3AZEC

Crystal structure of human nucleosome core particle containing h3k64q mutation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azeC00
3W99D 5GSUB 1AOIC 3NQUB 5C3IB 1P3BC 3WTPD 4Z2MG 5KDMA 5AV6D 3LELC 2HIOA 2PYOB 4Z66D 3MGQB 5B2IC 3REKB 5B24C 3AV1C 3REJB 1F66C 4G91B 5GSUD 1M18C 4JJNC 3AZND 2CV5C 1U35D 5B2JA 4X23B 3VH6W 1M1AC 3LZ0A 4XUJC 5CPJA 5B0ZB 3REKD 2BYKA 5B31B 1P3AC 2HIOD 3NQJA 4LD9A 1EQZB 5C3IC 1A7WA 5BT1C 4J8XA 5AVCC 3AZHC 3AZGB 3X1TB 5CPIB 5B0ZD 2F8NA 2BYMA 4H9RB 3KXBA 4KUDC 5B31D 3NQJB 1WWIA 4HGAB 4YM6A 3UT9B 2PYOC 3MGQC 4WU8A 3LZ0D 2F8NB 5CPJD 3REJC 1HQ3C 1EQZD 1P3GA 4X23C 1KX4A 5GT0A 5GT3A 3AZIB 4LD9D 3B6FB 4XZQC 5BO0A 1S32A 3AZKB 3WA9B 5CP6A 2F8ND 5B32A 4UUZA 3KXBD 4YM6D 4H9OA 3AZFA 1S32B 4WU8D 1KX5A 5CP6B 1BFMA 3AN2A 4J8UB 3X1TC 3AZGC 1P3FA 4ZUXA 1P3GD 1ZLAA 3UTBC 4M6BA 3W97C 5CPKB 4KHAB 4H9OB 1P3PC 3UT9C 3B6GC 5GT0D 3RELA 3AZFB 5GT3D 1H3OB 3LJAC 5B40C 4WU9C 1S32D 5CP6D 3X1VB 5B32D 3REHA 3A6NA 4J8UD 2HUEC 4QLCC 4WNNA 1JFIA 4NE5A 3AZIC 1P3OA 5CPKD 4CSRB 3B6FC 5AV8A 3AZFD 1KU5A 5AV9C 5AY8C 3REHB 3AZKC 5GXQC 3AN2D 3WA9C 1R4VA 3W96B 4ZUXD 3AZMB 1JFIB 1ID3C 1ZLAD 4J8VC 3REIC 5DNNA 4R8PA 3AYWB 4H9PB 2AROB 3C1CC 3B0CT 4E44A 1F1EA 5DNMB 3REHD 3A6ND 4J8WB 1P34A 5DNNB 3AZMD 3WKJA 1TAFA 5AV8D 3X1VC 1BH8A 3C1BB 5AV5A 3MVDA 3B0DB 4H9QB 3AZEA 5JRGC 5BNVA 5B1MA 5DNND 3UTAA 4R8PD 3O62B 1B6WA 1BH8B 3W96C 5AV5B 2NZDA 5B31G 1P3LA 1P34D 3C1BD 4Z5TB 5AV6B 3AYWC 2AROC 5BNXA 2F8NH 3MGSC 5F99C 4Z66B 1P3LB 4J8WC 5AV5D 4ZBJB 5FUGA 5B1LC 5BNXB 3AZED 3AZNB 3KWQA 5B1MD 4Z5TD 3UTAD 4XUJA 1U35B 1TZYC 2F8NG 4DRAA 2NZDD 3B0DC 1P3LD 3VH6A 3AV2A 2F8NK 3WAAA 4YS3A 5E5AA 5KDMB 3O62C 5JA4A 3AFAA 2HIOB 3W99C 5AVBA 3WAAB 3AZLA 4KUDA 3WTPC 4WV4B 3AFAB 5AV6C 1P3IA 3KWQD 5B2JB 4XUJD 5B32G 3LZ1A 4Z66C 1HQ3A 3LZ0B 4ZBJC 2YFVA 5CPJB 5BS7C 5GSUC 3AV2D 3WAAD 1P3IB 4CAYA 2BYKB 4DRBA 4YS3D 3AZNC 1U35C 5E5AD 3AFAD 1N1JA 2FJ7A 4LD9B 5B2JD 3B0CW 5AVBD 3AZLD 1P3MA 1KX3A 3REKC 4J8XB 2BYMB 4G91C 3X1SA 3KXBB 1P3KA 1P3ID 2FJ7B 5B0YA 3MNNA 2HIOC 4YM6B 3LZ1D 1P3MB 1HQ3D 1KX3B 4WU8B 3TU4A 3W97A 2NQBA 3KSYA 1P3PA 5B0ZC 1P3KB 5B0YB 1P3GB 5B31C 4J8XD 1KX4B 5GT0B 2FJ7D 5GT3B 4WU9A 2NQBB 3LZ0C 5CPJC 1P3MD 1KX3D 5BO0B 1EQZC 5B32B 4UUZB 5CPIC 3X1SD 1P3KD 5B0YD 3MNND 3WTPE 4LD9C 5GXQA 4HGAC 1KX4D 5B33A 1KX5B 3TU4D 1ID3A 2NQBD 3AN2B 1P3FB 4ZUXB 4WZSB 1M19A 3KXBC 1ZLAB 4YM6C 3RELB 4WU9D 4WU8C 4AWLB 3X1UA 3W98A 1KX5D 3MGPA 1P3GC 2L5AA 3VH5T 3A6NB 2CWEA 4WNNB 1P3FD 5GT0C 2RVQD 5GT3C 1P3OB 5GXQD 4H9SA 3MGRA 5AV8B 5B33D 3RELD 3MGPB 1S32C 5CP6C 3V9RA 5B32C 4J8UC 1M19D 3KUYA 5CPKC 3AZFC 4R8PB 1P3OD 3X1UD 3AN2C 3AZJA 3W98D 4ZUXC 3MGPD 3KUYB 1P34B 4KGCA 3MGSA 1TAFB 4AWLC 3WKJB 3MGRD 4NE6A 5B1LA 3REHC 1AOIA 3A6NC 1P3BA 3MVDB 3AZMC 1TZYA 3KUYD 3LELA 3AZEB 5BNVB 5B1MB 5AV8C 3UTAB 3WKJD 5B2IA 3AZJD 2NZDB 5B24A 3AV1A 5DNMC 1F66A 1M18A 4KGCD 4JJNA 2CV5A 2IO5B 5DNNC 3MVDD 4R8PC 1M1AA 3R45A 3AV1B 4G92B 1AOID 1P3BD 1P34C 3C1BC 5FUGB 1P3AA 3LELD 1M1AB 3KWQB 4XUJB 5GSUA 5B2ID 5B24D 5AV5C 3AZHA 3AV1D 5AVCA 1F66D 3AV2B 3AZEC 1M18D 4JJND 4YS3B 2CV5D 5B1MC 4Z5TC 5E5AB 3UTAC 3VH5A 2PYOA 5JA4B 3MGQA 1M1AD 3REKA 3AZHB 2NZDC 5AVCB 5AVBB 3REJA 3AZLB 1P3LC 4KUDB 3VH5W 2IO5C 4X23A 1P3AD 1ULYA 3LZ1B 4XZQA 4G92C 1HQ3B 5B0ZA 5B31A 5BT1D 3AZHD 1B67A 2YFVB 5AVCD 4CAYB 4KUDD 3KWQC 4NE3A 4XZQB 2PYOD 3MGQD 1N1JB 5CHLB 1EQZA 3X1TA 3REJD 3AZGA 5CPIA 4H9RA 3WAAC 3AV2C 3UTBA 4YS3C 5E5AC 4X23D 3B6GA 3UT9A 3X1SB 3AFAC 4EO5B 2LY8A 3MNNB 5B2JC 4XZQD 5AVBC 3LJAA 5B40A 3AZLC 3B0BA 4H9NA 3UTBB 3TU4B 3W97B 1P3PB 4QLCA 3B6GB 1P3IC 3AZIA 1WWSA 3LZ1C 3B6FA 3LJAB 5B40B 4WU9B 4H9NB 5AV9A 5AY8A 3AZKA 3WA9A 2HUEB 3X1TD 4QLCB 3AZGD 5CPID 3W97D 3UTBD 4J8VA 3REIA 4J8XC 1P3PD 3UT9D 3B6GD 1BH9A 2FJ7C 5AV9B 5AY8B 5GXQB 3C1CA 4J8UA 5B33B 3LJAD 5B40D 1P3MC 1KX3C 1ID3B 4J8VB 3REIB 5CPKA 4QLCD 4KHAA 1BH9B 1M19B 3X1SC 4EO5C 1P3KC 5B0YC 3MNNC 3AZID 3C1CB 3B6FD 1KX4C 1H3OA 5AV9D 3TU4C 5AY8D 3AZKD 3WA9D 3X1UB 3X1VA 2NQBC 3W98B 1Q9CA 4NFTA 1ID3D 2JSSA 4J8VD 3REID 5JRGA 4CSRA 3VH6T 2YFWA 1HTAA 3C1CD 3MGRB 3W96A 1KX5C 3AZMA 3V9RB 5JRGB 1P3FC 2RVQC 2YFWB 1ZLAC 3AYWA 4H9PA 2AROA 5B33C 3RELC 5F99A 4E45A 5DNMA 3X1VD 3AZJB 4J8WA 1M19C 5JRGD 4KGCB 3MGSB 5F99B 1P3OC 5G49A 3X1UC 3W96D 3C1BA 3W98C 5B1LB 3MGPC 1AOIB 1P3BB 4H9QA 1TZYB 3AYWD 5G49B 3O62A 3LELB 2AROD 4H9SC 3MGRC 3MGSD 5F99D 5DNMD 3W99A 5B2IB 4J8WD 5B24B 4Z5TA 3WTPA 5B1LD 1F66B 5AV6A 3KUYC 1M18B 4JJNB 2CV5B 1TZYD 3W99B 3WKJC 4Z66A 3AZJC 3R45B 3WTPB 5BS7A 3NQUA 4KGCC 3AZNA 1U35A 3MVDC 1P3AB 4Z2MH 3O62D
