3AZEC

Crystal structure of human nucleosome core particle containing h3k64q mutation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azeC00
4H9OA 4E44A 5B40C 5B33B 2PYOC 1P34C 3RELD 1P3GC 1P3AC 3AV1B 3LZ0B 5GT3C 5E5AD 1TZYA 5CPJA 4G92C 3LJAC 4ZUXA 4YM6D 1EQZA 5CP6C 3TU4D 1P3IA 3KWQA 5BT1D 4WU9B 3X1TD 4WZSB 3REHC 3C1CC 4Z66B 1S32D 5B0YC 3AZIC 5CPKC 3WA9D 1P3OD 5GT0D 5B2JD 2CV5C 1P3GD 3KUYA 3C1BC 1P3AD 3MGRB 3MGPC 1H3OA 5B1MA 3MGSB 5AY8B 5CP6D 3AZJC 1HQ3D 4X23A 5BO0A 3B0DB 3UTBC 5JRGC 5AV9D 3B6FA 3REHD 3AFAB 1P3LB 5B0YD 3AZID 5CPKD 3AZLA 4QLCA 3AN2A 1A7WA 3REKD 2CV5D 3W96B 4R8PA 5KDMA 4YM6A 4J8WC 3REIA 3TU4A 5CPIA 3MGPD 2NQBA 5E5AB 3UT9C 5AVBB 5JA4A 5B32G 4JJND 1M18C 2F8ND 1P3OA 1BFMA 5AV5B 5BS7C 3AZFB 3B6GB 3X1SD 1BH9B 3W97A 1KX4A 1AOIC 1P3BA 5BNXA 3AZEA 3MGQC 1U35D 1KX5B 3W98C 2HIOB 4Z5TC 5B40B 3AZGC 3AYWC 5B1LC 1P34B 2PYOB 4J8WD 1HQ3A 5GT3B 3WTPC 5AV9A 1P3KB 4NE6A 3UT9D 1M18D 5B0ZD 5B33C 4G92B 2YFWA 3LJAB 3AZKA 3REKA 5B2IA 3W99C 4J8XB 5B31B 5B31G 1M19A 3REHB 4H9PA 3X1UB 3C1CB 3MVDC 1AOID 5B0YB 3UTAA 4H9RB 2CV5B 4JJNA 4Z5TD 3AZGD 1ID3C 3VH6T 3AYWD 5B1LD 3R45B 3C1BB 4KHAB 2NZDD 4KUDC 4XZQC 3WTPD 1F66C 5B33D 4UUZA 2YFVB 4KGCB 3B0BA 3MGRC 3AZJB 3AV1D 1U35A 2F8NH 1B67A 4YS3A 5GSUC 3UTBB 5JRGB 1Q9CA 3MVDD 5AY8C 5F99C 4EO5C 5B0ZA 4WU9D 3KXBA 4Z2MH 4WV4B 3AV2B 3AFAC 4J8WB 4Z66D 4E45A 2BYMB 3WAAC 1M1AA 4XZQD 1F66D 3VH6A 3W96C 1P3FC 5AV8A 3MGRD 5GSUD 3AZNB 3MGSD 3VH6W 5B32C 5AVBC 5AVCB 2NZDA 5AY8D 3W98B 3MGQB 3NQJB 5AV5C 5DNMB 3AZFC 3B6GC 3AFAD 3AV1A 3LZ0A 1P3LD 3MNNA 1KX5C 4WNNB 4J8UC 2HIOC 3W96D 3A6NC 3O62C 4XUJB 4HGAB 2AROC 3W99B 4WU9A 1P3KC 3AZMB 4WU8C 5AVBD 4Z66A 3MVDB 2IO5C 1JFIA 1ZLAC 5AV5D 4J8XC 1TAFB 5B31C 4J8VB 3AZFD 1ID3B 3B6GD 3X1UC 4KUDB 5DNNA 4XZQB 1KX5D 3MGSA 4J8UD 1F66B 5AV6C 2HIOD 5B40D 4NE3A 1P34D 2PYOD 3O62D 5GXQA 3LZ1A 5BNVB 5GT3D 1B6WA 5GSUB 3AZHC 1P3KD 1P3LA 3LJAD 4KGCC 3X1VA 3WKJA 5F99B 4EO5B 4H9QA 4CAYB 5B31D 5G49A 4J8XD 3RELA 1TZYB 3REJC 4CSRA 3X1UD 3C1CD 3WAAB 4ZUXB 5E5AA 2RVQC 1EQZB 1P3IB 3WKJD 1P3FB 3AV2C 3LELC 3C1BD 4NFTA 1BH9A 3X1TA 5B32B 1P3MC 1S32A 4KGCD 3WA9A 3AZJD 5GT0A 5B2JA 5B40A 3UTBD 3AZNC 5JRGD 1P34A 2PYOA 1P3GA 5B1MB 1P3AA 5AVCC 2HUEB 5GT3A 4J8UB 5DNMC 3A6NB 5BO0B 3O62B 3B0CT 3LJAA 3AV2D 3B6FB 5CP6A 5B24C 2AROB 1N1JA 3AN2B 1P3MD 4WU8B 3REHA 4LD9C 3C1CA 1P3PC 4XUJC 2IO5B 4HGAC 4ZBJB 5B0YA 4R8PB 4H9RA 3AZIA 5KDMB 5CPKA 1ZLAB 2CV5A 5CPIB 3AZND 3KSYA 2NQBB 3AZMC 3R45A 3C1BA 5AVCD 5JA4B 1ULYA 3MGPA 3V9RA 3W98D 3MGQD 5DNMD 5AV6B 4J8VC 3WTPE 2F8NA 3AZJA 3W97B 3AZHB 3UTBA 1P3BB 5JRGA 3X1SA 5BNXB 2FJ7C 3VH5T 5C3IB 1KX3C 4XUJD 3W99D 4H9SC 3AZMD 4J8WA 3REJB 3B0CW 2YFWB 2F8NK 3UT9A 1M18A 4J8VD 1ID3D 1TZYC 1M19B 3LELB 5CPJC 4H9NB 4ZUXC 4KUDD 5BS7A 3UTAB 1EQZC 1P3IC 1P3MB 2FJ7D 3KWQC 1AOIA 2BYKB 2L5AA 3W98A 3MGQA 3NQJA 4Z5TA 3AZGA 3VH5A 5B1LA 3AYWA 4AWLC 2CWEA 3NQUA 3KUYC 3WTPA 5F99D 4YS3B 5B33A 3VH5W 1TZYD 5B1MC 4DRAA 5B24B 4G91B 3W99A 2HUEC 4ZUXD 3WAAD 1EQZD 1P3ID 4X23C 1P3FD 4LD9B 1P3PB 3KXBB 3MVDA 3B6FC 1TAFA 1ID3A 1M1AB 3AZLC 4QLCC 3AN2C 5B32D 4ZBJC 4R8PC 5AV8B 3KUYD 4XZQA 4YM6C 3REIC 1F66A 3TU4C 5CPIC 2NQBC 1WWSA 5B1MD 3MGRA 5GSUA 1P3OC 5FUGB 2FJ7B 3A6ND 1KX3B 5AY8A 3B6FD 5F99A 2AROD 3W97C 1KX4C 4CAYA 1BH8B 1P3BC 3MNNB 3AZEC 4QLCD 3AZLD 3AN2D 5CHLB 3AFAA 4WU8D 5C3IC 4H9OB 1ZLAD 4R8PD 3WAAA 3REID 1HQ3C 5CPID 3W96A 1P3FA 2NQBD 5AV9C 5CPJB 4NE5A 1JFIB 3AZKC 5B32A 3REKC 5AVBA 3KWQB 5B2IC 5AV6D 4DRBA 1M19C 3W97D 5AV5A 1KX4D 3AZHD 1P3BD 3UTAC 3AZFA 3B6GA 5DNNB 3AZED 4AWLB 4JJNC 3KUYB 5GXQB 1KX5A 4J8UA 2HIOA 3A6NA 1H3OB 3LZ1B 3O62A 3X1SC 3REJD 2AROA 2RVQD 3X1VB 1P3KA 3AZKD 3WKJB 4WU8A 1U35C 4X23B 4YS3C 5B2ID 4H9QB 5G49B 1M19D 3LELD 1ZLAA 3RELB 4CSRB 4G91C 4J8XA 5B31A 3UTAD 3AZLB 4QLCB 3X1UA 5B0ZC 3KXBC 4YM6B 3REIB 3TU4B 5AV6A 1M1AC 3X1TB 4KHAA 5AV8C 3AZHA 1S32B 3WA9B 1P3OB 5GT0B 5B2JB 4YS3D 2YFVA 4KGCA 1P3GB 1P3AB 5B24D 1KX4B 2NZDC 3AZEB 3REJA 4LD9D 1P3PD 3KXBD 5CP6B 3LZ0C 3AV1C 1HQ3B 1N1JB 3MNNC 1M1AD 3AV2A 5AV9B 4X23D 3LELA 4H9NA 2BYMA 5AV8D 3AZIB 5CPKB 1HTAA 3AZKB 1P3MA 3REKB 5B2IB 4WU9C 2BYKA 1R4VA 4H9PB 4Z66C 3MGPB 3AZNA 3V9RB 1KX3D 5AVCA 4JJNB 2LY8A 2F8NB 2F8NG 3LZ0D 1F1EA 5DNMA 3MNND 5DNNC 3X1SB 3MGSC 4M6BA 5B24A 4UUZB 4WNNA 5GXQC 1U35B 4LD9A 3LZ1C 1P3PA 3B0DC 4Z2MG 4XUJA 5CPJD 1KU5A 1P3LC 3X1VC 3WKJC 3AZMA 3KWQD 3UT9B 1M18B 5B0ZB 3RELC 4J8VA 2JSSA 5E5AC 5DNND 1AOIB 4KUDA 5GXQD 5FUGA 2FJ7A 1KX3A 3LZ1D 5BT1C 1WWIA 4Z5TB 3AZGB 3AYWB 5B1LB 3X1TC 5BNVA 1BH8A 1S32C 2NZDB 3X1VD 4H9SA 3NQUB 3WA9C 3WTPB 5GT0C 5B2JC
