC 3AFAA 5BT1D 1PZRA 5DNND 5B0YB 1KU5A 5AY8A 4M6BA 3EPLA 3UTBC 2CV5D 1P3KD 3W97D 3WKJA 3A6NC 5AV5A 3KWQA 5CPID 4Z66B 4Z2MG 3AZGC 1ID3D 2LY8A 3W96A 4H9OA 1F66C 3LELC 5AV6D 3AZKC 2BYKB 1KX4A 5B0ZA 1KX5C 1KX3C 4KUDD 3C1BD 5CP6C 3KXBB 3AV1C 2F8NB 1P3FB 3VH5T 3VH5W 3W98A 3RELD 2JE5A 5BO0B 3MVDC 1P3AA 3UTAD 1AOIA 2FJ7C 1S32B 1H3OB 5B31G 3AZHC 2Y2GA 1M18D 1HTAA 2RVQC 5B0YC 4XUJA 1P3MD 3REIA 3A1KA 3EPJA 4J8VD 4KGCA 4LD9D 4J8XA 5B1LD 5B33B 4Z66C 3W99A 3AFAD 1ZLAA 4Z5TA 5AY8D 4X23B 2Y2LA 3LZ1A 3KXBC 4XZQD 1U35A 1P3FC 4J8UB 1P3GB 3REKD 3AZLB 3KWQD 1TZYA 1P3LA 5AVCC 3AN2D 4JJNB 1S32C 1N1JB 3KUYB 3AV2D 4WJ3C 5BS7A 3AYWB 5DNNB 4G92B 3B0CT 3B0CW 4R8PA 4H9QA 1EQZB 2NZDB 2JCHA 1P3PD 1P3KB 2J8PA 5B31D 4J8WA 1M19B 5B33C 1TAFB 2HIOA 5DNMB 3TU4A 3REJA 3O62B 3FDDA 4ZUXA 3X1UB 3H0RC 3C1CA 3REID 4X23C 5FUGB 1P34A 5B2JA 4KHAB 1P3GC 4J8XD 3AZLC 5B1MA 4G91B 3LJAC 4JJNC 3X1SC 2BYMB 2ZY4A 3REHB 3AZMD 3AYWC 3F6TA 2CV5A 3W97A 1U35D 4WU9D 4WNNA 5DNNC 1P3BA 1WWIA 5CPIA 3AZEB 2JSSA 1TZYD 1P3MB 1P3LD 1EQZC 1ID3A 2NZDC 4HGAB 1P3IB 3V9RA 2YFWB 5AV6A 5B24A 1P3KC 2PYOB 4KUDA 5GT0A 3MGSB 3C1BA 1M19C 5DNMC 5JRGD 3AFAB 3O62C 3EPKA 3RELA 3X1UC 2NQBD 5AY8B 5F99B 3MGPD 3UTAA 4E44A 3WKJB 5CHLB 5AV5B 3WAAB 3KWQB 1M1AC 3MGRC 3R45A 2F8NK 4CSRA 3W96B 4H9OB 1M18A 4G91C 1HQ3B 2Y2MA 3AZND 1KX4B 5GT3D 5B0ZB 2HUEB 3REHC 5B32C 3B6GC 3KSYA 4H9SC 3W98B 4J8VA 2DQNC 4LD9A 2F2AC 5B1LA 2IO5C 3H0LC 3AZEC 1P3AB 1P3MC 1AOIB 4HGAC 1P3IC 2RIQA 5KDMA 4YS3D 3LZ0D 2PYOC 1B67A 3KFUG 3AZFD 3MGSC 3UT9A 1BH9A 4NFTA 4XZQA 5E5AB 3REKA 1P3BD 3AZJD 4XUJB 3B6FD 3REIB 5AY8C 4H9PA 4YM6A 3EPHA 5F99C 5AV9D 3AN2A 3AZIA 5B24D 3WKJC 3AV2A 4KGCB 2Y2PA 3MNND 2BG1A 3WAAC 5AV5C 3W99B 5GT0D 3W96C 1ZLAB 4Z5TB 1HQ3C 1KX4C 5B0ZC 2HUEC 4ZBJB 3A6NA 5JA4A 3VH6A 3LZ1B 2XD5A 1P3PA 1U35B 3X1TD 5B31A 3W98C 3X1VC 3AZKA 1TZYB 1P3LB 1KX5A 1P3AC 1AOIC 5CPJD 3WTPB 1B6WA 3H0MC 5CPKB 3WA9B 4R8PB 5E5AC 3B0DB 5GSUD 4H9QB 1BH8A 4UUZA 5B40D 4XUJC 4H9RA 4QLCD 2AROB 3MGQD 4J8WB 4KGCC 5AVBD 3AZMA 3W99C 2HIOB 3TU4B 3REJB 3UT9D 1ZLAC 4ZUXB 3VH6T 3VH6W 4WU9A 4Z5TC 3C1CB 4DRBA 4ZBJC 5BNVA 4YM6D 3LZ1C 3AZID 1P34B 5B2JB 1P3OD 1TZYC 5G49A 5B1MB 1P3LC 3IP4C 5JRGA 4H9NA 1P3FA 2NQBA 3WTPC 3A6ND 2CV5B 5CPKC 3MGPA 4WU8A 3WA9C 3W97B 5BO0A 4EO5B 5AVCA 4WNNB 1P3BB 2XD1A 4R8PC 1F66D 3LELD 3AZKD 3B0DC 5CPIB 2F8NH 1KX5D 1ID3B 5CP6D 5AV6B 5B24B 3AZNA 2AROC 3AV1D 4WV4B 5GT3A 4J8WC 4WZSB 4KUDB 5GT0B 3C1BB 2Y2KA 2HIOC 3TU4C 3MVDD 3REJC 4ZUXC 2FJ7D 4J8UC 3RELB 3C1CC 3UTAB 1P34C 3KUYC 5B2JC 3LZ0A 4YS3A 2RVQD 3R45B 2YFVA 2Y2IA 4CSRB 3AZFA 5B1MC 1R4VA 1M18B 5BT1C 4G92C 2DF4C 3AZJA 1P3GA 3B6FA 2CV5C 5AV9A 4Z66D 3W97C 4J8VB 4LD9B 3MNNA 3LJAA 5C3IB 5B1LB 3X1SA 5CPIC 1ID3C 3AYWA 5KDMB 5AV6C 2F8ND 1P3FD 2Y2QA 4KUDC 5GT0C 3C1BC 4WU8D 3UT9B 1BH9B 4XZQB 5B2IA 5AVCD 3X1TA 2NZDA 2G5IC 2L5AA 3REKB 3RELC 1S32D 4YM6B 4H9PB 3EG5B 3UTAC 3AN2B 3AZIB 1M19A 3AV2B 5CPJA 5AV8A 4E45A 3NQUA 1M18C 5GSUA 5FUGA 5BNXA 3A6NB 5B40A 5JA4B 4QLCA 2VQRA 4AWLB 1M1AA 3MGRA 1P3PB 3P5JB 4NE3A 5B31B 3MGQA 4J8VC 4LD9C 5AVBA 4NE5A 5C3IC 5B1LC 2BYMA 5B32G 5B32A 3B6GA 