3UTAD

Crystal structure of nucleosome core particle assembled with an alpha-satellite sequence containing two ttaaa elements (ncp-ta2)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utaD00
5AV9A 3AZHD 3VH5W 2IO5B 1F66A 5JRGA 3WTPC 3MGRA 3LZ1B 3AZMB 2F8NB 5B1LC 4QLCA 3KWQB 3MVDC 5B1MC 4Z5TA 2FJ7D 4H9RB 4KGCD 3AZKC 4KHAB 3X1SD 3MGQD 3NQJA 5B2ID 5B0YC 3AZIC 3AZLA 2YFWB 4XZQB 5GT3A 2NQBC 5DNMC 2AROC 1P3LB 3W96B 3MGSA 5E5AC 1P3MC 2RVQC 3B6FC 1P3FB 3UTAD 1M1AC 3AZHB 3B6GC 5CPJA 3RELA 5B32D 3C1BB 3REHC 3LJAD 5GT0B 3LZ1A 4KUDD 3AZMA 3AYWD 2FJ7B 2F8NA 2YFVB 3KWQA 3REJB 5AV9C 5B1LD 3X1SB 5AVCD 4WNNB 4H9RA 5B31A 5B2IB 5JRGC 3MVDD 3MGRC 4KHAA 4WU8D 4YM6B 4EO5B 4QLCC 3W97D 1KU5A 5B40B 4Z5TC 2YFWA 5B0YD 3UTAB 2AROD 1P3LA 3W96A 1P3GD 3AZLC 4H9SA 1P3FA 1EQZD 5GT3C 4X23D 3LJAB 4KUDB 3C1BA 3AYWB 3MGSC 5GT0A 1TZYD 3O62D 5AVCB 5F99D 2FJ7A 5CPIB 5CPJC 1KX4C 3RELC 2YFVA 5AV8D 4WV4B 3REJA 3WAAD 3X1SA 4J8XB 5CPKB 3W97B 2IO5C 5B2IA 3LZ0D 1U35B 3LZ1C 1P3FD 4YM6A 3LELD 5BS7A 5JRGD 1F66D 3B0CW 3KWQC 4ZUXC 5B40A 4YS3D 1P3GB 1A7WA 2F8NH 3UTAA 1EQZB 4X23B 5AY8C 3REID 4H9PB 1BH8B 5CHLB 1P3AB 4XZQC 3LJAA 3AZLD 1H3OB 4G91B 1TZYB 4KUDA 3W96C 1TAFB 5F99B 1HTAA 3KUYB 4J8WD 5AV8B 4H9SC 4Z66D 1P3FC 3W98B 3WAAB 3AZHC 5AVCA 3AZED 5CPIA 3LZ0B 5B33B 5GXQD 4KGCB 5CPJD 3LELB 3MGPB 1F66B 4J8XA 3X1UB 3RELD 5CPKA 1KX5B 2PYOA 1M18B 3W97A 5GT0C 1U35A 4YS3B 3C1CA 4NE3A 2FJ7C 1AOID 3LZ1D 3AZMD 3AV2D 2F8ND 3WKJD 3B0DC 3X1SC 3MGQC 4NE5A 3REIB 1P3GA 5B2IC 5B31D 1EQZA 5BS7C 4H9PA 1BH8A 4J8WB 1P3AA 5B32G 3TU4B 1HQ3D 1H3OA 4H9OB 4Z66B 3UTAC 1TZYA 3AZEB 1TAFA 5F99A 3KUYA 5GXQB 5AV8A 3KSYA 1P3LD 3W96D 3W98A 3WAAA 3LJAC 5B2JB 3LZ0A 5B33A 3VH6A 4KGCA 4KUDC 3AYWC 3LELA 3MGPA 3X1UA 1AOIB 1KX5A 3VH6W 3C1BD 3AV2B 1M18A 1ID3B 3WKJB 5CP6B 4YS3A 5AVCC 5GT0D 5CPIC 5G49B 4WU8C 5B31B 4J8XC 5CPKC 3REIA 5AV6D 3REJD 3W97C 1U35C 3WTPE 1HQ3B 5GSUD 4YM6D 4J8WA 1P3GC 5FUGB 5B40D 3TU4A 4H9OA 4Z66A 1EQZC 4J8VB 4X23C 3AZEA 5GXQA 1P3AC 4AWLB 1S32A 4G91C 5B2JA 1TZYC 3O62C 4Z2MG 5F99C 2NZDD 1BFMA 4CAYB 5AV8C 1AOIA 1ID3A 3AV2A 4HGAB 3WKJA 3WAAC 2L5AA 5CP6A 5AV6B 3LZ0C 5G49A 4KGCC 3LELC 3UTBD 3MGPC 5CPID 1F66C 3X1UC 1KX5C 5GSUB 1M18C 4J8XD 2PYOD 5CPKD 4YS3C 3AFAD 1U35D 1HQ3A 3C1CD 1M19D 3REIC 5FUGA 4JJND 1JFIB 5AV5D 4J8VA 1WWIA 4E44A 4J8WC 5B0ZD 4ZBJB 4UUZA 1P34A 2NZDB 1P3AD 4Z66C 3AZND 2CV5D 3AZEC 3WA9B 4CAYA 5GXQC 2HIOD 3KUYD 3UTBB 2F8NG 4J8UA 5AV6A 5B2JC 3W98D 2PYOB 3AZFD 3AFAB 5B33D 5B31G 1AOIC 5GSUA 1ID3C 3AZMC 3AV2C 3C1CB 3AV1B 3MGPD 1M19B 3WKJC 3X1UD 5CP6C 1KX5D 1M18D 4JJNB 1ZLAD 5AV5B 5B31C 1P3KD 4M6BA 1JFIA 3NQUB 3AZJB 5B0ZB 1HQ3C 3AZNB 5B1MB 2CV5B 2NZDA 3X1TB 3MNNB 4WU9D 1P3LC 3A6ND 2HIOB 5BT1C 3TU4D 1KX3B 3WA9A 3AZFB 3AZIB 3UTBA 4AWLC 5JA4B 3C1BC 3AFAA 1S32D 4R8PD 4CSRB 5B2JD 1ZLAB 4LD9B 3AV1A 1P3KB 1M19A 4H9QB 1ID3D 5AV6C 3REJC 4JJNA 3B6GB 5CP6D 5AV5A 4XUJD 5BNVB 5GSUC 3AN2D 4YM6C 4EO5C 3NQUA 3AZJA 5B0ZA 1P3PD 5KDMB 5B40C 4G92B 4WU9B 3A6NB 3AZNA 2JSSA 3W99D 5B1MA 2CV5A 3X1TA 4H9NB 3MNNA 2HIOA 1KX3A 3UT9D 5BT1D 4J8VD 3AZFA 3AZIA 2NZDC 1S32B 4ZBJC 4R8PB 1BH9B 5JA4A 1P34D 1N1JB 5B24D 1P3OD 4CSRA 1P3ID 1ZLAA 4LD9A 3X1VD 1P3KA 4XUJB 4DRAA 3UTBC 4H9QA 1M1AA 1B6WA 3AN2B 3B6GA 2PYOC 3AFAC 4J8UD 1P3PB 5BNVA 3C1CC 1M19C 2HUEB 3W99B 5KDMA 4JJNC 5AV5C 4WU9A 1KX4B 3A6NA 5C3IB 3UT9B 4H9NA 3AZJC 5B0ZC 1P34B 3AZNC 4UUZB 4ZUXB 2CV5C 3AZGB 4NFTA 5B24B 2BYMB 4R8PA 3X1TC 1P3IB 1P3OB 3MNNC 5DNND 1BH9A 2HIOC 1N1JA 3KUYC 3X1VB 1P3BB 1KX3C 5AY8B 1R4VA 3W98C 3AZFC 4J8UB 3WA9D 4XUJA 5BNXB 5B33C 3AN2A 1Q9CA 1P3PA 1ZLAC 4LD9C 3KXBD 3REKB 1P3KC 5AVBB 3W99A 3AV1D 4E45A 1KX4A 3UT9A 5BO0B 3WTPD 5DNNB 4G92C 3AZJD 3A6NC 4WU9C 4NE6A 4ZUXA 3TU4C 3B0DB 3AZGA 2BYMA 5B24A 3MGQB 1P3OA 1P3IA 5B1MD 3X1VA 3X1TD 1P3BA 3MNND 5AY8A 3AZKD 2BYKB 4Z2MH 1KX3D 1WWSA 1S32C 4R8PC 5BNXA 3B0BA 4XZQA 3KXBB 3AZID 2NQBD 5DNMD 3VH5T 3VH6T 3REKA 2CWEA 5B32B 4XUJC 5AVBA 4LD9D 5E5AD 3AN2C 2RVQD 3AZHA 1P3MD 3B6FD 1M1AD 1P3PC 3B6GD 3WTPB 3REHD 2HUEC 3W99C 5B1LB 5BO0A 3MVDB 5DNNA 1F1EA 2F8NK 3V9RB 4WU8B 5C3IC 3UT9C 3MGQA 3AZKB 4J8VC 4WNNA 5AV9D 5B0YB 3MGRD 1P34C 2BYKA 2NQBB 4QLCD 5DNMB 2AROB 3AZGC 5B24C 1P3OC 1P3IC 3KXBA 4Z5TD 3X1VC 1P3BC 5E5AB 1P3MB 3B6FB 4HGAC 1M1AB 3R45B 4J8UC 5B32A 4DRBA 1B67A 3REHB 5GT3D 3O62B 3AYWA 3WTPA 3REKC 5AVBC 4WZSB 3MGSD 5B1LA 3MVDA 5AV9B 3V9RA 4WU8A 1KX4D 5JRGB 3MGRB 3AZKA 4QLCB 5B0YA 5DNNC 1ULYA 4Z5TB 2NQBA 5DNMA 2AROA 3KWQD 4ZUXD 3AZGD 3WA9C 3NQJB 2LY8A 5E5AA 4X23A 1P3MA 3B6FA 3AZLB 1P3BD 5GT3B 3R45A 5AY8D 3KXBC 3REHA 4XZQD 3MGSB 3O62A 3AV1C 5B32C 3B0CT 5CPJB 3RELB 3REKD 3VH5A 5AVBD