chains in the Genus database with same CATH superfamily
4H9OA 4E44A 5B40C 5B33B 2PYOC 1P34C 3RELD 1P3GC 1P3AC 3AV1B 3LZ0B 2W8SA 5GT3C 5E5AD 1TZYA 5CPJA 4G92C 3LJAC 4ZUXA 1ZLAB 4YM6D 1EQZA 5CP6C 3TU4D 1P3IA 3KWQA 1Z2CB 5BT1D 4WU9B 3H0MC 3X1TD 4WZSB 3REHC 3C1CC 4Z66B 1S32D 5B0YC 3AZIC 5CPKC 3WA9D 1P3OD 5GT0D 5B2JD 2CV5C 1P3GD 3KUYA 2J8PA 3C1BC 1P3AD 3MGRB 3MGPC 1H3OA 5B1MA 3MGSB 3A1KA 5AY8B 2Y2NA 5CP6D 3AZJC 1HQ3D 4X23A 5BO0A 3B0DB 3UTBC 5JRGC 5AV9D 3B6FA 3REHD 3AFAB 1P3LB 5B0YD 3AZID 5CPKD 3AZLA 4QLCA 3AN2A 1A7WA 3REKD 2CV5D 3W96B 4R8PA 5KDMA 4YM6A 4J8WC 3REIA 3TU4A 5CPIA 2Y2LA 3MGPD 2NQBA 5E5AB 3UT9C 5AVBB 5JA4A 5B32G 4JJND 1M18C 2F8ND 1P3OA 1BFMA 5AV5B 5BS7C 3AZFB 3B6GB 3X1SD 1BH9B 3W97A 1KX4A 1AOIC 1P3BA 5BNXA 3AZEA 3MGQC 1U35D 1KX5B 3W98C 2HIOB 4Z5TC 5B40B 3AZGC 3AYWC 5B1LC 2Y2OA 1P34B 2PYOB 3EPLA 2Y2PA 4J8WD 1HQ3A 5GT3B 3WTPC 5AV9A 1P3KB 4NE6A 3UT9D 1M18D 5B0ZD 5B33C 2Y2MA 4G92B 2YFWA 3LJAB 3AZKA 3REKA 5B2IA 3W99C 4J8XB 5B31B 5B31G 1M19A 3REHB 4H9PA 3X1UB 3C1CB 3MVDC 1AOID 5B0YB 3UTAA 4H9RB 2CV5B 4JJNA 4Z5TD 3AZGD 1ID3C 3VH6T 3AYWD 5B1LD 3R45B 3C1BB 4KHAB 2NZDD 4KUDC 4XZQC 3WTPD 1F66C 5B33D 4UUZA 2YFVB 4KGCB 3B0BA 3MGRC 3AZJB 3AV1D 1U35A 2F8NH 1B67A 4YS3A 5GSUC 3UTBB 5JRGB 1Q9CA 3MVDD 5AY8C 5F99C 4EO5C 5B0ZA 4WU9D 3KXBA 4Z2MH 4WV4B 3AV2B 3AFAC 4J8WB 4Z66D 4E45A 2BYMB 3WAAC 1M1AA 4XZQD 1F66D 3VH6A 2ZY5A 3W96C 1P3FC 5AV8A 3MGRD 5GSUD 3AZNB 3MGSD 3VH6W 5B32C 5AVBC 5AVCB 2NZDA 5AY8D 3W98B 3MGQB 3NQJB 2BG1A 5AV5C 5DNMB 3AZFC 3B6GC 3AFAD 3AV1A 3LZ0A 1P3LD 3MNNA 1KX5C 4WNNB 4J8UC 2Y2KA 2HIOC 3W96D 3A6NC 2Y2HA 3O62C 4XUJB 4HGAB 2AROC 3W99B 4WU9A 2G5IC 1P3KC 3AZMB 4WU8C 5AVBD 3FDDA 4Z66A 3MVDB 2IO5C 1JFIA 1ZLAC 5AV5D 4J8XC 1TAFB 5B31C 2RIQA 4J8VB 3AZFD 1ID3B 3B6GD 2ZM5A 3X1UC 4KUDB 5DNNA 4XZQB 1KX5D 3MGSA 4J8UD 1F66B 5AV6C 2HIOD 5B40D 4NE3A 3EPJA 1P34D 3O62D 2PYOD 5GXQA 3LZ1A 5BNVB 5GT3D 1B6WA 5GSUB 3AZHC 1P3KD 1P3LA 3LJAD 4KGCC 3X1VA 3F6TA 3WKJA 5F99B 4EO5B 4H9QA 4CAYB 5B31D 2ZY4A 5G49A 4J8XD 3RELA 1TZYB 3REJC 4CSRA 3X1UD 3C1CD 3WAAB 4ZUXB 5E5AA 2RVQC 1EQZB 2XD5A 1P3IB 3WKJD 1P3FB 3AV2C 3LELC 3C1BD 4NFTA 1BH9A 3X1TA 5B32B 1P3MC 1S32A 4KGCD 3WA9A 3AZJD 5GT0A 5B2JA 5B40A 3UTBD 3AZNC 5JRGD 1P34A 2PYOA 1P3GA 5B1MB 1P3AA 5AVCC 2HUEB 5GT3A 4J8UB 5DNMC 3A6NB 5BO0B 3O62B 3B0CT 3LJAA 3AV2D 1PZRA 3B6FB 5CP6A 5B24C 2AROB 1N1JA 2FFFB 3AN2B 1P3MD 4WU8B 3REHA 4LD9C 3C1CA 1P3PC 4XUJC 2IO5B 4HGAC 4ZBJB 5B0YA 4R8PB 4H9RA 3AZIA 5KDMB 1T3UA 5CPKA 2CV5A 5CPIB 3AZND 3KSYA 2NQBB 3AZMC 3R45A 3C1BA 5AVCD 5JA4B 1ULYA 3MGPA 3V9RA 3W98D 3MGQD 5DNMD 5AV6B 4J8VC 3WTPE 2F8NA 3AZJA 3W97B 3EG5B 3AZHB 3UTBA 2JCHA 1P3BB 5JRGA 3X1SA 5BNXB 2FJ7C 3VH5T 5C3IB 1KX3C 4XUJD 3W99D 4H9SC 3AZMD 4J8WA 3REJB 3B0CW 2YFWB 2F8NK 3UT9A 1M18A 4J8VD 1ID3D 1TZYC 1M19B 3LELB 5CPJC 4H9NB 4ZUXC 4KUDD 5BS7A 3UTAB 1EQZC 3AL0C 1P3IC 1P3MB 2FJ7D 3KWQC 1AOIA 2BYKB 2L5AA 3W98A 3MGQA 3NQJA 3H0RC 4Z5TA 3AZGA 3VH5A 5B1LA 3AYWA 4AWLC 2CWEA 3P5JB 3NQUA 3KUYC 3WTPA 5F99D 4YS3B 5B33A 3VH5W 1TZYD 5B1MC 4DRAA 5B24B 2VQRA 4G91B 3W99A 2HUEC 4ZUXD 3WAAD 1EQZD 2Y2IA 1P3ID 4X23C 1P3FD 4LD9B 1P3PB 3KXBB 3MVDA 3B6FC 1TAFA 1ID3A 1M1AB 3AZLC 4QLCC 3AN2C 5B32D 4ZBJC 4R8PC 5AV8B 3KUYD 2DF4C 4XZQA 4YM6C 3REIC 1F66A 3TU4C 5CPIC 1W2EA 2NQBC 1WWSA 5B1MD 3MGRA 2Y2GA 5GSUA 1P3OC 5FUGB 2FJ7B 3A6ND 1KX3B 5AY8A 3B6FD 5F99A 2AROD 3W97C 1KX4C 4CAYA 1BH8B 1P3BC 3MNNB 3AZEC 4QLCD 3AZLD 3AN2D 5CHLB 3AFAA 4WU8D 5C3IC 4H9OB 3A1IA 1ZLAD 2F2AC 4R8PD 3WAAA 3REID 1HQ3C 5CPID 3W96A 1P3FA 2NQBD 5AV9C 5CPJB 3IP4C 4NE5A 1JFIB 2Y2JA 3AZKC 5B32A 3REKC 5AVBA 3KWQB 5B2IC 5AV6D 4DRBA 2ZY3A 2UWXA 1M19C 2Y2QA 5AV5A 3W97D 1KX4D 3AZHD 1P3BD 3UTAC 3AZFA 3B6GA 5DNNB 3AZED 4AWLB 4JJNC 2G5HC 5GXQB 3KUYB 1KX5A 4J8UA 2HIOA 3A6NA 1H3OB 3H0LC 3LZ1B 3O62A 3X1SC 3REJD 2AROA 4DQYB 2RVQD 3X1VB 1P3KA 3AZKD 3WKJB 4WU8A 1U35C 4X23B 4YS3C 5B2ID 4H9QB 5G49B 1M19D 3LELD 1ZLAA 3RELB 4CSRB 4G91C 4J8XA 3KFUG 5B31A 3UTAD 3AZLB 4QLCB 3X1UA 5B0ZC 3KXBC 4YM6B 3REIB 3TU4B 5AV6A 1M1AC 3X1TB 2ZY2A 4KHAA 5AV8C 3AZHA 1S32B 3WA9B 1P3OB 5GT0B 5B2JB 4YS3D 2YFVA 4KGCA 1P3GB 1P3AB 2JE5A 5B24D 1KX4B 2NZDC 3AZEB 3REJA 4LD9D 1P3PD 3KXBD 5CP6B 3LZ0C 3AV1C 1HQ3B 1N1JB 3MNNC 1M1AD 3AV2A 5AV9B 4X23D 3LELA 4H9NA 2BYMA 5AV8D 3AZIB 5CPKB 1HTAA 3AZKB 1P3MA 3REKB 2XD1A 5B2IB 4WU9C 2BYKA 1R4VA 4H9PB 4Z66C 3MGPB 3AZNA 3V9RB 4WJ3C 1KX3D 5AVCA 4JJNB 4UPKA 2LY8A 2F8NB 2F8NG 3LZ0D 1F1EA 5DNMA 3MNND 5DNNC 3X1SB 3MGSC 4M6BA 5B24A 4UUZB 4WNNA 5GXQC 1U35B 4LD9A 3LZ1C 1P3PA 3B0DC 4Z2MG 4XUJA 5CPJD 1KU5A 2DQNC 1P3LC 3X1VC 3WKJC 3EPKA 3AZMA 3EPHA 3KWQD 3UT9B 1M18B 5B0ZB 3RELC 4J8VA 2JSSA 5E5AC 5DNND 1AOIB 4KUDA 5GXQD 5FUGA 2FJ7A 1KX3A 3LZ1D 5BT1C 1WWIA 4Z5TB 3AZGB 3AYWB 5B1LB 3X1TC 5BNVA 1BH8A 1S32C 2NZDB 3X1VD 4H9SA 3NQUB 3WA9C 3WTPB 5GT0C 5B2JC