3AFAC 1P3GD 5GXQA 3UT9C 4XZQC 1P3OA 3VH5A 2ZY2A 3REKC 4J8XB 3LJAD 1BH8B 4UUZB 3X1SD 3KWQC 4H9RB 3AYWD 2ZY5A 3AN2C 3AZIC 3UTBA 3AV2C 2Y2OA 3AZMB 5B2ID 1EQZD 3AZGA 4WU9B 2NZDD 5F99A 1F66A 3LELA 5BNVB 1KX3A 3WAAA 4AWLC 2UWXA 1P3PC 3B0BA 5CP6A 1M19D 5DNMD 3AV1A 5B31C 1WWSA 3O62D 4CAYA 5AV8D 1HQ3A 5G49B 3X1UD 3AL0C 5JRGB 2G5HC 3NQJA 3MVDA 1JFIA 2FJ7A 4Z2MH 4H9NB 2NQBB 3AZHA 3REIC 3MGPB 4WU8B 3MGRD 3X1VA 1M1AD 5AVCB 4J8XC 4UPKA 3REHD 5B32D 5B0YA 3B6GD 1BFMA 3AZNB 1ULYA 5GT3B 3AZMC 5E5AA 5GXQD 4DRAA 4Z66A 3AZED 1U35C 2ZM5A 4WU9C 1P3ID 2BYKA 2PYOD 3UTBD 3MGSD 3LZ0B 3KXBA 4YS3B 2F8NG 2F8NA 5BS7C 2YFVB 3AZFB 5JRGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZG D;  5F99 D;  3AZJ B;  1S32 A;  3WKJ D;  2NQB C;  3B6F B;  1H3O A;  1KX3 D;  5AV5 D;  5AV9 B;  3WAA D;  3MGP C;  3V9R B;  4WU8 C;  2CWE A;  1F1E A;  3W96 D;  3MNN B;  3LJA B;  3X1S B;  1HQ3 D;  1KX4 D;  5B0Z D;  3WTP A;  5CPK A;  3WA9 A;  3AZN C;  5GT3 C;  3AZH D;  3W98 D;  3X1V D;  5B2I B;  5B33 A;  3X1T B;  1P3A D;  1AOI D;  2ARO A;  3WTP E;  5B0Y D;  4X23 A;  5CPJ B;  4YS3 C;  3LZ0 C;  5AV8 B;  4J8U A;  5E5A D;  3AZL A;  3AZF C;  3NQU B;  4XUJ D;  4EO5 C;  1P3B C;  5GSU B;  5BNX B;  3AZJ C;  4JJN A;  1Q9C A;  1N1J A;  5B40 B;  3KUY A;  4KGC D;  4QLC B;  3B6F C;  1M1A B;  3MGR B;  5AV9 C;  3W99 D;  5B24 C;  3MGQ B;  3KXB D;  5AVB B;  1ZLA D;  3MNN C;  5DNN A;  4Z5T D;  5B32 B;  3B6G B;  1EQZ A;  3LZ1 D;  1P3K A;  5GXQ B;  2IO5 B;  5B2I C;  1P3O B;  3X1T C;  1TAF A;  5DNM A;  3O62 A;  3X1U A;  3WTP D;  3UTB B;  5CPK D;  3WA9 D;  5CPJ C;  5AV8 C;  4R8P D;  4KHA A;  5B33 D;  3AZG B;  1F66 B;  3LEL B;  3AZK B;  5GSU C;  2ARO D;  4NE6 A;  5B40 C;  1KX5 B;  4J8W D;  4QLC C;  3REH A;  1KX3 B;  5CP6 B;  4X23 D;  2HIO D;  3TU4 D;  3MGQ C;  3AV1 B;  3REJ D;  4H9S A;  5AVB C;  4CAY B;  4ZUX D;  4J8U D;  3AZL D;  3NQJ B;  3MVD B;  3C1C D;  3AZE A;  1P3M A;  1JFI B;  2FJ7 B;  1P3I A;  4JJN D;  2YFW A;  1A7W A;  5B2J D;  3KUY D;  3AZH B;  1P34 D;  4YM6 C;  3X1V B;  2PYO A;  5GXQ C;  3MGS A;  5B1M D;  1P3O C;  3AFA A;  5BT1 D;  5DNN D;  5B0Y B;  1KU5 A;  5AY8 A;  4M6B A;  2CV5 D;  3UTB C;  1P3K D;  3W97 D;  3WKJ A;  3A6N C;  5AV5 A;  3KWQ A;  5CPI D;  4Z66 B;  4Z2M G;  3AZG C;  1ID3 D;  2LY8 A;  3W96 A;  4H9O A;  1F66 C;  3LEL C;  5AV6 D;  3AZK C;  2BYK B;  1KX4 A;  5B0Z A;  1KX5 C;  1KX3 C;  4KUD D;  3C1B D;  5CP6 C;  3KXB B;  3AV1 C;  2F8N B;  1P3F B;  3VH5 T;  3VH5 W;  3W98 A;  3REL D;  5BO0 B;  3MVD C;  1P3A A;  3UTA D;  1AOI A;  2FJ7 C;  1S32 B;  1H3O B;  5B31 G;  3AZH C;  1M18 D;  1HTA A;  2RVQ C;  5B0Y C;  4XUJ A;  1P3M D;  3REI A;  4J8V D;  4KGC A;  4LD9 D;  4J8X A;  5B1L D;  5B33 B;  4Z66 C;  3W99 A;  3AFA D;  1ZLA A;  4Z5T A;  5AY8 D;  4X23 B;  3LZ1 A;  3KXB C;  4XZQ D;  1U35 A;  1P3F C;  4J8U B;  1P3G B;  3REK D;  3AZL B;  3KWQ D;  1TZY A;  1P3L A;  5AVC C;  3AN2 D;  4JJN B;  1S32 C;  1N1J B;  3KUY B;  3AV2 D;  5BS7 A;  3AYW B;  5DNN B;  4G92 B;  3B0C T;  3B0C W;  4R8P A;  4H9Q A;  1EQZ B;  2NZD B;  1P3P D;  1P3K B;  5B31 D;  4J8W A;  