chains in the Genus database with same CATH superfamily
2DQNC 3W99D 5GSUB 1AOIC 3NQUB 5C3IB 1P3BC 3WTPD 4Z2MG 5KDMA 5AV6D 3LELC 2HIOA 2PYOB 4Z66D 3MGQB 5B2IC 3REKB 3A1IA 5B24C 3AV1C 3REJB 1F66C 4G91B 5GSUD 1M18C 4JJNC 3AZND 2CV5C 1U35D 5B2JA 4X23B 3VH6W 1M1AC 3LZ0A 4UPKA 4XUJC 2BG1A 2UWXA 5CPJA 5B0ZB 3REKD 2BYKA 5B31B 1P3AC 2HIOD 3NQJA 4LD9A 1EQZB 5C3IC 1A7WA 5BT1C 4J8XA 5AVCC 3AZHC 3AZGB 3X1TB 5CPIB 5B0ZD 2F8NA 2BYMA 4H9RB 3KXBA 4KUDC 5B31D 3NQJB 1WWIA 3A1KA 4HGAB 4YM6A 3UT9B 2PYOC 3MGQC 4WU8A 3LZ0D 2F8NB 5CPJD 3REJC 1HQ3C 1EQZD 1P3GA 4X23C 1KX4A 5GT0A 5GT3A 3AZIB 4LD9D 3B6FB 4XZQC 5BO0A 1S32A 3AZKB 3WA9B 5CP6A 2F8ND 5B32A 4UUZA 2Y2LA 3KXBD 4YM6D 4H9OA 3AZFA 1S32B 4WU8D 1KX5A 5CP6B 1BFMA 3AN2A 4J8UB 3X1TC 3AZGC 1P3FA 4ZUXA 1P3GD 1ZLAA 3UTBC 4M6BA 3W97C 5CPKB 4KHAB 4H9OB 1P3PC 3UT9C 3B6GC 5GT0D 3RELA 3AZFB 5GT3D 1H3OB 3LJAC 5B40C 4WU9C 1S32D 5CP6D 3X1VB 5B32D 3REHA 3A6NA 4J8UD 2HUEC 4QLCC 4WNNA 1JFIA 4NE5A 3AZIC 1P3OA 5CPKD 4CSRB 3B6FC 5AV8A 3AZFD 1KU5A 5AV9C 5AY8C 3REHB 3AZKC 5GXQC 3AN2D 3WA9C 1R4VA 3W96B 4ZUXD 3AZMB 1JFIB 1ID3C 1ZLAD 2Y2MA 4J8VC 3REIC 2JE5A 3EPJA 5DNNA 4R8PA 3AYWB 4H9PB 2AROB 3C1CC 3B0CT 4E44A 1F1EA 2RIQA 5DNMB 3REHD 3A6ND 3H0RC 4J8WB 1P34A 5DNNB 3AZMD 3WKJA 1TAFA 5AV8D 3X1VC 2ZY3A 1BH8A 3C1BB 5AV5A 3MVDA 3B0DB 3FDDA 4H9QB 3AZEA 5JRGC 5BNVA 5B1MA 5DNND 3UTAA 4R8PD 3O62B 1B6WA 2ZY5A 1BH8B 3W96C 5AV5B 3H0MC 2NZDA 5B31G 1P3LA 1P34D 3C1BD 4Z5TB 5AV6B 3AYWC 2AROC 5BNXA 2F8NH 3MGSC 5F99C 4Z66B 1P3LB 2F2AC 4J8WC 5AV5D 4ZBJB 5FUGA 5B1LC 5BNXB 3AZED 3AZNB 3KWQA 5B1MD 4Z5TD 3UTAD 4XUJA 1U35B 1TZYC 2F8NG 4DRAA 2NZDD 3EG5B 3B0DC 1P3LD 3EPKA 3VH6A 3AV2A 2F8NK 3WAAA 4YS3A 5E5AA 5KDMB 3O62C 5JA4A 3AFAA 2HIOB 3W99C 5AVBA 3WAAB 3AZLA 4KUDA 2FFFB 3WTPC 4WV4B 3AFAB 5AV6C 3KFUG 1P3IA 3H0LC 3KWQD 5B2JB 4XUJD 5B32G 3LZ1A 4Z66C 1HQ3A 3LZ0B 2J8PA 4ZBJC 2YFVA 5CPJB 5BS7C 5GSUC 3AV2D 3WAAD 1P3IB 4CAYA 2BYKB 4DRBA 4YS3D 3AZNC 1U35C 5E5AD 2G5IC 3AFAD 1N1JA 2FJ7A 4LD9B 5B2JD 3B0CW 5AVBD 3AZLD 1P3MA 1KX3A 3REKC 4J8XB 2BYMB 4G91C 3X1SA 3KXBB 1P3KA 1P3ID 2FJ7B 5B0YA 3MNNA 1PZRA 2HIOC 4YM6B 3LZ1D 1P3MB 1HQ3D 1KX3B 4WU8B 3TU4A 3W97A 2NQBA 3KSYA 1P3PA 5B0ZC 1P3KB 5B0YB 1P3GB 5B31C 4J8XD 1KX4B 5GT0B 2FJ7D 5GT3B 4WU9A 2NQBB 3LZ0C 5CPJC 3EPHA 1P3MD 1KX3D 5BO0B 1EQZC 5B32B 4UUZB 2Y2JA 5CPIC 3X1SD 1P3KD 5B0YD 3MNND 3WTPE 4LD9C 5GXQA 4HGAC 1KX4D 5B33A 1KX5B 3TU4D 3IP4C 1ID3A 2NQBD 3AN2B 1P3FB 4ZUXB 4WZSB 1M19A 3KXBC 1ZLAB 4YM6C 3RELB 4WU9D 4WU8C 4AWLB 3X1UA 3W98A 1KX5D 3MGPA 1P3GC 2L5AA 3VH5T 3A6NB 2CWEA 4WNNB 1P3FD 5GT0C 2RVQD 5GT3C 1P3OB 5GXQD 4H9SA 3MGRA 5AV8B 5B33D 3RELD 3MGPB 1S32C 5CP6C 3V9RA 5B32C 4J8UC 1M19D 2Y2HA 3KUYA 5CPKC 3AZFC 4R8PB 1P3OD 3X1UD 3AN2C 3AZJA 3EPLA 3W98D 4ZUXC 3MGPD 3KUYB 2ZM5A 1P34B 4KGCA 3MGSA 1TAFB 4AWLC 3WKJB 3MGRD 4NE6A 5B1LA 3REHC 1AOIA 3A6NC 1P3BA 3MVDB 3AZMC 1TZYA 3KUYD 3LELA 3AZEB 5BNVB 5B1MB 5AV8C 4DQYB 3UTAB 3WKJD 5B2IA 3AZJD 2Y2GA 1Z2CB 2NZDB 5B24A 3AV1A 5DNMC 1F66A 1M18A 4KGCD 4JJNA 2CV5A 2IO5B 5DNNC 3MVDD 4R8PC 1M1AA 3R45A 3AV1B 1T3UA 4G92B 1AOID 1P3BD 1P34C 3C1BC 5FUGB 1P3AA 3LELD 1M1AB 2XD5A 3KWQB 2ZY2A 4XUJB 5GSUA 5B2ID 2Y2PA 5B24D 5AV5C 3AZHA 3AV1D 5AVCA 1F66D 2DF4C 3AV2B 2G5HC 3AZEC 1M18D 4JJND 4YS3B 2CV5D 5B1MC 4Z5TC 5E5AB 3UTAC 3VH5A 2PYOA 5JA4B 3MGQA 1M1AD 3REKA 3AZHB 2NZDC 5AVCB 5AVBB 3REJA 3AZLB 1P3LC 4KUDB 3VH5W 2IO5C 4X23A 1P3AD 1ULYA 3LZ1B 4XZQA 2Y2IA 4G92C 1HQ3B 5B0ZA 5B31A 5BT1D 3AZHD 1B67A 2YFVB 5AVCD 4WJ3C 4CAYB 4KUDD 3KWQC 4NE3A 4XZQB 2PYOD 3MGQD 1N1JB 5CHLB 1EQZA 3X1TA 3REJD 3AZGA 5CPIA 4H9RA 3WAAC 3AV2C 3UTBA 4YS3C 5E5AC 4X23D 3B6GA 3UT9A 3X1SB 3AFAC 4EO5B 2LY8A 3MNNB 5B2JC 4XZQD 5AVBC 3LJAA 5B40A 3AZLC 3B0BA 4H9NA 3UTBB 3TU4B 3W97B 1P3PB 4QLCA 3B6GB 1P3IC 3AZIA 1WWSA 3LZ1C 3B6FA 3LJAB 5B40B 4WU9B 4H9NB 5AV9A 5AY8A 3AZKA 3WA9A 2HUEB 3X1TD 4QLCB 3AZGD 5CPID 3W97D 3UTBD 4J8VA 3REIA 4J8XC 1P3PD 3UT9D 3B6GD 1BH9A 2FJ7C 5AV9B 5AY8B 5GXQB 2Y2QA 3C1CA 4J8UA 5B33B 3LJAD 5B40D 1P3MC 1KX3C 1ID3B 4J8VB 3REIB 2ZY4A 5CPKA 4QLCD 4KHAA 1BH9B 1M19B 3X1SC 4EO5C 1P3KC 5B0YC 3MNNC 3AZID 3C1CB 3B6FD 1KX4C 1H3OA 3AL0C 5AV9D 3TU4C 5AY8D 3AZKD 3WA9D 3X1UB 3X1VA 2NQBC 3W98B 1Q9CA 4NFTA 1ID3D 2JSSA 3F6TA 4J8VD 3REID 5JRGA 4CSRA 2Y2NA 3VH6T 2XD1A 2YFWA 1HTAA 3C1CD 3MGRB 3W96A 1KX5C 3AZMA 3V9RB 5JRGB 1P3FC 2RVQC 1W2EA 2YFWB 1ZLAC 3AYWA 4H9PA 2AROA 5B33C 3RELC 2Y2OA 5F99A 4E45A 2W8SA 5DNMA 3X1VD 3AZJB 4J8WA 1M19C 2VQRA 5JRGD 4KGCB 3MGSB 5F99B 1P3OC 5G49A 3X1UC 3W96D 3C1BA 3W98C 5B1LB 3MGPC 1AOIB 1P3BB 4H9QA 1TZYB 3AYWD 5G49B 3O62A 3LELB 2AROD 4H9SC 3MGRC 3MGSD 5F99D 5DNMD 3W99A 5B2IB 4J8WD 5B24B 3P5JB 4Z5TA 5B1LD 3WTPA 2JCHA 1F66B 5AV6A 3KUYC 1M18B 4JJNB 2CV5B 1TZYD 3W99B 3WKJC 4Z66A 3AZJC 3R45B 3WTPB 5BS7A 3NQUA 4KGCC 3AZNA 1U35A 3MVDC 1P3AB 4Z2MH 2Y2KA 3O62D
