5CPJC

Nucleosome containing methylated sat2r dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags "structural protein/dna
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpjC00
3C1CB 3AZIC 5B0ZC 3WKJC 4AWLB 4LD9C 3W99A 2AROB 2F8NH 3B0CT 3X1VA 4AWLC 5AV9B 5KDMB 1H3OB 1P3MD 4H9QA 1P3AB 1M1AB 1HQ3A 1P3GC 1KX3B 5AV9C 5F99B 4HGAC 3TU4D 1M1AC 3AV1D 4J8WC 4H9SA 3MGRB 5B24A 1KX3C 5F99C 4Z66D 1ZLAA 2FJ7A 3V9RB 5B2JD 3REHB 4J8VC 5B0YA 4JJNB 5B32A 3WTPE 1P3OB 3WKJD 3B6FA 4JJNC 4LD9D 3UTBD 3R45B 3W98B 3MGPB 4Z5TB 5CP6B 4WV4B 1U35B 3AV2B 1S32A 4EO5B 2YFWA 3C1BA 1P3GD 3W98C 3B6GB 5B2IA 1JFIA 5CP6C 5B31B 4J8WD 1F1EA 3AZKA 3KXBB 1M18A 5JRGC 4WU8B 3AZLB 5AV5B 1P34C 4H9OB 4J8VD 4WU8C 3AZLC 1TZYC 5AV5C 3LZ0A 3AZHA 3AN2C 3W96C 4E44A 5GT0A 3B0DC 3RELC 5BT1C 4KGCB 5AVBC 3O62A 3REJA 1ID3B 4KGCC 2F8NB 5AVCC 5CPKA 3AYWB 5FUGB 1P3BC 5B31G 4X23A 4J8XB 3KUYC 5BO0A 5GT3C 4UUZA 5JRGD 3REID 3LJAA 3AZJC 3W99B 1P34D 3C1CA 1B67A 3X1VB 1TZYD 3MVDD 2NZDB 3W99C 3KWQB 3AN2D 2AROA 3W96D 3RELD 3X1VC 5KDMA 1H3OA 5CPJD 5AVBD 1P3AA 1HQ3C 5B24B 3AZNB 3AZFA 1P3LD 2F8NG 5AVCD 3MGRA 4H9SC 1ZLAB 2FJ7B 1P3BD 5B24C 2BYKB 5B0YB 5B1LA 3KUYD 1ZLAC 2FJ7C 3REHA 5GT3D 1P3ID 4KUDA 3AZEB 3AZJD 5B0YC 5B32C 5AY8A 1P3OA 3B6FC 3R45A 5AV6A 3C1BB 2HIOD 4KHAB 3MGPA 3X1VD 1P3FA 4Z5TA 4R8PA 1JFIB 1U35A 3AV2A 1S32C 5BNVB 1HQ3D 3C1BC 3B6GA 5B2IC 5B31A 3KXBA 3AZKC 1BFMA 1M18C 4NE3A 5B1MB 1ULYA 2HUEB 3LELB 3MGSD 1ZLAD 3LZ0B 5DNMA 5B32G 4H9OA 5GT0B 2HUEC 3UT9A 3LZ0C 3O62B 3AZHC 5B32D 5GT0C 3B6FD 3O62C 1KX4A 1ID3A 5CPKB 3REJC 1M19A 3VH6A 3WA9A 1S32D 3WTPB 2F8NA 3AYWA 5CPKC 5AV8B 3C1BD 5BO0B 4UUZB 5B2ID 4J8XA 4X23C 2IO5B 4WU9B 3AZKD 1M18D 1EQZA 3LJAC 5CPIA 3C1CC 4ZUXA 3WAAB 3KWQA 2NZDA 3AZHD 2AROC 3MNNB 3UTAB 3AZFB 1P3AC 4ZBJB 3O62D 4G92B 3REJD 3AZNA 3AZFC 4J8UA 4ZBJC 4G92C 5B1LB 3MGRC 2BYKA 4X23D 4KUDB 5B1LC 2CV5B 3REHC 4YS3A 5AY8B 4CAYA 5B0ZD 3AZID 3AZEA 3LJAD 4KUDC 1R4VA 3C1CD 5AY8C 5C3IB 5AV6B 1P3OC 1P3FB 4R8PB 5JA4A 4H9PA 2AROD 5AV6C 4KHAA 1P3FC 3MGPC 5AV9D 4Z5TC 3W97B 4R8PC 1U35C 3AV2C 1P3AD 3LZ1B 1M1AD 5BNVA 2RVQC 4EO5C 2YFVA 3B6GC 1KX3D 