1M19 B;  5B33 C;  1TAF B;  2HIO A;  5DNM B;  3TU4 A;  3REJ A;  3O62 B;  4ZUX A;  3X1U B;  3C1C A;  3REI D;  4X23 C;  5FUG B;  1P34 A;  5B2J A;  4KHA B;  1P3G C;  4J8X D;  3AZL C;  5B1M A;  4G91 B;  3LJA C;  4JJN C;  3X1S C;  2BYM B;  3REH B;  3AZM D;  3AYW C;  2CV5 A;  3W97 A;  1U35 D;  4WU9 D;  4WNN A;  5DNN C;  1P3B A;  1WWI A;  5CPI A;  3AZE B;  2JSS A;  1TZY D;  1P3M B;  1P3L D;  1EQZ C;  1ID3 A;  2NZD C;  4HGA B;  1P3I B;  3V9R A;  2YFW B;  5AV6 A;  5B24 A;  1P3K C;  2PYO B;  4KUD A;  5GT0 A;  3MGS B;  3C1B A;  1M19 C;  5DNM C;  5JRG D;  3AFA B;  3O62 C;  3REL A;  3X1U C;  2NQB D;  5AY8 B;  5F99 B;  3MGP D;  3UTA A;  4E44 A;  3WKJ B;  5CHL B;  5AV5 B;  3WAA B;  3KWQ B;  1M1A C;  3MGR C;  3R45 A;  2F8N K;  4CSR A;  3W96 B;  4H9O B;  1M18 A;  4G91 C;  1HQ3 B;  3AZN D;  1KX4 B;  5GT3 D;  5B0Z B;  2HUE B;  3REH C;  5B32 C;  3B6G C;  3KSY A;  4H9S C;  3W98 B;  4J8V A;  4LD9 A;  5B1L A;  2IO5 C;  3AZE C;  1P3A B;  1P3M C;  1AOI B;  4HGA C;  1P3I C;  5KDM A;  4YS3 D;  3LZ0 D;  2PYO C;  1B67 A;  3AZF D;  3MGS C;  3UT9 A;  1BH9 A;  4NFT A;  4XZQ A;  5E5A B;  3REK A;  1P3B D;  3AZJ D;  4XUJ B;  3B6F D;  3REI B;  5AY8 C;  4H9P A;  4YM6 A;  5F99 C;  5AV9 D;  3AN2 A;  3AZI A;  5B24 D;  3WKJ C;  3AV2 A;  4KGC B;  3MNN D;  3WAA C;  5AV5 C;  3W99 B;  5GT0 D;  3W96 C;  1ZLA B;  4Z5T B;  1HQ3 C;  1KX4 C;  5B0Z C;  2HUE C;  4ZBJ B;  3A6N A;  5JA4 A;  3VH6 A;  3LZ1 B;  1P3P A;  1U35 B;  3X1T D;  5B31 A;  3W98 C;  3X1V C;  3AZK A;  1TZY B;  1P3L B;  1KX5 A;  1P3A C;  1AOI C;  5CPJ D;  3WTP B;  1B6W A;  5CPK B;  3WA9 B;  4R8P B;  5E5A C;  3B0D B;  5GSU D;  4H9Q B;  1BH8 A;  4UUZ A;  5B40 D;  4XUJ C;  4H9R A;  4QLC D;  2ARO B;  3MGQ D;  4J8W B;  4KGC C;  5AVB D;  3AZM A;  3W99 C;  2HIO B;  3TU4 B;  3REJ B;  3UT9 D;  1ZLA C;  4ZUX B;  3VH6 T;  3VH6 W;  4WU9 A;  4Z5T C;  3C1C B;  4DRB A;  4ZBJ C;  5BNV A;  4YM6 D;  3LZ1 C;  3AZI D;  1P34 B;  5B2J B;  1P3O D;  1TZY C;  5G49 A;  5B1M B;  1P3L C;  5JRG A;  4H9N A;  1P3F A;  2NQB A;  3WTP C;  3A6N D;  2CV5 B;  5CPK C;  3MGP A;  4WU8 A;  3WA9 C;  3W97 B;  5BO0 A;  4EO5 B;  5AVC A;  4WNN B;  1P3B B;  4R8P C;  1F66 D;  3LEL D;  3AZK D;  3B0D C;  5CPI B;  2F8N H;  1KX5 D;  1ID3 B;  5CP6 D;  5AV6 B;  5B24 B;  3AZN A;  2ARO C;  3AV1 D;  4WV4 B;  5GT3 A;  4J8W C;  4WZS B;  4KUD B;  5GT0 B;  3C1B B;  2HIO C;  3TU4 C;  3MVD D;  3REJ C;  4ZUX C;  2FJ7 D;  4J8U C;  3REL B;  3C1C C;  3UTA B;  1P34 C;  3KUY C;  5B2J C;  3LZ0 A;  4YS3 A;  2RVQ D;  3R45 B;  2YFV A;  4CSR B;  3AZF A;  5B1M C;  1R4V A;  1M18 B;  5BT1 C;  4G92 C;  3AZJ A;  1P3G A;  3B6F A;  2CV5 C;  5AV9 A;  4Z66 D;  3W97 C;  4J8V B;  4LD9 B;  3MNN A;  3LJA A;  5C3I B;  5B1L B;  3X1S A;  5CPI C;  1ID3 C;  3AYW A;  5KDM B;  5AV6 C;  2F8N D;  1P3F D;  4KUD C;  5GT0 C;  3C1B C;  4WU8 D;  3UT9 B;  1BH9 B;  4XZQ B;  5B2I A;  5AVC D;  3X1T A;  2NZD A;  2L5A A;  3REK B;  3REL C;  1S32 D;  4YM6 B;  4H9P B;  3UTA C;  3AN2 B;  3AZI B;  1M19 A;  3AV2 B;  5CPJ A;  5AV8 A;  4E45 A;  3NQU A;  1M18 C;  5GSU A;  5FUG A;  5BNX