chains in the Genus database with same CATH topology
2DQNC 3W99D 5GSUB 1AOIC 3NQUB 5C3IB 1P3BC 3WTPD 4Z2MG 5KDMA 5AV6D 3LELC 2HIOA 2PYOB 4Z66D 3MGQB 5B2IC 3REKB 3A1IA 5B24C 3AV1C 3REJB 1F66C 4G91B 5GSUD 1M18C 4JJNC 3AZND 2CV5C 1U35D 5B2JA 4X23B 3VH6W 1M1AC 3LZ0A 4UPKA 4XUJC 2BG1A 2UWXA 5CPJA 5B0ZB 3REKD 2BYKA 5B31B 1P3AC 2HIOD 3NQJA 4LD9A 1EQZB 5C3IC 1A7WA 5BT1C 4J8XA 5AVCC 3AZHC 3AZGB 3X1TB 5CPIB 5B0ZD 2F8NA 2BYMA 4H9RB 3KXBA 4KUDC 5B31D 3NQJB 1WWIA 3A1KA 4HGAB 4YM6A 3UT9B 2PYOC 3MGQC 4WU8A 3LZ0D 2F8NB 5CPJD 3REJC 1HQ3C 1EQZD 1P3GA 4X23C 1KX4A 5GT0A 5GT3A 3AZIB 4LD9D 3B6FB 4XZQC 5BO0A 1S32A 3AZKB 3WA9B 5CP6A 2F8ND 5B32A 4UUZA 2Y2LA 3KXBD 4YM6D 4H9OA 3AZFA 1S32B 4WU8D 1KX5A 5CP6B 1BFMA 3AN2A 4J8UB 3X1TC 3AZGC 1P3FA 4ZUXA 1P3GD 1ZLAA 3UTBC 4M6BA 3W97C 5CPKB 4KHAB 4H9OB 1P3PC 3UT9C 3B6GC 5GT0D 3RELA 3AZFB 5GT3D 1H3OB 3LJAC 5B40C 4WU9C 1S32D 5CP6D 3X1VB 5B32D 3REHA 3A6NA 4J8UD 2HUEC 4QLCC 4WNNA 1JFIA 4NE5A 3AZIC 1P3OA 5CPKD 4CSRB 3B6FC 5AV8A 3AZFD 1KU5A 5AV9C 5AY8C 3REHB 3AZKC 5GXQC 3AN2D 3WA9C 1R4VA 3W96B 4ZUXD 3AZMB 1JFIB 1ID3C 1ZLAD 2Y2MA 4J8VC 3REIC 2JE5A 3EPJA 5DNNA 4R8PA 3AYWB 4H9PB 2AROB 3C1CC 3B0CT 4E44A 1F1EA 2RIQA 5DNMB 3REHD 3A6ND 3H0RC 4J8WB 1P34A 5DNNB 3AZMD 3WKJA 1TAFA 5AV8D 3X1VC 2ZY3A 1BH8A 3C1BB 5AV5A 3MVDA 3B0DB 3FDDA 4H9QB 3AZEA 5JRGC 5BNVA 5B1MA 5DNND 3UTAA 4R8PD 3O62B 1B6WA 2ZY5A 1BH8B 3W96C 5AV5B 3H0MC 2NZDA 5B31G 1P3LA 1P34D 3C1BD 4Z5TB 5AV6B 3AYWC 2AROC 5BNXA 2F8NH 3MGSC 5F99C 4Z66B 1P3LB 2F2AC 4J8WC 5AV5D 4ZBJB 5FUGA 5B1LC 5BNXB 3AZED 3AZNB 3KWQA 5B1MD 4Z5TD 3UTAD 4XUJA 1U35B 1TZYC 2F8NG 4DRAA 2NZDD 3EG5B 3B0DC 1P3LD 3EPKA 3VH6A 3AV2A 2F8NK 3WAAA 4YS3A 5E5AA 5KDMB 3O62C 5JA4A 3AFAA 2HIOB 3W99C 5AVBA 3WAAB 3AZLA 4KUDA 2FFFB 3WTPC 4WV4B 3AFAB 5AV6C 3KFUG 1P3IA 3H0LC 3KWQD 5B2JB 4XUJD 5B32G 3LZ1A 4Z66C 1HQ3A 3LZ0B 2J8PA 4ZBJC 2YFVA 5CPJB 5BS7C 5GSUC 3AV2D 3WAAD 1P3IB 4CAYA 2BYKB 4DRBA 4YS3D 3AZNC 1U35C 5E5AD 2G5IC 3AFAD 1N1JA 2FJ7A 4LD9B 5B2JD 3B0CW 5AVBD 3AZLD 1P3MA 1KX3A 3REKC 4J8XB 2BYMB 4G91C 3X1SA 3KXBB 1P3KA 1P3ID 2FJ7B 5B0YA 3MNNA 1PZRA 2HIOC 4YM6B 3LZ1D 1P3MB 1HQ3D 1KX3B 4WU8B 3TU4A 3W97A 2NQBA 3KSYA 1P3PA 5B0ZC 1P3KB 5B0YB 1P3GB 5B31C 4J8XD 1KX4B 5GT0B 2FJ7D 5GT3B 4WU9A 2NQBB 3LZ0C 5CPJC 3EPHA 1P3MD 1KX3D 5BO0B 1EQZC 5B32B 4UUZB 2Y2JA 5CPIC 3X1SD 1P3KD 5B0YD 3MNND 3WTPE 4LD9C 5GXQA 4HGAC 1KX4D 5B33A 1KX5B 3TU4D 3IP4C 1ID3A 2NQBD 3AN2B 1P3FB 4ZUXB 4WZSB 1M19A 3KXBC 1ZLAB 4YM6C 3RELB 4WU9D 4WU8C 4AWLB 3X1UA 3W98A 1KX5D 3MGPA 1P3GC 2L5AA 3VH5T 3A6NB 2CWEA 4WNNB 1P3FD 5GT0C 2RVQD 5GT3C 1P3OB 5GXQD 4H9SA 3MGRA 5AV8B 5B33D 3RELD 3MGPB 1S32C 5CP6C 3V9RA 5B32C 4J8UC 1M19D 2Y2HA 3KUYA 5CPKC 3AZFC 4R8PB 1P3OD 3X1UD 3AN2C 3AZJA 3EPLA 3W98D 4ZUXC 3MGPD 3KUYB 2ZM5A 1P34B 4KGCA 3MGSA 1TAFB 4AWLC 3WKJB 3MGRD 4NE6A 5B1LA 3REHC 1AOIA 3A6NC 1P3BA 3MVDB 3AZMC 1TZYA 3KUYD 3LELA 3AZEB 5BNVB 5B1MB 5AV8C 4DQYB 3UTAB 3WKJD 5B2IA 3AZJD 2Y2GA 1Z2CB 2NZDB 5B24A 3AV1A 5DNMC 1F66A 1M18A 4KGCD 4JJNA 2CV5A 2IO5B 5DNNC 3MVDD 4R8PC 1M1AA 3R45A 3AV1B 1T3UA 4G92B 1AOID 1P3BD 1P34C 3C1BC 5FUGB 1P3AA 3LELD 1M1AB 2XD5A 3KWQB 2ZY2A 4XUJB 5GSUA 5B2ID 2Y2PA 5B24D 5AV5C 3AZHA 3AV1D 5AVCA 1F66D 2DF4C 3AV2B 2G5HC 3AZEC 1M18D 4JJND 4YS3B 2CV5D 5B1MC 4Z5TC 5E5AB 3UTAC 3VH5A 2PYOA 5JA4B 3MGQA 1M1AD 3REKA 3AZHB 2NZDC 5AVCB 5AVBB 3REJA 3AZLB 1P3LC 4KUDB 3VH5W 2IO5C 4X23A 1P3AD 1ULYA 3LZ1B 4XZQA 2Y2IA 4G92C 1HQ3B 5B0ZA 5B31A 5BT1D 3AZHD 1B67A 2YFVB 5AVCD 4WJ3C 4CAYB 4KUDD 3KWQC 4NE3A 4XZQB 2PYOD 3MGQD 1N1JB 5CHLB 1EQZA 3X1TA 3REJD 3AZGA 5CPIA 4H9RA 3WAAC 3AV2C 3UTBA 4YS3C 5E5AC 4X23D 3B6GA 3UT9A 3X1SB 3AFAC 4EO5B 2LY8A 3MNNB 5B2JC 4XZQD 5AVBC 3LJAA 5B40A 3AZLC 3B0BA 4H9NA 3UTBB 3TU4B 3W97B 1P3PB 4QLCA 3B6GB 1P3IC 3AZIA 1WWSA 3LZ1C 3B6FA 3LJAB 5B40B 4WU9B 4H9NB 5AV9A 5AY8A 3AZKA 3WA9A 2HUEB 3X1TD 4QLCB 3AZGD 