chains in the Genus database with same CATH superfamily
5AV9A 3AZHD 3VH5W 2IO5B 1F66A 5JRGA 3WTPC 3MGRA 3LZ1B 3AZMB 2F8NB 5B1LC 4QLCA 3KWQB 3MVDC 5B1MC 4Z5TA 2FJ7D 4H9RB 4KGCD 3H0MC 3AZKC 4KHAB 3X1SD 2DF4C 3MGQD 3NQJA 5B2ID 5B0YC 3AZIC 3H0RC 3AZLA 2YFWB 4XZQB 5GT3A 2NQBC 5DNMC 2AROC 1P3LB 3W96B 3MGSA 5E5AC 1P3MC 2RVQC 3B6FC 1P3FB 3UTAD 1M1AC 3AZHB 3B6GC 5CPJA 3RELA 5B32D 3C1BB 3REHC 3LJAD 5GT0B 3LZ1A 4KUDD 3EPKA 3AZMA 3AYWD 2FJ7B 2F8NA 2YFVB 3KWQA 3REJB 5AV9C 5B1LD 3X1SB 5AVCD 4WNNB 4H9RA 5B31A 5B2IB 5JRGC 3MVDD 3MGRC 4KHAA 4WU8D 4YM6B 4EO5B 4QLCC 3W97D 1KU5A 5B40B 4Z5TC 3IP4C 2YFWA 5B0YD 2VQRA 3UTAB 2AROD 1P3LA 3W96A 1P3GD 3AZLC 4H9SA 1P3FA 1EQZD 5GT3C 4X23D 3LJAB 4KUDB 3C1BA 3AYWB 3MGSC 2ZY4A 5GT0A 1TZYD 3O62D 5AVCB 5F99D 2FJ7A 5CPIB 5CPJC 3A1IA 1KX4C 3RELC 2YFVA 5AV8D 4WV4B 3REJA 3WAAD 3X1SA 4J8XB 5CPKB 3W97B 2IO5C 5B2IA 3LZ0D 1U35B 3LZ1C 1P3FD 4YM6A 3LELD 5BS7A 5JRGD 1F66D 3B0CW 3KWQC 4ZUXC 1PZRA 5B40A 4YS3D 1P3GB 1A7WA 2W8SA 2F8NH 3UTAA 1EQZB 4X23B 5AY8C 3REID 4H9PB 1BH8B 5CHLB 3EPHA 1P3AB 4XZQC 3LJAA 3AZLD 1H3OB 4G91B 1TZYB 2G5IC 4KUDA 3W96C 1TAFB 5F99B 1HTAA 3KUYB 4J8WD 5AV8B 4H9SC 4Z66D 1P3FC 3W98B 3WAAB 3AZHC 5AVCA 3AZED 5CPIA 3LZ0B 5B33B 5GXQD 4KGCB 5CPJD 3LELB 3MGPB 1F66B 4J8XA 3X1UB 3RELD 5CPKA 1KX5B 2PYOA 1M18B 3W97A 5GT0C 1U35A 4YS3B 3C1CA 4NE3A 2FJ7C 1AOID 3LZ1D 3AZMD 3AV2D 2F8ND 3WKJD 3B0DC 3X1SC 3MGQC 4NE5A 3REIB 1P3GA 5B2IC 5B31D 1EQZA 5BS7C 4H9PA 1BH8A 4J8WB 1P3AA 5B32G 3TU4B 1HQ3D 1H3OA 4H9OB 4Z66B 3UTAC 1TZYA 3AZEB 1TAFA 5F99A 3KUYA 5GXQB 5AV8A 3KSYA 1P3LD 3W96D 3W98A 3WAAA 3LJAC 5B2JB 3LZ0A 5B33A 3VH6A 4KGCA 4KUDC 3AYWC 3LELA 3MGPA 3X1UA 1AOIB 1KX5A 3VH6W 3C1BD 3AV2B 1M18A 1ID3B 3WKJB 5CP6B 4YS3A 5AVCC 5GT0D 5CPIC 2BG1A 5G49B 4WU8C 5B31B 4J8XC 5CPKC 3REIA 5AV6D 3REJD 3W97C 1U35C 2RIQA 4WJ3C 3WTPE 1HQ3B 5GSUD 4YM6D 1Z2CB 4J8WA 1P3GC 5FUGB 2UWXA 5B40D 3TU4A 4H9OA 4Z66A 1EQZC 4J8VB 4UPKA 4X23C 3AZEA 5GXQA 1P3AC 4AWLB 1S32A 2ZM5A 2XD5A 3FDDA 4G91C 1TZYC 5B2JA 3O62C 4Z2MG 5F99C 2NZDD 1BFMA 4CAYB 5AV8C 1AOIA 1ID3A 3AV2A 4HGAB 3WKJA 3WAAC 2L5AA 5CP6A 5AV6B 3LZ0C 5G49A 4KGCC 3LELC 3UTBD 2Y2NA 3MGPC 5CPID 2Y2LA 3X1UC 1F66C 1KX5C 5GSUB 1M18C 4J8XD 2PYOD 5CPKD 4YS3C 3AFAD 1U35D 1HQ3A 2ZY2A 3C1CD 1M19D 3REIC 5FUGA 4JJND 1JFIB 5AV5D 4J8VA 2Y2QA 2Y2KA 1WWIA 4E44A 4J8WC 5B0ZD 4ZBJB 4UUZA 1P34A 2NZDB 1P3AD 2XD1A 2Y2PA 4Z66C 3AZND 2CV5D 3AZEC 3WA9B 4CAYA 5GXQC 2HIOD 3KUYD 3UTBB 2F8NG 4J8UA 5AV6A 5B2JC 3W98D 2PYOB 3AZFD 3AFAB 5B33D 5B31G 1AOIC 5GSUA 1ID3C 3AZMC 3AV2C 3C1CB 3AV1B 3MGPD 1M19B 3WKJC 3X1UD 5CP6C 1KX5D 1M18D 4JJNB 1ZLAD 5AV5B 5B31C 1P3KD 4M6BA 1JFIA 3NQUB 3AZJB 5B0ZB 1HQ3C 3AZNB 5B1MB 2CV5B 2NZDA 3X1TB 3MNNB 4WU9D 3EG5B 1P3LC 3A6ND 2HIOB 5BT1C 3A1KA 3TU4D 1KX3B 3WA9A 3AZFB 3AZIB 3UTBA 4AWLC 5JA4B 3C1BC 3H0LC 3AFAA 1S32D 2Y2JA 4R8PD 4CSRB 5B2JD 1ZLAB 4LD9B 3AV1A 1P3KB 1M19A 4H9QB 1ID3D 5AV6C 3REJC 4JJNA 3B6GB 5CP6D 5AV5A 3EPLA 2Y2GA 4XUJD 5BNVB 5GSUC 3AN2D 4YM6C 4EO5C 3NQUA 3AZJA 5B0ZA 1P3PD 5KDMB 5B40C 4G92B 4DQYB 4WU9B 3A6NB 3AZNA 2JSSA 3W99D 5B1MA 2CV5A 3X1TA 4H9NB 3MNNA 2HIOA 1KX3A 3UT9D 5BT1D 4J8VD 3AZFA 3AZIA 2NZDC 1S32B 4ZBJC 4R8PB 1BH9B 5JA4A 1P34D 1N1JB 5B24D 1P3OD 4CSRA 1P3ID 1ZLAA 4LD9A 3X1VD 1P3KA 4XUJB 4DRAA 3F6TA 3UTBC 4H9QA 1M1AA 1B6WA 2F2AC 3AN2B 3B6GA 2PYOC 3AFAC 4J8UD 1P3PB 2Y2IA 5BNVA 3C1CC 1M19C 2HUEB 3W99B 5KDMA 4JJNC 5AV5C 4WU9A 1KX4B 3A6NA 5C3IB 3UT9B 4H9NA 3AZJC 2FFFB 5B0ZC 1P34B 3AZNC 4UUZB 2Y2OA 4ZUXB 2CV5C 3AZGB 4NFTA 2BYMB 5B24B 4R8PA 3X1TC 1P3IB 1P3OB 3MNNC 5DNND 2ZY5A 1BH9A 2HIOC 1N1JA 3KUYC 3X1VB 1P3BB 1KX3C 5AY8B 1R4VA 3W98C 3AZFC 2Y2MA 4J8UB 3WA9D 4XUJA 5BNXB 5B33C 3AN2A 1Q9CA 1P3PA 1ZLAC 4LD9C 3KXBD 3KFUG 3REKB 1P3KC 5AVBB 3W99A 3AV1D 4E45A 1KX4A 3UT9A 5BO0B 3WTPD 5DNNB 2DQNC 4G92C 2JCHA 3A6NC 3AZJD 4WU9C 4NE6A 4ZUXA 3TU4C 3B0DB 3AZGA 2BYMA 5B24A 3MGQB 1P3OA 1P3IA 5B1MD 3X1VA 3X1TD 1P3BA 3MNND 5AY8A 3AZKD 2BYKB 4Z2MH 1KX3D 1WWSA 1S32C 4R8PC 5BNXA 3B0BA 4XZQA 3KXBB 3AZID 2NQBD 5DNMD 2Y2HA 3VH5T 3VH6T 2ZY3A 3REKA 2CWEA 5B32B 4XUJC 2J8PA 5AVBA 4LD9D 5E5AD 3AN2C 2RVQD 3AZHA 1P3MD 3B6FD 1M1AD 1P3PC 3B6GD 3WTPB 3REHD 2HUEC 3W99C 5B1LB 5BO0A 3AL0C 3MVDB 5DNNA 1F1EA 2F8NK 3V9RB 4WU8B 5C3IC 3UT9C 3MGQA 3AZKB 4J8VC 4WNNA 2G5HC 5AV9D 5B0YB 3MGRD 1P34C 2BYKA 2NQBB 4QLCD 5DNMB 2AROB 3AZGC 5B24C 1P3OC 1P3IC 3KXBA 4Z5TD 3X1VC 1P3BC 5E5AB 1P3MB 3B6FB 4HGAC 1T3UA 1M1AB 3R45B 4J8UC 5B32A 4DRBA 1B67A 3REHB 2JE5A 5GT3D 3O62B 3AYWA 3WTPA 3REKC 5AVBC 4WZSB 3MGSD 5B1LA 3MVDA 5AV9B 3V9RA 4WU8A 1KX4D 5JRGB 3MGRB 3AZKA 4QLCB 5B0YA 5DNNC 1ULYA 4Z5TB 1W2EA 2NQBA 5DNMA 2AROA 3KWQD 3EPJA 4ZUXD 3AZGD 3WA9C 3NQJB 2LY8A 5E5AA 4X23A 1P3MA 3B6FA 3AZLB 1P3BD 5GT3B 3R45A 5AY8D 3P5JB 3KXBC 3REHA 4XZQD 3MGSB 3O62A 3AV1C 5B32C 3B0CT 5CPJB 3RELB 3REKD 3VH5A 5AVBD
