3UTAD

Crystal structure of nucleosome core particle assembled with an alpha-satellite sequence containing two ttaaa elements (ncp-ta2)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title The mechanics behind DNA sequence-dependent properties of the nucleosome
pubmed doi rcsb
source organism Xenopus laevis
total genus 38
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3utaD00
4XZQC 3KXBD 1P34A 1P3FC 3AZLC 3REHA 3KWQA 1S32B 4CSRA 3LZ1C 5E5AB 3AZLD 4NFTA 4KUDA 3WTPA 2BYKA 3LZ1D 3AZGA 3AZMA 4J8VB 4UUZA 3WAAC 5B0YD 3W98A 2NQBC 5B2IA 3UTBD 1EQZA 3AZJA 4EO5B 5AV6D 2NQBD 5B33C 3AV2A 1M1AA 1HQ3A 2LY8A 5B33D 1P3AA 3AZNC 5DNNB 3AZIA 2YFVA 3MGRC 4NE6A 3B6GB 2F8NG 2CV5A 4WU8B 2YFWA 5CPIA 1KX3B 3WTPE 5DNMB 4X23A 5F99A 4YS3D 2PYOA 1Q9CA 5FUGB 3WKJB 3MNNA 3AYWA 1P3ID 5JRGD 1F66D 1P3BA 3REJA 1TZYA 5B2JC 3MGQB 4J8WC 4G92B 3C1BC 1P3OB 4JJNC 1AOIC 5B2JD 4J8WD 3X1SC 3AZFB 1AOID 5C3IC 2FJ7A 3VH6A 1P3LA 3REIA 1BH9B 5GSUC 4R8PA 4WU9C 2F8NA 4Z5TA 5B31A 4WU9D 3MVDA 4LD9C 1P3KC 3KSYA 3B6FB 5B0ZA 5B40B 4LD9D 1ZLAD 5B24B 2AROD 1M18D 5GT0A 5AV8C 3WTPC 5GXQA 4YM6B 3LZ0A 3AZKD 1JFIB 5AV8D 3W98C 5B2IC 4HGAC 1EQZC 3KXBB 3AZJC 1N1JA 2NZDA 3AV2C 1M1AC 4XZQB 1P3FB 1HQ3C 3AZLB 2BYMB 3AZHB 5E5AD 3LZ1B 1A7WA 1KX5C 3AZIC 4M6BA 4Z2MH 4J8VD 5CPJB 3WAAB 3AFAA 4CAYA 5BO0B 3LJAA 5B33B 3RELA 3AZEC 4X23C 3KUYA 5GT3B 5DNND 3AZNB 3AN2A 4WV4B 3AZED 2F8NH 4H9QA 4J8UA 1P3BC 3MGRB 3REJC 5G49B 4WU8C 2JSSA 1KX4C 4Z66A 1KX3C 3B6GD 3AV1A 4WU8D 1KX4D 5DNMC 1KX3D 4NE5A 3V9RB 4G91C 3WKJC 5DNMD 1P3LC 5BT1C 5B1LA 3WKJD 4R8PC 1P3GC 5AVBA 1KU5A 1P3OC 3MGQD 4J8WB 3C1BB 1P3OD 3AZFC 2IO5C 4H9RA 3C1CA 4JJNB 4XUJA 3X1SB 5B0ZC 3R45A 1AOIB 3AZFD 5GT0C 3W96A 5C3IB 5GXQC 5GSUB 4J8XA 1ID3A 5JA4A 3VH5T 2NZDC 5B40C 1P3KB 1P34B 3B6FD 3REHB 5B40D 4QLCA 5BNVB 5B24D 3WTPB 2BYKB 3W99A 4UUZB 4KHAA 3LJAC 5KDMA 3UTAC 5B2IB 3W98B 4HGAB 4KGCA 1EQZB 1F66A 3AZJB 3AZHC 3RELC 4XZQD 3AV2B 1P3FD 3B0CT 1HQ3B 1M1AB 3AZHD 1P3AB 3AN2C 5CPJC 1KX5B 3AZIB 3X1UC 2YFVB 5CPJD 3O62C 3WAAD 3AV1C 4Z2MG 3X1TA 2CV5B 5CPIB 1U35A 3MGPC 5GT3C 3A6NC 3AZEB 4X23B 3WA9A 5GT3D 3A6ND 3AZND 2PYOB 5AV5A 5AVBC 1BH8A 3MGSC 1P3BB 3MGRD 3REKC 3REJB 5B1MA 1KX4B 5B31G 3MGSD 3C1CC 1P3PA 4XUJC 5AY8A 4G91B 4NE3A 3W96C 2FJ7B 1P3LB 2RVQC 4WZSB 3UT9A 3VH5A 1S32A 4J8XC 4R8PB 1ID3C 1P3GB 1WWIA 2F8NB 5B31B 2HUEC 1P3MA 5B32G 3C1BD 4JJND 2IO5B 4ZUXA 3X1SD 5B0ZB 4QLCC 5GT0B 3W99C 5GXQB 3X1VC 5GSUD 3TU4A 4KGCC 1P34C 5BNXA 3REHC 1N1JB 3KWQC 2NZDB 1P3KD 2L5AA 1P34D 3REHD 4KUDC 3KWQD 3AZGC 3AZMC 3W97A 3LELA 5CHLB 5CPKA 3WTPD 4H9OA 4CAYB 3LJAB 5FUGA 5B32A 5AVCA 5B2ID 3UTAB 3W98D 3NQUA 1EQZD 1U35C 3AZJD 4H9SA 3RELB 3MGQA 3AV2D 1TAFA 2HIOA 1HQ3D 1P3AC 1M1AD 1P3AD 3AN2B 1KX5D 4H9QB 3AZID 3X1UB 4H9NA 3O62B 5B1MC 2CV5C 5CP6A 5CPIC 1BH9A 4WNNB 3AV1B 2CV5D 1M19A 5CPID 5F99C 3MGPB 2PYOC 3A6NB 4X23D 3MNNC 3UT9C 3AYWC 5F99D 2PYOD 4DRBA 3AYWD 1TZYC 5AVBB 3B0BA 3MGSB 1P3BD 3REJD 3REKB 1P3MC 4YM6A 1JFIA 5AV9A 4ZUXC 3C1CB 4XUJB 2FJ7C 3KXBA 1H3OA 3REIC 3W96B 2FJ7D 1P3LD 4XZQA 3NQJB 5BT1D 3AZLA 3REID 4Z5TC 4R8PD 4J8XB 5B31C 3LZ1A 3TU4C 3MVDC 5JA4B 1P3GD 1ID3B 1BFMA 2F8ND 5B0YA 5B31D 2HUEB 3WAAA 4H9PA 3UTBA 2NQBA 5AV6A 5B0ZD 4QLCB 3W97C 3LELC 5GT0D 3LZ0C 5CPKC 5B33A 3W99B 5GXQD 3LZ0D 3X1VB 3VH6W 4KHAB 5BS7A 5B32C 5AVCC 3AZNA 4KGCB 2NZDD 3KWQB 4CSRB 2HIOC 4KUDB 3AZGB 3AZMB 3AFAC 4YS3A 1WWSA 1P3IA 5CP6C 5JRGA 3AFAD 3LJAD 3UTAD 3X1TB 1M19C 3KUYC 1U35B 3RELD 5B2JA 4J8WA 3KUYD 3C1BA 4J8UC 3AN2D 3X1SA 1AOIA 5AV5B 1BH8B 3X1UD 4Z66C 3O62D 5B1MB 4Z66D 2YFWB 3AV1D 4DRAA 1P3PB 4WU9A 5AY8B 3MGPD 5F99B 4ZBJB 5B1LC 4LD9A 3MNNB 3AYWB 3UT9B 1P3KA 1ZLAA 2AROA 1M18A 5B1LD 5AVBD 1TZYB 5BNVA 1B6WA 3AZKA 5AV8A 5B0YC 3REKD 1P3MB 3UTBC 3C1CD 4ZUXB 4XUJD 5AV6C 3W96D 3REIB 2RVQD 5E5AA 4J8XD 5BS7C 4Z5TB 1ID3D 3TU4B 3MVDB 4J8VA 1KX5A 2F8NK 5BNXB 4QLCD 3W97B 3LELB 3LZ0B 5CPKB 4YS3C 3W99D 5DNNA 4AWLB 4H9OB 3AZEA 3X1VD 1P3IC 5JRGC 1F66C 5AVCB 5B32B 4KGCD 3NQUB 4E44A 3B6GA 4WU8A 1TAFB 2HIOB 1KX4A 1KX3A 4KUDD 3AZGD 1R4VA 3AZMD 5DNMA 1F1EA 3AFAB 3WKJA 4H9NB 3X1TC 5CP6B 3X1TD 1P3GA 1M19B 1U35D 3KUYB 1P3OA 3WA9C 3B0DC 5AV5C 3AZFA 3WA9D 1ZLAC 2AROC 1M18C 4J8UB 1ULYA 5AV5D 3AZKC 4Z66B 1P3PC 5B1MD 5AY8C 5AV9B 1P3PD 4ZBJC 5AY8D 1H3OB 3B6FA 5B1LB 1S32C 5B40A 3MNND 5E5AC 3UT9D 5B24A 1S32D 1TZYD 4J8VC 5B0YB 4H9RB 1P3MD 1HTAA 3R45B 4H9PB 3UTBB 4ZUXD 4EO5C 2NQBB 5AV6B 3UTAA 1P3FA 1B67A 2BYMA 3AZHA 5DNNC 4Z5TD 3TU4D 3MVDD 5CPJA 3VH5W 3X1UA 5BO0A 3B6GC 3O62A 4WNNA 4AWLC 3W97D 3LELD 2CWEA 3MGPA 5CPKD 5GT3A 3A6NA 4YS3B 5KDMB 1P3IB 5JRGB 1F66B 5B32D 5AVCD 3MGRA 4H9SC 5G49A 3MGQC 4G92C 3MGSA 3REKA 5B2JB 2HIOD 3B0CW 3V9RA 4E45A 3NQJA 5CP6D 1M19D 4WU9B 3WA9B 3B6FC 4JJNA 4LD9B 3B0DB 5B24C 1ZLAB 2AROB 4J8UD 1M18B 4YM6C 3AZKB 3VH6T 5GSUA 5AV8B 5AV9C 4YM6D 3X1VA 3KXBC 5AV9D