5CPID 3W97D 3UTBD 4J8VA 3REIA 4J8XC 1P3PD 3UT9D 3B6GD 1BH9A 2FJ7C 5AV9B 5AY8B 5GXQB 2Y2QA 3C1CA 4J8UA 5B33B 3LJAD 5B40D 1P3MC 1KX3C 1ID3B 4J8VB 3REIB 2ZY4A 5CPKA 4QLCD 4KHAA 1BH9B 1M19B 3X1SC 4EO5C 1P3KC 5B0YC 3MNNC 3AZID 3C1CB 3B6FD 1KX4C 1H3OA 3AL0C 5AV9D 3TU4C 5AY8D 3AZKD 3WA9D 3X1UB 3X1VA 2NQBC 3W98B 1Q9CA 4NFTA 1ID3D 2JSSA 3F6TA 4J8VD 3REID 5JRGA 4CSRA 2Y2NA 3VH6T 2XD1A 2YFWA 1HTAA 3C1CD 3MGRB 3W96A 1KX5C 3AZMA 3V9RB 5JRGB 1P3FC 2RVQC 1W2EA 2YFWB 1ZLAC 3AYWA 4H9PA 2AROA 5B33C 3RELC 2Y2OA 5F99A 4E45A 2W8SA 5DNMA 3X1VD 3AZJB 4J8WA 1M19C 2VQRA 5JRGD 4KGCB 3MGSB 5F99B 1P3OC 5G49A 3X1UC 3W96D 3C1BA 3W98C 5B1LB 3MGPC 1AOIB 1P3BB 4H9QA 1TZYB 3AYWD 5G49B 3O62A 3LELB 2AROD 4H9SC 3MGRC 3MGSD 5F99D 5DNMD 3W99A 5B2IB 4J8WD 5B24B 3P5JB 4Z5TA 5B1LD 3WTPA 2JCHA 1F66B 5AV6A 3KUYC 1M18B 4JJNB 2CV5B 1TZYD 3W99B 3WKJC 4Z66A 3AZJC 3R45B 3WTPB 5BS7A 3NQUA 4KGCC 3AZNA 1U35A 3MVDC 1P3AB 4Z2MH 2Y2KA 3O62D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W99 D;  5GSU B;  1AOI C;  3NQU B;  5C3I B;  1P3B C;  3WTP D;  4Z2M G;  5KDM A;  5AV6 D;  3LEL C;  2HIO A;  2PYO B;  4Z66 D;  3MGQ B;  5B2I C;  3REK B;  5B24 C;  3AV1 C;  3REJ B;  1F66 C;  4G91 B;  5GSU D;  1M18 C;  4JJN C;  3AZN D;  2CV5 C;  1U35 D;  5B2J A;  4X23 B;  3VH6 W;  1M1A C;  3LZ0 A;  4XUJ C;  5CPJ A;  5B0Z B;  3REK D;  2BYK A;  5B31 B;  1P3A C;  2HIO D;  3NQJ A;  4LD9 A;  1EQZ B;  5C3I C;  1A7W A;  5BT1 C;  4J8X A;  5AVC C;  3AZH C;  3AZG B;  3X1T B;  5CPI B;  5B0Z D;  2F8N A;  2BYM A;  4H9R B;  3KXB A;  4KUD C;  5B31 D;  3NQJ B;  1WWI A;  4HGA B;  4YM6 A;  3UT9 B;  2PYO C;  3MGQ C;  4WU8 A;  3LZ0 D;  2F8N B;  5CPJ D;  3REJ C;  1HQ3 C;  1EQZ D;  1P3G A;  4X23 C;  1KX4 A;  5GT0 A;  5GT3 A;  3AZI B;  4LD9 D;  3B6F B;  4XZQ C;  5BO0 A;  1S32 A;  3AZK B;  3WA9 B;  5CP6 A;  2F8N D;  5B32 A;  4UUZ A;  3KXB D;  4YM6 D;  4H9O A;  3AZF A;  1S32 B;  4WU8 D;  1KX5 A;  5CP6 B;  1BFM A;  3AN2 A;  4J8U B;  3X1T C;  3AZG C;  1P3F A;  4ZUX A;  1P3G D;  1ZLA A;  3UTB C;  4M6B A;  3W97 C;  5CPK B;  4KHA B;  4H9O B;  1P3P C;  3UT9 C;  3B6G C;  5GT0 D;  3REL A;  3AZF B;  5GT3 D;  1H3O B;  3LJA C;  5B40 C;  4WU9 C;  1S32 D;  5CP6 D;  3X1V B;  5B32 D;  3REH A;  3A6N A;  4J8U D;  2HUE C;  4QLC C;  4WNN A;  1JFI A;  4NE5 A;  3AZI C;  1P3O A;  5CPK D;  4CSR B;  3B6F C;  5AV8 A;  3AZF D;  1KU5 A;  5AV9 C;  5AY8 C;  3REH B;  3AZK C;  5GXQ C;  3AN2 D;  3WA9 C;  1R4V A;  3W96 B;  4ZUX D;  3AZM B;  1JFI B;  1ID3 C;  1ZLA D;  4J8V C;  3REI C;  5DNN A;  4R8P A;  3AYW B;  4H9P B;  2ARO B;  3C1C C;  3B0C T;  4E44 A;  1F1E A;  5DNM B;  3REH D;  3A6N D;  4J8W B;  1P34 A;  5DNN B;  3AZM D;  3WKJ A;  1TAF A;  5AV8 D;  3X1V C;  1BH8 A;  3C1B B;  5AV5 A;  3MVD A;  3B0D B;  4H9Q B;  3AZE A;  5JRG C;  5BNV A;  5B1M A;  5DNN D;  3UTA A;  4R8P D;  3O62 B;  1B6W A;  1BH8 B;  3W96 C;  5AV5 B;  2NZD A;  5B31 G;  1P3L A;  1P34 D;  3C1B D;  4Z5T B;  5AV6 B;  3AYW C;  2ARO C;  5BNX A;  2F8N H;  3MGS C;  5F99 C;  4Z66 B;  1P3L B;  4J8W C;  5AV5 D;  4ZBJ B;  5FUG A;  5B1L C;  5BNX B;  3AZE D;  3AZN B;  3KWQ A;  5B1M D;  4Z5T D;  3UTA D;  4XUJ A;  1U35 B;  1TZY C;  2F8N G;  4DRA A;  2NZD D;  3B0D C;  1P3L D;  3VH6 A;  3AV2 A;  2F8N K;  3WAA A;  4YS3 A;  5E5A A;  5KDM B;  3O62 C;  5JA4 A;  3AFA A;  2HIO B;  3W99 C;  5AVB A;  3WAA B;  3AZL A;  4KUD A;  3WTP C;  4WV4 B;  3AFA B;  5AV6 C;  1P3I A;  3KWQ D;  5B2J B;  4XUJ D;  5B32 G;  3LZ1 A;  4Z66 C;  1HQ3 A;  3LZ0 B;  4ZBJ C;  2YFV A;  5CPJ B;  5BS7 C;  5GSU C;  3AV2 D;  3WAA D;  1P3I B;  4CAY A;  2BYK B;  4DRB A;  4YS3 D;  3AZN C;  1U35 C;  5E5A D;  3AFA D;  1N1J A;  2FJ7 A;  4LD9 B;  5B2J D;  3B0C W;  5AVB D;  3AZL D;  1P3M A;  1KX3 A;  3REK C;  4J8X B;  2BYM B;  4G91 C;  3X1S A;  3KXB B;  1P3K A;  1P3I D;  2FJ7 B;  5B0Y A;  3MNN A;  2HIO C;  4YM6 B;  3LZ1 D;  1P3M B;  1HQ3 D;  1KX3 B;  4WU8 B;  3TU4 A;  3W97 A;  2NQB A;  3KSY A;  1P3P A;  5B0Z C;  1P3K B;  5B0Y B;  1P3G B;  5B31 C;  4J8X D;  1KX4 B;  5GT0 B;  2FJ7 D;  5GT3 B;  4WU9 A;  2NQB B;  3LZ0 C;  5CPJ C;  1P3M D;  1KX3 D;  5BO0 B;  1EQZ C;  5B32 B;  4UUZ B;  5CPI C;  3X1S D;  1P3K D;  5B0Y D;  3MNN D;  3WTP E;  4LD9 C;  5GXQ A;  4HGA C;  1KX4 D;  5B33 A;  1KX5 B;  3TU4 D;  1ID3 A;  2NQB D;  3AN2 B;  1P3F B;  4ZUX B;  4WZS B;  1M19 A;  3KXB C;  1ZLA B;  4YM6 C;  3REL B;  4WU9 D;  4WU8 C;  4AWL B;  