chains in the Genus database with same CATH topology
5AV9A 3AZHD 3VH5W 2IO5B 1F66A 5JRGA 3WTPC 3MGRA 3LZ1B 3AZMB 2F8NB 5B1LC 4QLCA 3KWQB 3MVDC 5B1MC 4Z5TA 2FJ7D 4H9RB 4KGCD 3H0MC 3AZKC 4KHAB 3X1SD 2DF4C 3MGQD 3NQJA 5B2ID 5B0YC 3AZIC 3H0RC 3AZLA 2YFWB 4XZQB 5GT3A 2NQBC 5DNMC 2AROC 1P3LB 3W96B 3MGSA 5E5AC 1P3MC 2RVQC 3B6FC 1P3FB 3UTAD 1M1AC 3AZHB 3B6GC 5CPJA 3RELA 5B32D 3C1BB 3REHC 3LJAD 5GT0B 3LZ1A 4KUDD 3EPKA 3AZMA 3AYWD 2FJ7B 2F8NA 2YFVB 3KWQA 3REJB 5AV9C 5B1LD 3X1SB 5AVCD 4WNNB 4H9RA 5B31A 5B2IB 5JRGC 3MVDD 3MGRC 4KHAA 4WU8D 4YM6B 4EO5B 4QLCC 3W97D 1KU5A 5B40B 4Z5TC 3IP4C 2YFWA 5B0YD 2VQRA 3UTAB 2AROD 1P3LA 3W96A 1P3GD 3AZLC 4H9SA 1P3FA 1EQZD 5GT3C 4X23D 3LJAB 4KUDB 3C1BA 3AYWB 3MGSC 2ZY4A 5GT0A 1TZYD 3O62D 5AVCB 5F99D 2FJ7A 5CPIB 5CPJC 3A1IA 1KX4C 3RELC 2YFVA 5AV8D 4WV4B 3REJA 3WAAD 3X1SA 4J8XB 5CPKB 3W97B 2IO5C 5B2IA 3LZ0D 1U35B 3LZ1C 1P3FD 4YM6A 3LELD 5BS7A 5JRGD 1F66D 3B0CW 3KWQC 4ZUXC 1PZRA 5B40A 4YS3D 1P3GB 1A7WA 2W8SA 2F8NH 3UTAA 1EQZB 4X23B 5AY8C 3REID 4H9PB 1BH8B 5CHLB 3EPHA 1P3AB 4XZQC 3LJAA 3AZLD 1H3OB 4G91B 1TZYB 2G5IC 4KUDA 3W96C 1TAFB 5F99B 1HTAA 3KUYB 4J8WD 5AV8B 4H9SC 4Z66D 1P3FC 3W98B 3WAAB 3AZHC 5AVCA 3AZED 5CPIA 3LZ0B 5B33B 5GXQD 4KGCB 5CPJD 3LELB 3MGPB 1F66B 4J8XA 3X1UB 3RELD 5CPKA 1KX5B 2PYOA 1M18B 3W97A 5GT0C 1U35A 4YS3B 3C1CA 4NE3A 2FJ7C 1AOID 3LZ1D 3AZMD 3AV2D 2F8ND 3WKJD 3B0DC 3X1SC 3MGQC 4NE5A 3REIB 1P3GA 5B2IC 5B31D 1EQZA 5BS7C 4H9PA 1BH8A 4J8WB 1P3AA 5B32G 3TU4B 1HQ3D 1H3OA 4H9OB 4Z66B 3UTAC 1TZYA 3AZEB 1TAFA 5F99A 3KUYA 5GXQB 5AV8A 3KSYA 1P3LD 3W96D 3W98A 3WAAA 3LJAC 5B2JB 3LZ0A 5B33A 3VH6A 4KGCA 4KUDC 3AYWC 3LELA 3MGPA 3X1UA 1AOIB 1KX5A 3VH6W 3C1BD 3AV2B 1M18A 1ID3B 3WKJB 5CP6B 4YS3A 5AVCC 5GT0D 5CPIC 2BG1A 5G49B 4WU8C 5B31B 4J8XC 5CPKC 3REIA 5AV6D 3REJD 3W97C 1U35C 2RIQA 4WJ3C 3WTPE 1HQ3B 5GSUD 4YM6D 1Z2CB 4J8WA 1P3GC 5FUGB 2UWXA 5B40D 3TU4A 4H9OA 4Z66A 1EQZC 4J8VB 4UPKA 4X23C 3AZEA 5GXQA 1P3AC 4AWLB 1S32A 2ZM5A 2XD5A 3FDDA 4G91C 1TZYC 5B2JA 3O62C 4Z2MG 5F99C 2NZDD 1BFMA 4CAYB 5AV8C 1AOIA 1ID3A 3AV2A 4HGAB 3WKJA 3WAAC 2L5AA 5CP6A 5AV6B 3LZ0C 5G49A 4KGCC 3LELC 3UTBD 2Y2NA 3MGPC 5CPID 2Y2LA 3X1UC 1F66C 1KX5C 5GSUB 1M18C 4J8XD 2PYOD 5CPKD 4YS3C 3AFAD 1U35D 1HQ3A 2ZY2A 3C1CD 1M19D 3REIC 5FUGA 4JJND 1JFIB 5AV5D 4J8VA 2Y2QA 2Y2KA 1WWIA 4E44A 4J8WC 5B0ZD 4ZBJB 4UUZA 1P34A 2NZDB 1P3AD 2XD1A 2Y2PA 4Z66C 3AZND 2CV5D 3AZEC 3WA9B 4CAYA 5GXQC 2HIOD 3KUYD 3UTBB 2F8NG 4J8UA 5AV6A 5B2JC 3W98D 2PYOB 3AZFD 3AFAB 5B33D 5B31G 1AOIC 5GSUA 1ID3C 3AZMC 3AV2C 3C1CB 3AV1B 3MGPD 1M19B 3WKJC 3X1UD 5CP6C 1KX5D 1M18D 4JJNB 1ZLAD 5AV5B 5B31C 1P3KD 4M6BA 1JFIA 3NQUB 3AZJB 5B0ZB 1HQ3C 3AZNB 5B1MB 2CV5B 2NZDA 3X1TB 3MNNB 4WU9D 3EG5B 1P3LC 3A6ND 2HIOB 5BT1C 3A1KA 3TU4D 1KX3B 3WA9A 3AZFB 3AZIB 3UTBA 4AWLC 5JA4B 3C1BC 3H0LC 3AFAA 1S32D 2Y2JA 4R8PD 4CSRB 5B2JD 1ZLAB 4LD9B 3AV1A 1P3KB 1M19A 4H9QB 1ID3D 5AV6C 3REJC 4JJNA 3B6GB 5CP6D 5AV5A 3EPLA 2Y2GA 4XUJD 5BNVB 5GSUC 3AN2D 4YM6C 4EO5C 3NQUA 3AZJA 5B0ZA 1P3PD 5KDMB 5B40C 4G92B 4DQYB 4WU9B 3A6NB 3AZNA 2JSSA 3W99D 5B1MA 2CV5A 3X1TA 4H9NB 3MNNA 2HIOA 1KX3A 3UT9D 5BT1D 4J8VD 3AZFA 3AZIA 2NZDC 1S32B 4ZBJC 4R8PB 1BH9B 5JA4A 1P34D 1N1JB 5B24D 1P3OD 4CSRA 1P3ID 1ZLAA 4LD9A 3X1VD 1P3KA 4XUJB 4DRAA 3F6TA 3UTBC 4H9QA 1M1AA 1B6WA 2F2AC 3AN2B 3B6GA 2PYOC 3AFAC 4J8UD 1P3PB 2Y2IA 5BNVA 3C1CC 1M19C 2HUEB 3W99B 5KDMA 4JJNC 5AV5C 4WU9A 1KX4B 3A6NA 5C3IB 3UT9B 4H9NA 3AZJC 2FFFB 5B0ZC 1P34B 3AZNC 4UUZB 2Y2OA 4ZUXB 2CV5C 3AZGB 4NFTA 2BYMB 5B24B 4R8PA 3X1TC 1P3IB 1P3OB 3MNNC 5DNND 2ZY5A 1BH9A 2HIOC 1N1JA 3KUYC 3X1VB 1P3BB 1KX3C 5AY8B 1R4VA 3W98C 3AZFC 2Y2MA 4J8UB 3WA9D 4XUJA 5BNXB 5B33C 3AN2A 1Q9CA 1P3PA 1ZLAC 4LD9C 3KXBD 3KFUG 3REKB 1P3KC 5AVBB 3W99A 3AV1D 4E45A 1KX4A 3UT9A 5BO0B 3WTPD 5DNNB 2DQNC 4G92C 2JCHA 3A6NC 3AZJD 4WU9C 