3AZFD 5F99D 4QLCA 5B31C 3AFAA 3MGRD 5DNMB 3KXBC 4M6BA 5B1MA 3AZMA 3LELA 3UT9B 3VH6T 3REHD 5DNMC 1A7WA 1F66B 4JJND 3UT9C 3X1SB 3AZGA 1KX4B 5GXQB 1P3OD 1M19B 3WA9B 5B40A 1KX4C 1ID3C 1M19C 3W98D 3WA9C 3VH5W 3MGPD 4Z5TD 5CP6D 1U35D 3WTPA 3AV2D 1KX5B 2RVQD 5AV8A 3AYWC 3B6GD 4Z2MH 4J8XC 1EQZB 5B31D 4WU9A 3KXBD 1BH9A 5CPIB 4WU8D 1EQZC 4ZUXB 3AZLD 5AV5D 2F8NK 5CPIC 3AV1A 4ZUXC 5BT1D 3UT9D 3WAAA 4NE5A 2NZDC 3KWQC 2NQBB 2BYMB 4XZQB 3MNNA 3UTAA 4H9RB 5B33A 4KGCD 5DNNB 4J8UB 3NQJB 1ID3D 3MGQB 3WA9D 5G49A 3AZNC 4J8UC 2F8ND 4WNNB 3AYWD 2JSSA 4NE6A 3UTBA 4YS3B 4E45A 4CAYB 1B6WA 4J8XD 1P3KB 3A6NB 2CV5A 4YS3C 3AZEC 3W99D 5JA4B 4H9PB 1TAFA 2NZDD 3KWQD 5GSUB 2YFVB 3REKB 3W97A 4QLCB 3LZ1A 3AFAB 5B24D 3AZND 4QLCC 1P3PB 3AFAC 4YM6B 3AZMB 5E5AB 2FJ7D 5B1MC 3AZMC 3LELC 1AOIA 5B0YD 1F66A 4XUJB 3AZGB 4YS3D 3AZED 3X1SA 5B40B 3AZGC 5GXQA 1N1JA 5B40C 3REIA 5CHLB 1KX5A 2PYOA 3WTPC 5AV8C 1BH9B 3MVDA 4QLCD 2CWEA 2IO5C 4WU9C 3TU4B 5CPJA 3AV1B 5B1MD 3LELD 4Z2MG 3LZ0D 1P3LA 4Z66B 3AV1C 5GT0D 5B33B 3WAAC 2NQBA 2BYMA 4XZQA 3MNNC 4H9RA 3UTAC 5G49B 5B33C 5DNNA 5B40D 3NQJA 1P3IA 4CSRB 5CPKD 3MGQA 3WKJB 4LD9B 3UTBB 3WTPD 3KSYA 4WNNA 5AV8D 3X1UA 3UTBC 1P3KA 3A6NA 1P3GB 4WU9D 2HIOA 2CV5C 4HGAB 4J8WB 1TAFB 5C3IC 3B0BA 3WAAD 5GSUA 4J8VB 3MNND 3MGSA 4NFTA 3REKA 3UTAD 5B33D 3W97C 3LZ1C 1P3PA 4YM6A 5E5AA 1AOIB 5B1LD 1Q9CA 3VH5A 4KUDD 1AOIC 2CV5D 4XUJA 1F66C 4H9NB 3X1TA 5AY8D 5BNXB 1N1JB 3NQUB 5BS7A 3X1SC 5JRGB 5GXQC 3REIB 5AV6D 1P3FD 4R8PD 1P34B 2PYOB 4DRBA 1BH8A 3REIC 4G91B 1TZYB 3MVDB 3W97D 3AN2B 3W96B 1KX5C 3LZ1D 2PYOC 3B0DB 3RELB 4G91C 5CPJB 3MVDC 5AVBB 1P3MA 1P3LB 3TU4A 5DNMD 5CPJC 5AVCB 1AOID 1P3BB 1P3LC 1F66D 4Z66A 3KUYB 2L5AA 5B2JA 5GT3B 2NQBC 3X1SD 1KX4D 4XZQC 1P3IB 5GXQD 1M19D 3AZJB 5DNNC 4CSRA 5B0ZA 3AZIA 1P3IC 3WKJA 3MGQC 4LD9A 3X1UB 1KX5D 2PYOD 4DRAA 2HIOB 3X1UC 4H9QB 1EQZD 1P3KC 1P3GA 1HQ3B 3A6NC 2HIOC 5AV9A 5CPID 1M1AA 4J8WA 4ZUXD 1KX3A 5F99A 4WZSB 2LY8A 3MGSB 2NQBD 5GSUC 4J8VA 4XZQD 3VH5T 3MGSC 3REKC 3V9RA 5DNND 4J8UD 5B32B 3B0CW 3MGQD 4JJNA 3B6FB 1P3PC 4YM6C 5E5AC 3X1UD 3X1TB 1HTAA 1S32B 1P3KD 3A6ND 2YFWB 3W98A 