chains in the Genus database with same CATH superfamily
4XZQC 3KXBD 1P34A 1P3FC 3AZLC 3REHA 3KWQA 1S32B 4CSRA 3LZ1C 5E5AB 3AZLD 4NFTA 4KUDA 3WTPA 2BYKA 3LZ1D 3AZGA 3AZMA 4J8VB 4UUZA 3WAAC 5B0YD 3W98A 2NQBC 5B2IA 3UTBD 2Y2JA 1EQZA 3AZJA 4EO5B 5AV6D 2NQBD 5B33C 3AV2A 1M1AA 2ZY5A 1HQ3A 2LY8A 5B33D 1P3AA 3AZNC 5DNNB 3AZIA 2YFVA 3MGRC 2VQRA 4NE6A 3B6GB 2F8NG 2CV5A 4WU8B 2YFWA 5CPIA 1KX3B 3WTPE 5DNMB 4X23A 5F99A 4YS3D 2PYOA 1Q9CA 3EG5B 5FUGB 3IP4C 3MNNA 3AYWA 1P3ID 3WKJB 5JRGD 1F66D 1P3BA 3REJA 1TZYA 5B2JC 3MGQB 4J8WC 4G92B 3C1BC 1P3OB 4JJNC 1AOIC 5B2JD 4J8WD 3X1SC 3AZFB 1AOID 5C3IC 2FJ7A 3VH6A 1P3LA 3REIA 1BH9B 5GSUC 4R8PA 4WU9C 3FDDA 2F8NA 4Z5TA 5B31A 4WU9D 3MVDA 3H0LC 4LD9C 1P3KC 3KSYA 3B6FB 3KFUG 5B0ZA 5B40B 4LD9D 1ZLAD 5B24B 2AROD 1M18D 5GT0A 5AV8C 3WTPC 5GXQA 4YM6B 3LZ0A 3AZKD 1JFIB 5AV8D 3W98C 5B2IC 4HGAC 1EQZC 3KXBB 3AZJC 1N1JA 2NZDA 3AV2C 1M1AC 4XZQB 1P3FB 1HQ3C 3AZLB 1T3UA 2BYMB 3AZHB 5E5AD 2Y2QA 3LZ1B 1A7WA 1KX5C 3AZIC 4UPKA 4M6BA 4Z2MH 4J8VD 5CPJB 3WAAB 3AFAA 4CAYA 5BO0B 3LJAA 5B33B 3RELA 3AZEC 4X23C 3KUYA 5GT3B 5DNND 3AZNB 3AN2A 4WV4B 3AZED 2F8NH 4H9QA 2ZY3A 4J8UA 1P3BC 3MGRB 3REJC 5G49B 4WU8C 2JSSA 1KX4C 4Z66A 1KX3C 3B6GD 3AV1A 4WU8D 1KX4D 5DNMC 1KX3D 4NE5A 3V9RB 4G91C 3WKJC 5DNMD 1P3LC 2Y2IA 5BT1C 5B1LA 3WKJD 4R8PC 2F2AC 1P3GC 5AVBA 1KU5A 1P3OC 3MGQD 4J8WB 3C1BB 1P3OD 3AZFC 2IO5C 4H9RA 3C1CA 4JJNB 4XUJA 3X1SB 5B0ZC 3R45A 1AOIB 3AZFD 5GT0C 3W96A 5C3IB 5GXQC 5GSUB 4J8XA 1ID3A 5JA4A 3VH5T 2NZDC 5B40C 1P3KB 1P34B 3B6FD 3REHB 5B40D 4QLCA 5BNVB 5B24D 3WTPB 2BYKB 3W99A 4UUZB 4KHAA 3LJAC 5KDMA 3UTAC 5B2IB 2Y2LA 4HGAB 3W98B 4KGCA 1EQZB 1F66A 3AZJB 3AZHC 3RELC 4XZQD 3AV2B 1P3FD 3B0CT 1HQ3B 1M1AB 3AZHD 1P3AB 3AN2C 5CPJC 1KX5B 3AZIB 3X1UC 2YFVB 5CPJD 3O62C 3WAAD 3AV1C 4Z2MG 3X1TA 2CV5B 5CPIB 1U35A 3MGPC 5GT3C 2Y2KA 3A6NC 3F6TA 3AZEB 4X23B 3WA9A 5GT3D 3A6ND 3AZND 2PYOB 5AV5A 5AVBC 1BH8A 3MGSC 1P3BB 3MGRD 3REKC 3REJB 5B1MA 1KX4B 5B31G 3MGSD 3H0RC 3C1CC 2XD1A 4XUJC 5AY8A 1P3PA 4G91B 4NE3A 3W96C 2FJ7B 1P3LB 2RVQC 4WZSB 3UT9A 2ZM5A 3EPLA 3VH5A 1S32A 4J8XC 4R8PB 1ID3C 1P3GB 1WWIA 2F8NB 5B31B 2HUEC 1P3MA 5B32G 3C1BD 4JJND 2IO5B 4ZUXA 3X1SD 5B0ZB 4QLCC 5GT0B 3W99C 5GXQB 3X1VC 5GSUD 3TU4A 4KGCC 1P34C 5BNXA 3REHC 1N1JB 1W2EA 3KWQC 2NZDB 1P3KD 2L5AA 1P34D 3REHD 4KUDC 3KWQD 3AZGC 3AZMC 3W97A 3LELA 5CHLB 5CPKA 3H0MC 2Y2OA 3WTPD 4H9OA 4CAYB 3LJAB 5FUGA 5B32A 5AVCA 5B2ID 3UTAB 3W98D 3NQUA 1EQZD 1U35C 3AZJD 4H9SA 3RELB 3MGQA 3AV2D 1TAFA 2HIOA 1HQ3D 1P3AC 1M1AD 1P3AD 3AN2B 2ZY4A 1KX5D 2ZY2A 4H9QB 3AZID 3X1UB 4H9NA 3O62B 5B1MC 2CV5C 3EPJA 5CP6A 5CPIC 1BH9A 4WNNB 3AV1B 2CV5D 1M19A 5CPID 5F99C 3MGPB 2PYOC 3A6NB 4X23D 3MNNC 3UT9C 3AYWC 5F99D 2PYOD 4DRBA 3AYWD 1TZYC 5AVBB 3B0BA 3MGSB 1P3BD 3REJD 3REKB 1P3MC 4YM6A 1JFIA 5AV9A 4ZUXC 3C1CB 4XUJB 2FJ7C 3KXBA 1H3OA 3REIC 3W96B 2FJ7D 1P3LD 4XZQA 2RIQA 3NQJB 5BT1D 3AZLA 3REID 4Z5TC 4R8PD 4J8XB 5B31C 3LZ1A 3TU4C 3MVDC 5JA4B 1P3GD 1ID3B 1BFMA 2F8ND 2Y2NA 5B0YA 5B31D 2HUEB 3WAAA 4H9PA 3UTBA 2NQBA 5AV6A 5B0ZD 4QLCB 3W97C 3LELC 5GT0D 3LZ0C 5CPKC 5B33A 3W99B 5GXQD 3LZ0D 3X1VB 3VH6W 4KHAB 5BS7A 5B32C 5AVCC 3AZNA 4KGCB 2NZDD 3KWQB 4CSRB 2W8SA 2HIOC 4KUDB 3AZGB 2BG1A 3AZMB 3AFAC 4YS3A 1WWSA 1P3IA 5CP6C 5JRGA 3AFAD 3EPKA 3LJAD 3UTAD 3X1TB 3P5JB 1M19C 3KUYC 1U35B 3A1IA 3RELD 5B2JA 4J8WA 3KUYD 3C1BA 4J8UC 3AN2D 3X1SA 1AOIA 5AV5B 1BH8B 3X1UD 4Z66C 2Y2GA 3O62D 5B1MB 2YFWB 4Z66D 3AV1D 4DRAA 1P3PB 4WU9A 2DF4C 5AY8B 3MGPD 5F99B 4ZBJB 5B1LC 4LD9A 3MNNB 3AYWB 3UT9B 1P3KA 1ZLAA 2AROA 1M18A 5B1LD 5AVBD 1TZYB 5BNVA 1B6WA 3AZKA 5AV8A 5B0YC 3REKD 1P3MB 3UTBC 3C1CD 4ZUXB 4XUJD 5AV6C 3W96D 3REIB 2RVQD 5E5AA 4J8XD 5BS7C 4Z5TB 1ID3D 3TU4B 3MVDB 4J8VA 1KX5A 2F8NK 5BNXB 2Y2MA 4QLCD 1Z2CB 3W97B 3LELB 3LZ0B 5CPKB 4YS3C 3W99D 5DNNA 4AWLB 4H9OB 3AZEA 3X1VD 1P3IC 5JRGC 1F66C 5AVCB 5B32B 4KGCD 3AL0C 3NQUB 4E44A 3B6GA 4WU8A 1TAFB 2HIOB 1KX4A 1KX3A 4KUDD 3AZGD 1R4VA 3AZMD 5DNMA 1F1EA 3AFAB 3WKJA 4H9NB 3X1TC 4WJ3C 5CP6B 3X1TD 1P3GA 2Y2PA 1M19B 1U35D 3KUYB 1P3OA 3WA9C 2J8PA 3B0DC 5AV5C 3AZFA 3WA9D 