A;  3A6N B;  5B40 A;  5JA4 B;  4QLC A;  4AWL B;  1M1A A;  3MGR A;  1P3P B;  4NE3 A;  5B31 B;  3MGQ A;  4J8V C;  4LD9 C;  5AVB A;  4NE5 A;  5C3I C;  5B1L C;  2BYM A;  5B32 G;  5B32 A;  3B6G A;  3AFA C;  1P3G D;  5GXQ A;  3UT9 C;  4XZQ C;  1P3O A;  3VH5 A;  3REK C;  4J8X B;  3LJA D;  1BH8 B;  4UUZ B;  3X1S D;  3KWQ C;  4H9R B;  3AYW D;  3AN2 C;  3AZI C;  3UTB A;  3AV2 C;  3AZM B;  5B2I D;  1EQZ D;  3AZG A;  4WU9 B;  2NZD D;  5F99 A;  1F66 A;  3LEL A;  5BNV B;  1KX3 A;  3WAA A;  4AWL C;  1P3P C;  3B0B A;  5CP6 A;  1M19 D;  5DNM D;  3AV1 A;  5B31 C;  1WWS A;  3O62 D;  4CAY A;  5AV8 D;  1HQ3 A;  5G49 B;  3X1U D;  5JRG B;  3NQJ A;  3MVD A;  1JFI A;  2FJ7 A;  4Z2M H;  4H9N B;  2NQB B;  3AZH A;  3REI C;  3MGP B;  4WU8 B;  3MGR D;  3X1V A;  1M1A D;  5AVC B;  4J8X C;  3REH D;  5B32 D;  5B0Y A;  3B6G D;  1BFM A;  3AZN B;  1ULY A;  5GT3 B;  3AZM C;  5E5A A;  5GXQ D;  4DRA A;  4Z66 A;  3AZE D;  1U35 C;  4WU9 C;  1P3I D;  2BYK A;  2PYO D;  3UTB D;  3MGS D;  3LZ0 B;  3KXB A;  4YS3 B;  2F8N G;  2F8N A;  5BS7 C;  2YFV B;  3AZF B;  5JRG C; 
#chains in the Genus database with same CATH topology
 3AZG D;  5F99 D;  3AZJ B;  1S32 A;  3WKJ D;  2NQB C;  3B6F B;  1H3O A;  1KX3 D;  5AV5 D;  5AV9 B;  3WAA D;  3MGP C;  3V9R B;  4WU8 C;  2CWE A;  1F1E A;  3W96 D;  3MNN B;  3LJA B;  3X1S B;  1HQ3 D;  1KX4 D;  5B0Z D;  3WTP A;  5CPK A;  2W8S A;  3WA9 A;  3AZN C;  5GT3 C;  3AZH D;  3W98 D;  3X1V D;  5B2I B;  2FFF B;  5B33 A;  3X1T B;  1P3A D;  1AOI D;  4DQY B;  2ARO A;  3WTP E;  5B0Y D;  4X23 A;  5CPJ B;  4YS3 C;  3LZ0 C;  5AV8 B;  4J8U A;  5E5A D;  3AZL A;  3AZF C;  3NQU B;  4XUJ D;  4EO5 C;  1P3B C;  5GSU B;  1T3U A;  5BNX B;  3AZJ C;  4JJN A;  1Q9C A;  1N1J A;  5B40 B;  3KUY A;  4KGC D;  4QLC B;  3B6F C;  1M1A B;  3MGR B;  5AV9 C;  3W99 D;  5B24 C;  3MGQ B;  3KXB D;  5AVB B;  1ZLA D;  3MNN C;  5DNN A;  4Z5T D;  5B32 B;  3B6G B;  1EQZ A;  3LZ1 D;  1W2E A;  1P3K A;  2ZY3 A;  5GXQ B;  2IO5 B;  5B2I C;  1P3O B;  3X1T C;  2Y2H A;  1TAF A;  5DNM A;  3O62 A;  3X1U A;  3WTP D;  3UTB B;  5CPK D;  3WA9 D;  5CPJ C;  5AV8 C;  4R8P D;  4KHA A;  5B33 D;  3AZG B;  1F66 B;  1Z2C B;  3LEL B;  3AZK B;  5GSU C;  2ARO D;  4NE6 A;  5B40 C;  1KX5 B;  4J8W D;  4QLC C;  3REH A;  1KX3 B;  2Y2J A;  5CP6 B;  4X23 D;  2HIO D;  3TU4 D;  3MGQ C;  3AV1 B;  3REJ D;  4H9S A;  5AVB C;  4CAY B;  4ZUX D;  4J8U D;  3AZL D;  2Y2N A;  3NQJ B;  3MVD B;  3C1C D;  3AZE A;  1P3M A;  1JFI B;  2FJ7 B;  1P3I A;  4JJN D;  2YFW A;  1A7W A;  5B2J D;  3KUY D;  3AZH B;  1P34 D;  4YM6 C;  3X1V B;  2PYO A;  5GXQ C;  3A1I A;  3MGS A;  5B1M D;  1P3O C;  3AFA A;  5BT1 D;  1PZR A;  5DNN D;  5B0Y B;  1KU5 A;  5AY8 A;  4M6B A;  3EPL A;  3UTB C;  2CV5 D;  1P3K D;  3W97 D;  3WKJ A;  3A6N C;  5AV5 A;  3KWQ A;  5CPI D;  4Z66 B;  4Z2M G;  3AZG C;  1ID3 D;  2LY8 A;  3W96 A;  4H9O A;  1F66 C;  3LEL C;  5AV6 D;  3AZK C;  2BYK B;  1KX4 A;  5B0Z A;  1KX5 C;  1KX3 C;  4KUD D;  3C1B D;  5CP6 C;  3KXB B;  3AV1 C;  2F8N B;  1P3F B;  3VH5 T;  3VH5 W;  3W98 A;  3REL D;  2JE5 A;  5BO0 B;  