4NE6A 4ZUXA 3TU4C 3B0DB 3AZGA 2BYMA 5B24A 3MGQB 1P3OA 1P3IA 5B1MD 3X1VA 3X1TD 1P3BA 3MNND 5AY8A 3AZKD 2BYKB 4Z2MH 1KX3D 1WWSA 1S32C 4R8PC 5BNXA 3B0BA 4XZQA 3KXBB 3AZID 2NQBD 5DNMD 2Y2HA 3VH5T 3VH6T 2ZY3A 3REKA 2CWEA 5B32B 4XUJC 2J8PA 5AVBA 4LD9D 5E5AD 3AN2C 2RVQD 3AZHA 1P3MD 3B6FD 1M1AD 1P3PC 3B6GD 3WTPB 3REHD 2HUEC 3W99C 5B1LB 5BO0A 3AL0C 3MVDB 5DNNA 1F1EA 2F8NK 3V9RB 4WU8B 5C3IC 3UT9C 3MGQA 3AZKB 4J8VC 4WNNA 2G5HC 5AV9D 5B0YB 3MGRD 1P34C 2BYKA 2NQBB 4QLCD 5DNMB 2AROB 3AZGC 5B24C 1P3OC 1P3IC 3KXBA 4Z5TD 3X1VC 1P3BC 5E5AB 1P3MB 3B6FB 4HGAC 1T3UA 1M1AB 3R45B 4J8UC 5B32A 4DRBA 1B67A 3REHB 2JE5A 5GT3D 3O62B 3AYWA 3WTPA 3REKC 5AVBC 4WZSB 3MGSD 5B1LA 3MVDA 5AV9B 3V9RA 4WU8A 1KX4D 5JRGB 3MGRB 3AZKA 4QLCB 5B0YA 5DNNC 1ULYA 4Z5TB 1W2EA 2NQBA 5DNMA 2AROA 3KWQD 3EPJA 4ZUXD 3AZGD 3WA9C 3NQJB 2LY8A 5E5AA 4X23A 1P3MA 3B6FA 3AZLB 1P3BD 5GT3B 3R45A 5AY8D 3P5JB 3KXBC 3REHA 4XZQD 3MGSB 3O62A 3AV1C 5B32C 3B0CT 5CPJB 3RELB 3REKD 3VH5A 5AVBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV9 A;  3AZH D;  3VH5 W;  2IO5 B;  1F66 A;  5JRG A;  3WTP C;  3MGR A;  3LZ1 B;  3AZM B;  2F8N B;  5B1L C;  4QLC A;  3KWQ B;  3MVD C;  5B1M C;  4Z5T A;  2FJ7 D;  4H9R B;  4KGC D;  3AZK C;  4KHA B;  3X1S D;  3MGQ D;  3NQJ A;  5B2I D;  5B0Y C;  3AZI C;  3AZL A;  2YFW B;  4XZQ B;  5GT3 A;  2NQB C;  5DNM C;  2ARO C;  1P3L B;  3W96 B;  3MGS A;  5E5A C;  1P3M C;  2RVQ C;  3B6F C;  1P3F B;  3UTA D;  1M1A C;  3AZH B;  3B6G C;  5CPJ A;  3REL A;  5B32 D;  3C1B B;  3REH C;  3LJA D;  5GT0 B;  3LZ1 A;  4KUD D;  3AZM A;  3AYW D;  2FJ7 B;  2F8N A;  2YFV B;  3KWQ A;  3REJ B;  5AV9 C;  5B1L D;  3X1S B;  5AVC D;  4WNN B;  4H9R A;  5B31 A;  5B2I B;  5JRG C;  3MVD D;  3MGR C;  4KHA A;  4WU8 D;  4YM6 B;  4EO5 B;  4QLC C;  3W97 D;  1KU5 A;  5B40 B;  4Z5T C;  2YFW A;  5B0Y D;  3UTA B;  2ARO D;  1P3L A;  3W96 A;  1P3G D;  3AZL C;  4H9S A;  1P3F A;  1EQZ D;  5GT3 C;  4X23 D;  3LJA B;  4KUD B;  3C1B A;  3AYW B;  3MGS C;  5GT0 A;  1TZY D;  3O62 D;  5AVC B;  5F99 D;  2FJ7 A;  5CPI B;  5CPJ C;  1KX4 C;  3REL C;  2YFV A;  5AV8 D;  4WV4 B;  3REJ A;  3WAA D;  3X1S A;  4J8X B;  5CPK B;  3W97 B;  2IO5 C;  5B2I A;  3LZ0 D;  1U35 B;  3LZ1 C;  1P3F D;  4YM6 A;  3LEL D;  5BS7 A;  5JRG D;  1F66 D;  3B0C W;  3KWQ C;  4ZUX C;  5B40 A;  4YS3 D;  1P3G B;  1A7W A;  2F8N H;  3UTA A;  1EQZ B;  4X23 B;  5AY8 C;  3REI D;  4H9P B;  1BH8 B;  5CHL B;  1P3A B;  4XZQ C;  3LJA A;  3AZL D;  1H3O B;  4G91 B;  1TZY B;  4KUD A;  3W96 C;  1TAF B;  5F99 B;  1HTA A;  3KUY B;  4J8W D;  5AV8 B;  4H9S C;  4Z66 D;  1P3F C;  3W98 B;  3WAA B;  3AZH C;  5AVC A;  3AZE D;  5CPI A;  3LZ0 B;  5B33 B;  5GXQ D;  4KGC B;  5CPJ D;  3LEL B;  3MGP B;  1F66 B;  4J8X A;  3X1U B;  3REL D;  5CPK A;  1KX5 B;  2PYO A;  1M18 B;  3W97 A;  5GT0 C;  1U35 A;  4YS3 B;  3C1C A;  4NE3 A;  2FJ7 C;  1AOI D;  3LZ1 D;  3AZM D;  3AV2 D;  2F8N D;  3WKJ D;  3B0D C;  3X1S C;  3MGQ C;  4NE5 A;  3REI B;  1P3G A;  5B2I C;  5B31 D;  1EQZ A;  5BS7 C;  4H9P A;  1BH8 A;  4J8W B;  1P3A A;  5B32 G;  3TU4 B;  1HQ3 D;  1H3O A;  4H9O B;  4Z66 B;  3UTA C;  1TZY A;  3AZE B;  1TAF A;  5F99 A;  3KUY A;  5GXQ B;  5AV8 A;  3KSY A;  1P3L D;  3W96 D;  3W98 A;  3WAA A;  3LJA C;  5B2J B;  3LZ0 A;  5B33 A;  3VH6 A;  4KGC A;  4KUD C;  3AYW C;  3LEL A;  3MGP A;  3X1U A;  1AOI B;  1KX5 A;  3VH6 W;  3C1B D;  3AV2 B;  1M18 A;  1ID3 B;  3WKJ B;  5CP6 B;  4YS3 A;  5AVC C;  5GT0 D;  5CPI C;  5G49 B;  4WU8 C;  5B31 B;  4J8X C;  5CPK C;  3REI A;  5AV6 D;  3REJ D;  3W97 C;  1U35 C;  3WTP E;  1HQ3 B;  5GSU D;  4YM6 D;  4J8W A;  1P3G C;  5FUG B;  5B40 D;  3TU4 A;  4H9O A;  4Z66 A;  1EQZ C;  4J8V B;  4X23 C;  3AZE A;  5GXQ A;  1P3A C;  4AWL B;  1S32 A;  4G91 C;  5B2J A;  1TZY C;  3O62 C;  4Z2M G;  5F99 C;  2NZD D;  1BFM A;  4CAY B;  5AV8 C;  1AOI A;  1ID3 A;  3AV2 A;  4HGA B;  3WKJ A;  3WAA C;  2L5A A;  5CP6 A;  5AV6 B;  3LZ0 C;  5G49 A;  4KGC C;  3LEL C;  3UTB D;  3MGP C;  5CPI D;  1F66 C;  3X1U C;  1KX5 C;  5GSU B;  1M18 C;  4J8X D;  2PYO D;  5CPK D;  4YS3 C;  3AFA D;  1U35 D;  1HQ3 A;  3C1C D;  1M19 D;  3REI C;  5FUG A;  4JJN D;  1JFI B;  5AV5 D;  4J8V A;  1WWI A;  4E44 A;  4J8W C;  5B0Z D;  4ZBJ B;  4UUZ A;  1P34 A;  2NZD B;  1P3A D;  4Z66 C;  3AZN D;  2CV5 D;  3AZE C;  3WA9 B;  4CAY A;  5GXQ C;  2HIO D;  3KUY D;  3UTB B;  2F8N G;  4J8U A;  5AV6 A;  5B2J C;  3W98 D;  