1ZLAC 2AROC 1M18C 4J8UB 1ULYA 5AV5D 3AZKC 4Z66B 1P3PC 5B1MD 5AY8C 5AV9B 1P3PD 4ZBJC 5AY8D 1H3OB 3B6FA 5B1LB 1S32C 5B40A 3MNND 5E5AC 3UT9D 5B24A 2G5IC 1S32D 3EPHA 1TZYD 4J8VC 5B0YB 4H9RB 1P3MD 1HTAA 3R45B 2DQNC 2UWXA 4H9PB 3UTBB 2FFFB 4ZUXD 4DQYB 4EO5C 2NQBB 5AV6B 3UTAA 3A1KA 1P3FA 1B67A 2BYMA 2XD5A 3AZHA 5DNNC 4Z5TD 3TU4D 3MVDD 5CPJA 3VH5W 3X1UA 5BO0A 3B6GC 3O62A 4WNNA 4AWLC 3W97D 3LELD 2CWEA 3MGPA 5CPKD 5GT3A 3A6NA 4YS3B 5KDMB 1P3IB 5JRGB 1F66B 5B32D 5AVCD 3MGRA 2G5HC 4H9SC 5G49A 3MGQC 4G92C 1PZRA 2JCHA 3MGSA 3REKA 5B2JB 2HIOD 3B0CW 3V9RA 4E45A 3NQJA 5CP6D 1M19D 4WU9B 2JE5A 3WA9B 3B6FC 4JJNA 4LD9B 3B0DB 5B24C 1ZLAB 2AROB 4J8UD 1M18B 4YM6C 3AZKB 3VH6T 5GSUA 5AV8B 5AV9C 2Y2HA 4YM6D 3X1VA 3KXBC 5AV9D
chains in the Genus database with same CATH topology
4XZQC 3KXBD 1P34A 1P3FC 3AZLC 3REHA 3KWQA 1S32B 4CSRA 3LZ1C 5E5AB 3AZLD 4NFTA 4KUDA 3WTPA 2BYKA 3LZ1D 3AZGA 3AZMA 4J8VB 4UUZA 3WAAC 5B0YD 3W98A 2NQBC 5B2IA 3UTBD 2Y2JA 1EQZA 3AZJA 4EO5B 5AV6D 2NQBD 5B33C 3AV2A 1M1AA 2ZY5A 1HQ3A 2LY8A 5B33D 1P3AA 3AZNC 5DNNB 3AZIA 2YFVA 3MGRC 2VQRA 4NE6A 3B6GB 2F8NG 2CV5A 4WU8B 2YFWA 5CPIA 1KX3B 3WTPE 5DNMB 4X23A 5F99A 4YS3D 2PYOA 1Q9CA 3EG5B 5FUGB 3IP4C 3MNNA 3AYWA 1P3ID 3WKJB 5JRGD 1F66D 1P3BA 3REJA 1TZYA 5B2JC 3MGQB 4J8WC 4G92B 3C1BC 1P3OB 4JJNC 1AOIC 5B2JD 4J8WD 3X1SC 3AZFB 1AOID 5C3IC 2FJ7A 3VH6A 1P3LA 3REIA 1BH9B 5GSUC 4R8PA 4WU9C 3FDDA 2F8NA 4Z5TA 5B31A 4WU9D 3MVDA 3H0LC 4LD9C 1P3KC 3KSYA 3B6FB 3KFUG 5B0ZA 5B40B 4LD9D 1ZLAD 5B24B 2AROD 1M18D 5GT0A 5AV8C 3WTPC 5GXQA 4YM6B 3LZ0A 3AZKD 1JFIB 5AV8D 3W98C 5B2IC 4HGAC 1EQZC 3KXBB 3AZJC 1N1JA 2NZDA 3AV2C 1M1AC 4XZQB 1P3FB 1HQ3C 3AZLB 1T3UA 2BYMB 3AZHB 5E5AD 2Y2QA 3LZ1B 1A7WA 1KX5C 3AZIC 4UPKA 4M6BA 4Z2MH 4J8VD 5CPJB 3WAAB 3AFAA 4CAYA 5BO0B 3LJAA 5B33B 3RELA 3AZEC 4X23C 3KUYA 5GT3B 5DNND 3AZNB 3AN2A 4WV4B 3AZED 2F8NH 4H9QA 2ZY3A 4J8UA 1P3BC 3MGRB 3REJC 5G49B 4WU8C 2JSSA 1KX4C 4Z66A 1KX3C 3B6GD 3AV1A 4WU8D 1KX4D 5DNMC 1KX3D 4NE5A 3V9RB 4G91C 3WKJC 5DNMD 1P3LC 2Y2IA 5BT1C 5B1LA 3WKJD 4R8PC 2F2AC 1P3GC 5AVBA 1KU5A 1P3OC 3MGQD 4J8WB 3C1BB 1P3OD 3AZFC 2IO5C 4H9RA 3C1CA 4JJNB 4XUJA 3X1SB 5B0ZC 3R45A 1AOIB 3AZFD 5GT0C 3W96A 5C3IB 5GXQC 5GSUB 4J8XA 1ID3A 5JA4A 3VH5T 2NZDC 5B40C 1P3KB 1P34B 3B6FD 3REHB 5B40D 4QLCA 5BNVB 5B24D 3WTPB 2BYKB 3W99A 4UUZB 4KHAA 3LJAC 5KDMA 3UTAC 5B2IB 2Y2LA 4HGAB 3W98B 4KGCA 1EQZB 1F66A 3AZJB 3AZHC 3RELC 4XZQD 3AV2B 1P3FD 3B0CT 1HQ3B 1M1AB 3AZHD 1P3AB 3AN2C 5CPJC 1KX5B 3AZIB 3X1UC 2YFVB 5CPJD 3O62C 3WAAD 3AV1C 4Z2MG 3X1TA 2CV5B 5CPIB 1U35A 3MGPC 5GT3C 2Y2KA 3A6NC 3F6TA 3AZEB 4X23B 3WA9A 5GT3D 3A6ND 3AZND 2PYOB 5AV5A 5AVBC 1BH8A 3MGSC 1P3BB 3MGRD 3REKC 3REJB 5B1MA 1KX4B 5B31G 3MGSD 3H0RC 3C1CC 2XD1A 4XUJC 5AY8A 1P3PA 4G91B 4NE3A 3W96C 2FJ7B 1P3LB 2RVQC 4WZSB 3UT9A 2ZM5A 3EPLA 3VH5A 1S32A 4J8XC 4R8PB 1ID3C 1P3GB 1WWIA 2F8NB 5B31B 2HUEC 1P3MA 5B32G 3C1BD 4JJND 2IO5B 4ZUXA 3X1SD 5B0ZB 4QLCC 5GT0B 3W99C 5GXQB 3X1VC 5GSUD 3TU4A 4KGCC 1P34C 5BNXA 3REHC 1N1JB 1W2EA 3KWQC 2NZDB 1P3KD 2L5AA 1P34D 3REHD 4KUDC 3KWQD 3AZGC 3AZMC 3W97A 3LELA 5CHLB 5CPKA 3H0MC 2Y2OA 3WTPD 4H9OA 4CAYB 3LJAB 5FUGA 5B32A 5AVCA 5B2ID 3UTAB 3W98D 3NQUA 1EQZD 1U35C 3AZJD 4H9SA 3RELB 3MGQA 3AV2D 1TAFA 2HIOA 1HQ3D 1P3AC 1M1AD 1P3AD 3AN2B 2ZY4A 1KX5D 2ZY2A 4H9QB 3AZID 3X1UB 4H9NA 3O62B 5B1MC 2CV5C 3EPJA 5CP6A 5CPIC 1BH9A 4WNNB 3AV1B 2CV5D 1M19A 5CPID 5F99C 3MGPB 2PYOC 3A6NB 4X23D 3MNNC 3UT9C 3AYWC 5F99D 2PYOD 4DRBA 3AYWD 1TZYC 5AVBB 3B0BA 3MGSB 1P3BD 3REJD 3REKB 1P3MC 4YM6A 1JFIA 5AV9A 4ZUXC 3C1CB 4XUJB 2FJ7C 3KXBA 1H3OA 3REIC 3W96B 2FJ7D 1P3LD 4XZQA 2RIQA 3NQJB 5BT1D 3AZLA 3REID 4Z5TC 4R8PD 4J8XB 5B31C 3LZ1A 3TU4C 3MVDC 5JA4B 1P3GD 1ID3B 1BFMA 2F8ND 2Y2NA 5B0YA 5B31D 2HUEB 3WAAA 4H9PA 3UTBA 2NQBA 5AV6A 5B0ZD 4QLCB 3W97C 3LELC 5GT0D 3LZ0C 5CPKC 5B33A 3W99B 5GXQD 3LZ0D 3X1VB 3VH6W 4KHAB 5BS7A 5B32C 5AVCC 3AZNA 4KGCB 2NZDD 3KWQB 4CSRB 2W8SA 2HIOC 4KUDB 3AZGB 2BG1A 3AZMB 3AFAC 4YS3A 1WWSA 1P3IA 5CP6C 5JRGA 3AFAD 3EPKA 3LJAD 3UTAD 3X1TB 3P5JB 1M19C 3KUYC 1U35B 3A1IA 3RELD 5B2JA 4J8WA 3KUYD 3C1BA 4J8UC 3AN2D 3X1SA 1AOIA 5AV5B 1BH8B 3X1UD 4Z66C 2Y2GA 3O62D 5B1MB 2YFWB 4Z66D 3AV1D 4DRAA 1P3PB 4WU9A 2DF4C 5AY8B 3MGPD 5F99B 4ZBJB 5B1LC 4LD9A 3MNNB 3AYWB 3UT9B 1P3KA 1ZLAA 2AROA 1M18A 5B1LD 5AVBD 1TZYB 5BNVA 1B6WA 3AZKA 5AV8A 5B0YC 3REKD 1P3MB 3UTBC 3C1CD 4ZUXB 4XUJD 5AV6C 3W96D 3REIB 2RVQD 5E5AA 4J8XD 5BS7C 4Z5TB 1ID3D 3TU4B 3MVDB 