3MVD C;  1P3A A;  3UTA D;  1AOI A;  2FJ7 C;  1S32 B;  1H3O B;  5B31 G;  3AZH C;  2Y2G A;  1M18 D;  1HTA A;  2RVQ C;  5B0Y C;  4XUJ A;  1P3M D;  3REI A;  3A1K A;  3EPJ A;  4J8V D;  4KGC A;  4LD9 D;  4J8X A;  5B1L D;  5B33 B;  4Z66 C;  3W99 A;  3AFA D;  1ZLA A;  4Z5T A;  5AY8 D;  4X23 B;  2Y2L A;  3LZ1 A;  3KXB C;  4XZQ D;  1U35 A;  1P3F C;  4J8U B;  1P3G B;  3REK D;  3AZL B;  3KWQ D;  1TZY A;  1P3L A;  5AVC C;  3AN2 D;  4JJN B;  1S32 C;  1N1J B;  3KUY B;  3AV2 D;  4WJ3 C;  5BS7 A;  3AYW B;  5DNN B;  4G92 B;  3B0C T;  3B0C W;  4R8P A;  4H9Q A;  1EQZ B;  2NZD B;  2JCH A;  1P3P D;  1P3K B;  2J8P A;  5B31 D;  4J8W A;  1M19 B;  5B33 C;  1TAF B;  2HIO A;  5DNM B;  3TU4 A;  3REJ A;  3O62 B;  3FDD A;  4ZUX A;  3X1U B;  3H0R C;  3C1C A;  3REI D;  4X23 C;  5FUG B;  1P34 A;  5B2J A;  4KHA B;  1P3G C;  4J8X D;  3AZL C;  5B1M A;  4G91 B;  3LJA C;  4JJN C;  3X1S C;  2BYM B;  2ZY4 A;  3REH B;  3AZM D;  3AYW C;  3F6T A;  2CV5 A;  3W97 A;  1U35 D;  4WU9 D;  4WNN A;  5DNN C;  1P3B A;  1WWI A;  5CPI A;  3AZE B;  2JSS A;  1TZY D;  1P3M B;  1P3L D;  1EQZ C;  1ID3 A;  2NZD C;  4HGA B;  1P3I B;  3V9R A;  2YFW B;  5AV6 A;  5B24 A;  1P3K C;  2PYO B;  4KUD A;  5GT0 A;  3MGS B;  3C1B A;  1M19 C;  5DNM C;  5JRG D;  3AFA B;  3O62 C;  3EPK A;  3REL A;  3X1U C;  2NQB D;  5AY8 B;  5F99 B;  3MGP D;  3UTA A;  4E44 A;  3WKJ B;  5CHL B;  5AV5 B;  3WAA B;  3KWQ B;  1M1A C;  3MGR C;  3R45 A;  2F8N K;  4CSR A;  3W96 B;  4H9O B;  1M18 A;  4G91 C;  1HQ3 B;  2Y2M A;  3AZN D;  1KX4 B;  5GT3 D;  5B0Z B;  2HUE B;  3REH C;  5B32 C;  3B6G C;  3KSY A;  4H9S C;  3W98 B;  4J8V A;  2DQN C;  4LD9 A;  2F2A C;  5B1L A;  2IO5 C;  3H0L C;  3AZE C;  1P3A B;  1P3M C;  1AOI B;  4HGA C;  1P3I C;  2RIQ A;  5KDM A;  4YS3 D;  3LZ0 D;  2PYO C;  1B67 A;  3KFU G;  3AZF D;  3MGS C;  3UT9 A;  1BH9 A;  4NFT A;  4XZQ A;  5E5A B;  3REK A;  1P3B D;  3AZJ D;  4XUJ B;  3B6F D;  3REI B;  5AY8 C;  4H9P A;  4YM6 A;  3EPH A;  5F99 C;  5AV9 D;  3AN2 A;  3AZI A;  5B24 D;  3WKJ C;  3AV2 A;  4KGC B;  2Y2P A;  3MNN D;  2BG1 A;  3WAA C;  5AV5 C;  3W99 B;  5GT0 D;  3W96 C;  1ZLA B;  4Z5T B;  1HQ3 C;  1KX4 C;  5B0Z C;  2HUE C;  4ZBJ B;  3A6N A;  5JA4 A;  3VH6 A;  3LZ1 B;  2XD5 A;  1P3P A;  1U35 B;  3X1T D;  5B31 A;  3W98 C;  3X1V C;  3AZK A;  1TZY B;  1P3L B;  1KX5 A;  1P3A C;  1AOI C;  5CPJ D;  3WTP B;  1B6W A;  3H0M C;  5CPK B;  3WA9 B;  4R8P B;  5E5A C;  3B0D B;  5GSU D;  4H9Q B;  1BH8 A;  4UUZ A;  5B40 D;  4XUJ C;  4H9R A;  4QLC D;  2ARO B;  3MGQ D;  4J8W B;  4KGC C;  5AVB D;  3AZM A;  3W99 C;  2HIO B;  3TU4 B;  3REJ B;  3UT9 D;  1ZLA C;  4ZUX B;  3VH6 T;  3VH6 W;  4WU9 A;  4Z5T C;  3C1C B;  4DRB A;  4ZBJ C;  5BNV A;  4YM6 D;  3LZ1 C;  3AZI D;  1P34 B;  5B2J B;  1P3O D;  1TZY C;  5G49 A;  5B1M B;  1P3L C;  3IP4 C;  5JRG A;  4H9N A;  1P3F A;  2NQB A;  3WTP C;  3A6N D;  2CV5 B;  5CPK C;  3MGP A;  4WU8 A;  3WA9 C;  3W97 B;  5BO0 A;  4EO5 B;  5AVC A;  4WNN B;  1P3B B;  2XD1 A;  4R8P C;  1F66 D;  3LEL D;  3AZK D;  3B0D C;  5CPI B;  2F8N H;  1KX5 D;  1ID3 B;  5CP6 D;  5AV6 B;  