3X1U A;  3W98 A;  1KX5 D;  3MGP A;  1P3G C;  2L5A A;  3VH5 T;  3A6N B;  2CWE A;  4WNN B;  1P3F D;  5GT0 C;  2RVQ D;  5GT3 C;  1P3O B;  5GXQ D;  4H9S A;  3MGR A;  5AV8 B;  5B33 D;  3REL D;  3MGP B;  1S32 C;  5CP6 C;  3V9R A;  5B32 C;  4J8U C;  1M19 D;  3KUY A;  5CPK C;  3AZF C;  4R8P B;  1P3O D;  3X1U D;  3AN2 C;  3AZJ A;  3W98 D;  4ZUX C;  3MGP D;  3KUY B;  1P34 B;  4KGC A;  3MGS A;  1TAF B;  4AWL C;  3WKJ B;  3MGR D;  4NE6 A;  5B1L A;  3REH C;  1AOI A;  3A6N C;  1P3B A;  3MVD B;  3AZM C;  1TZY A;  3KUY D;  3LEL A;  3AZE B;  5BNV B;  5B1M B;  5AV8 C;  3UTA B;  3WKJ D;  5B2I A;  3AZJ D;  2NZD B;  5B24 A;  3AV1 A;  5DNM C;  1F66 A;  1M18 A;  4KGC D;  4JJN A;  2CV5 A;  2IO5 B;  5DNN C;  3MVD D;  4R8P C;  1M1A A;  3R45 A;  3AV1 B;  4G92 B;  1AOI D;  1P3B D;  1P34 C;  3C1B C;  5FUG B;  1P3A A;  3LEL D;  1M1A B;  3KWQ B;  4XUJ B;  5GSU A;  5B2I D;  5B24 D;  5AV5 C;  3AZH A;  3AV1 D;  5AVC A;  1F66 D;  3AV2 B;  3AZE C;  1M18 D;  4JJN D;  4YS3 B;  2CV5 D;  5B1M C;  4Z5T C;  5E5A B;  3UTA C;  3VH5 A;  2PYO A;  5JA4 B;  3MGQ A;  1M1A D;  3REK A;  3AZH B;  2NZD C;  5AVC B;  5AVB B;  3REJ A;  3AZL B;  1P3L C;  4KUD B;  3VH5 W;  2IO5 C;  4X23 A;  1P3A D;  1ULY A;  3LZ1 B;  4XZQ A;  4G92 C;  1HQ3 B;  5B0Z A;  5B31 A;  5BT1 D;  3AZH D;  1B67 A;  2YFV B;  5AVC D;  4CAY B;  4KUD D;  3KWQ C;  4NE3 A;  4XZQ B;  2PYO D;  3MGQ D;  1N1J B;  5CHL B;  1EQZ A;  3X1T A;  3REJ D;  3AZG A;  5CPI A;  4H9R A;  3WAA C;  3AV2 C;  3UTB A;  4YS3 C;  5E5A C;  4X23 D;  3B6G A;  3UT9 A;  3X1S B;  3AFA C;  4EO5 B;  2LY8 A;  3MNN B;  5B2J C;  4XZQ D;  5AVB C;  3LJA A;  5B40 A;  3AZL C;  3B0B A;  4H9N A;  3UTB B;  3TU4 B;  3W97 B;  1P3P B;  4QLC A;  3B6G B;  1P3I C;  3AZI A;  1WWS A;  3LZ1 C;  3B6F A;  3LJA B;  5B40 B;  4WU9 B;  4H9N B;  5AV9 A;  5AY8 A;  3AZK A;  3WA9 A;  2HUE B;  3X1T D;  4QLC B;  3AZG D;  5CPI D;  3W97 D;  3UTB D;  4J8V A;  3REI A;  4J8X C;  1P3P D;  3UT9 D;  3B6G D;  1BH9 A;  2FJ7 C;  5AV9 B;  5AY8 B;  5GXQ B;  3C1C A;  4J8U A;  5B33 B;  3LJA D;  5B40 D;  1P3M C;  1KX3 C;  1ID3 B;  4J8V B;  3REI B;  5CPK A;  4QLC D;  4KHA A;  1BH9 B;  1M19 B;  3X1S C;  4EO5 C;  1P3K C;  5B0Y C;  3MNN C;  3AZI D;  3C1C B;  3B6F D;  1KX4 C;  1H3O A;  5AV9 D;  3TU4 C;  5AY8 D;  3AZK D;  3WA9 D;  3X1U B;  3X1V A;  2NQB C;  3W98 B;  1Q9C A;  4NFT A;  1ID3 D;  2JSS A;  4J8V D;  3REI D;  5JRG A;  4CSR A;  3VH6 T;  2YFW A;  1HTA A;  3C1C D;  3MGR B;  3W96 A;  1KX5 C;  3AZM A;  3V9R B;  5JRG B;  1P3F C;  2RVQ C;  2YFW B;  1ZLA C;  3AYW A;  4H9P A;  2ARO A;  5B33 C;  3REL C;  5F99 A;  4E45 A;  5DNM A;  3X1V D;  3AZJ B;  4J8W A;  1M19 C;  5JRG D;  4KGC B;  3MGS B;  5F99 B;  1P3O C;  5G49 A;  3X1U C;  3W96 D;  3C1B A;  3W98 C;  5B1L B;  3MGP C;  1AOI B;  1P3B B;  4H9Q A;  1TZY B;  3AYW D;  5G49 B;  3O62 A;  3LEL B;  2ARO D;  4H9S C;  3MGR C;  3MGS D;  5F99 D;  5DNM D;  3W99 A;  5B2I B;  4J8W D;  5B24 B;  4Z5T A;  3WTP A;  5B1L D;  1F66 B;  5AV6 A;  3KUY C;  1M18 B;  4JJN B;  2CV5 B;  1TZY D;  3W99 B;  3WKJ C;  4Z66 A;  3AZJ C;  3R45 B;  3WTP B;  5BS7 A;  3NQU A;  4KGC C;  3AZN A;  1U35 A;  3MVD C;  1P3A B;  4Z2M H;  3O62 D; 
#chains in the Genus database with same CATH topology
 2DQN C;  3W99 D;  5GSU B;  1AOI C;  3NQU B;  5C3I B;  1P3B C;  3WTP D;  4Z2M G;  5KDM A;  5AV6 D;  3LEL C;  2HIO A;  2PYO B;  4Z66 D;  3MGQ B;  5B2I C;  3REK B;  3A1I A;  5B24 C;  3AV1 C;  3REJ B;  1F66 C;  4G91 B;  5GSU D;  1M18 C;  4JJN C;  3AZN D;  2CV5 C;  1U35 D;  5B2J A;  4X23 B;  3VH6 W;  1M1A C;  3LZ0 A;  4UPK A;  4XUJ C;  2BG1 A;  2UWX A;  5CPJ A;  5B0Z B;  3REK D;  2BYK A;  5B31 B;  1P3A C;  2HIO D;  3NQJ A;  4LD9 A;  1EQZ B;  5C3I C;  1A7W A;  5BT1 C;  4J8X A;  5AVC C;  3AZH C;  3AZG B;  3X1T B;  5CPI B;  5B0Z D;  2F8N A;  2BYM A;  4H9R B;  3KXB A;  4KUD C;  5B31 D;  3NQJ B;  1WWI A;  3A1K A;  4HGA B;  4YM6 A;  3UT9 B;  2PYO C;  3MGQ C;  4WU8 A;  3LZ0 D;  2F8N B;  5CPJ D;  3REJ C;  1HQ3 C;  1EQZ D;  1P3G A;  4X23 C;  1KX4 A;  5GT0 A;  5GT3 A;  3AZI B;  4LD9 D;  3B6F B;  4XZQ C;  5BO0 A;  1S32 A;  3AZK B;  3WA9 B;  5CP6 A;  2F8N D;  5B32 A;  4UUZ A;  2Y2L A;  3KXB D;  4YM6 D;  4H9O A;  3AZF A;  1S32 B;  4WU8 D;  1KX5 A;  5CP6 B;  1BFM A;  3AN2 A;  4J8U B;  3X1T C;  3AZG C;  1P3F A;  4ZUX A;  1P3G D;  1ZLA A;  3UTB C;  4M6B A;  3W97 C;  5CPK B;  4KHA B;  4H9O