4J8VA 1KX5A 2F8NK 5BNXB 2Y2MA 4QLCD 1Z2CB 3W97B 3LELB 3LZ0B 5CPKB 4YS3C 3W99D 5DNNA 4AWLB 4H9OB 3AZEA 3X1VD 1P3IC 5JRGC 1F66C 5AVCB 5B32B 4KGCD 3AL0C 3NQUB 4E44A 3B6GA 4WU8A 1TAFB 2HIOB 1KX4A 1KX3A 4KUDD 3AZGD 1R4VA 3AZMD 5DNMA 1F1EA 3AFAB 3WKJA 4H9NB 3X1TC 4WJ3C 5CP6B 3X1TD 1P3GA 2Y2PA 1M19B 1U35D 3KUYB 1P3OA 3WA9C 2J8PA 3B0DC 5AV5C 3AZFA 3WA9D 1ZLAC 2AROC 1M18C 4J8UB 1ULYA 5AV5D 3AZKC 4Z66B 1P3PC 5B1MD 5AY8C 5AV9B 1P3PD 4ZBJC 5AY8D 1H3OB 3B6FA 5B1LB 1S32C 5B40A 3MNND 5E5AC 3UT9D 5B24A 2G5IC 1S32D 3EPHA 1TZYD 4J8VC 5B0YB 4H9RB 1P3MD 1HTAA 3R45B 2DQNC 2UWXA 4H9PB 3UTBB 2FFFB 4ZUXD 4DQYB 4EO5C 2NQBB 5AV6B 3UTAA 3A1KA 1P3FA 1B67A 2BYMA 2XD5A 3AZHA 5DNNC 4Z5TD 3TU4D 3MVDD 5CPJA 3VH5W 3X1UA 5BO0A 3B6GC 3O62A 4WNNA 4AWLC 3W97D 3LELD 2CWEA 3MGPA 5CPKD 5GT3A 3A6NA 4YS3B 5KDMB 1P3IB 5JRGB 1F66B 5B32D 5AVCD 3MGRA 2G5HC 4H9SC 5G49A 3MGQC 4G92C 1PZRA 2JCHA 3MGSA 3REKA 5B2JB 2HIOD 3B0CW 3V9RA 4E45A 3NQJA 5CP6D 1M19D 4WU9B 2JE5A 3WA9B 3B6FC 4JJNA 4LD9B 3B0DB 5B24C 1ZLAB 2AROB 4J8UD 1M18B 4YM6C 3AZKB 3VH6T 5GSUA 5AV8B 5AV9C 2Y2HA 4YM6D 3X1VA 3KXBC 5AV9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZQ C;  3KXB D;  1P34 A;  1P3F C;  3AZL C;  3REH A;  3KWQ A;  1S32 B;  4CSR A;  3LZ1 C;  5E5A B;  3AZL D;  4NFT A;  4KUD A;  3WTP A;  2BYK A;  3LZ1 D;  3AZG A;  3AZM A;  4J8V B;  4UUZ A;  3WAA C;  5B0Y D;  3W98 A;  2NQB C;  5B2I A;  3UTB D;  1EQZ A;  3AZJ A;  4EO5 B;  5AV6 D;  2NQB D;  5B33 C;  3AV2 A;  1M1A A;  1HQ3 A;  2LY8 A;  5B33 D;  1P3A A;  3AZN C;  5DNN B;  3AZI A;  2YFV A;  3MGR C;  4NE6 A;  3B6G B;  2F8N G;  2CV5 A;  4WU8 B;  2YFW A;  5CPI A;  1KX3 B;  3WTP E;  5DNM B;  4X23 A;  5F99 A;  4YS3 D;  2PYO A;  1Q9C A;  5FUG B;  3WKJ B;  3MNN A;  3AYW A;  1P3I D;  5JRG D;  1F66 D;  1P3B A;  3REJ A;  1TZY A;  5B2J C;  3MGQ B;  4J8W C;  4G92 B;  3C1B C;  1P3O B;  4JJN C;  1AOI C;  5B2J D;  4J8W D;  3X1S C;  3AZF B;  1AOI D;  5C3I C;  2FJ7 A;  3VH6 A;  1P3L A;  3REI A;  1BH9 B;  5GSU C;  4R8P A;  4WU9 C;  2F8N A;  4Z5T A;  5B31 A;  4WU9 D;  3MVD A;  4LD9 C;  1P3K C;  3KSY A;  3B6F B;  5B0Z A;  5B40 B;  4LD9 D;  1ZLA D;  5B24 B;  2ARO D;  1M18 D;  5GT0 A;  5AV8 C;  3WTP C;  5GXQ A;  4YM6 B;  3LZ0 A;  3AZK D;  1JFI B;  5AV8 D;  3W98 C;  5B2I C;  4HGA C;  1EQZ C;  3KXB B;  3AZJ C;  1N1J A;  2NZD A;  3AV2 C;  1M1A C;  4XZQ B;  1P3F B;  1HQ3 C;  3AZL B;  2BYM B;  3AZH B;  5E5A D;  3LZ1 B;  1A7W A;  1KX5 C;  3AZI C;  4M6B A;  4Z2M H;  4J8V D;  5CPJ B;  3WAA B;  3AFA A;  4CAY A;  5BO0 B;  3LJA A;  5B33 B;  3REL A;  3AZE C;  4X23 C;  3KUY A;  5GT3 B;  5DNN D;  3AZN B;  3AN2 A;  4WV4 B;  3AZE D;  2F8N H;  4H9Q A;  4J8U A;  1P3B C;  3MGR B;  3REJ C;  5G49 B;  4WU8 C;  2JSS A;  1KX4 C;  4Z66 A;  1KX3 C;  3B6G D;  3AV1 A;  4WU8 D;  1KX4 D;  5DNM C;  1KX3 D;  4NE5 A;  3V9R B;  4G91 C;  3WKJ C;  5DNM D;  1P3L C;  5BT1 C;  5B1L A;  3WKJ D;  4R8P C;  1P3G C;  5AVB A;  1KU5 A;  1P3O C;  3MGQ D;  4J8W B;  3C1B B;  1P3O D;  3AZF C;  2IO5 C;  4H9R A;  3C1C A;  4JJN B;  4XUJ A;  3X1S B;  5B0Z C;  3R45 A;  1AOI B;  3AZF D;  5GT0 C;  3W96 A;  5C3I B;  5GXQ C;  5GSU B;  4J8X A;  1ID3 A;  5JA4 A;  3VH5 T;  2NZD C;  5B40 C;  1P3K B;  1P34 B;  3B6F D;  3REH B;  5B40 D;  4QLC A;  5BNV B;  5B24 D;  3WTP B;  2BYK B;  3W99 A;  4UUZ B;  4KHA A;  3LJA C;  5KDM A;  3UTA C;  5B2I B;  3W98 B;  4HGA B;  4KGC A;  1EQZ B;  1F66 A;  3AZJ B;  3AZH C;  3REL C;  4XZQ D;  3AV2 B;  1P3F D;  3B0C T;  1HQ3 B;  1M1A B;  3AZH D;  1P3A B;  3AN2 C;  5CPJ C;  1KX5 B;  3AZI B;  3X1U C;  2YFV B;  5CPJ D;  3O62 C;  3WAA D;  3AV1 C;  4Z2M G;  3X1T A;  2CV5 B;  5CPI B;  1U35 A;  3MGP C;  5GT3 C;  3A6N C;  3AZE B;  4X23 B;  3WA9 A;  5GT3 D;  3A6N D;  3AZN D;  2PYO B;  5AV5 A;  5AVB C;  1BH8 A;  3MGS C;  1P3B B;  3MGR D;  3REK C;  3REJ B;  5B1M A;  1KX4 B;  5B31 G;  3MGS D;  3C1C C;  1P3P A;  4XUJ C;  5AY8 A;  4G91 B;  4NE3 A;  3W96 C;  2FJ7 B;  1P3L B;  2RVQ C;  4WZS B;  3UT9 A;  3VH5 A;  1S32 A;  4J8X C;  4R8P B;  1ID3 C;  1P3G B;  1WWI A;  2F8N B;  5B31 B;  2HUE C;  1P3M A;  5B32 G;  3C1B D;  4JJN D;  2IO5 B;  4ZUX A;  3X1S D;  5B0Z B;  4QLC C;  5GT0 B;  3W99 C;  5GXQ B;  3X1V C;  5GSU D;  3TU4 A;  4KGC C;  1P34 C;  5BNX A;  3REH C;  1N1J B;  3KWQ C;  2NZD B;  1P3K D;  2L5A A;  1P34 D;  3REH D;  4KUD C;  3KWQ D;  3AZG C;  3AZM C;  3W97 A;  3LEL A;  5CHL B;  5CPK A;  3WTP D;  4H9O A;  4CAY B;  3LJA