chains in the Genus database with same CATH topology
4H9OA 4E44A 5B40C 5B33B 2PYOC 1P34C 3RELD 1P3GC 1P3AC 3AV1B 3LZ0B 2W8SA 5GT3C 5E5AD 1TZYA 5CPJA 4G92C 3LJAC 4ZUXA 1ZLAB 4YM6D 1EQZA 5CP6C 3TU4D 1P3IA 3KWQA 1Z2CB 5BT1D 4WU9B 3H0MC 3X1TD 4WZSB 3REHC 3C1CC 4Z66B 1S32D 5B0YC 3AZIC 5CPKC 3WA9D 1P3OD 5GT0D 5B2JD 2CV5C 1P3GD 3KUYA 2J8PA 3C1BC 1P3AD 3MGRB 3MGPC 1H3OA 5B1MA 3MGSB 3A1KA 5AY8B 2Y2NA 5CP6D 3AZJC 1HQ3D 4X23A 5BO0A 3B0DB 3UTBC 5JRGC 5AV9D 3B6FA 3REHD 3AFAB 1P3LB 5B0YD 3AZID 5CPKD 3AZLA 4QLCA 3AN2A 1A7WA 3REKD 2CV5D 3W96B 4R8PA 5KDMA 4YM6A 4J8WC 3REIA 3TU4A 5CPIA 2Y2LA 3MGPD 2NQBA 5E5AB 3UT9C 5AVBB 5JA4A 5B32G 4JJND 1M18C 2F8ND 1P3OA 1BFMA 5AV5B 5BS7C 3AZFB 3B6GB 3X1SD 1BH9B 3W97A 1KX4A 1AOIC 1P3BA 5BNXA 3AZEA 3MGQC 1U35D 1KX5B 3W98C 2HIOB 4Z5TC 5B40B 3AZGC 3AYWC 5B1LC 2Y2OA 1P34B 2PYOB 3EPLA 2Y2PA 4J8WD 1HQ3A 5GT3B 3WTPC 5AV9A 1P3KB 4NE6A 3UT9D 1M18D 5B0ZD 5B33C 2Y2MA 4G92B 2YFWA 3LJAB 3AZKA 3REKA 5B2IA 3W99C 4J8XB 5B31B 5B31G 1M19A 3REHB 4H9PA 3X1UB 3C1CB 3MVDC 1AOID 5B0YB 3UTAA 4H9RB 2CV5B 4JJNA 4Z5TD 3AZGD 1ID3C 3VH6T 3AYWD 5B1LD 3R45B 3C1BB 4KHAB 2NZDD 4KUDC 4XZQC 3WTPD 1F66C 5B33D 4UUZA 2YFVB 4KGCB 3B0BA 3MGRC 3AZJB 3AV1D 1U35A 2F8NH 1B67A 4YS3A 5GSUC 3UTBB 5JRGB 1Q9CA 3MVDD 5AY8C 5F99C 4EO5C 5B0ZA 4WU9D 3KXBA 4Z2MH 4WV4B 3AV2B 3AFAC 4J8WB 4Z66D 4E45A 2BYMB 3WAAC 1M1AA 4XZQD 1F66D 3VH6A 2ZY5A 3W96C 1P3FC 5AV8A 3MGRD 5GSUD 3AZNB 3MGSD 3VH6W 5B32C 5AVBC 5AVCB 2NZDA 5AY8D 3W98B 3MGQB 3NQJB 2BG1A 5AV5C 5DNMB 3AZFC 3B6GC 3AFAD 3AV1A 3LZ0A 1P3LD 3MNNA 1KX5C 4WNNB 4J8UC 2Y2KA 2HIOC 3W96D 3A6NC 2Y2HA 3O62C 4XUJB 4HGAB 2AROC 3W99B 4WU9A 2G5IC 1P3KC 3AZMB 4WU8C 5AVBD 3FDDA 4Z66A 3MVDB 2IO5C 1JFIA 1ZLAC 5AV5D 4J8XC 1TAFB 5B31C 2RIQA 4J8VB 3AZFD 1ID3B 3B6GD 2ZM5A 3X1UC 4KUDB 5DNNA 4XZQB 1KX5D 3MGSA 4J8UD 1F66B 5AV6C 2HIOD 5B40D 4NE3A 3EPJA 1P34D 3O62D 2PYOD 5GXQA 3LZ1A 5BNVB 5GT3D 1B6WA 5GSUB 3AZHC 1P3KD 1P3LA 3LJAD 4KGCC 3X1VA 3F6TA 3WKJA 5F99B 4EO5B 4H9QA 4CAYB 5B31D 2ZY4A 5G49A 4J8XD 3RELA 1TZYB 3REJC 4CSRA 3X1UD 3C1CD 3WAAB 4ZUXB 5E5AA 2RVQC 1EQZB 2XD5A 1P3IB 3WKJD 1P3FB 3AV2C 3LELC 3C1BD 4NFTA 1BH9A 3X1TA 5B32B 1P3MC 1S32A 4KGCD 3WA9A 3AZJD 5GT0A 5B2JA 5B40A 3UTBD 3AZNC 5JRGD 1P34A 2PYOA 1P3GA 5B1MB 1P3AA 5AVCC 2HUEB 5GT3A 4J8UB 5DNMC 3A6NB 5BO0B 3O62B 3B0CT 3LJAA 3AV2D 1PZRA 3B6FB 5CP6A 5B24C 2AROB 1N1JA 2FFFB 3AN2B 1P3MD 4WU8B 3REHA 4LD9C 3C1CA 1P3PC 4XUJC 2IO5B 4HGAC 4ZBJB 5B0YA 4R8PB 4H9RA 3AZIA 5KDMB 1T3UA 5CPKA 2CV5A 5CPIB 3AZND 3KSYA 2NQBB 3AZMC 3R45A 3C1BA 5AVCD 5JA4B 1ULYA 3MGPA 3V9RA 3W98D 3MGQD 5DNMD 5AV6B 4J8VC 3WTPE 2F8NA 3AZJA 3W97B 3EG5B 3AZHB 3UTBA 2JCHA 1P3BB 5JRGA 3X1SA 5BNXB 2FJ7C 3VH5T 5C3IB 1KX3C 4XUJD 3W99D 4H9SC 3AZMD 4J8WA 3REJB 3B0CW 2YFWB 2F8NK 3UT9A 1M18A 4J8VD 1ID3D 1TZYC 1M19B 3LELB 5CPJC 4H9NB 4ZUXC 4KUDD 5BS7A 3UTAB 1EQZC 3AL0C 1P3IC 1P3MB 2FJ7D 3KWQC 1AOIA 2BYKB 2L5AA 3W98A 3MGQA 3NQJA 3H0RC 4Z5TA 3AZGA 3VH5A 5B1LA 3AYWA 4AWLC 2CWEA 3P5JB 3NQUA 3KUYC 3WTPA 5F99D 4YS3B 5B33A 3VH5W 1TZYD 5B1MC 4DRAA 5B24B 2VQRA 4G91B 3W99A 2HUEC 4ZUXD 3WAAD 1EQZD 2Y2IA 1P3ID 4X23C 1P3FD 4LD9B 1P3PB 3KXBB 3MVDA 3B6FC 1TAFA 1ID3A 1M1AB 3AZLC 4QLCC 3AN2C 5B32D 4ZBJC 4R8PC 5AV8B 3KUYD 2DF4C 4XZQA 4YM6C 3REIC 1F66A 3TU4C 5CPIC 1W2EA 2NQBC 1WWSA 5B1MD 3MGRA 2Y2GA 5GSUA 1P3OC 5FUGB 2FJ7B 3A6ND 1KX3B 5AY8A 3B6FD 5F99A 2AROD 3W97C 1KX4C 4CAYA 1BH8B 1P3BC 3MNNB 3AZEC 4QLCD 3AZLD 3AN2D 5CHLB 3AFAA 4WU8D 5C3IC 4H9OB 3A1IA 1ZLAD 2F2AC 4R8PD 3WAAA 3REID 1HQ3C 5CPID 3W96A 1P3FA 2NQBD 5AV9C 5CPJB 3IP4C 4NE5A 1JFIB 2Y2JA 3AZKC 5B32A 3REKC 5AVBA 3KWQB 5B2IC 5AV6D 4DRBA 2ZY3A 2UWXA 1M19C 2Y2QA 5AV5A 3W97D 1KX4D 3AZHD 1P3BD 3UTAC 3AZFA 3B6GA 5DNNB 3AZED 4AWLB 4JJNC 2G5HC 5GXQB 3KUYB 1KX5A 4J8UA 2HIOA 3A6NA 1H3OB 3H0LC 3LZ1B 3O62A 3X1SC 3REJD 2AROA 4DQYB 2RVQD 3X1VB 1P3KA 3AZKD 3WKJB 