B;  1P3P C;  3UT9 C;  3B6G C;  5GT0 D;  3REL A;  3AZF B;  5GT3 D;  1H3O B;  3LJA C;  5B40 C;  4WU9 C;  1S32 D;  5CP6 D;  3X1V B;  5B32 D;  3REH A;  3A6N A;  4J8U D;  2HUE C;  4QLC C;  4WNN A;  1JFI A;  4NE5 A;  3AZI C;  1P3O A;  5CPK D;  4CSR B;  3B6F C;  5AV8 A;  3AZF D;  1KU5 A;  5AV9 C;  5AY8 C;  3REH B;  3AZK C;  5GXQ C;  3AN2 D;  3WA9 C;  1R4V A;  3W96 B;  4ZUX D;  3AZM B;  1JFI B;  1ID3 C;  1ZLA D;  2Y2M A;  4J8V C;  3REI C;  2JE5 A;  3EPJ A;  5DNN A;  4R8P A;  3AYW B;  4H9P B;  2ARO B;  3C1C C;  3B0C T;  4E44 A;  1F1E A;  2RIQ A;  5DNM B;  3REH D;  3A6N D;  3H0R C;  4J8W B;  1P34 A;  5DNN B;  3AZM D;  3WKJ A;  1TAF A;  5AV8 D;  3X1V C;  2ZY3 A;  1BH8 A;  3C1B B;  5AV5 A;  3MVD A;  3B0D B;  3FDD A;  4H9Q B;  3AZE A;  5JRG C;  5BNV A;  5B1M A;  5DNN D;  3UTA A;  4R8P D;  3O62 B;  1B6W A;  2ZY5 A;  1BH8 B;  3W96 C;  5AV5 B;  3H0M C;  2NZD A;  5B31 G;  1P3L A;  1P34 D;  3C1B D;  4Z5T B;  5AV6 B;  3AYW C;  2ARO C;  5BNX A;  2F8N H;  3MGS C;  5F99 C;  4Z66 B;  1P3L B;  2F2A C;  4J8W C;  5AV5 D;  4ZBJ B;  5FUG A;  5B1L C;  5BNX B;  3AZE D;  3AZN B;  3KWQ A;  5B1M D;  4Z5T D;  3UTA D;  4XUJ A;  1U35 B;  1TZY C;  2F8N G;  4DRA A;  2NZD D;  3EG5 B;  3B0D C;  1P3L D;  3EPK A;  3VH6 A;  3AV2 A;  2F8N K;  3WAA A;  4YS3 A;  5E5A A;  5KDM B;  3O62 C;  5JA4 A;  3AFA A;  2HIO B;  3W99 C;  5AVB A;  3WAA B;  3AZL A;  4KUD A;  2FFF B;  3WTP C;  4WV4 B;  3AFA B;  5AV6 C;  3KFU G;  1P3I A;  3H0L C;  3KWQ D;  5B2J B;  4XUJ D;  5B32 G;  3LZ1 A;  4Z66 C;  1HQ3 A;  3LZ0 B;  2J8P A;  4ZBJ C;  2YFV A;  5CPJ B;  5BS7 C;  5GSU C;  3AV2 D;  3WAA D;  1P3I B;  4CAY A;  2BYK B;  4DRB A;  4YS3 D;  3AZN C;  1U35 C;  5E5A D;  2G5I C;  3AFA D;  1N1J A;  2FJ7 A;  4LD9 B;  5B2J D;  3B0C W;  5AVB D;  3AZL D;  1P3M A;  1KX3 A;  3REK C;  4J8X B;  2BYM B;  4G91 C;  3X1S A;  3KXB B;  1P3K A;  1P3I D;  2FJ7 B;  5B0Y A;  3MNN A;  1PZR A;  2HIO C;  4YM6 B;  3LZ1 D;  1P3M B;  1HQ3 D;  1KX3 B;  4WU8 B;  3TU4 A;  3W97 A;  2NQB A;  3KSY A;  1P3P A;  5B0Z C;  1P3K B;  5B0Y B;  1P3G B;  5B31 C;  4J8X D;  1KX4 B;  5GT0 B;  2FJ7 D;  5GT3 B;  4WU9 A;  2NQB B;  3LZ0 C;  5CPJ C;  3EPH A;  1P3M D;  1KX3 D;  5BO0 B;  1EQZ C;  5B32 B;  4UUZ B;  2Y2J A;  5CPI C;  3X1S D;  1P3K D;  5B0Y D;  3MNN D;  3WTP E;  4LD9 C;  5GXQ A;  4HGA C;  1KX4 D;  5B33 A;  1KX5 B;  3TU4 D;  3IP4 C;  1ID3 A;  2NQB D;  3AN2 B;  1P3F B;  4ZUX B;  4WZS B;  1M19 A;  3KXB C;  1ZLA B;  4YM6 C;  3REL B;  4WU9 D;  4WU8 C;  4AWL B;  3X1U A;  3W98 A;  1KX5 D;  3MGP A;  1P3G C;  2L5A A;  3VH5 T;  3A6N B;  2CWE A;  4WNN B;  1P3F D;  5GT0 C;  2RVQ D;  5GT3 C;  1P3O B;  5GXQ D;  4H9S A;  3MGR A;  5AV8 B;  5B33 D;  3REL D;  3MGP B;  1S32 C;  5CP6 C;  3V9R A;  5B32 C;  4J8U C;  1M19 D;  2Y2H A;  3KUY A;  5CPK C;  3AZF C;  4R8P B;  1P3O D;  3X1U D;  3AN2 C;  3AZJ A;  3EPL A;  3W98 D;  4ZUX C;  3MGP D;  3KUY B;  2ZM5 A;  1P34 B;  4KGC A;  3MGS A;  1TAF B;  4AWL C;  3WKJ B;  3MGR D;  4NE6 A;  5B1L A;  3REH C;  1AOI A;  3A6N C;  1P3B A;  3MVD B;  3AZM C;  1TZY A;  3KUY D;  3LEL A;  3AZE B;  5BNV B;  5B1M B;  5AV8 C;  4DQY B;  3UTA B;  3WKJ D;  5B2I A;  3AZJ D;  2Y2G A;  1Z2C B;  2NZD B;  5B24 A;  3AV1 A;  5DNM C;  1F66 A;  1M18 A;  4KGC D;  4JJN A;  2CV5 A;  2IO5 B;  5DNN C;  3MVD D;  4R8P C;  1M1A A;  3R45 A;  3AV1 B;  1T3U A;  4G92 B;  1AOI D;  1P3B D;  1P34 C;  3C1B C;  5FUG B;  1P3A A;  3LEL D;  1M1A B;  2XD5 A;  3KWQ B;  2ZY2 A;  4XUJ B;  5GSU A;  5B2I D;  2Y2P A;  5B24 D;  5AV5 C;  3AZH A;  3AV1 D;  5AVC A;  1F66 D;  2DF4 C;  3AV2 B;  2G5H C;  3AZE C;  1M18 D;  4JJN D;  4YS3 B;  2CV5 D;  5B1M C;  4Z5T C;  5E5A B;  3UTA C;  3VH5 A;  2PYO A;  5JA4 B;  3MGQ A;  1M1A D;  3REK A;  3AZH B;  2NZD C;  5AVC B;  5AVB B;  3REJ A;  3AZL B;  1P3L C;  4KUD B;  3VH5 W;  2IO5 C;  4X23 A;  1P3A D;  1ULY A;  3LZ1 B;  4XZQ A;  2Y2I A;  4G92 C;  1HQ3 B;  5B0Z A;  5B31 A;  5BT1 D;  3AZH D;  1B67 A;  2YFV B;  5AVC D;  4WJ3 C;  4CAY B;  4KUD D;  3KWQ C;  4NE3 A;  4XZQ B;  2PYO D;  3MGQ D;  1N1J B;  5CHL B;  1EQZ A;  3X1T A;  3REJ D;  3AZG A;  5CPI A;  4H9R A;  3WAA C;  3AV2 C;  3UTB A;  4YS3 C;  5E5A C;  4X23 D;  3B6G A;  3UT9 A;  3X1S B;  3AFA C;  4EO5 B;  2LY8 A;  3MNN B;  5B2J C;  4XZQ D;  5AVB C;  3LJA A;  5B40 A;  3AZL C;  3B0B A;  4H9N A;  3UTB B;  3TU4 B;  3W97 B;  1P3P B;  4QLC A;  3B6G B;  1P3I C;  3AZI