B;  5FUG A;  5B32 A;  5AVC A;  5B2I D;  3UTA B;  3W98 D;  3NQU A;  1EQZ D;  1U35 C;  3AZJ D;  4H9S A;  3REL B;  3MGQ A;  3AV2 D;  1TAF A;  2HIO A;  1HQ3 D;  1P3A C;  1M1A D;  1P3A D;  3AN2 B;  1KX5 D;  4H9Q B;  3AZI D;  3X1U B;  4H9N A;  3O62 B;  5B1M C;  2CV5 C;  5CP6 A;  5CPI C;  1BH9 A;  4WNN B;  3AV1 B;  2CV5 D;  1M19 A;  5CPI D;  5F99 C;  3MGP B;  2PYO C;  3A6N B;  4X23 D;  3MNN C;  3UT9 C;  3AYW C;  5F99 D;  2PYO D;  4DRB A;  3AYW D;  1TZY C;  5AVB B;  3B0B A;  3MGS B;  1P3B D;  3REJ D;  3REK B;  1P3M C;  4YM6 A;  1JFI A;  5AV9 A;  4ZUX C;  3C1C B;  4XUJ B;  2FJ7 C;  3KXB A;  1H3O A;  3REI C;  3W96 B;  2FJ7 D;  1P3L D;  4XZQ A;  3NQJ B;  5BT1 D;  3AZL A;  3REI D;  4Z5T C;  4R8P D;  4J8X B;  5B31 C;  3LZ1 A;  3TU4 C;  3MVD C;  5JA4 B;  1P3G D;  1ID3 B;  1BFM A;  2F8N D;  5B0Y A;  5B31 D;  2HUE B;  3WAA A;  4H9P A;  3UTB A;  2NQB A;  5AV6 A;  5B0Z D;  4QLC B;  3W97 C;  3LEL C;  5GT0 D;  3LZ0 C;  5CPK C;  5B33 A;  3W99 B;  5GXQ D;  3LZ0 D;  3X1V B;  3VH6 W;  4KHA B;  5BS7 A;  5B32 C;  5AVC C;  3AZN A;  4KGC B;  2NZD D;  3KWQ B;  4CSR B;  2HIO C;  4KUD B;  3AZG B;  3AZM B;  3AFA C;  4YS3 A;  1WWS A;  1P3I A;  5CP6 C;  5JRG A;  3AFA D;  3LJA D;  3UTA D;  3X1T B;  1M19 C;  3KUY C;  1U35 B;  3REL D;  5B2J A;  4J8W A;  3KUY D;  3C1B A;  4J8U C;  3AN2 D;  3X1S A;  1AOI A;  5AV5 B;  1BH8 B;  3X1U D;  4Z66 C;  3O62 D;  5B1M B;  4Z66 D;  2YFW B;  3AV1 D;  4DRA A;  1P3P B;  4WU9 A;  5AY8 B;  3MGP D;  5F99 B;  4ZBJ B;  5B1L C;  4LD9 A;  3MNN B;  3AYW B;  3UT9 B;  1P3K A;  1ZLA A;  2ARO A;  1M18 A;  5B1L D;  5AVB D;  1TZY B;  5BNV A;  1B6W A;  3AZK A;  5AV8 A;  5B0Y C;  3REK D;  1P3M B;  3UTB C;  3C1C D;  4ZUX B;  4XUJ D;  5AV6 C;  3W96 D;  3REI B;  2RVQ D;  5E5A A;  4J8X D;  5BS7 C;  4Z5T B;  1ID3 D;  3TU4 B;  3MVD B;  4J8V A;  1KX5 A;  2F8N K;  5BNX B;  4QLC D;  3W97 B;  3LEL B;  3LZ0 B;  5CPK B;  4YS3 C;  3W99 D;  5DNN A;  4AWL B;  4H9O B;  3AZE A;  3X1V D;  1P3I C;  5JRG C;  1F66 C;  5AVC B;  5B32 B;  4KGC D;  3NQU B;  4E44 A;  3B6G A;  4WU8 A;  1TAF B;  2HIO B;  1KX4 A;  1KX3 A;  4KUD D;  3AZG D;  1R4V A;  3AZM D;  5DNM A;  1F1E A;  3AFA B;  3WKJ A;  4H9N B;  3X1T C;  5CP6 B;  3X1T D;  1P3G A;  1M19 B;  1U35 D;  3KUY B;  1P3O A;  3WA9 C;  3B0D C;  5AV5 C;  3AZF A;  3WA9 D;  1ZLA C;  2ARO C;  1M18 C;  4J8U B;  1ULY A;  5AV5 D;  3AZK C;  4Z66 B;  1P3P C;  5B1M D;  5AY8 C;  5AV9 B;  1P3P D;  4ZBJ C;  5AY8 D;  1H3O B;  3B6F A;  5B1L B;  1S32 C;  5B40 A;  3MNN D;  5E5A C;  3UT9 D;  5B24 A;  1S32 D;  1TZY D;  4J8V C;  5B0Y B;  4H9R B;  1P3M D;  1HTA A;  3R45 B;  4H9P B;  3UTB B;  4ZUX D;  4EO5 C;  2NQB B;  5AV6 B;  3UTA A;  1P3F A;  1B67 A;  2BYM A;  3AZH A;  5DNN C;  4Z5T D;  3TU4 D;  3MVD D;  5CPJ A;  3VH5 W;  3X1U A;  5BO0 A;  3B6G C;  3O62 A;  4WNN A;  4AWL C;  3W97 D;  3LEL D;  2CWE A;  3MGP A;  5CPK D;  5GT3 A;  3A6N A;  4YS3 B;  5KDM B;  1P3I B;  5JRG B;  1F66 B;  5B32 D;  5AVC D;  3MGR A;  4H9S C;  5G49 A;  3MGQ C;  4G92 C;  3MGS A;  3REK A;  5B2J B;  2HIO D;  3B0C W;  3V9R A;  4E45 A;  3NQJ A;  5CP6 D;  1M19 D;  4WU9 B;  3WA9 B;  3B6F C;  4JJN A;  4LD9 B;  3B0D B;  5B24 C;  1ZLA B;  2ARO B;  4J8U D;  1M18 B;  4YM6 C;  3AZK B;  3VH6 T;  5GSU A;  5AV8 B;  5AV9 C;  4YM6 D;  3X1V A;  3KXB C;  5AV9 D; 
#chains in the Genus database with same CATH topology
 4XZQ C;  3KXB D;  1P34 A;  1P3F C;  3AZL C;  3REH A;  3KWQ A;  1S32 B;  4CSR A;  3LZ1 C;  5E5A B;  3AZL D;  4NFT A;  4KUD A;  3WTP A;  2BYK A;  3LZ1 D;  3AZG A;  3AZM A;  4J8V B;  4UUZ A;  3WAA C;  5B0Y D;  3W98 A;  2NQB C;  5B2I A;  3UTB D;  2Y2J A;  1EQZ A;  3AZJ A;  4EO5 B;  5AV6 D;  2NQB D;  5B33 C;  3AV2 A;  1M1A A;  2ZY5 A;  1HQ3 A;  2LY8 A;  5B33 D;  1P3A A;  3AZN C;  5DNN B;  3AZI A;  2YFV A;  3MGR C;  2VQR A;  4NE6 A;  3B6G B;  2F8N G;  2CV5 A;  4WU8 B;  2YFW A;  5CPI A;  1KX3 B;  3WTP E;  5DNM B;  4X23 A;  5F99 A;  4YS3 D;  2PYO A;  1Q9C A;  3EG5 B;  5FUG B;  3IP4 C;  3MNN A;  3AYW A;  1P3I D;  3WKJ B;  5JRG D;  1F66 D;  1P3B A;  3REJ A;  1TZY A;  5B2J C;  3MGQ B;  4J8W C;  4G92 B;  3C1B C;  1P3O B;  4JJN C;  1AOI C;  5B2J D;  4J8W D;  3X1S C;  3AZF B;  1AOI D;  5C3I C;  2FJ7 A;  3VH6 A;  1P3L A;  3REI A;  1BH9 B;  5GSU C;  4R8P A;  4WU9 C;  3FDD A;  2F8N A;  4Z5T A;  5B31 A;  4WU9 D;  3MVD A;  3H0L C;  4LD9 C;  1P3K C;  3KSY A;  3B6F B;  3KFU G;  5B0Z A;  5B40 B;  4LD9 