4WU8A 1U35C 4X23B 4YS3C 5B2ID 4H9QB 5G49B 1M19D 3LELD 1ZLAA 3RELB 4CSRB 4G91C 4J8XA 3KFUG 5B31A 3UTAD 3AZLB 4QLCB 3X1UA 5B0ZC 3KXBC 4YM6B 3REIB 3TU4B 5AV6A 1M1AC 3X1TB 2ZY2A 4KHAA 5AV8C 3AZHA 1S32B 3WA9B 1P3OB 5GT0B 5B2JB 4YS3D 2YFVA 4KGCA 1P3GB 1P3AB 2JE5A 5B24D 1KX4B 2NZDC 3AZEB 3REJA 4LD9D 1P3PD 3KXBD 5CP6B 3LZ0C 3AV1C 1HQ3B 1N1JB 3MNNC 1M1AD 3AV2A 5AV9B 4X23D 3LELA 4H9NA 2BYMA 5AV8D 3AZIB 5CPKB 1HTAA 3AZKB 1P3MA 3REKB 2XD1A 5B2IB 4WU9C 2BYKA 1R4VA 4H9PB 4Z66C 3MGPB 3AZNA 3V9RB 4WJ3C 1KX3D 5AVCA 4JJNB 4UPKA 2LY8A 2F8NB 2F8NG 3LZ0D 1F1EA 5DNMA 3MNND 5DNNC 3X1SB 3MGSC 4M6BA 5B24A 4UUZB 4WNNA 5GXQC 1U35B 4LD9A 3LZ1C 1P3PA 3B0DC 4Z2MG 4XUJA 5CPJD 1KU5A 2DQNC 1P3LC 3X1VC 3WKJC 3EPKA 3AZMA 3EPHA 3KWQD 3UT9B 1M18B 5B0ZB 3RELC 4J8VA 2JSSA 5E5AC 5DNND 1AOIB 4KUDA 5GXQD 5FUGA 2FJ7A 1KX3A 3LZ1D 5BT1C 1WWIA 4Z5TB 3AZGB 3AYWB 5B1LB 3X1TC 5BNVA 1BH8A 1S32C 2NZDB 3X1VD 4H9SA 3NQUB 3WA9C 3WTPB 5GT0C 5B2JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9O A;  4E44 A;  5B40 C;  5B33 B;  2PYO C;  1P34 C;  3REL D;  1P3G C;  1P3A C;  3AV1 B;  3LZ0 B;  5GT3 C;  5E5A D;  1TZY A;  5CPJ A;  4G92 C;  3LJA C;  4ZUX A;  4YM6 D;  1EQZ A;  5CP6 C;  3TU4 D;  1P3I A;  3KWQ A;  5BT1 D;  4WU9 B;  3X1T D;  4WZS B;  3REH C;  3C1C C;  4Z66 B;  1S32 D;  5B0Y C;  3AZI C;  5CPK C;  3WA9 D;  1P3O D;  5GT0 D;  5B2J D;  2CV5 C;  1P3G D;  3KUY A;  3C1B C;  1P3A D;  3MGR B;  3MGP C;  1H3O A;  5B1M A;  3MGS B;  5AY8 B;  5CP6 D;  3AZJ C;  1HQ3 D;  4X23 A;  5BO0 A;  3B0D B;  3UTB C;  5JRG C;  5AV9 D;  3B6F A;  3REH D;  3AFA B;  1P3L B;  5B0Y D;  3AZI D;  5CPK D;  3AZL A;  4QLC A;  3AN2 A;  1A7W A;  3REK D;  2CV5 D;  3W96 B;  4R8P A;  5KDM A;  4YM6 A;  4J8W C;  3REI A;  3TU4 A;  5CPI A;  3MGP D;  2NQB A;  5E5A B;  3UT9 C;  5AVB B;  5JA4 A;  5B32 G;  4JJN D;  1M18 C;  2F8N D;  1P3O A;  1BFM A;  5AV5 B;  5BS7 C;  3AZF B;  3B6G B;  3X1S D;  1BH9 B;  3W97 A;  1KX4 A;  1AOI C;  1P3B A;  5BNX A;  3AZE A;  3MGQ C;  1U35 D;  1KX5 B;  3W98 C;  2HIO B;  4Z5T C;  5B40 B;  3AZG C;  3AYW C;  5B1L C;  1P34 B;  2PYO B;  4J8W D;  1HQ3 A;  5GT3 B;  3WTP C;  5AV9 A;  1P3K B;  4NE6 A;  3UT9 D;  1M18 D;  5B0Z D;  5B33 C;  4G92 B;  2YFW A;  3LJA B;  3AZK A;  3REK A;  5B2I A;  3W99 C;  4J8X B;  5B31 B;  5B31 G;  1M19 A;  3REH B;  4H9P A;  3X1U B;  3C1C B;  3MVD C;  1AOI D;  5B0Y B;  3UTA A;  4H9R B;  2CV5 B;  4JJN A;  4Z5T D;  3AZG D;  1ID3 C;  3VH6 T;  3AYW D;  5B1L D;  3R45 B;  3C1B B;  4KHA B;  2NZD D;  4KUD C;  4XZQ C;  3WTP D;  1F66 C;  5B33 D;  4UUZ A;  2YFV B;  4KGC B;  3B0B A;  3MGR C;  3AZJ B;  3AV1 D;  1U35 A;  2F8N H;  1B67 A;  4YS3 A;  5GSU C;  3UTB B;  5JRG B;  1Q9C A;  3MVD D;  5AY8 C;  5F99 C;  4EO5 C;  5B0Z A;  4WU9 D;  3KXB A;  4Z2M H;  4WV4 B;  3AV2 B;  3AFA C;  4J8W B;  4Z66 D;  4E45 A;  2BYM B;  3WAA C;  1M1A A;  4XZQ D;  1F66 D;  3VH6 A;  3W96 C;  1P3F C;  5AV8 A;  3MGR D;  5GSU D;  3AZN B;  3MGS D;  3VH6 W;  5B32 C;  5AVB C;  5AVC B;  2NZD A;  5AY8 D;  3W98 B;  3MGQ B;  3NQJ B;  5AV5 C;  5DNM B;  3AZF C;  3B6G C;  3AFA D;  3AV1 A;  3LZ0 A;  1P3L D;  3MNN A;  1KX5 C;  4WNN B;  4J8U C;  2HIO C;  3W96 D;  3A6N C;  3O62 C;  4XUJ B;  4HGA B;  2ARO C;  3W99 B;  4WU9 A;  1P3K C;  3AZM B;  4WU8 C;  5AVB D;  4Z66 A;  3MVD B;  2IO5 C;  1JFI A;  1ZLA C;  5AV5 D;  4J8X C;  1TAF B;  5B31 C;  4J8V B;  3AZF D;  1ID3 B;  3B6G D;  3X1U C;  4KUD B;  5DNN A;  4XZQ B;  1KX5 D;  3MGS A;  4J8U D;  1F66 B;  5AV6 C;  2HIO D;  5B40 D;  4NE3 A;  1P34 D;  2PYO D;  3O62 D;  5GXQ A;  3LZ1 A;  5BNV B;  5GT3 D;  1B6W A;  5GSU B;  3AZH C;  1P3K D;  1P3L A;  3LJA D;  4KGC C;  3X1V A;  3WKJ A;  5F99 B;  4EO5 B;  4H9Q A;  4CAY B;  5B31 D;  5G49 A;  4J8X D;  3REL A;  1TZY B;  3REJ C;  4CSR A;  3X1U D;  3C1C D;  3WAA B;  4ZUX B;  5E5A A;  2RVQ C;  1EQZ B;  1P3I B;  3WKJ D;  1P3F B;  3AV2 C;  3LEL C;  3C1B D;  4NFT A;  1BH9 A;  3X1T A;  5B32 B;  1P3M C;  1S32 A;  4KGC D;  3WA9 A;  3AZJ D;  5GT0 A;  5B2J A;  5B40 A;  3UTB D;  3AZN C;  5JRG D;  1P34 A;  2PYO A;  1P3G A;  5B1M B;  1P3A A;  5AVC C;  2HUE B;  5GT3 A;  4J8U B;  5DNM C;  3A6N B;  5BO0 B;  3O62 B;  3B0C T;  3LJA A;  3AV2 D;  3B6F B;  5CP6 A;  5B24 C;  2ARO B;  1N1J A;  3AN2 B;  1P3M D;  4WU8 B;  3REH A;  4LD9 C;  3C1C A;  1P3P C;  4XUJ C;  2IO5 B;  4HGA C;  4ZBJ B;  5B0Y A;  4R8P B;  4H9R A;  3AZI A;  5KDM B;  5CPK A;  