5B24 B;  3AZN A;  2ARO C;  3AV1 D;  4WV4 B;  5GT3 A;  4J8W C;  4WZS B;  4KUD B;  5GT0 B;  3C1B B;  2Y2K A;  2HIO C;  3TU4 C;  3MVD D;  3REJ C;  4ZUX C;  2FJ7 D;  4J8U C;  3REL B;  3C1C C;  3UTA B;  1P34 C;  3KUY C;  5B2J C;  3LZ0 A;  4YS3 A;  2RVQ D;  3R45 B;  2YFV A;  2Y2I A;  4CSR B;  3AZF A;  5B1M C;  1R4V A;  1M18 B;  5BT1 C;  4G92 C;  2DF4 C;  3AZJ A;  1P3G A;  3B6F A;  2CV5 C;  5AV9 A;  4Z66 D;  3W97 C;  4J8V B;  4LD9 B;  3MNN A;  3LJA A;  5C3I B;  5B1L B;  3X1S A;  5CPI C;  1ID3 C;  3AYW A;  5KDM B;  5AV6 C;  2F8N D;  1P3F D;  2Y2Q A;  4KUD C;  5GT0 C;  3C1B C;  4WU8 D;  3UT9 B;  1BH9 B;  4XZQ B;  5B2I A;  5AVC D;  3X1T A;  2NZD A;  2G5I C;  2L5A A;  3REK B;  3REL C;  1S32 D;  4YM6 B;  4H9P B;  3EG5 B;  3UTA C;  3AN2 B;  3AZI B;  1M19 A;  3AV2 B;  5CPJ A;  5AV8 A;  4E45 A;  3NQU A;  1M18 C;  5GSU A;  5FUG A;  5BNX A;  3A6N B;  5B40 A;  5JA4 B;  4QLC A;  2VQR A;  4AWL B;  1M1A A;  3MGR A;  1P3P B;  3P5J B;  4NE3 A;  5B31 B;  3MGQ A;  4J8V C;  4LD9 C;  5AVB A;  4NE5 A;  5C3I C;  5B1L C;  2BYM A;  5B32 G;  5B32 A;  3B6G A;  3AFA C;  1P3G D;  5GXQ A;  3UT9 C;  4XZQ C;  1P3O A;  3VH5 A;  2ZY2 A;  3REK C;  4J8X B;  3LJA D;  1BH8 B;  4UUZ B;  3X1S D;  3KWQ C;  4H9R B;  3AYW D;  2ZY5 A;  3AN2 C;  3AZI C;  3UTB A;  3AV2 C;  2Y2O A;  3AZM B;  5B2I D;  1EQZ D;  3AZG A;  4WU9 B;  2NZD D;  5F99 A;  1F66 A;  3LEL A;  5BNV B;  1KX3 A;  3WAA A;  4AWL C;  2UWX A;  1P3P C;  3B0B A;  5CP6 A;  1M19 D;  5DNM D;  3AV1 A;  5B31 C;  1WWS A;  3O62 D;  4CAY A;  5AV8 D;  1HQ3 A;  5G49 B;  3X1U D;  3AL0 C;  5JRG B;  2G5H C;  3NQJ A;  3MVD A;  1JFI A;  2FJ7 A;  4Z2M H;  4H9N B;  2NQB B;  3AZH A;  3REI C;  3MGP B;  4WU8 B;  3MGR D;  3X1V A;  1M1A D;  5AVC B;  4J8X C;  4UPK A;  3REH D;  5B32 D;  5B0Y A;  3B6G D;  1BFM A;  3AZN B;  1ULY A;  5GT3 B;  3AZM C;  5E5A A;  5GXQ D;  4DRA A;  4Z66 A;  3AZE D;  1U35 C;  2ZM5 A;  4WU9 C;  1P3I D;  2BYK A;  2PYO D;  3UTB D;  3MGS D;  3LZ0 B;  3KXB A;  4YS3 B;  2F8N G;  2F8N A;  5BS7 C;  2YFV B;  3AZF B;  5JRG C; 
#chains in the Genus database with same CATH homology
 3AZG D;  5F99 D;  3AZJ B;  1S32 A;  3WKJ D;  2NQB C;  3B6F B;  1H3O A;  1KX3 D;  5AV5 D;  5AV9 B;  3WAA D;  3MGP C;  3V9R B;  4WU8 C;  2CWE A;  1F1E A;  3W96 D;  3MNN B;  3LJA B;  3X1S B;  1HQ3 D;  1KX4 D;  5B0Z D;  3WTP A;  5CPK A;  2W8S A;  3WA9 A;  3AZN C;  5GT3 C;  3AZH D;  3W98 D;  3X1V D;  5B2I B;  2FFF B;  5B33 A;  3X1T B;  1P3A D;  1AOI D;  4DQY B;  2ARO A;  3WTP E;  5B0Y D;  4X23 A;  5CPJ B;  4YS3 C;  3LZ0 C;  5AV8 B;  4J8U A;  5E5A D;  3AZL A;  3AZF C;  3NQU B;  4XUJ D;  4EO5 C;  1P3B C;  5GSU B;  1T3U A;  5BNX B;  3AZJ C;  4JJN A;  1Q9C A;  1N1J A;  5B40 B;  3KUY A;  4KGC D;  4QLC B;  3B6F C;  1M1A B;  3MGR B;  5AV9 C;  3W99 D;  5B24 C;  3MGQ B;  3KXB D;  5AVB B;  1ZLA D;  3MNN C;  5DNN A;  4Z5T D;  5B32 B;  3B6G B;  1EQZ A;  3LZ1 D;  1W2E A;  1P3K A;  2ZY3 A;  5GXQ B;  2IO5 B;  5B2I C;  1P3O B;  3X1T C;  2Y2H A;  1TAF A;  5DNM A;  3O62 A;  3X1U A;  3WTP D;  3UTB B;  5CPK D;  3WA9 D;  5CPJ C;  5AV8 