D;  1ZLA D;  5B24 B;  2ARO D;  1M18 D;  5GT0 A;  5AV8 C;  3WTP C;  5GXQ A;  4YM6 B;  3LZ0 A;  3AZK D;  1JFI B;  5AV8 D;  3W98 C;  5B2I C;  4HGA C;  1EQZ C;  3KXB B;  3AZJ C;  1N1J A;  2NZD A;  3AV2 C;  1M1A C;  4XZQ B;  1P3F B;  1HQ3 C;  3AZL B;  1T3U A;  2BYM B;  3AZH B;  5E5A D;  2Y2Q A;  3LZ1 B;  1A7W A;  1KX5 C;  3AZI C;  4UPK A;  4M6B A;  4Z2M H;  4J8V D;  5CPJ B;  3WAA B;  3AFA A;  4CAY A;  5BO0 B;  3LJA A;  5B33 B;  3REL A;  3AZE C;  4X23 C;  3KUY A;  5GT3 B;  5DNN D;  3AZN B;  3AN2 A;  4WV4 B;  3AZE D;  2F8N H;  4H9Q A;  2ZY3 A;  4J8U A;  1P3B C;  3MGR B;  3REJ C;  5G49 B;  4WU8 C;  2JSS A;  1KX4 C;  4Z66 A;  1KX3 C;  3B6G D;  3AV1 A;  4WU8 D;  1KX4 D;  5DNM C;  1KX3 D;  4NE5 A;  3V9R B;  4G91 C;  3WKJ C;  5DNM D;  1P3L C;  2Y2I A;  5BT1 C;  5B1L A;  3WKJ D;  4R8P C;  2F2A C;  1P3G C;  5AVB A;  1KU5 A;  1P3O C;  3MGQ D;  4J8W B;  3C1B B;  1P3O D;  3AZF C;  2IO5 C;  4H9R A;  3C1C A;  4JJN B;  4XUJ A;  3X1S B;  5B0Z C;  3R45 A;  1AOI B;  3AZF D;  5GT0 C;  3W96 A;  5C3I B;  5GXQ C;  5GSU B;  4J8X A;  1ID3 A;  5JA4 A;  3VH5 T;  2NZD C;  5B40 C;  1P3K B;  1P34 B;  3B6F D;  3REH B;  5B40 D;  4QLC A;  5BNV B;  5B24 D;  3WTP B;  2BYK B;  3W99 A;  4UUZ B;  4KHA A;  3LJA C;  5KDM A;  3UTA C;  5B2I B;  2Y2L A;  4HGA B;  3W98 B;  4KGC A;  1EQZ B;  1F66 A;  3AZJ B;  3AZH C;  3REL C;  4XZQ D;  3AV2 B;  1P3F D;  3B0C T;  1HQ3 B;  1M1A B;  3AZH D;  1P3A B;  3AN2 C;  5CPJ C;  1KX5 B;  3AZI B;  3X1U C;  2YFV B;  5CPJ D;  3O62 C;  3WAA D;  3AV1 C;  4Z2M G;  3X1T A;  2CV5 B;  5CPI B;  1U35 A;  3MGP C;  5GT3 C;  2Y2K A;  3A6N C;  3F6T A;  3AZE B;  4X23 B;  3WA9 A;  5GT3 D;  3A6N D;  3AZN D;  2PYO B;  5AV5 A;  5AVB C;  1BH8 A;  3MGS C;  1P3B B;  3MGR D;  3REK C;  3REJ B;  5B1M A;  1KX4 B;  5B31 G;  3MGS D;  3H0R C;  3C1C C;  2XD1 A;  4XUJ C;  5AY8 A;  1P3P A;  4G91 B;  4NE3 A;  3W96 C;  2FJ7 B;  1P3L B;  2RVQ C;  4WZS B;  3UT9 A;  2ZM5 A;  3EPL A;  3VH5 A;  1S32 A;  4J8X C;  4R8P B;  1ID3 C;  1P3G B;  1WWI A;  2F8N B;  5B31 B;  2HUE C;  1P3M A;  5B32 G;  3C1B D;  4JJN D;  2IO5 B;  4ZUX A;  3X1S D;  5B0Z B;  4QLC C;  5GT0 B;  3W99 C;  5GXQ B;  3X1V C;  5GSU D;  3TU4 A;  4KGC C;  1P34 C;  5BNX A;  3REH C;  1N1J B;  1W2E A;  3KWQ C;  2NZD B;  1P3K D;  2L5A A;  1P34 D;  3REH D;  4KUD C;  3KWQ D;  3AZG C;  3AZM C;  3W97 A;  3LEL A;  5CHL B;  5CPK A;  3H0M C;  2Y2O A;  3WTP D;  4H9O A;  4CAY B;  3LJA B;  5FUG A;  5B32 A;  5AVC A;  5B2I D;  3UTA B;  3W98 D;  3NQU A;  1EQZ D;  1U35 C;  3AZJ D;  4H9S A;  3REL B;  3MGQ A;  3AV2 D;  1TAF A;  2HIO A;  1HQ3 D;  1P3A C;  1M1A D;  1P3A D;  3AN2 B;  2ZY4 A;  1KX5 D;  2ZY2 A;  4H9Q B;  3AZI D;  3X1U B;  4H9N A;  3O62 B;  5B1M C;  2CV5 C;  3EPJ A;  5CP6 A;  5CPI C;  1BH9 A;  4WNN B;  3AV1 B;  2CV5 D;  1M19 A;  5CPI D;  5F99 C;  3MGP B;  2PYO C;  3A6N B;  4X23 D;  3MNN C;  3UT9 C;  3AYW C;  5F99 D;  2PYO D;  4DRB A;  3AYW D;  1TZY C;  5AVB B;  3B0B A;  3MGS B;  1P3B D;  3REJ D;  3REK B;  1P3M C;  4YM6 A;  1JFI A;  5AV9 A;  4ZUX C;  3C1C B;  4XUJ B;  2FJ7 C;  3KXB A;  1H3O A;  3REI C;  3W96 B;  2FJ7 D;  1P3L D;  4XZQ A;  2RIQ A;  3NQJ B;  5BT1 D;  3AZL A;  3REI D;  4Z5T C;  4R8P D;  4J8X B;  5B31 C;  3LZ1 A;  3TU4 C;  3MVD C;  5JA4 B;  1P3G D;  1ID3 B;  1BFM A;  2F8N D;  2Y2N A;  5B0Y A;  5B31 D;  2HUE B;  3WAA A;  4H9P A;  3UTB A;  2NQB A;  5AV6 A;  5B0Z D;  4QLC B;  3W97 C;  3LEL C;  5GT0 D;  3LZ0 C;  5CPK C;  5B33 A;  3W99 B;  5GXQ D;  3LZ0 D;  3X1V B;  3VH6 W;  4KHA B;  5BS7 A;  5B32 C;  5AVC C;  3AZN A;  4KGC B;  2NZD D;  3KWQ B;  4CSR B;  2W8S A;  2HIO C;  4KUD B;  3AZG B;  2BG1 A;  3AZM B;  3AFA C;  4YS3 A;  1WWS A;  1P3I A;  5CP6 C;  5JRG A;  3AFA D;  3EPK A;  3LJA D;  3UTA D;  3X1T B;  3P5J B;  1M19 C;  3KUY C;  1U35 B;  3A1I A;  3REL D;  5B2J A;  4J8W A;  3KUY D;  3C1B A;  4J8U C;  3AN2 D;  3X1S A;  1AOI A;  5AV5 B;  1BH8 B;  3X1U D;  4Z66 C;  2Y2G A;  3O62 D;  5B1M B;  2YFW B;  4Z66 D;  3AV1 D;  4DRA A;  1P3P B;  4WU9 A;  2DF4 C;  5AY8 B;  3MGP D;  5F99 B;  4ZBJ B;  5B1L C;  4LD9 A;  3MNN B;  3AYW B;  3UT9 B;  1P3K A;  1ZLA A;  2ARO A;  1M18 A;  5B1L D;  5AVB D;  1TZY B;  5BNV A;  1B6W A;  3AZK A;  5AV8 A;  5B0Y C;  3REK D;  1P3M B;  3UTB C;  3C1C D;  4ZUX B;  4XUJ D;  5AV6 C;  3W96 D;  3REI B;  2RVQ D;  5E5A A;  4J8X D;  5BS7 C;  4Z5T B;  1ID3 D;  3TU4 B;  3MVD B;  4J8V A;  1KX5 A;  2F8N K;  5BNX