1ZLA B;  2CV5 A;  5CPI B;  3AZN D;  3KSY A;  2NQB B;  3AZM C;  3R45 A;  3C1B A;  5AVC D;  5JA4 B;  1ULY A;  3MGP A;  3V9R A;  3W98 D;  3MGQ D;  5DNM D;  5AV6 B;  4J8V C;  3WTP E;  2F8N A;  3AZJ A;  3W97 B;  3AZH B;  3UTB A;  1P3B B;  5JRG A;  3X1S A;  5BNX B;  2FJ7 C;  3VH5 T;  5C3I B;  1KX3 C;  4XUJ D;  3W99 D;  4H9S C;  3AZM D;  4J8W A;  3REJ B;  3B0C W;  2YFW B;  2F8N K;  3UT9 A;  1M18 A;  4J8V D;  1ID3 D;  1TZY C;  1M19 B;  3LEL B;  5CPJ C;  4H9N B;  4ZUX C;  4KUD D;  5BS7 A;  3UTA B;  1EQZ C;  1P3I C;  1P3M B;  2FJ7 D;  3KWQ C;  1AOI A;  2BYK B;  2L5A A;  3W98 A;  3MGQ A;  3NQJ A;  4Z5T A;  3AZG A;  3VH5 A;  5B1L A;  3AYW A;  4AWL C;  2CWE A;  3NQU A;  3KUY C;  3WTP A;  5F99 D;  4YS3 B;  5B33 A;  3VH5 W;  1TZY D;  5B1M C;  4DRA A;  5B24 B;  4G91 B;  3W99 A;  2HUE C;  4ZUX D;  3WAA D;  1EQZ D;  1P3I D;  4X23 C;  1P3F D;  4LD9 B;  1P3P B;  3KXB B;  3MVD A;  3B6F C;  1TAF A;  1ID3 A;  1M1A B;  3AZL C;  4QLC C;  3AN2 C;  5B32 D;  4ZBJ C;  4R8P C;  5AV8 B;  3KUY D;  4XZQ A;  4YM6 C;  3REI C;  1F66 A;  3TU4 C;  5CPI C;  2NQB C;  1WWS A;  5B1M D;  3MGR A;  5GSU A;  1P3O C;  5FUG B;  2FJ7 B;  3A6N D;  1KX3 B;  5AY8 A;  3B6F D;  5F99 A;  2ARO D;  3W97 C;  1KX4 C;  4CAY A;  1BH8 B;  1P3B C;  3MNN B;  3AZE C;  4QLC D;  3AZL D;  3AN2 D;  5CHL B;  3AFA A;  4WU8 D;  5C3I C;  4H9O B;  1ZLA D;  4R8P D;  3WAA A;  3REI D;  1HQ3 C;  5CPI D;  3W96 A;  1P3F A;  2NQB D;  5AV9 C;  5CPJ B;  4NE5 A;  1JFI B;  3AZK C;  5B32 A;  3REK C;  5AVB A;  3KWQ B;  5B2I C;  5AV6 D;  4DRB A;  1M19 C;  3W97 D;  5AV5 A;  1KX4 D;  3AZH D;  1P3B D;  3UTA C;  3AZF A;  3B6G A;  5DNN B;  3AZE D;  4AWL B;  4JJN C;  3KUY B;  5GXQ B;  1KX5 A;  4J8U A;  2HIO A;  3A6N A;  1H3O B;  3LZ1 B;  3O62 A;  3X1S C;  3REJ D;  2ARO A;  2RVQ D;  3X1V B;  1P3K A;  3AZK D;  3WKJ B;  4WU8 A;  1U35 C;  4X23 B;  4YS3 C;  5B2I D;  4H9Q B;  5G49 B;  1M19 D;  3LEL D;  1ZLA A;  3REL B;  4CSR B;  4G91 C;  4J8X A;  5B31 A;  3UTA D;  3AZL B;  4QLC B;  3X1U A;  5B0Z C;  3KXB C;  4YM6 B;  3REI B;  3TU4 B;  5AV6 A;  1M1A C;  3X1T B;  4KHA A;  5AV8 C;  3AZH A;  1S32 B;  3WA9 B;  1P3O B;  5GT0 B;  5B2J B;  4YS3 D;  2YFV A;  4KGC A;  1P3G B;  1P3A B;  5B24 D;  1KX4 B;  2NZD C;  3AZE B;  3REJ A;  4LD9 D;  1P3P D;  3KXB D;  5CP6 B;  3LZ0 C;  3AV1 C;  1HQ3 B;  1N1J B;  3MNN C;  1M1A D;  3AV2 A;  5AV9 B;  4X23 D;  3LEL A;  4H9N A;  2BYM A;  5AV8 D;  3AZI B;  5CPK B;  1HTA A;  3AZK B;  1P3M A;  3REK B;  5B2I B;  4WU9 C;  2BYK A;  1R4V A;  4H9P B;  4Z66 C;  3MGP B;  3AZN A;  3V9R B;  1KX3 D;  5AVC A;  4JJN B;  2LY8 A;  2F8N B;  2F8N G;  3LZ0 D;  1F1E A;  5DNM A;  3MNN D;  5DNN C;  3X1S B;  3MGS C;  4M6B A;  5B24 A;  4UUZ B;  4WNN A;  5GXQ C;  1U35 B;  4LD9 A;  3LZ1 C;  1P3P A;  3B0D C;  4Z2M G;  4XUJ A;  5CPJ D;  1KU5 A;  1P3L C;  3X1V C;  3WKJ C;  3AZM A;  3KWQ D;  3UT9 B;  1M18 B;  5B0Z B;  3REL C;  4J8V A;  2JSS A;  5E5A C;  5DNN D;  1AOI B;  4KUD A;  5GXQ D;  5FUG A;  2FJ7 A;  1KX3 A;  3LZ1 D;  5BT1 C;  1WWI A;  4Z5T B;  3AZG B;  3AYW B;  5B1L B;  3X1T C;  5BNV A;  1BH8 A;  1S32 C;  2NZD B;  3X1V D;  4H9S A;  3NQU B;  3WA9 C;  3WTP B;  5GT0 C;  5B2J C; 
#chains in the Genus database with same CATH topology
 4H9O A;  4E44 A;  5B40 C;  5B33 B;  2PYO C;  1P34 C;  3REL D;  1P3G C;  1P3A C;  3AV1 B;  3LZ0 B;  2W8S A;  5GT3 C;  5E5A D;  1TZY A;  5CPJ A;  4G92 C;  3LJA C;  4ZUX A;  1ZLA B;  4YM6 D;  1EQZ A;  5CP6 C;  3TU4 D;  1P3I A;  3KWQ A;  1Z2C B;  5BT1 D;  4WU9 B;  3H0M C;  3X1T D;  4WZS B;  3REH C;  3C1C C;  4Z66 B;  1S32 D;  5B0Y C;  3AZI C;  5CPK C;  3WA9 D;  1P3O D;  5GT0 D;  5B2J D;  2CV5 C;  1P3G D;  3KUY A;  2J8P A;  3C1B C;  1P3A D;  3MGR B;  3MGP C;  1H3O A;  5B1M A;  3MGS B;  3A1K A;  5AY8 B;  2Y2N A;  5CP6 D;  3AZJ C;  1HQ3 D;  4X23 A;  5BO0 A;  3B0D B;  3UTB C;  5JRG C;  5AV9 D;  3B6F A;  3REH D;  3AFA B;  1P3L B;  5B0Y D;  3AZI D;  5CPK D;  3AZL A;  4QLC A;  3AN2 A;  1A7W A;  3REK D;  2CV5 D;  3W96 B;  4R8P A;  5KDM A;  4YM6 A;  4J8W C;  3REI A;  3TU4 A;  5CPI A;  2Y2L A;  3MGP D;  2NQB A;  5E5A B;  3UT9 C;  5AVB B;  5JA4 A;  5B32 G;  4JJN D;  1M18 C;  2F8N D;  1P3O A;  1BFM A;  5AV5 B;  5BS7 C;  3AZF B;  3B6G B;  3X1S D;  1BH9 B;  3W97 A;  1KX4 A;  1AOI C;  1P3B A;  5BNX A;  3AZE A;  3MGQ C;  1U35 D;  1KX5 B;  3W98 C;  2HIO B;  4Z5T C;  5B40 B;  3AZG C;  3AYW