C;  4R8P D;  4KHA A;  5B33 D;  3AZG B;  1F66 B;  1Z2C B;  3LEL B;  3AZK B;  5GSU C;  2ARO D;  4NE6 A;  5B40 C;  1KX5 B;  4J8W D;  4QLC C;  3REH A;  1KX3 B;  2Y2J A;  5CP6 B;  4X23 D;  2HIO D;  3TU4 D;  3MGQ C;  3AV1 B;  3REJ D;  4H9S A;  5AVB C;  4CAY B;  4ZUX D;  4J8U D;  3AZL D;  2Y2N A;  3NQJ B;  3MVD B;  3C1C D;  3AZE A;  1P3M A;  1JFI B;  2FJ7 B;  1P3I A;  4JJN D;  2YFW A;  1A7W A;  5B2J D;  3KUY D;  3AZH B;  1P34 D;  4YM6 C;  3X1V B;  2PYO A;  5GXQ C;  3A1I A;  3MGS A;  5B1M D;  1P3O C;  3AFA A;  5BT1 D;  1PZR A;  5DNN D;  5B0Y B;  1KU5 A;  5AY8 A;  4M6B A;  3EPL A;  3UTB C;  2CV5 D;  1P3K D;  3W97 D;  3WKJ A;  3A6N C;  5AV5 A;  3KWQ A;  5CPI D;  4Z66 B;  4Z2M G;  3AZG C;  1ID3 D;  2LY8 A;  3W96 A;  4H9O A;  1F66 C;  3LEL C;  5AV6 D;  3AZK C;  2BYK B;  1KX4 A;  5B0Z A;  1KX5 C;  1KX3 C;  4KUD D;  3C1B D;  5CP6 C;  3KXB B;  3AV1 C;  2F8N B;  1P3F B;  3VH5 T;  3VH5 W;  3W98 A;  3REL D;  2JE5 A;  5BO0 B;  3MVD C;  1P3A A;  3UTA D;  1AOI A;  2FJ7 C;  1S32 B;  1H3O B;  5B31 G;  3AZH C;  2Y2G A;  1M18 D;  1HTA A;  2RVQ C;  5B0Y C;  4XUJ A;  1P3M D;  3REI A;  3A1K A;  3EPJ A;  4J8V D;  4KGC A;  4LD9 D;  4J8X A;  5B1L D;  5B33 B;  4Z66 C;  3W99 A;  3AFA D;  1ZLA A;  4Z5T A;  5AY8 D;  4X23 B;  2Y2L A;  3LZ1 A;  3KXB C;  4XZQ D;  1U35 A;  1P3F C;  4J8U B;  1P3G B;  3REK D;  3AZL B;  3KWQ D;  1TZY A;  1P3L A;  5AVC C;  3AN2 D;  4JJN B;  1S32 C;  1N1J B;  3KUY B;  3AV2 D;  4WJ3 C;  5BS7 A;  3AYW B;  5DNN B;  4G92 B;  3B0C T;  3B0C W;  4R8P A;  4H9Q A;  1EQZ B;  2NZD B;  2JCH A;  1P3P D;  1P3K B;  2J8P A;  5B31 D;  4J8W A;  1M19 B;  5B33 C;  1TAF B;  2HIO A;  5DNM B;  3TU4 A;  3REJ A;  3O62 B;  3FDD A;  4ZUX A;  3X1U B;  3H0R C;  3C1C A;  3REI D;  4X23 C;  5FUG B;  1P34 A;  5B2J A;  4KHA B;  1P3G C;  4J8X D;  3AZL C;  5B1M A;  4G91 B;  3LJA C;  4JJN C;  3X1S C;  2BYM B;  2ZY4 A;  3REH B;  3AZM D;  3AYW C;  3F6T A;  2CV5 A;  3W97 A;  1U35 D;  4WU9 D;  4WNN A;  5DNN C;  1P3B A;  1WWI A;  5CPI A;  3AZE B;  2JSS A;  1TZY D;  1P3M B;  1P3L D;  1EQZ C;  1ID3 A;  2NZD C;  4HGA B;  1P3I B;  3V9R A;  2YFW B;  5AV6 A;  5B24 A;  1P3K C;  2PYO B;  4KUD A;  5GT0 A;  3MGS B;  3C1B A;  1M19 C;  5DNM C;  5JRG D;  3AFA B;  3O62 C;  3EPK A;  3REL A;  3X1U C;  2NQB D;  5AY8 B;  5F99 B;  3MGP D;  3UTA A;  4E44 A;  3WKJ B;  5CHL B;  5AV5 B;  3WAA B;  3KWQ B;  1M1A C;  3MGR C;  3R45 A;  2F8N K;  4CSR A;  3W96 B;  4H9O B;  1M18 A;  4G91 C;  1HQ3 B;  2Y2M A;  3AZN D;  1KX4 B;  5GT3 D;  5B0Z B;  2HUE B;  3REH C;  5B32 C;  3B6G C;  3KSY A;  4H9S C;  3W98 B;  4J8V A;  2DQN C;  4LD9 A;  2F2A C;  5B1L A;  2IO5 C;  3H0L C;  3AZE C;  1P3A B;  1P3M C;  1AOI B;  4HGA C;  1P3I C;  2RIQ A;  5KDM A;  4YS3 D;  3LZ0 D;  2PYO C;  1B67 A;  3KFU G;  3AZF D;  3MGS C;  3UT9 A;  1BH9 A;  4NFT A;  4XZQ A;  5E5A B;  3REK A;  1P3B D;  3AZJ D;  4XUJ B;  3B6F D;  3REI B;  5AY8 C;  4H9P A;  4YM6 A;  3EPH A;  5F99 C;  5AV9 D;  3AN2 A;  3AZI A;  5B24 D;  3WKJ C;  3AV2 A;  4KGC B;  2Y2P A;  3MNN D;  2BG1 A;  3WAA C;  5AV5 C;  3W99 B;  5GT0 D;  