B;  2Y2M A;  4QLC D;  1Z2C B;  3W97 B;  3LEL B;  3LZ0 B;  5CPK B;  4YS3 C;  3W99 D;  5DNN A;  4AWL B;  4H9O B;  3AZE A;  3X1V D;  1P3I C;  5JRG C;  1F66 C;  5AVC B;  5B32 B;  4KGC D;  3AL0 C;  3NQU B;  4E44 A;  3B6G A;  4WU8 A;  1TAF B;  2HIO B;  1KX4 A;  1KX3 A;  4KUD D;  3AZG D;  1R4V A;  3AZM D;  5DNM A;  1F1E A;  3AFA B;  3WKJ A;  4H9N B;  3X1T C;  4WJ3 C;  5CP6 B;  3X1T D;  1P3G A;  2Y2P A;  1M19 B;  1U35 D;  3KUY B;  1P3O A;  3WA9 C;  2J8P A;  3B0D C;  5AV5 C;  3AZF A;  3WA9 D;  1ZLA C;  2ARO C;  1M18 C;  4J8U B;  1ULY A;  5AV5 D;  3AZK C;  4Z66 B;  1P3P C;  5B1M D;  5AY8 C;  5AV9 B;  1P3P D;  4ZBJ C;  5AY8 D;  1H3O B;  3B6F A;  5B1L B;  1S32 C;  5B40 A;  3MNN D;  5E5A C;  3UT9 D;  5B24 A;  2G5I C;  1S32 D;  3EPH A;  1TZY D;  4J8V C;  5B0Y B;  4H9R B;  1P3M D;  1HTA A;  3R45 B;  2DQN C;  2UWX A;  4H9P B;  3UTB B;  2FFF B;  4ZUX D;  4DQY B;  4EO5 C;  2NQB B;  5AV6 B;  3UTA A;  3A1K A;  1P3F A;  1B67 A;  2BYM A;  2XD5 A;  3AZH A;  5DNN C;  4Z5T D;  3TU4 D;  3MVD D;  5CPJ A;  3VH5 W;  3X1U A;  5BO0 A;  3B6G C;  3O62 A;  4WNN A;  4AWL C;  3W97 D;  3LEL D;  2CWE A;  3MGP A;  5CPK D;  5GT3 A;  3A6N A;  4YS3 B;  5KDM B;  1P3I B;  5JRG B;  1F66 B;  5B32 D;  5AVC D;  3MGR A;  2G5H C;  4H9S C;  5G49 A;  3MGQ C;  4G92 C;  1PZR A;  2JCH A;  3MGS A;  3REK A;  5B2J B;  2HIO D;  3B0C W;  3V9R A;  4E45 A;  3NQJ A;  5CP6 D;  1M19 D;  4WU9 B;  2JE5 A;  3WA9 B;  3B6F C;  4JJN A;  4LD9 B;  3B0D B;  5B24 C;  1ZLA B;  2ARO B;  4J8U D;  1M18 B;  4YM6 C;  3AZK B;  3VH6 T;  5GSU A;  5AV8 B;  5AV9 C;  2Y2H A;  4YM6 D;  3X1V A;  3KXB C;  5AV9 D; 
#chains in the Genus database with same CATH homology
 4XZQ C;  3KXB D;  1P34 A;  1P3F C;  3AZL C;  3REH A;  3KWQ A;  1S32 B;  4CSR A;  3LZ1 C;  5E5A B;  3AZL D;  4NFT A;  4KUD A;  3WTP A;  2BYK A;  3LZ1 D;  3AZG A;  3AZM A;  4J8V B;  4UUZ A;  3WAA C;  5B0Y D;  3W98 A;  2NQB C;  5B2I A;  3UTB D;  2Y2J A;  1EQZ A;  3AZJ A;  4EO5 B;  5AV6 D;  2NQB D;  5B33 C;  3AV2 A;  1M1A A;  2ZY5 A;  1HQ3 A;  2LY8 A;  5B33 D;  1P3A A;  3AZN C;  5DNN B;  3AZI A;  2YFV A;  3MGR C;  2VQR A;  4NE6 A;  3B6G B;  2F8N G;  2CV5 A;  4WU8 B;  2YFW A;  5CPI A;  1KX3 B;  3WTP E;  5DNM B;  4X23 A;  5F99 A;  4YS3 D;  2PYO A;  1Q9C A;  3EG5 B;  5FUG B;  3IP4 C;  3MNN A;  3AYW A;  1P3I D;  3WKJ B;  5JRG D;  1F66 D;  1P3B A;  3REJ A;  1TZY A;  5B2J C;  3MGQ B;  4J8W C;  4G92 B;  3C1B C;  1P3O B;  4JJN C;  1AOI C;  5B2J D;  4J8W D;  3X1S C;  3AZF B;  1AOI D;  5C3I C;  2FJ7 A;  3VH6 A;  1P3L A;  3REI A;  1BH9 B;  5GSU C;  4R8P A;  4WU9 C;  3FDD A;  2F8N A;  4Z5T A;  5B31 A;  4WU9 D;  3MVD A;  3H0L C;  4LD9 C;  1P3K C;  3KSY A;  3B6F B;  3KFU G;  5B0Z A;  5B40 B;  4LD9 D;  1ZLA D;  5B24 B;  2ARO D;  1M18 D;  5GT0 A;  5AV8 C;  3WTP C;  5GXQ A;  4YM6 B;  3LZ0 A;  3AZK D;  1JFI B;  5AV8 D;  3W98 C;  5B2I C;  4HGA C;  1EQZ C;  3KXB B;  3AZJ C;  1N1J A;  2NZD A;  3AV2 C;  1M1A C;  4XZQ B;  1P3F B;  1HQ3 C;  3AZL B;  1T3U A;  2BYM B;  3AZH B;  5E5A D;  2Y2Q A;  3LZ1 B;  1A7W A;  1KX5 C;  3AZI C;  4UPK A;  4M6B A;  4Z2M H;  4J8V D;  5CPJ B;  3WAA B;  3AFA A;  4CAY A;  5BO0 B;  3LJA A;  5B33 B;  3REL A;  3AZE C;  4X23 C;  3KUY A;  5GT3 B;  5DNN D;  3AZN B;  3AN2 A;  4WV4 B;  3AZE D;  2F8N H;  4H9Q A;  2ZY3 A;  4J8U A;  1P3B C;  3MGR B;  3REJ C;  5G49 B;  4WU8 C;  2JSS A;  1KX4 C;  4Z66 A;  1KX3 C;  3B6G D;  3AV1 A;  4WU8 D;  1KX4 D;  5DNM C;  1KX3 D;  4NE5 A;  3V9R B;  4G91 C;  3WKJ C;  5DNM D;  1P3L C;  2Y2I A;  5BT1 C;  5B1L A;  3WKJ D;  4R8P C;  2F2A C;  1P3G C;  5AVB A;  1KU5 A;  1P3O C;  3MGQ D;  4J8W B;  3C1B B;  1P3O D;  3AZF C;  2IO5 C;  4H9R A;  3C1C A;  4JJN B;  4XUJ A;  3X1S B;  5B0Z C;  3R45 A;  1AOI B;  3AZF D;  5GT0 C;  3W96 A;  5C3I B;  5GXQ C;  5GSU B;  4J8X A;  1ID3 A;  5JA4 A;  3VH5 T;  2NZD C;  5B40 C;  1P3K B;  1P34 B;  3B6F D;  3REH B;  5B40 D;  4QLC A;  5BNV B;  5B24 D;  3WTP B;  2BYK B;  3W99 A;  4UUZ B;  4KHA A;  3LJA C;  5KDM A;  3UTA C;  5B2I B;  2Y2L A;  4HGA B;  3W98 B;  4KGC A;  1EQZ B;  1F66 A;  3AZJ B;  3AZH C;  3REL C;  4XZQ D;  3AV2 B;  1P3F D;  3B0C T;  1HQ3 B;  1M1A B;  3AZH D;  1P3A B;  3AN2 C;  5CPJ C;  1KX5 B;  3AZI B;  3X1U C;  2YFV B;  5CPJ D;  3O62 C;  3WAA D;  3AV1 C;  4Z2M G;  3X1T A;  2CV5 B;  5CPI B;  1U35 A;  3MGP C;  5GT3 C;  2Y2K A;  3A6N C;  3F6T A;  3AZE B;  4X23 B;  3WA9 A;  5GT3 D;  3A6N D;  3AZN