C;  5B1L C;  2Y2O A;  1P34 B;  2PYO B;  3EPL A;  2Y2P A;  4J8W D;  1HQ3 A;  5GT3 B;  3WTP C;  5AV9 A;  1P3K B;  4NE6 A;  3UT9 D;  1M18 D;  5B0Z D;  5B33 C;  2Y2M A;  4G92 B;  2YFW A;  3LJA B;  3AZK A;  3REK A;  5B2I A;  3W99 C;  4J8X B;  5B31 B;  5B31 G;  1M19 A;  3REH B;  4H9P A;  3X1U B;  3C1C B;  3MVD C;  1AOI D;  5B0Y B;  3UTA A;  4H9R B;  2CV5 B;  4JJN A;  4Z5T D;  3AZG D;  1ID3 C;  3VH6 T;  3AYW D;  5B1L D;  3R45 B;  3C1B B;  4KHA B;  2NZD D;  4KUD C;  4XZQ C;  3WTP D;  1F66 C;  5B33 D;  4UUZ A;  2YFV B;  4KGC B;  3B0B A;  3MGR C;  3AZJ B;  3AV1 D;  1U35 A;  2F8N H;  1B67 A;  4YS3 A;  5GSU C;  3UTB B;  5JRG B;  1Q9C A;  3MVD D;  5AY8 C;  5F99 C;  4EO5 C;  5B0Z A;  4WU9 D;  3KXB A;  4Z2M H;  4WV4 B;  3AV2 B;  3AFA C;  4J8W B;  4Z66 D;  4E45 A;  2BYM B;  3WAA C;  1M1A A;  4XZQ D;  1F66 D;  3VH6 A;  2ZY5 A;  3W96 C;  1P3F C;  5AV8 A;  3MGR D;  5GSU D;  3AZN B;  3MGS D;  3VH6 W;  5B32 C;  5AVB C;  5AVC B;  2NZD A;  5AY8 D;  3W98 B;  3MGQ B;  3NQJ B;  2BG1 A;  5AV5 C;  5DNM B;  3AZF C;  3B6G C;  3AFA D;  3AV1 A;  3LZ0 A;  1P3L D;  3MNN A;  1KX5 C;  4WNN B;  4J8U C;  2Y2K A;  2HIO C;  3W96 D;  3A6N C;  2Y2H A;  3O62 C;  4XUJ B;  4HGA B;  2ARO C;  3W99 B;  4WU9 A;  2G5I C;  1P3K C;  3AZM B;  4WU8 C;  5AVB D;  3FDD A;  4Z66 A;  3MVD B;  2IO5 C;  1JFI A;  1ZLA C;  5AV5 D;  4J8X C;  1TAF B;  5B31 C;  2RIQ A;  4J8V B;  3AZF D;  1ID3 B;  3B6G D;  2ZM5 A;  3X1U C;  4KUD B;  5DNN A;  4XZQ B;  1KX5 D;  3MGS A;  4J8U D;  1F66 B;  5AV6 C;  2HIO D;  5B40 D;  4NE3 A;  3EPJ A;  1P34 D;  3O62 D;  2PYO D;  5GXQ A;  3LZ1 A;  5BNV B;  5GT3 D;  1B6W A;  5GSU B;  3AZH C;  1P3K D;  1P3L A;  3LJA D;  4KGC C;  3X1V A;  3F6T A;  3WKJ A;  5F99 B;  4EO5 B;  4H9Q A;  4CAY B;  5B31 D;  2ZY4 A;  5G49 A;  4J8X D;  3REL A;  1TZY B;  3REJ C;  4CSR A;  3X1U D;  3C1C D;  3WAA B;  4ZUX B;  5E5A A;  2RVQ C;  1EQZ B;  2XD5 A;  1P3I B;  3WKJ D;  1P3F B;  3AV2 C;  3LEL C;  3C1B D;  4NFT A;  1BH9 A;  3X1T A;  5B32 B;  1P3M C;  1S32 A;  4KGC D;  3WA9 A;  3AZJ D;  5GT0 A;  5B2J A;  5B40 A;  3UTB D;  3AZN C;  5JRG D;  1P34 A;  2PYO A;  1P3G A;  5B1M B;  1P3A A;  5AVC C;  2HUE B;  5GT3 A;  4J8U B;  5DNM C;  3A6N B;  5BO0 B;  3O62 B;  3B0C T;  3LJA A;  3AV2 D;  1PZR A;  3B6F B;  5CP6 A;  5B24 C;  2ARO B;  1N1J A;  2FFF B;  3AN2 B;  1P3M D;  4WU8 B;  3REH A;  4LD9 C;  3C1C A;  1P3P C;  4XUJ C;  2IO5 B;  4HGA C;  4ZBJ B;  5B0Y A;  4R8P B;  4H9R A;  3AZI A;  5KDM B;  1T3U A;  5CPK A;  2CV5 A;  5CPI B;  3AZN D;  3KSY A;  2NQB B;  3AZM C;  3R45 A;  3C1B A;  5AVC D;  5JA4 B;  1ULY A;  3MGP A;  3V9R A;  3W98 D;  3MGQ D;  5DNM D;  5AV6 B;  4J8V C;  3WTP E;  2F8N A;  3AZJ A;  3W97 B;  3EG5 B;  3AZH B;  3UTB A;  2JCH A;  1P3B B;  5JRG A;  3X1S A;  5BNX B;  2FJ7 C;  3VH5 T;  5C3I B;  1KX3 C;  4XUJ D;  3W99 D;  4H9S C;  3AZM D;  4J8W A;  3REJ B;  3B0C W;  2YFW B;  2F8N K;  3UT9 A;  1M18 A;  4J8V D;  1ID3 D;  1TZY C;  1M19 B;  3LEL B;  5CPJ C;  4H9N B;  4ZUX C;  4KUD D;  5BS7 A;  3UTA B;  1EQZ C;  3AL0 C;  1P3I C;  1P3M B;  2FJ7 D;  3KWQ C;  1AOI A;  2BYK B;  2L5A A;  3W98 A;  3MGQ A;  3NQJ A;  3H0R C;  4Z5T A;  3AZG A;  3VH5 A;  5B1L A;  3AYW A;  4AWL C;  2CWE A;  3P5J B;  3NQU A;  3KUY C;  3WTP A;  5F99 D;  4YS3 B;  5B33 A;  3VH5 W;  1TZY D;  5B1M C;  4DRA A;  5B24 B;  2VQR A;  4G91 B;  3W99 A;  2HUE C;  4ZUX D;  3WAA D;  1EQZ D;  2Y2I A;  1P3I D;  4X23 C;  1P3F D;  4LD9 B;  1P3P B;  3KXB B;  3MVD A;  3B6F C;  1TAF A;  1ID3 A;  1M1A B;  3AZL C;  4QLC C;  3AN2 C;  5B32 D;  4ZBJ C;  4R8P C;  5AV8 B;  3KUY D;  2DF4 C;  4XZQ A;  4YM6 C;  3REI C;  1F66 A;  3TU4 C;  5CPI C;  1W2E A;  2NQB C;  1WWS A;  5B1M D;  3MGR A;  2Y2G A;  5GSU A;  1P3O C;  5FUG B;  2FJ7 B;  3A6N D;  1KX3 B;  5AY8 A;  3B6F D;  5F99 A;  2ARO D;  3W97 C;  1KX4 C;  4CAY A;  1BH8 B;  1P3B C;  3MNN B;  3AZE C;  4QLC D;  3AZL D;  3AN2 D;  5CHL B;  3AFA A;  4WU8 D;  5C3I C;  4H9O B;  3A1I A;  1ZLA D;  2F2A C;  4R8P D;  3WAA A;  3REI D;  1HQ3 C;  5CPI D;  3W96 A;  1P3F A;  2NQB D;  5AV9 C;  5CPJ B;  3IP4 C;  4NE5 A;  1JFI B;  2Y2J A;  3AZK C;  5B32 A;  3REK C;  5AVB A;  3KWQ B;  5B2I C;  5AV6 D;  4DRB A;  2ZY3 A;  2UWX A;  1M19 C;  2Y2Q A;  5AV5 A;  3W97 D;  1KX4 D;  3AZH D;  1P3B D;  3UTA C;  3AZF A;  3B6G A;  5DNN B;  3AZE D;  4AWL B;  4JJN C;  2G5H C;  5GXQ B;  3KUY B;  1KX5 A;  4J8U A;  2HIO