2PYO B;  3AZF D;  3AFA B;  5B33 D;  5B31 G;  1AOI C;  5GSU A;  1ID3 C;  3AZM C;  3AV2 C;  3C1C B;  3AV1 B;  3MGP D;  1M19 B;  3WKJ C;  3X1U D;  5CP6 C;  1KX5 D;  1M18 D;  4JJN B;  1ZLA D;  5AV5 B;  5B31 C;  1P3K D;  4M6B A;  1JFI A;  3NQU B;  3AZJ B;  5B0Z B;  1HQ3 C;  3AZN B;  5B1M B;  2CV5 B;  2NZD A;  3X1T B;  3MNN B;  4WU9 D;  1P3L C;  3A6N D;  2HIO B;  5BT1 C;  3TU4 D;  1KX3 B;  3WA9 A;  3AZF B;  3AZI B;  3UTB A;  4AWL C;  5JA4 B;  3C1B C;  3AFA A;  1S32 D;  4R8P D;  4CSR B;  5B2J D;  1ZLA B;  4LD9 B;  3AV1 A;  1P3K B;  1M19 A;  4H9Q B;  1ID3 D;  5AV6 C;  3REJ C;  4JJN A;  3B6G B;  5CP6 D;  5AV5 A;  4XUJ D;  5BNV B;  5GSU C;  3AN2 D;  4YM6 C;  4EO5 C;  3NQU A;  3AZJ A;  5B0Z A;  1P3P D;  5KDM B;  5B40 C;  4G92 B;  4WU9 B;  3A6N B;  3AZN A;  2JSS A;  3W99 D;  5B1M A;  2CV5 A;  3X1T A;  4H9N B;  3MNN A;  2HIO A;  1KX3 A;  3UT9 D;  5BT1 D;  4J8V D;  3AZF A;  3AZI A;  2NZD C;  1S32 B;  4ZBJ C;  4R8P B;  1BH9 B;  5JA4 A;  1P34 D;  1N1J B;  5B24 D;  1P3O D;  4CSR A;  1P3I D;  1ZLA A;  4LD9 A;  3X1V D;  1P3K A;  4XUJ B;  4DRA A;  3UTB C;  4H9Q A;  1M1A A;  1B6W A;  3AN2 B;  3B6G A;  2PYO C;  3AFA C;  4J8U D;  1P3P B;  5BNV A;  3C1C C;  1M19 C;  2HUE B;  3W99 B;  5KDM A;  4JJN C;  5AV5 C;  4WU9 A;  1KX4 B;  3A6N A;  5C3I B;  3UT9 B;  4H9N A;  3AZJ C;  5B0Z C;  1P34 B;  3AZN C;  4UUZ B;  4ZUX B;  2CV5 C;  3AZG B;  4NFT A;  5B24 B;  2BYM B;  4R8P A;  3X1T C;  1P3I B;  1P3O B;  3MNN C;  5DNN D;  1BH9 A;  2HIO C;  1N1J A;  3KUY C;  3X1V B;  1P3B B;  1KX3 C;  5AY8 B;  1R4V A;  3W98 C;  3AZF C;  4J8U B;  3WA9 D;  4XUJ A;  5BNX B;  5B33 C;  3AN2 A;  1Q9C A;  1P3P A;  1ZLA C;  4LD9 C;  3KXB D;  3REK B;  1P3K C;  5AVB B;  3W99 A;  3AV1 D;  4E45 A;  1KX4 A;  3UT9 A;  5BO0 B;  3WTP D;  5DNN B;  4G92 C;  3AZJ D;  3A6N C;  4WU9 C;  4NE6 A;  4ZUX A;  3TU4 C;  3B0D B;  3AZG A;  2BYM A;  5B24 A;  3MGQ B;  1P3O A;  1P3I A;  5B1M D;  3X1V A;  3X1T D;  1P3B A;  3MNN D;  5AY8 A;  3AZK D;  2BYK B;  4Z2M H;  1KX3 D;  1WWS A;  1S32 C;  4R8P C;  5BNX A;  3B0B A;  4XZQ A;  3KXB B;  3AZI D;  2NQB D;  5DNM D;  3VH5 T;  3VH6 T;  3REK A;  2CWE A;  5B32 B;  4XUJ C;  5AVB A;  4LD9 D;  5E5A D;  3AN2 C;  2RVQ D;  3AZH A;  1P3M D;  3B6F D;  1M1A D;  1P3P C;  3B6G D;  3WTP B;  3REH D;  2HUE C;  3W99 C;  5B1L B;  5BO0 A;  3MVD B;  5DNN A;  1F1E A;  2F8N K;  3V9R B;  4WU8 B;  5C3I C;  3UT9 C;  3MGQ A;  3AZK B;  4J8V C;  4WNN A;  5AV9 D;  5B0Y B;  3MGR D;  1P34 C;  2BYK A;  2NQB B;  4QLC D;  5DNM B;  2ARO B;  3AZG C;  5B24 C;  1P3O C;  1P3I C;  3KXB A;  4Z5T D;  3X1V C;  1P3B C;  5E5A B;  1P3M B;  3B6F B;  4HGA C;  1M1A B;  3R45 B;  4J8U C;  5B32 A;  4DRB A;  1B67 A;  3REH B;  5GT3 D;  3O62 B;  3AYW A;  3WTP A;  3REK C;  5AVB C;  4WZS B;  3MGS D;  5B1L A;  3MVD A;  5AV9 B;  3V9R A;  4WU8 A;  1KX4 D;  5JRG B;  3MGR B;  3AZK A;  4QLC B;  5B0Y A;  5DNN C;  1ULY A;  4Z5T B;  2NQB A;  5DNM A;  2ARO A;  3KWQ D;  4ZUX D;  3AZG D;  3WA9 C;  3NQJ B;  2LY8 A;  5E5A A;  4X23 A;  1P3M A;  3B6F A;  3AZL B;  1P3B D;  5GT3 B;  3R45 A;  5AY8 D;  3KXB C;  3REH A;  4XZQ D;  3MGS B;  3O62 A;  3AV1 C;  5B32 C;  3B0C T;  5CPJ B;  3REL B;  3REK D;  3VH5 A;  5AVB D; 
#chains in the Genus database with same CATH topology
 5AV9 A;  3AZH D;  3VH5 W;  2IO5 B;  1F66 A;  5JRG A;  3WTP C;  3MGR A;  3LZ1 B;  3AZM B;  2F8N B;  5B1L C;  4QLC A;  3KWQ B;  3MVD C;  5B1M C;  4Z5T A;  2FJ7 D;  4H9R B;  4KGC D;  3H0M C;  3AZK C;  4KHA B;  3X1S D;  2DF4 C;  3MGQ D;  3NQJ A;  5B2I D;  5B0Y C;  3AZI C;  3H0R C;  3AZL A;  2YFW B;  4XZQ B;  5GT3 A;  2NQB C;  5DNM C;  2ARO C;  1P3L B;  3W96 B;  3MGS A;  5E5A C;  1P3M C;  2RVQ C;  3B6F C;  1P3F B;  3UTA D;  1M1A C;  3AZH B;  3B6G C;  5CPJ A;  3REL A;  5B32 D;  3C1B B;  3REH C;  3LJA D;  5GT0 B;  3LZ1 A;  4KUD D;  3EPK A;  3AZM A;  3AYW D;  2FJ7 B;  2F8N A;  2YFV B;  3KWQ A;  3REJ B;  5AV9 C;  5B1L D;  3X1S B;  5AVC D;  4WNN B;  4H9R A;  5B31 A;  5B2I B;  5JRG C;  3MVD D;  3MGR C;  4KHA A;  4WU8 D;  4YM6 B;  4EO5 B;  4QLC C;  3W97 D;  1KU5 A;  5B40 B;  4Z5T C;  3IP4 C;  2YFW A;  5B0Y D;  2VQR A;  3UTA B;  2ARO D;  1P3L A;  3W96 A;  1P3G D;  3AZL C;  4H9S A;  1P3F A;  1EQZ D;  5GT3 C;  4X23 D;  3LJA B;  4KUD B;  3C1B A;  3AYW B;  3MGS C;  2ZY4 A;  5GT0 A;  1TZY D;  3O62 D;  5AVC B;  5F99 D;  2FJ7 A;  5CPI B;  5CPJ C;  3A1I A;  1KX4 C;  3REL