D;  2PYO B;  5AV5 A;  5AVB C;  1BH8 A;  3MGS C;  1P3B B;  3MGR D;  3REK C;  3REJ B;  5B1M A;  1KX4 B;  5B31 G;  3MGS D;  3H0R C;  3C1C C;  2XD1 A;  4XUJ C;  5AY8 A;  1P3P A;  4G91 B;  4NE3 A;  3W96 C;  2FJ7 B;  1P3L B;  2RVQ C;  4WZS B;  3UT9 A;  2ZM5 A;  3EPL A;  3VH5 A;  1S32 A;  4J8X C;  4R8P B;  1ID3 C;  1P3G B;  1WWI A;  2F8N B;  5B31 B;  2HUE C;  1P3M A;  5B32 G;  3C1B D;  4JJN D;  2IO5 B;  4ZUX A;  3X1S D;  5B0Z B;  4QLC C;  5GT0 B;  3W99 C;  5GXQ B;  3X1V C;  5GSU D;  3TU4 A;  4KGC C;  1P34 C;  5BNX A;  3REH C;  1N1J B;  1W2E A;  3KWQ C;  2NZD B;  1P3K D;  2L5A A;  1P34 D;  3REH D;  4KUD C;  3KWQ D;  3AZG C;  3AZM C;  3W97 A;  3LEL A;  5CHL B;  5CPK A;  3H0M C;  2Y2O A;  3WTP D;  4H9O A;  4CAY B;  3LJA B;  5FUG A;  5B32 A;  5AVC A;  5B2I D;  3UTA B;  3W98 D;  3NQU A;  1EQZ D;  1U35 C;  3AZJ D;  4H9S A;  3REL B;  3MGQ A;  3AV2 D;  1TAF A;  2HIO A;  1HQ3 D;  1P3A C;  1M1A D;  1P3A D;  3AN2 B;  2ZY4 A;  1KX5 D;  2ZY2 A;  4H9Q B;  3AZI D;  3X1U B;  4H9N A;  3O62 B;  5B1M C;  2CV5 C;  3EPJ A;  5CP6 A;  5CPI C;  1BH9 A;  4WNN B;  3AV1 B;  2CV5 D;  1M19 A;  5CPI D;  5F99 C;  3MGP B;  2PYO C;  3A6N B;  4X23 D;  3MNN C;  3UT9 C;  3AYW C;  5F99 D;  2PYO D;  4DRB A;  3AYW D;  1TZY C;  5AVB B;  3B0B A;  3MGS B;  1P3B D;  3REJ D;  3REK B;  1P3M C;  4YM6 A;  1JFI A;  5AV9 A;  4ZUX C;  3C1C B;  4XUJ B;  2FJ7 C;  3KXB A;  1H3O A;  3REI C;  3W96 B;  2FJ7 D;  1P3L D;  4XZQ A;  2RIQ A;  3NQJ B;  5BT1 D;  3AZL A;  3REI D;  4Z5T C;  4R8P D;  4J8X B;  5B31 C;  3LZ1 A;  3TU4 C;  3MVD C;  5JA4 B;  1P3G D;  1ID3 B;  1BFM A;  2F8N D;  2Y2N A;  5B0Y A;  5B31 D;  2HUE B;  3WAA A;  4H9P A;  3UTB A;  2NQB A;  5AV6 A;  5B0Z D;  4QLC B;  3W97 C;  3LEL C;  5GT0 D;  3LZ0 C;  5CPK C;  5B33 A;  3W99 B;  5GXQ D;  3LZ0 D;  3X1V B;  3VH6 W;  4KHA B;  5BS7 A;  5B32 C;  5AVC C;  3AZN A;  4KGC B;  2NZD D;  3KWQ B;  4CSR B;  2W8S A;  2HIO C;  4KUD B;  3AZG B;  2BG1 A;  3AZM B;  3AFA C;  4YS3 A;  1WWS A;  1P3I A;  5CP6 C;  5JRG A;  3AFA D;  3EPK A;  3LJA D;  3UTA D;  3X1T B;  3P5J B;  1M19 C;  3KUY C;  1U35 B;  3A1I A;  3REL D;  5B2J A;  4J8W A;  3KUY D;  3C1B A;  4J8U C;  3AN2 D;  3X1S A;  1AOI A;  5AV5 B;  1BH8 B;  3X1U D;  4Z66 C;  2Y2G A;  3O62 D;  5B1M B;  2YFW B;  4Z66 D;  3AV1 D;  4DRA A;  1P3P B;  4WU9 A;  2DF4 C;  5AY8 B;  3MGP D;  5F99 B;  4ZBJ B;  5B1L C;  4LD9 A;  3MNN B;  3AYW B;  3UT9 B;  1P3K A;  1ZLA A;  2ARO A;  1M18 A;  5B1L D;  5AVB D;  1TZY B;  5BNV A;  1B6W A;  3AZK A;  5AV8 A;  5B0Y C;  3REK D;  1P3M B;  3UTB C;  3C1C D;  4ZUX B;  4XUJ D;  5AV6 C;  3W96 D;  3REI B;  2RVQ D;  5E5A A;  4J8X D;  5BS7 C;  4Z5T B;  1ID3 D;  3TU4 B;  3MVD B;  4J8V A;  1KX5 A;  2F8N K;  5BNX B;  2Y2M A;  4QLC D;  1Z2C B;  3W97 B;  3LEL B;  3LZ0 B;  5CPK B;  4YS3 C;  3W99 D;  5DNN A;  4AWL B;  4H9O B;  3AZE A;  3X1V D;  1P3I C;  5JRG C;  1F66 C;  5AVC B;  5B32 B;  4KGC D;  3AL0 C;  3NQU B;  4E44 A;  3B6G A;  4WU8 A;  1TAF B;  2HIO B;  1KX4 A;  1KX3 A;  4KUD D;  3AZG D;  1R4V A;  3AZM D;  5DNM A;  1F1E A;  3AFA B;  3WKJ A;  4H9N B;  3X1T C;  4WJ3 C;  5CP6 B;  3X1T D;  1P3G A;  2Y2P A;  1M19 B;  1U35 D;  3KUY B;  1P3O A;  3WA9 C;  2J8P A;  3B0D C;  5AV5 C;  3AZF A;  3WA9 D;  1ZLA C;  2ARO C;  1M18 C;  4J8U B;  1ULY A;  5AV5 D;  3AZK C;  4Z66 B;  1P3P C;  5B1M D;  5AY8 C;  5AV9 B;  1P3P D;  4ZBJ C;  5AY8 D;  1H3O B;  3B6F A;  5B1L B;  1S32 C;  5B40 A;  3MNN D;  5E5A C;  3UT9 D;  5B24 A;  2G5I C;  1S32 D;  3EPH A;  1TZY D;  4J8V C;  5B0Y B;  4H9R B;  1P3M D;  1HTA A;  3R45 B;  2DQN C;  2UWX A;  4H9P B;  3UTB B;  2FFF B;  4ZUX D;  4DQY B;  4EO5 C;  2NQB B;  5AV6 B;  3UTA A;  3A1K A;  1P3F A;  1B67 A;  2BYM A;  2XD5 A;  3AZH A;  5DNN C;  4Z5T D;  3TU4 D;  3MVD D;  5CPJ A;  3VH5 W;  3X1U A;  5BO0 A;  3B6G C;  3O62 A;  4WNN A;  4AWL C;  3W97 D;  3LEL D;  2CWE A;  3MGP A;  5CPK D;  5GT3 A;  3A6N A;  4YS3 B;  5KDM B;  1P3I B;  5JRG B;  1F66 B;  5B32 D;  5AVC D;  3MGR A;  2G5H C;  4H9S C;  5G49 A;  3MGQ C;  4G92 C;  1PZR A;  2JCH A;  3MGS A;  3REK A;  5B2J B;  2HIO D;  3B0C W;  3V9R A;  4E45 A;  3NQJ A;  5CP6 D;  1M19 D;  4WU9 B;  2JE5 A;  3WA9 B;  3B6F C;  4JJN A;  4LD9 B;  3B0D B;  5B24 C;  1ZLA B;  2ARO B;  4J8U D;  1M18 B;  4YM6 C;  3AZK B;  3VH6 T;  5GSU A;  5AV8 B;  5AV9 C;  2Y2H A;  4YM6 D;  3X1V A;  3KXB C;  5AV9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...