A;  1WWS A;  3LZ1 C;  3B6F A;  3LJA B;  5B40 B;  4WU9 B;  4H9N B;  5AV9 A;  5AY8 A;  3AZK A;  3WA9 A;  2HUE B;  3X1T D;  4QLC B;  3AZG D;  5CPI D;  3W97 D;  3UTB D;  4J8V A;  3REI A;  4J8X C;  1P3P D;  3UT9 D;  3B6G D;  1BH9 A;  2FJ7 C;  5AV9 B;  5AY8 B;  5GXQ B;  2Y2Q A;  3C1C A;  4J8U A;  5B33 B;  3LJA D;  5B40 D;  1P3M C;  1KX3 C;  1ID3 B;  4J8V B;  3REI B;  2ZY4 A;  5CPK A;  4QLC D;  4KHA A;  1BH9 B;  1M19 B;  3X1S C;  4EO5 C;  1P3K C;  5B0Y C;  3MNN C;  3AZI D;  3C1C B;  3B6F D;  1KX4 C;  1H3O A;  3AL0 C;  5AV9 D;  3TU4 C;  5AY8 D;  3AZK D;  3WA9 D;  3X1U B;  3X1V A;  2NQB C;  3W98 B;  1Q9C A;  4NFT A;  1ID3 D;  2JSS A;  3F6T A;  4J8V D;  3REI D;  5JRG A;  4CSR A;  2Y2N A;  3VH6 T;  2XD1 A;  2YFW A;  1HTA A;  3C1C D;  3MGR B;  3W96 A;  1KX5 C;  3AZM A;  3V9R B;  5JRG B;  1P3F C;  2RVQ C;  1W2E A;  2YFW B;  1ZLA C;  3AYW A;  4H9P A;  2ARO A;  5B33 C;  3REL C;  2Y2O A;  5F99 A;  4E45 A;  2W8S A;  5DNM A;  3X1V D;  3AZJ B;  4J8W A;  1M19 C;  2VQR A;  5JRG D;  4KGC B;  3MGS B;  5F99 B;  1P3O C;  5G49 A;  3X1U C;  3W96 D;  3C1B A;  3W98 C;  5B1L B;  3MGP C;  1AOI B;  1P3B B;  4H9Q A;  1TZY B;  3AYW D;  5G49 B;  3O62 A;  3LEL B;  2ARO D;  4H9S C;  3MGR C;  3MGS D;  5F99 D;  5DNM D;  3W99 A;  5B2I B;  4J8W D;  5B24 B;  3P5J B;  4Z5T A;  5B1L D;  3WTP A;  2JCH A;  1F66 B;  5AV6 A;  3KUY C;  1M18 B;  4JJN B;  2CV5 B;  1TZY D;  3W99 B;  3WKJ C;  4Z66 A;  3AZJ C;  3R45 B;  3WTP B;  5BS7 A;  3NQU A;  4KGC C;  3AZN A;  1U35 A;  3MVD C;  1P3A B;  4Z2M H;  2Y2K A;  3O62 D; 
#chains in the Genus database with same CATH homology
 2DQN C;  3W99 D;  5GSU B;  1AOI C;  3NQU B;  5C3I B;  1P3B C;  3WTP D;  4Z2M G;  5KDM A;  5AV6 D;  3LEL C;  2HIO A;  2PYO B;  4Z66 D;  3MGQ B;  5B2I C;  3REK B;  3A1I A;  5B24 C;  3AV1 C;  3REJ B;  1F66 C;  4G91 B;  5GSU D;  1M18 C;  4JJN C;  3AZN D;  2CV5 C;  1U35 D;  5B2J A;  4X23 B;  3VH6 W;  1M1A C;  3LZ0 A;  4UPK A;  4XUJ C;  2BG1 A;  2UWX A;  5CPJ A;  5B0Z B;  3REK D;  2BYK A;  5B31 B;  1P3A C;  2HIO D;  3NQJ A;  4LD9 A;  1EQZ B;  5C3I C;  1A7W A;  5BT1 C;  4J8X A;  5AVC C;  3AZH C;  3AZG B;  3X1T B;  5CPI B;  5B0Z D;  2F8N A;  2BYM A;  4H9R B;  3KXB A;  4KUD C;  5B31 D;  3NQJ B;  1WWI A;  3A1K A;  4HGA B;  4YM6 A;  3UT9 B;  2PYO C;  3MGQ C;  4WU8 A;  3LZ0 D;  2F8N B;  5CPJ D;  3REJ C;  1HQ3 C;  1EQZ D;  1P3G A;  4X23 C;  1KX4 A;  5GT0 A;  5GT3 A;  3AZI B;  4LD9 D;  3B6F B;  4XZQ C;  5BO0 A;  1S32 A;  3AZK B;  3WA9 B;  5CP6 A;  2F8N D;  5B32 A;  4UUZ A;  2Y2L A;  3KXB D;  4YM6 D;  4H9O A;  3AZF A;  1S32 B;  4WU8 D;  1KX5 A;  5CP6 B;  1BFM A;  3AN2 A;  4J8U B;  3X1T C;  3AZG C;  1P3F A;  4ZUX A;  1P3G D;  1ZLA A;  3UTB C;  4M6B A;  3W97 C;  5CPK B;  4KHA B;  4H9O B;  1P3P C;  3UT9 C;  3B6G C;  5GT0 D;  3REL A;  3AZF B;  5GT3 D;  1H3O B;  3LJA C;  5B40 C;  4WU9 C;  1S32 D;  5CP6 D;  3X1V B;  5B32 D;  3REH A;  3A6N A;  4J8U D;  2HUE C;  4QLC C;  4WNN A;  1JFI A;  4NE5 A;  3AZI C;  1P3O A;  5CPK D;  4CSR B;  3B6F C;  5AV8 A;  3AZF D;  1KU5 A;  5AV9 C;  5AY8 C;  3REH B;  3AZK C;  5GXQ C;  3AN2 D;  3WA9 C;  1R4V A;  3W96 B;  4ZUX D;  3AZM B;  1JFI B;  1ID3 C;  1ZLA D;  2Y2M A;  4J8V C;  3REI C;  2JE5 A;  3EPJ A;  5DNN A;  4R8P A;  3AYW B;  4H9P B;  2ARO B;  3C1C C;  3B0C T;  4E44 A;  1F1E A;  2RIQ A;  5DNM B;  3REH D;  3A6N D;  3H0R C;  4J8W B;  1P34 A;  5DNN B;  3AZM D;  3WKJ A;  1TAF A;  5AV8 D;  3X1V C;  2ZY3 A;  1BH8 A;  3C1B B;  5AV5 A;  3MVD A;  3B0D B;  3FDD A;  4H9Q B;  3AZE A;  5JRG C;  5BNV A;  5B1M A;  5DNN D;  3UTA A;  4R8P D;  3O62 B;  1B6W A;  2ZY5 A;  1BH8 B;  3W96 C;  5AV5 B;  3H0M C;  2NZD A;  5B31 G;  1P3L A;  1P34 D;  3C1B D;  4Z5T B;  5AV6 B;  3AYW C;  2ARO C;  5BNX A;  2F8N H;  3MGS C;  5F99 C;  4Z66 B;  1P3L B;  2F2A C;  4J8W C;  5AV5 D;  4ZBJ B;  5FUG A;  5B1L C;  5BNX B;  3AZE D;  3AZN B;  3KWQ A;  5B1M D;  4Z5T D;  3UTA D;  4XUJ A;  1U35 B;  1TZY C;  2F8N G;  4DRA A;  2NZD D;  3EG5 B;  3B0D C;  1P3L D;  3EPK A;  3VH6 A;  3AV2 A;  2F8N K;  3WAA A;  4YS3 A;  5E5A A;  5KDM B;  3O62 C;  5JA4 A;  3AFA A;  2HIO B;  3W99 C;  5AVB A;  3WAA B;  3AZL A;  4KUD A;  2FFF B;  3WTP C;  4WV4 B;  3AFA B;  5AV6 C;  3KFU G;  1P3I A;  3H0L C;  3KWQ D;  5B2J B;  4XUJ D;  5B32 G;  3LZ1 A;  4Z66 C;  1HQ3 A;  3LZ0 B;  2J8P A;  4ZBJ C;  2YFV A;  5CPJ B;  5BS7 C;  5GSU C;  3AV2 D;  