C;  2YFV A;  5AV8 D;  4WV4 B;  3REJ A;  3WAA D;  3X1S A;  4J8X B;  5CPK B;  3W97 B;  2IO5 C;  5B2I A;  3LZ0 D;  1U35 B;  3LZ1 C;  1P3F D;  4YM6 A;  3LEL D;  5BS7 A;  5JRG D;  1F66 D;  3B0C W;  3KWQ C;  4ZUX C;  1PZR A;  5B40 A;  4YS3 D;  1P3G B;  1A7W A;  2W8S A;  2F8N H;  3UTA A;  1EQZ B;  4X23 B;  5AY8 C;  3REI D;  4H9P B;  1BH8 B;  5CHL B;  3EPH A;  1P3A B;  4XZQ C;  3LJA A;  3AZL D;  1H3O B;  4G91 B;  1TZY B;  2G5I C;  4KUD A;  3W96 C;  1TAF B;  5F99 B;  1HTA A;  3KUY B;  4J8W D;  5AV8 B;  4H9S C;  4Z66 D;  1P3F C;  3W98 B;  3WAA B;  3AZH C;  5AVC A;  3AZE D;  5CPI A;  3LZ0 B;  5B33 B;  5GXQ D;  4KGC B;  5CPJ D;  3LEL B;  3MGP B;  1F66 B;  4J8X A;  3X1U B;  3REL D;  5CPK A;  1KX5 B;  2PYO A;  1M18 B;  3W97 A;  5GT0 C;  1U35 A;  4YS3 B;  3C1C A;  4NE3 A;  2FJ7 C;  1AOI D;  3LZ1 D;  3AZM D;  3AV2 D;  2F8N D;  3WKJ D;  3B0D C;  3X1S C;  3MGQ C;  4NE5 A;  3REI B;  1P3G A;  5B2I C;  5B31 D;  1EQZ A;  5BS7 C;  4H9P A;  1BH8 A;  4J8W B;  1P3A A;  5B32 G;  3TU4 B;  1HQ3 D;  1H3O A;  4H9O B;  4Z66 B;  3UTA C;  1TZY A;  3AZE B;  1TAF A;  5F99 A;  3KUY A;  5GXQ B;  5AV8 A;  3KSY A;  1P3L D;  3W96 D;  3W98 A;  3WAA A;  3LJA C;  5B2J B;  3LZ0 A;  5B33 A;  3VH6 A;  4KGC A;  4KUD C;  3AYW C;  3LEL A;  3MGP A;  3X1U A;  1AOI B;  1KX5 A;  3VH6 W;  3C1B D;  3AV2 B;  1M18 A;  1ID3 B;  3WKJ B;  5CP6 B;  4YS3 A;  5AVC C;  5GT0 D;  5CPI C;  2BG1 A;  5G49 B;  4WU8 C;  5B31 B;  4J8X C;  5CPK C;  3REI A;  5AV6 D;  3REJ D;  3W97 C;  1U35 C;  2RIQ A;  4WJ3 C;  3WTP E;  1HQ3 B;  5GSU D;  4YM6 D;  1Z2C B;  4J8W A;  1P3G C;  5FUG B;  2UWX A;  5B40 D;  3TU4 A;  4H9O A;  4Z66 A;  1EQZ C;  4J8V B;  4UPK A;  4X23 C;  3AZE A;  5GXQ A;  1P3A C;  4AWL B;  1S32 A;  2ZM5 A;  2XD5 A;  3FDD A;  4G91 C;  1TZY C;  5B2J A;  3O62 C;  4Z2M G;  5F99 C;  2NZD D;  1BFM A;  4CAY B;  5AV8 C;  1AOI A;  1ID3 A;  3AV2 A;  4HGA B;  3WKJ A;  3WAA C;  2L5A A;  5CP6 A;  5AV6 B;  3LZ0 C;  5G49 A;  4KGC C;  3LEL C;  3UTB D;  2Y2N A;  3MGP C;  5CPI D;  2Y2L A;  3X1U C;  1F66 C;  1KX5 C;  5GSU B;  1M18 C;  4J8X D;  2PYO D;  5CPK D;  4YS3 C;  3AFA D;  1U35 D;  1HQ3 A;  2ZY2 A;  3C1C D;  1M19 D;  3REI C;  5FUG A;  4JJN D;  1JFI B;  5AV5 D;  4J8V A;  2Y2Q A;  2Y2K A;  1WWI A;  4E44 A;  4J8W C;  5B0Z D;  4ZBJ B;  4UUZ A;  1P34 A;  2NZD B;  1P3A D;  2XD1 A;  2Y2P A;  4Z66 C;  3AZN D;  2CV5 D;  3AZE C;  3WA9 B;  4CAY A;  5GXQ C;  2HIO D;  3KUY D;  3UTB B;  2F8N G;  4J8U A;  5AV6 A;  5B2J C;  3W98 D;  2PYO B;  3AZF D;  3AFA B;  5B33 D;  5B31 G;  1AOI C;  5GSU A;  1ID3 C;  3AZM C;  3AV2 C;  3C1C B;  3AV1 B;  3MGP D;  1M19 B;  3WKJ C;  3X1U D;  5CP6 C;  1KX5 D;  1M18 D;  4JJN B;  1ZLA D;  5AV5 B;  5B31 C;  1P3K D;  4M6B A;  1JFI A;  3NQU B;  3AZJ B;  5B0Z B;  1HQ3 C;  3AZN B;  5B1M B;  2CV5 B;  2NZD A;  3X1T B;  3MNN B;  4WU9 D;  3EG5 B;  1P3L C;  3A6N D;  2HIO B;  5BT1 C;  3A1K A;  3TU4 D;  1KX3 B;  3WA9 A;  3AZF B;  3AZI B;  3UTB A;  4AWL C;  5JA4 B;  3C1B C;  3H0L C;  3AFA A;  1S32 D;  2Y2J A;  4R8P D;  4CSR B;  5B2J D;  1ZLA B;  4LD9 B;  3AV1 A;  1P3K B;  1M19 A;  4H9Q B;  1ID3 D;  5AV6 C;  3REJ C;  4JJN A;  3B6G B;  5CP6 D;  5AV5 A;  3EPL A;  2Y2G A;  4XUJ D;  5BNV B;  5GSU C;  3AN2 D;  4YM6 C;  4EO5 C;  3NQU A;  3AZJ A;  5B0Z A;  1P3P D;  5KDM B;  5B40 C;  4G92 B;  4DQY B;  4WU9 B;  3A6N B;  3AZN A;  2JSS A;  3W99 D;  5B1M A;  2CV5 A;  3X1T A;  4H9N B;  3MNN A;  2HIO A;  1KX3 A;  3UT9 D;  5BT1 D;  4J8V D;  3AZF A;  3AZI A;  2NZD C;  1S32 B;  4ZBJ C;  4R8P B;  1BH9 B;  5JA4 A;  1P34 D;  1N1J B;  5B24 D;  1P3O D;  4CSR A;  1P3I D;  1ZLA A;  4LD9 A;  3X1V D;  1P3K A;  4XUJ B;  4DRA A;  3F6T A;  3UTB C;  4H9Q A;  1M1A A;  1B6W A;  2F2A C;  3AN2 B;  3B6G A;  2PYO C;  3AFA C;  4J8U D;  1P3P B;  2Y2I A;  5BNV A;  3C1C C;  1M19 C;  2HUE B;  3W99 B;  5KDM A;  4JJN C;  5AV5 C;  4WU9 A;  1KX4 B;  3A6N A;  5C3I B;  3UT9 B;  4H9N A;  3AZJ C;  2FFF B;  5B0Z C;  1P34 B;  3AZN C;  4UUZ B;  2Y2O A;  4ZUX B;  2CV5 C;  3AZG B;  4NFT A;  2BYM B;  5B24 B;  4R8P A;  3X1T C;  1P3I B;  1P3O B;  3MNN C;  5DNN D;  2ZY5 A;  1BH9 A;  2HIO C;  1N1J A;  3KUY C;  3X1V B;  1P3B B;  1KX3 C;  5AY8 B;  1R4V A;  3W98 C;  3AZF C;  2Y2M A;  4J8U B;  3WA9 D;  4XUJ A;  5BNX B;  5B33 C;  3AN2 A;  1Q9C A;  1P3P A;  1ZLA C;  4LD9 C;  3KXB D;  3KFU G;  3REK B;  1P3K C;  5AVB B;  3W99 A;  3AV1 D;  4E45 A;  