3W96 C;  1ZLA B;  4Z5T B;  1HQ3 C;  1KX4 C;  5B0Z C;  2HUE C;  4ZBJ B;  3A6N A;  5JA4 A;  3VH6 A;  3LZ1 B;  2XD5 A;  1P3P A;  1U35 B;  3X1T D;  5B31 A;  3W98 C;  3X1V C;  3AZK A;  1TZY B;  1P3L B;  1KX5 A;  1P3A C;  1AOI C;  5CPJ D;  3WTP B;  1B6W A;  3H0M C;  5CPK B;  3WA9 B;  4R8P B;  5E5A C;  3B0D B;  5GSU D;  4H9Q B;  1BH8 A;  4UUZ A;  5B40 D;  4XUJ C;  4H9R A;  4QLC D;  2ARO B;  3MGQ D;  4J8W B;  4KGC C;  5AVB D;  3AZM A;  3W99 C;  2HIO B;  3TU4 B;  3REJ B;  3UT9 D;  1ZLA C;  4ZUX B;  3VH6 T;  3VH6 W;  4WU9 A;  4Z5T C;  3C1C B;  4DRB A;  4ZBJ C;  5BNV A;  4YM6 D;  3LZ1 C;  3AZI D;  1P34 B;  5B2J B;  1P3O D;  1TZY C;  5G49 A;  5B1M B;  1P3L C;  3IP4 C;  5JRG A;  4H9N A;  1P3F A;  2NQB A;  3WTP C;  3A6N D;  2CV5 B;  5CPK C;  3MGP A;  4WU8 A;  3WA9 C;  3W97 B;  5BO0 A;  4EO5 B;  5AVC A;  4WNN B;  1P3B B;  2XD1 A;  4R8P C;  1F66 D;  3LEL D;  3AZK D;  3B0D C;  5CPI B;  2F8N H;  1KX5 D;  1ID3 B;  5CP6 D;  5AV6 B;  5B24 B;  3AZN A;  2ARO C;  3AV1 D;  4WV4 B;  5GT3 A;  4J8W C;  4WZS B;  4KUD B;  5GT0 B;  3C1B B;  2Y2K A;  2HIO C;  3TU4 C;  3MVD D;  3REJ C;  4ZUX C;  2FJ7 D;  4J8U C;  3REL B;  3C1C C;  3UTA B;  1P34 C;  3KUY C;  5B2J C;  3LZ0 A;  4YS3 A;  2RVQ D;  3R45 B;  2YFV A;  2Y2I A;  4CSR B;  3AZF A;  5B1M C;  1R4V A;  1M18 B;  5BT1 C;  4G92 C;  2DF4 C;  3AZJ A;  1P3G A;  3B6F A;  2CV5 C;  5AV9 A;  4Z66 D;  3W97 C;  4J8V B;  4LD9 B;  3MNN A;  3LJA A;  5C3I B;  5B1L B;  3X1S A;  5CPI C;  1ID3 C;  3AYW A;  5KDM B;  5AV6 C;  2F8N D;  1P3F D;  2Y2Q A;  4KUD C;  5GT0 C;  3C1B C;  4WU8 D;  3UT9 B;  1BH9 B;  4XZQ B;  5B2I A;  5AVC D;  3X1T A;  2NZD A;  2G5I C;  2L5A A;  3REK B;  3REL C;  1S32 D;  4YM6 B;  4H9P B;  3EG5 B;  3UTA C;  3AN2 B;  3AZI B;  1M19 A;  3AV2 B;  5CPJ A;  5AV8 A;  4E45 A;  3NQU A;  1M18 C;  5GSU A;  5FUG A;  5BNX A;  3A6N B;  5B40 A;  5JA4 B;  4QLC A;  2VQR A;  4AWL B;  1M1A A;  3MGR A;  1P3P B;  3P5J B;  4NE3 A;  5B31 B;  3MGQ A;  4J8V C;  4LD9 C;  5AVB A;  4NE5 A;  5C3I C;  5B1L C;  2BYM A;  5B32 G;  5B32 A;  3B6G A;  3AFA C;  1P3G D;  5GXQ A;  3UT9 C;  4XZQ C;  1P3O A;  3VH5 A;  2ZY2 A;  3REK C;  4J8X B;  3LJA D;  1BH8 B;  4UUZ B;  3X1S D;  3KWQ C;  4H9R B;  3AYW D;  2ZY5 A;  3AN2 C;  3AZI C;  3UTB A;  3AV2 C;  2Y2O A;  3AZM B;  5B2I D;  1EQZ D;  3AZG A;  4WU9 B;  2NZD D;  5F99 A;  1F66 A;  3LEL A;  5BNV B;  1KX3 A;  3WAA A;  4AWL C;  2UWX A;  1P3P C;  3B0B A;  5CP6 A;  1M19 D;  5DNM D;  3AV1 A;  5B31 C;  1WWS A;  3O62 D;  4CAY A;  5AV8 D;  1HQ3 A;  5G49 B;  3X1U D;  3AL0 C;  5JRG B;  2G5H C;  3NQJ A;  3MVD A;  1JFI A;  2FJ7 A;  4Z2M H;  4H9N B;  2NQB B;  3AZH A;  3REI C;  3MGP B;  4WU8 B;  3MGR D;  3X1V A;  1M1A D;  5AVC B;  4J8X C;  4UPK A;  3REH D;  5B32 D;  5B0Y A;  3B6G D;  1BFM A;  3AZN B;  1ULY A;  5GT3 B;  3AZM C;  5E5A A;  5GXQ D;  4DRA A;  4Z66 A;  3AZE D;  1U35 C;  2ZM5 A;  4WU9 C;  1P3I D;  2BYK A;  2PYO D;  3UTB D;  3MGS D;  3LZ0 B;  3KXB A;  4YS3 B;  2F8N G;  2F8N A;  5BS7 C;  2YFV B;  3AZF B;  5JRG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...