A;  3A6N A;  1H3O B;  3H0L C;  3LZ1 B;  3O62 A;  3X1S C;  3REJ D;  2ARO A;  4DQY B;  2RVQ D;  3X1V B;  1P3K A;  3AZK D;  3WKJ B;  4WU8 A;  1U35 C;  4X23 B;  4YS3 C;  5B2I D;  4H9Q B;  5G49 B;  1M19 D;  3LEL D;  1ZLA A;  3REL B;  4CSR B;  4G91 C;  4J8X A;  3KFU G;  5B31 A;  3UTA D;  3AZL B;  4QLC B;  3X1U A;  5B0Z C;  3KXB C;  4YM6 B;  3REI B;  3TU4 B;  5AV6 A;  1M1A C;  3X1T B;  2ZY2 A;  4KHA A;  5AV8 C;  3AZH A;  1S32 B;  3WA9 B;  1P3O B;  5GT0 B;  5B2J B;  4YS3 D;  2YFV A;  4KGC A;  1P3G B;  1P3A B;  2JE5 A;  5B24 D;  1KX4 B;  2NZD C;  3AZE B;  3REJ A;  4LD9 D;  1P3P D;  3KXB D;  5CP6 B;  3LZ0 C;  3AV1 C;  1HQ3 B;  1N1J B;  3MNN C;  1M1A D;  3AV2 A;  5AV9 B;  4X23 D;  3LEL A;  4H9N A;  2BYM A;  5AV8 D;  3AZI B;  5CPK B;  1HTA A;  3AZK B;  1P3M A;  3REK B;  2XD1 A;  5B2I B;  4WU9 C;  2BYK A;  1R4V A;  4H9P B;  4Z66 C;  3MGP B;  3AZN A;  3V9R B;  4WJ3 C;  1KX3 D;  5AVC A;  4JJN B;  4UPK A;  2LY8 A;  2F8N B;  2F8N G;  3LZ0 D;  1F1E A;  5DNM A;  3MNN D;  5DNN C;  3X1S B;  3MGS C;  4M6B A;  5B24 A;  4UUZ B;  4WNN A;  5GXQ C;  1U35 B;  4LD9 A;  3LZ1 C;  1P3P A;  3B0D C;  4Z2M G;  4XUJ A;  5CPJ D;  1KU5 A;  2DQN C;  1P3L C;  3X1V C;  3WKJ C;  3EPK A;  3AZM A;  3EPH A;  3KWQ D;  3UT9 B;  1M18 B;  5B0Z B;  3REL C;  4J8V A;  2JSS A;  5E5A C;  5DNN D;  1AOI B;  4KUD A;  5GXQ D;  5FUG A;  2FJ7 A;  1KX3 A;  3LZ1 D;  5BT1 C;  1WWI A;  4Z5T B;  3AZG B;  3AYW B;  5B1L B;  3X1T C;  5BNV A;  1BH8 A;  1S32 C;  2NZD B;  3X1V D;  4H9S A;  3NQU B;  3WA9 C;  3WTP B;  5GT0 C;  5B2J C; 
#chains in the Genus database with same CATH homology
 4H9O A;  4E44 A;  5B40 C;  5B33 B;  2PYO C;  1P34 C;  3REL D;  1P3G C;  1P3A C;  3AV1 B;  3LZ0 B;  2W8S A;  5GT3 C;  5E5A D;  1TZY A;  5CPJ A;  4G92 C;  3LJA C;  4ZUX A;  1ZLA B;  4YM6 D;  1EQZ A;  5CP6 C;  3TU4 D;  1P3I A;  3KWQ A;  1Z2C B;  5BT1 D;  4WU9 B;  3H0M C;  3X1T D;  4WZS B;  3REH C;  3C1C C;  4Z66 B;  1S32 D;  5B0Y C;  3AZI C;  5CPK C;  3WA9 D;  1P3O D;  5GT0 D;  5B2J D;  2CV5 C;  1P3G D;  3KUY A;  2J8P A;  3C1B C;  1P3A D;  3MGR B;  3MGP C;  1H3O A;  5B1M A;  3MGS B;  3A1K A;  5AY8 B;  2Y2N A;  5CP6 D;  3AZJ C;  1HQ3 D;  4X23 A;  5BO0 A;  3B0D B;  3UTB C;  5JRG C;  5AV9 D;  3B6F A;  3REH D;  3AFA B;  1P3L B;  5B0Y D;  3AZI D;  5CPK D;  3AZL A;  4QLC A;  3AN2 A;  1A7W A;  3REK D;  2CV5 D;  3W96 B;  4R8P A;  5KDM A;  4YM6 A;  4J8W C;  3REI A;  3TU4 A;  5CPI A;  2Y2L A;  3MGP D;  2NQB A;  5E5A B;  3UT9 C;  5AVB B;  5JA4 A;  5B32 G;  4JJN D;  1M18 C;  2F8N D;  1P3O A;  1BFM A;  5AV5 B;  5BS7 C;  3AZF B;  3B6G B;  3X1S D;  1BH9 B;  3W97 A;  1KX4 A;  1AOI C;  1P3B A;  5BNX A;  3AZE A;  3MGQ C;  1U35 D;  1KX5 B;  3W98 C;  2HIO B;  4Z5T C;  5B40 B;  3AZG C;  3AYW C;  5B1L C;  2Y2O A;  1P34 B;  2PYO B;  3EPL A;  2Y2P A;  4J8W D;  1HQ3 A;  5GT3 B;  3WTP C;  5AV9 A;  1P3K B;  4NE6 A;  3UT9 D;  1M18 D;  5B0Z D;  5B33 C;  2Y2M A;  4G92 B;  2YFW A;  3LJA B;  3AZK A;  3REK A;  5B2I A;  3W99 C;  4J8X B;  5B31 B;  5B31 G;  1M19 A;  3REH B;  4H9P A;  3X1U B;  3C1C B;  3MVD C;  1AOI D;  5B0Y B;  3UTA A;  4H9R B;  2CV5 B;  4JJN A;  4Z5T D;  3AZG D;  1ID3 C;  3VH6 T;  3AYW D;  5B1L D;  3R45 B;  3C1B B;  4KHA B;  2NZD D;  4KUD C;  4XZQ C;  3WTP D;  1F66 C;  5B33 D;  4UUZ A;  2YFV B;  4KGC B;  3B0B A;  3MGR C;  3AZJ B;  3AV1 D;  1U35 A;  2F8N H;  1B67 A;  4YS3 A;  5GSU C;  3UTB B;  5JRG B;  1Q9C A;  3MVD D;  5AY8 C;  5F99 C;  4EO5 C;  5B0Z A;  4WU9 D;  3KXB A;  4Z2M H;  4WV4 B;  3AV2 B;  3AFA C;  4J8W B;  4Z66 D;  4E45 A;  2BYM B;  3WAA C;  1M1A A;  4XZQ D;  1F66 D;  3VH6 A;  2ZY5 A;  3W96 C;  1P3F C;  5AV8 A;  3MGR D;  5GSU D;  3AZN B;  3MGS D;  3VH6 W;  5B32 C;  5AVB C;  5AVC B;  2NZD A;  5AY8 D;  3W98 B;  3MGQ B;  3NQJ B;  2BG1 A;  5AV5 C;  5DNM B;  3AZF C;  3B6G C;  3AFA D;  3AV1 A;  3LZ0 A;  1P3L D;  3MNN A;  1KX5 C;  4WNN B;  4J8U C;  2Y2K A;  2HIO C;  3W96 D;  3A6N C;  2Y2H A;  3O62 C;  4XUJ B;  4HGA B;  2ARO C;  3W99 B;  4WU9 A;  2G5I C;  1P3K C;  3AZM B;  4WU8 C;  5AVB D;  3FDD A;  4Z66 A;  3MVD B;  2IO5 C;  1JFI A;  1ZLA C;  5AV5 D;  4J8X C;  1TAF B;  5B31 C;  2RIQ A;  4J8V B;  3AZF D;  1ID3 B;  3B6G D;  2ZM5 A;  3X1U C;  4KUD B;  5DNN A;  4XZQ B;  1KX5 D;  3MGS A;  4J8U D;  1F66 B;  5AV6 C;  2HIO D;  5B40 D;  4NE3 A;  3EPJ A;  1P34 D;  3O62 D;  2PYO D;  5GXQ A;  3LZ1 A;  5BNV B;  