1KX4 A;  3UT9 A;  5BO0 B;  3WTP D;  5DNN B;  2DQN C;  4G92 C;  2JCH A;  3A6N C;  3AZJ D;  4WU9 C;  4NE6 A;  4ZUX A;  3TU4 C;  3B0D B;  3AZG A;  2BYM A;  5B24 A;  3MGQ B;  1P3O A;  1P3I A;  5B1M D;  3X1V A;  3X1T D;  1P3B A;  3MNN D;  5AY8 A;  3AZK D;  2BYK B;  4Z2M H;  1KX3 D;  1WWS A;  1S32 C;  4R8P C;  5BNX A;  3B0B A;  4XZQ A;  3KXB B;  3AZI D;  2NQB D;  5DNM D;  2Y2H A;  3VH5 T;  3VH6 T;  2ZY3 A;  3REK A;  2CWE A;  5B32 B;  4XUJ C;  2J8P A;  5AVB A;  4LD9 D;  5E5A D;  3AN2 C;  2RVQ D;  3AZH A;  1P3M D;  3B6F D;  1M1A D;  1P3P C;  3B6G D;  3WTP B;  3REH D;  2HUE C;  3W99 C;  5B1L B;  5BO0 A;  3AL0 C;  3MVD B;  5DNN A;  1F1E A;  2F8N K;  3V9R B;  4WU8 B;  5C3I C;  3UT9 C;  3MGQ A;  3AZK B;  4J8V C;  4WNN A;  2G5H C;  5AV9 D;  5B0Y B;  3MGR D;  1P34 C;  2BYK A;  2NQB B;  4QLC D;  5DNM B;  2ARO B;  3AZG C;  5B24 C;  1P3O C;  1P3I C;  3KXB A;  4Z5T D;  3X1V C;  1P3B C;  5E5A B;  1P3M B;  3B6F B;  4HGA C;  1T3U A;  1M1A B;  3R45 B;  4J8U C;  5B32 A;  4DRB A;  1B67 A;  3REH B;  2JE5 A;  5GT3 D;  3O62 B;  3AYW A;  3WTP A;  3REK C;  5AVB C;  4WZS B;  3MGS D;  5B1L A;  3MVD A;  5AV9 B;  3V9R A;  4WU8 A;  1KX4 D;  5JRG B;  3MGR B;  3AZK A;  4QLC B;  5B0Y A;  5DNN C;  1ULY A;  4Z5T B;  1W2E A;  2NQB A;  5DNM A;  2ARO A;  3KWQ D;  3EPJ A;  4ZUX D;  3AZG D;  3WA9 C;  3NQJ B;  2LY8 A;  5E5A A;  4X23 A;  1P3M A;  3B6F A;  3AZL B;  1P3B D;  5GT3 B;  3R45 A;  5AY8 D;  3P5J B;  3KXB C;  3REH A;  4XZQ D;  3MGS B;  3O62 A;  3AV1 C;  5B32 C;  3B0C T;  5CPJ B;  3REL B;  3REK D;  3VH5 A;  5AVB D; 
#chains in the Genus database with same CATH homology
 5AV9 A;  3AZH D;  3VH5 W;  2IO5 B;  1F66 A;  5JRG A;  3WTP C;  3MGR A;  3LZ1 B;  3AZM B;  2F8N B;  5B1L C;  4QLC A;  3KWQ B;  3MVD C;  5B1M C;  4Z5T A;  2FJ7 D;  4H9R B;  4KGC D;  3H0M C;  3AZK C;  4KHA B;  3X1S D;  2DF4 C;  3MGQ D;  3NQJ A;  5B2I D;  5B0Y C;  3AZI C;  3H0R C;  3AZL A;  2YFW B;  4XZQ B;  5GT3 A;  2NQB C;  5DNM C;  2ARO C;  1P3L B;  3W96 B;  3MGS A;  5E5A C;  1P3M C;  2RVQ C;  3B6F C;  1P3F B;  3UTA D;  1M1A C;  3AZH B;  3B6G C;  5CPJ A;  3REL A;  5B32 D;  3C1B B;  3REH C;  3LJA D;  5GT0 B;  3LZ1 A;  4KUD D;  3EPK A;  3AZM A;  3AYW D;  2FJ7 B;  2F8N A;  2YFV B;  3KWQ A;  3REJ B;  5AV9 C;  5B1L D;  3X1S B;  5AVC D;  4WNN B;  4H9R A;  5B31 A;  5B2I B;  5JRG C;  3MVD D;  3MGR C;  4KHA A;  4WU8 D;  4YM6 B;  4EO5 B;  4QLC C;  3W97 D;  1KU5 A;  5B40 B;  4Z5T C;  3IP4 C;  2YFW A;  5B0Y D;  2VQR A;  3UTA B;  2ARO D;  1P3L A;  3W96 A;  1P3G D;  3AZL C;  4H9S A;  1P3F A;  1EQZ D;  5GT3 C;  4X23 D;  3LJA B;  4KUD B;  3C1B A;  3AYW B;  3MGS C;  2ZY4 A;  5GT0 A;  1TZY D;  3O62 D;  5AVC B;  5F99 D;  2FJ7 A;  5CPI B;  5CPJ C;  3A1I A;  1KX4 C;  3REL C;  2YFV A;  5AV8 D;  4WV4 B;  3REJ A;  3WAA D;  3X1S A;  4J8X B;  5CPK B;  3W97 B;  2IO5 C;  5B2I A;  3LZ0 D;  1U35 B;  3LZ1 C;  1P3F D;  4YM6 A;  3LEL D;  5BS7 A;  5JRG D;  1F66 D;  3B0C W;  3KWQ C;  4ZUX C;  1PZR A;  5B40 A;  4YS3 D;  1P3G B;  1A7W A;  2W8S A;  2F8N H;  3UTA A;  1EQZ B;  4X23 B;  5AY8 C;  3REI D;  4H9P B;  1BH8 B;  5CHL B;  3EPH A;  1P3A B;  4XZQ C;  3LJA A;  3AZL D;  1H3O B;  4G91 B;  1TZY B;  2G5I C;  4KUD A;  3W96 C;  1TAF B;  5F99 B;  1HTA A;  3KUY B;  4J8W D;  5AV8 B;  4H9S C;  4Z66 D;  1P3F C;  3W98 B;  3WAA B;  3AZH C;  5AVC A;  3AZE D;  5CPI A;  3LZ0 B;  5B33 B;  5GXQ D;  4KGC B;  5CPJ D;  3LEL B;  3MGP B;  1F66 B;  4J8X A;  3X1U B;  3REL D;  5CPK A;  1KX5 B;  2PYO A;  1M18 B;  3W97 A;  5GT0 C;  1U35 A;  4YS3 B;  3C1C A;  4NE3 A;  2FJ7 C;  1AOI D;  3LZ1 D;  3AZM D;  3AV2 D;  2F8N D;  3WKJ D;  3B0D C;  3X1S C;  3MGQ C;  4NE5 A;  3REI B;  1P3G A;  5B2I C;  5B31 D;  1EQZ A;  5BS7 C;  4H9P A;  1BH8 A;  4J8W B;  1P3A A;  5B32 G;  3TU4 B;  1HQ3 D;  1H3O A;  4H9O B;  4Z66 B;  3UTA C;  1TZY A;  3AZE B;  1TAF A;  5F99 A;  3KUY A;  5GXQ B;  5AV8 A;  3KSY A;  1P3L D;  3W96 D;  3W98 A;  3WAA A;  3LJA C;  5B2J B;  3LZ0 A;  5B33 A;  3VH6 A;  4KGC A;  4KUD C;  3AYW C;  3LEL A;  3MGP A;  3X1U A;  1AOI B;  1KX5 A;  3VH6 W;  3C1B D;  3AV2 B;  1M18 A;  1ID3 B;  3WKJ B;  5CP6 B;  4YS3 A;  5AVC C;  5GT0 D;  5CPI C;  2BG1 A;  5G49 B;  4WU8 C;  5B31 B;  4J8X C;  5CPK C;  3REI A;  5AV6 D;  3REJ D;  3W97 C;  1U35 C;  2RIQ A;  4WJ3 C;  3WTP E;  1HQ3 B;  5GSU D;  4YM6 D;  1Z2C B;  4J8W A;  1P3G C;  5FUG B;  2UWX A;  5B40 D;  