3WAA D;  1P3I B;  4CAY A;  2BYK B;  4DRB A;  4YS3 D;  3AZN C;  1U35 C;  5E5A D;  2G5I C;  3AFA D;  1N1J A;  2FJ7 A;  4LD9 B;  5B2J D;  3B0C W;  5AVB D;  3AZL D;  1P3M A;  1KX3 A;  3REK C;  4J8X B;  2BYM B;  4G91 C;  3X1S A;  3KXB B;  1P3K A;  1P3I D;  2FJ7 B;  5B0Y A;  3MNN A;  1PZR A;  2HIO C;  4YM6 B;  3LZ1 D;  1P3M B;  1HQ3 D;  1KX3 B;  4WU8 B;  3TU4 A;  3W97 A;  2NQB A;  3KSY A;  1P3P A;  5B0Z C;  1P3K B;  5B0Y B;  1P3G B;  5B31 C;  4J8X D;  1KX4 B;  5GT0 B;  2FJ7 D;  5GT3 B;  4WU9 A;  2NQB B;  3LZ0 C;  5CPJ C;  3EPH A;  1P3M D;  1KX3 D;  5BO0 B;  1EQZ C;  5B32 B;  4UUZ B;  2Y2J A;  5CPI C;  3X1S D;  1P3K D;  5B0Y D;  3MNN D;  3WTP E;  4LD9 C;  5GXQ A;  4HGA C;  1KX4 D;  5B33 A;  1KX5 B;  3TU4 D;  3IP4 C;  1ID3 A;  2NQB D;  3AN2 B;  1P3F B;  4ZUX B;  4WZS B;  1M19 A;  3KXB C;  1ZLA B;  4YM6 C;  3REL B;  4WU9 D;  4WU8 C;  4AWL B;  3X1U A;  3W98 A;  1KX5 D;  3MGP A;  1P3G C;  2L5A A;  3VH5 T;  3A6N B;  2CWE A;  4WNN B;  1P3F D;  5GT0 C;  2RVQ D;  5GT3 C;  1P3O B;  5GXQ D;  4H9S A;  3MGR A;  5AV8 B;  5B33 D;  3REL D;  3MGP B;  1S32 C;  5CP6 C;  3V9R A;  5B32 C;  4J8U C;  1M19 D;  2Y2H A;  3KUY A;  5CPK C;  3AZF C;  4R8P B;  1P3O D;  3X1U D;  3AN2 C;  3AZJ A;  3EPL A;  3W98 D;  4ZUX C;  3MGP D;  3KUY B;  2ZM5 A;  1P34 B;  4KGC A;  3MGS A;  1TAF B;  4AWL C;  3WKJ B;  3MGR D;  4NE6 A;  5B1L A;  3REH C;  1AOI A;  3A6N C;  1P3B A;  3MVD B;  3AZM C;  1TZY A;  3KUY D;  3LEL A;  3AZE B;  5BNV B;  5B1M B;  5AV8 C;  4DQY B;  3UTA B;  3WKJ D;  5B2I A;  3AZJ D;  2Y2G A;  1Z2C B;  2NZD B;  5B24 A;  3AV1 A;  5DNM C;  1F66 A;  1M18 A;  4KGC D;  4JJN A;  2CV5 A;  2IO5 B;  5DNN C;  3MVD D;  4R8P C;  1M1A A;  3R45 A;  3AV1 B;  1T3U A;  4G92 B;  1AOI D;  1P3B D;  1P34 C;  3C1B C;  5FUG B;  1P3A A;  3LEL D;  1M1A B;  2XD5 A;  3KWQ B;  2ZY2 A;  4XUJ B;  5GSU A;  5B2I D;  2Y2P A;  5B24 D;  5AV5 C;  3AZH A;  3AV1 D;  5AVC A;  1F66 D;  2DF4 C;  3AV2 B;  2G5H C;  3AZE C;  1M18 D;  4JJN D;  4YS3 B;  2CV5 D;  5B1M C;  4Z5T C;  5E5A B;  3UTA C;  3VH5 A;  2PYO A;  5JA4 B;  3MGQ A;  1M1A D;  3REK A;  3AZH B;  2NZD C;  5AVC B;  5AVB B;  3REJ A;  3AZL B;  1P3L C;  4KUD B;  3VH5 W;  2IO5 C;  4X23 A;  1P3A D;  1ULY A;  3LZ1 B;  4XZQ A;  2Y2I A;  4G92 C;  1HQ3 B;  5B0Z A;  5B31 A;  5BT1 D;  3AZH D;  1B67 A;  2YFV B;  5AVC D;  4WJ3 C;  4CAY B;  4KUD D;  3KWQ C;  4NE3 A;  4XZQ B;  2PYO D;  3MGQ D;  1N1J B;  5CHL B;  1EQZ A;  3X1T A;  3REJ D;  3AZG A;  5CPI A;  4H9R A;  3WAA C;  3AV2 C;  3UTB A;  4YS3 C;  5E5A C;  4X23 D;  3B6G A;  3UT9 A;  3X1S B;  3AFA C;  4EO5 B;  2LY8 A;  3MNN B;  5B2J C;  4XZQ D;  5AVB C;  3LJA A;  5B40 A;  3AZL C;  3B0B A;  4H9N A;  3UTB B;  3TU4 B;  3W97 B;  1P3P B;  4QLC A;  3B6G B;  1P3I C;  3AZI A;  1WWS A;  3LZ1 C;  3B6F A;  3LJA B;  5B40 B;  4WU9 B;  4H9N B;  5AV9 A;  5AY8 A;  3AZK A;  3WA9 A;  2HUE B;  3X1T D;  4QLC B;  3AZG D;  5CPI D;  3W97 D;  3UTB D;  4J8V A;  3REI A;  4J8X C;  1P3P D;  3UT9 D;  3B6G D;  1BH9 A;  2FJ7 C;  5AV9 B;  5AY8 B;  5GXQ B;  2Y2Q A;  3C1C A;  4J8U A;  5B33 B;  3LJA D;  5B40 D;  1P3M C;  1KX3 C;  1ID3 B;  4J8V B;  3REI B;  2ZY4 A;  5CPK A;  4QLC D;  4KHA A;  1BH9 B;  1M19 B;  3X1S C;  4EO5 C;  1P3K C;  5B0Y C;  3MNN C;  3AZI D;  3C1C B;  3B6F D;  1KX4 C;  1H3O A;  3AL0 C;  5AV9 D;  3TU4 C;  5AY8 D;  3AZK D;  3WA9 D;  3X1U B;  3X1V A;  2NQB C;  3W98 B;  1Q9C A;  4NFT A;  1ID3 D;  2JSS A;  3F6T A;  4J8V D;  3REI D;  5JRG A;  4CSR A;  2Y2N A;  3VH6 T;  2XD1 A;  2YFW A;  1HTA A;  3C1C D;  3MGR B;  3W96 A;  1KX5 C;  3AZM A;  3V9R B;  5JRG B;  1P3F C;  2RVQ C;  1W2E A;  2YFW B;  1ZLA C;  3AYW A;  4H9P A;  2ARO A;  5B33 C;  3REL C;  2Y2O A;  5F99 A;  4E45 A;  2W8S A;  5DNM A;  3X1V D;  3AZJ B;  4J8W A;  1M19 C;  2VQR A;  5JRG D;  4KGC B;  3MGS B;  5F99 B;  1P3O C;  5G49 A;  3X1U C;  3W96 D;  3C1B A;  3W98 C;  5B1L B;  3MGP C;  1AOI B;  1P3B B;  4H9Q A;  1TZY B;  3AYW D;  5G49 B;  3O62 A;  3LEL B;  2ARO D;  4H9S C;  3MGR C;  3MGS D;  5F99 D;  5DNM D;  3W99 A;  5B2I B;  4J8W D;  5B24 B;  3P5J B;  4Z5T A;  5B1L D;  3WTP A;  2JCH A;  1F66 B;  5AV6 A;  3KUY C;  1M18 B;  4JJN B;  2CV5 B;  1TZY D;  3W99 B;  3WKJ C;  4Z66 A;  3AZJ C;  3R45 B;  3WTP B;  5BS7 A;  3NQU A;  4KGC C;  3AZN A;  1U35 A;  3MVD C;  1P3A B;  4Z2M H;  2Y2K A;  3O62 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...