5GT3 D;  1B6W A;  5GSU B;  3AZH C;  1P3K D;  1P3L A;  3LJA D;  4KGC C;  3X1V A;  3F6T A;  3WKJ A;  5F99 B;  4EO5 B;  4H9Q A;  4CAY B;  5B31 D;  2ZY4 A;  5G49 A;  4J8X D;  3REL A;  1TZY B;  3REJ C;  4CSR A;  3X1U D;  3C1C D;  3WAA B;  4ZUX B;  5E5A A;  2RVQ C;  1EQZ B;  2XD5 A;  1P3I B;  3WKJ D;  1P3F B;  3AV2 C;  3LEL C;  3C1B D;  4NFT A;  1BH9 A;  3X1T A;  5B32 B;  1P3M C;  1S32 A;  4KGC D;  3WA9 A;  3AZJ D;  5GT0 A;  5B2J A;  5B40 A;  3UTB D;  3AZN C;  5JRG D;  1P34 A;  2PYO A;  1P3G A;  5B1M B;  1P3A A;  5AVC C;  2HUE B;  5GT3 A;  4J8U B;  5DNM C;  3A6N B;  5BO0 B;  3O62 B;  3B0C T;  3LJA A;  3AV2 D;  1PZR A;  3B6F B;  5CP6 A;  5B24 C;  2ARO B;  1N1J A;  2FFF B;  3AN2 B;  1P3M D;  4WU8 B;  3REH A;  4LD9 C;  3C1C A;  1P3P C;  4XUJ C;  2IO5 B;  4HGA C;  4ZBJ B;  5B0Y A;  4R8P B;  4H9R A;  3AZI A;  5KDM B;  1T3U A;  5CPK A;  2CV5 A;  5CPI B;  3AZN D;  3KSY A;  2NQB B;  3AZM C;  3R45 A;  3C1B A;  5AVC D;  5JA4 B;  1ULY A;  3MGP A;  3V9R A;  3W98 D;  3MGQ D;  5DNM D;  5AV6 B;  4J8V C;  3WTP E;  2F8N A;  3AZJ A;  3W97 B;  3EG5 B;  3AZH B;  3UTB A;  2JCH A;  1P3B B;  5JRG A;  3X1S A;  5BNX B;  2FJ7 C;  3VH5 T;  5C3I B;  1KX3 C;  4XUJ D;  3W99 D;  4H9S C;  3AZM D;  4J8W A;  3REJ B;  3B0C W;  2YFW B;  2F8N K;  3UT9 A;  1M18 A;  4J8V D;  1ID3 D;  1TZY C;  1M19 B;  3LEL B;  5CPJ C;  4H9N B;  4ZUX C;  4KUD D;  5BS7 A;  3UTA B;  1EQZ C;  3AL0 C;  1P3I C;  1P3M B;  2FJ7 D;  3KWQ C;  1AOI A;  2BYK B;  2L5A A;  3W98 A;  3MGQ A;  3NQJ A;  3H0R C;  4Z5T A;  3AZG A;  3VH5 A;  5B1L A;  3AYW A;  4AWL C;  2CWE A;  3P5J B;  3NQU A;  3KUY C;  3WTP A;  5F99 D;  4YS3 B;  5B33 A;  3VH5 W;  1TZY D;  5B1M C;  4DRA A;  5B24 B;  2VQR A;  4G91 B;  3W99 A;  2HUE C;  4ZUX D;  3WAA D;  1EQZ D;  2Y2I A;  1P3I D;  4X23 C;  1P3F D;  4LD9 B;  1P3P B;  3KXB B;  3MVD A;  3B6F C;  1TAF A;  1ID3 A;  1M1A B;  3AZL C;  4QLC C;  3AN2 C;  5B32 D;  4ZBJ C;  4R8P C;  5AV8 B;  3KUY D;  2DF4 C;  4XZQ A;  4YM6 C;  3REI C;  1F66 A;  3TU4 C;  5CPI C;  1W2E A;  2NQB C;  1WWS A;  5B1M D;  3MGR A;  2Y2G A;  5GSU A;  1P3O C;  5FUG B;  2FJ7 B;  3A6N D;  1KX3 B;  5AY8 A;  3B6F D;  5F99 A;  2ARO D;  3W97 C;  1KX4 C;  4CAY A;  1BH8 B;  1P3B C;  3MNN B;  3AZE C;  4QLC D;  3AZL D;  3AN2 D;  5CHL B;  3AFA A;  4WU8 D;  5C3I C;  4H9O B;  3A1I A;  1ZLA D;  2F2A C;  4R8P D;  3WAA A;  3REI D;  1HQ3 C;  5CPI D;  3W96 A;  1P3F A;  2NQB D;  5AV9 C;  5CPJ B;  3IP4 C;  4NE5 A;  1JFI B;  2Y2J A;  3AZK C;  5B32 A;  3REK C;  5AVB A;  3KWQ B;  5B2I C;  5AV6 D;  4DRB A;  2ZY3 A;  2UWX A;  1M19 C;  2Y2Q A;  5AV5 A;  3W97 D;  1KX4 D;  3AZH D;  1P3B D;  3UTA C;  3AZF A;  3B6G A;  5DNN B;  3AZE D;  4AWL B;  4JJN C;  2G5H C;  5GXQ B;  3KUY B;  1KX5 A;  4J8U A;  2HIO A;  3A6N A;  1H3O B;  3H0L C;  3LZ1 B;  3O62 A;  3X1S C;  3REJ D;  2ARO A;  4DQY B;  2RVQ D;  3X1V B;  1P3K A;  3AZK D;  3WKJ B;  4WU8 A;  1U35 C;  4X23 B;  4YS3 C;  5B2I D;  4H9Q B;  5G49 B;  1M19 D;  3LEL D;  1ZLA A;  3REL B;  4CSR B;  4G91 C;  4J8X A;  3KFU G;  5B31 A;  3UTA D;  3AZL B;  4QLC B;  3X1U A;  5B0Z C;  3KXB C;  4YM6 B;  3REI B;  3TU4 B;  5AV6 A;  1M1A C;  3X1T B;  2ZY2 A;  4KHA A;  5AV8 C;  3AZH A;  1S32 B;  3WA9 B;  1P3O B;  5GT0 B;  5B2J B;  4YS3 D;  2YFV A;  4KGC A;  1P3G B;  1P3A B;  2JE5 A;  5B24 D;  1KX4 B;  2NZD C;  3AZE B;  3REJ A;  4LD9 D;  1P3P D;  3KXB D;  5CP6 B;  3LZ0 C;  3AV1 C;  1HQ3 B;  1N1J B;  3MNN C;  1M1A D;  3AV2 A;  5AV9 B;  4X23 D;  3LEL A;  4H9N A;  2BYM A;  5AV8 D;  3AZI B;  5CPK B;  1HTA A;  3AZK B;  1P3M A;  3REK B;  2XD1 A;  5B2I B;  4WU9 C;  2BYK A;  1R4V A;  4H9P B;  4Z66 C;  3MGP B;  3AZN A;  3V9R B;  4WJ3 C;  1KX3 D;  5AVC A;  4JJN B;  4UPK A;  2LY8 A;  2F8N B;  2F8N G;  3LZ0 D;  1F1E A;  5DNM A;  3MNN D;  5DNN C;  3X1S B;  3MGS C;  4M6B A;  5B24 A;  4UUZ B;  4WNN A;  5GXQ C;  1U35 B;  4LD9 A;  3LZ1 C;  1P3P A;  3B0D C;  4Z2M G;  4XUJ A;  5CPJ D;  1KU5 A;  2DQN C;  1P3L C;  3X1V C;  3WKJ C;  3EPK A;  3AZM A;  3EPH A;  3KWQ D;  3UT9 B;  1M18 B;  5B0Z B;  3REL C;  4J8V A;  2JSS A;  5E5A C;  5DNN D;  1AOI B;  4KUD A;  5GXQ D;  5FUG A;  2FJ7 A;  1KX3 A;  3LZ1 D;  5BT1 C;  1WWI A;  4Z5T B;  3AZG B;  3AYW B;  5B1L B;  3X1T C;  5BNV A;  1BH8 A;  1S32 C;  2NZD B;  3X1V D;  4H9S A;  3NQU B;  3WA9 C;  3WTP B;  5GT0 C;  5B2J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...