3TU4 A;  4H9O A;  4Z66 A;  1EQZ C;  4J8V B;  4UPK A;  4X23 C;  3AZE A;  5GXQ A;  1P3A C;  4AWL B;  1S32 A;  2ZM5 A;  2XD5 A;  3FDD A;  4G91 C;  1TZY C;  5B2J A;  3O62 C;  4Z2M G;  5F99 C;  2NZD D;  1BFM A;  4CAY B;  5AV8 C;  1AOI A;  1ID3 A;  3AV2 A;  4HGA B;  3WKJ A;  3WAA C;  2L5A A;  5CP6 A;  5AV6 B;  3LZ0 C;  5G49 A;  4KGC C;  3LEL C;  3UTB D;  2Y2N A;  3MGP C;  5CPI D;  2Y2L A;  3X1U C;  1F66 C;  1KX5 C;  5GSU B;  1M18 C;  4J8X D;  2PYO D;  5CPK D;  4YS3 C;  3AFA D;  1U35 D;  1HQ3 A;  2ZY2 A;  3C1C D;  1M19 D;  3REI C;  5FUG A;  4JJN D;  1JFI B;  5AV5 D;  4J8V A;  2Y2Q A;  2Y2K A;  1WWI A;  4E44 A;  4J8W C;  5B0Z D;  4ZBJ B;  4UUZ A;  1P34 A;  2NZD B;  1P3A D;  2XD1 A;  2Y2P A;  4Z66 C;  3AZN D;  2CV5 D;  3AZE C;  3WA9 B;  4CAY A;  5GXQ C;  2HIO D;  3KUY D;  3UTB B;  2F8N G;  4J8U A;  5AV6 A;  5B2J C;  3W98 D;  2PYO B;  3AZF D;  3AFA B;  5B33 D;  5B31 G;  1AOI C;  5GSU A;  1ID3 C;  3AZM C;  3AV2 C;  3C1C B;  3AV1 B;  3MGP D;  1M19 B;  3WKJ C;  3X1U D;  5CP6 C;  1KX5 D;  1M18 D;  4JJN B;  1ZLA D;  5AV5 B;  5B31 C;  1P3K D;  4M6B A;  1JFI A;  3NQU B;  3AZJ B;  5B0Z B;  1HQ3 C;  3AZN B;  5B1M B;  2CV5 B;  2NZD A;  3X1T B;  3MNN B;  4WU9 D;  3EG5 B;  1P3L C;  3A6N D;  2HIO B;  5BT1 C;  3A1K A;  3TU4 D;  1KX3 B;  3WA9 A;  3AZF B;  3AZI B;  3UTB A;  4AWL C;  5JA4 B;  3C1B C;  3H0L C;  3AFA A;  1S32 D;  2Y2J A;  4R8P D;  4CSR B;  5B2J D;  1ZLA B;  4LD9 B;  3AV1 A;  1P3K B;  1M19 A;  4H9Q B;  1ID3 D;  5AV6 C;  3REJ C;  4JJN A;  3B6G B;  5CP6 D;  5AV5 A;  3EPL A;  2Y2G A;  4XUJ D;  5BNV B;  5GSU C;  3AN2 D;  4YM6 C;  4EO5 C;  3NQU A;  3AZJ A;  5B0Z A;  1P3P D;  5KDM B;  5B40 C;  4G92 B;  4DQY B;  4WU9 B;  3A6N B;  3AZN A;  2JSS A;  3W99 D;  5B1M A;  2CV5 A;  3X1T A;  4H9N B;  3MNN A;  2HIO A;  1KX3 A;  3UT9 D;  5BT1 D;  4J8V D;  3AZF A;  3AZI A;  2NZD C;  1S32 B;  4ZBJ C;  4R8P B;  1BH9 B;  5JA4 A;  1P34 D;  1N1J B;  5B24 D;  1P3O D;  4CSR A;  1P3I D;  1ZLA A;  4LD9 A;  3X1V D;  1P3K A;  4XUJ B;  4DRA A;  3F6T A;  3UTB C;  4H9Q A;  1M1A A;  1B6W A;  2F2A C;  3AN2 B;  3B6G A;  2PYO C;  3AFA C;  4J8U D;  1P3P B;  2Y2I A;  5BNV A;  3C1C C;  1M19 C;  2HUE B;  3W99 B;  5KDM A;  4JJN C;  5AV5 C;  4WU9 A;  1KX4 B;  3A6N A;  5C3I B;  3UT9 B;  4H9N A;  3AZJ C;  2FFF B;  5B0Z C;  1P34 B;  3AZN C;  4UUZ B;  2Y2O A;  4ZUX B;  2CV5 C;  3AZG B;  4NFT A;  2BYM B;  5B24 B;  4R8P A;  3X1T C;  1P3I B;  1P3O B;  3MNN C;  5DNN D;  2ZY5 A;  1BH9 A;  2HIO C;  1N1J A;  3KUY C;  3X1V B;  1P3B B;  1KX3 C;  5AY8 B;  1R4V A;  3W98 C;  3AZF C;  2Y2M A;  4J8U B;  3WA9 D;  4XUJ A;  5BNX B;  5B33 C;  3AN2 A;  1Q9C A;  1P3P A;  1ZLA C;  4LD9 C;  3KXB D;  3KFU G;  3REK B;  1P3K C;  5AVB B;  3W99 A;  3AV1 D;  4E45 A;  1KX4 A;  3UT9 A;  5BO0 B;  3WTP D;  5DNN B;  2DQN C;  4G92 C;  2JCH A;  3A6N C;  3AZJ D;  4WU9 C;  4NE6 A;  4ZUX A;  3TU4 C;  3B0D B;  3AZG A;  2BYM A;  5B24 A;  3MGQ B;  1P3O A;  1P3I A;  5B1M D;  3X1V A;  3X1T D;  1P3B A;  3MNN D;  5AY8 A;  3AZK D;  2BYK B;  4Z2M H;  1KX3 D;  1WWS A;  1S32 C;  4R8P C;  5BNX A;  3B0B A;  4XZQ A;  3KXB B;  3AZI D;  2NQB D;  5DNM D;  2Y2H A;  3VH5 T;  3VH6 T;  2ZY3 A;  3REK A;  2CWE A;  5B32 B;  4XUJ C;  2J8P A;  5AVB A;  4LD9 D;  5E5A D;  3AN2 C;  2RVQ D;  3AZH A;  1P3M D;  3B6F D;  1M1A D;  1P3P C;  3B6G D;  3WTP B;  3REH D;  2HUE C;  3W99 C;  5B1L B;  5BO0 A;  3AL0 C;  3MVD B;  5DNN A;  1F1E A;  2F8N K;  3V9R B;  4WU8 B;  5C3I C;  3UT9 C;  3MGQ A;  3AZK B;  4J8V C;  4WNN A;  2G5H C;  5AV9 D;  5B0Y B;  3MGR D;  1P34 C;  2BYK A;  2NQB B;  4QLC D;  5DNM B;  2ARO B;  3AZG C;  5B24 C;  1P3O C;  1P3I C;  3KXB A;  4Z5T D;  3X1V C;  1P3B C;  5E5A B;  1P3M B;  3B6F B;  4HGA C;  1T3U A;  1M1A B;  3R45 B;  4J8U C;  5B32 A;  4DRB A;  1B67 A;  3REH B;  2JE5 A;  5GT3 D;  3O62 B;  3AYW A;  3WTP A;  3REK C;  5AVB C;  4WZS B;  3MGS D;  5B1L A;  3MVD A;  5AV9 B;  3V9R A;  4WU8 A;  1KX4 D;  5JRG B;  3MGR B;  3AZK A;  4QLC B;  5B0Y A;  5DNN C;  1ULY A;  4Z5T B;  1W2E A;  2NQB A;  5DNM A;  2ARO A;  3KWQ D;  3EPJ A;  4ZUX D;  3AZG D;  3WA9 C;  3NQJ B;  2LY8 A;  5E5A A;  4X23 A;  1P3M A;  3B6F A;  3AZL B;  1P3B D;  5GT3 B;  3R45 A;  5AY8 D;  3P5J B;  3KXB C;  3REH A;  4XZQ D;  3MGS B;  3O62 A;  3AV1 C;  5B32 C;  3B0C T;  5CPJ B;  3REL B;  3REK D;  3VH5 A;  5AVB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...