1KU5A 4XUJC 4H9NA 5CP6A 5B2IB 5BNXA 3X1TC 3NQUA 3AZKB 5BS7C 5JRGA 1M18B 1BH8B 1P34A 5GSUD 4WU8A 3AZLA 1TZYA 3REKD 5AV5A 1P3MB 3AN2A 3W96A 3AZHB 3AFAD 3RELA 5AVBA 1P3MC 1P3PD 3AZMD 4YM6D 3REJB 5E5AD 3TU4C 4KGCA 5AVCA 1WWIA 5B2JB 1P3BA 4XUJD 3AZGD 4Z66C 4X23B 3X1TD 3KUYA 5FUGA 5GT3A 5B2JC 3AZIB 5B0ZB 3LJAB 3AZJA 1WWSA 3VH6W
chains in the Genus database with same CATH superfamily
3C1CB 3AZIC 5B0ZC 3WKJC 4AWLB 4LD9C 2G5HC 3W99A 2AROB 3IP4C 2F8NH 3B0CT 3X1VA 4AWLC 1T3UA 5AV9B 5KDMB 1H3OB 1P3MD 4H9QA 1P3AB 1M1AB 1HQ3A 1P3GC 1KX3B 2Y2OA 3P5JB 5AV9C 5F99B 4HGAC 3TU4D 1M1AC 3AV1D 4J8WC 4H9SA 3MGRB 5B24A 2Y2QA 1KX3C 5F99C 4Z66D 1ZLAA 2FJ7A 3V9RB 5B2JD 3REHB 4J8VC 5B0YA 4JJNB 5B32A 3WTPE 1P3OB 3WKJD 3B6FA 3KFUG 4JJNC 4LD9D 3UTBD 3R45B 3FDDA 3W98B 3MGPB 4Z5TB 5CP6B 4WV4B 1U35B 3AV2B 1S32A 4EO5B 2YFWA 3C1BA 1P3GD 3W98C 3B6GB 5B2IA 1JFIA 5CP6C 5B31B 4J8WD 1F1EA 3AZKA 3KXBB 1M18A 5JRGC 4WU8B 3AZLB 5AV5B 1P34C 2ZY3A 4H9OB 4J8VD 4WU8C 2ZM5A 3AZLC 1TZYC 5AV5C 3LZ0A 3AZHA 3AN2C 3W96C 4E44A 5GT0A 3B0DC 3RELC 5BT1C 4KGCB 5AVBC 3O62A 3REJA 1ID3B 4KGCC 2F8NB 5AVCC 5CPKA 3AYWB 5FUGB 1P3BC 5B31G 4X23A 4J8XB 2F2AC 3KUYC 5BO0A 5GT3C 4UUZA 5JRGD 3REID 3LJAA 3AZJC 3W99B 1P34D 3C1CA 1B67A 3X1VB 1TZYD 3MVDD 2NZDB 3W99C 3KWQB 3AN2D 2AROA 3W96D 3RELD 3EPJA 3X1VC 5KDMA 1H3OA 5CPJD 5AVBD 1P3AA 1HQ3C 2ZY4A 5B24B 3AZNB 2Y2MA 3AZFA 1P3LD 2F8NG 5AVCD 3MGRA 4H9SC 1ZLAB 2FJ7B 2W8SA 1P3BD 5B24C 2BYKB 5B0YB 5B1LA 3KUYD 1ZLAC 2FJ7C 3REHA 5GT3D 1P3ID 2Y2NA 4KUDA 3AZEB 3AZJD 2J8PA 5B0YC 5B32C 5AY8A 1P3OA 3B6FC 3R45A 5AV6A 3C1BB 2HIOD 4KHAB 3MGPA 3X1VD 1P3FA 4Z5TA 4R8PA 1JFIB 1U35A 3AV2A 1S32C 5BNVB 1HQ3D 3C1BC 3B6GA 5B2IC 5B31A 3KXBA 3AZKC 1BFMA 1M18C 4NE3A 5B1MB 1ULYA 2HUEB 3LELB 3MGSD 1ZLAD 2FFFB 3LZ0B 5DNMA 5B32G 4H9OA 5GT0B 2HUEC 3UT9A 3LZ0C 3O62B 3AZHC 5B32D 5GT0C 3B6FD 4WJ3C 3O62C 1KX4A 1ID3A 5CPKB 3REJC 1M19A 3VH6A 3WA9A 1S32D 3WTPB 2F8NA 3AYWA 5CPKC 5AV8B 3C1BD 5BO0B 4UUZB 5B2ID 4J8XA 4X23C 2IO5B 4WU9B 3AZKD 1M18D 1EQZA 3LJAC 5CPIA 3C1CC 2Y2IA 4ZUXA 3WAAB 3KWQA 2NZDA 3AZHD 2AROC 3MNNB 3UTAB 3AZFB 1P3AC 4ZBJB 3O62D 4G92B 3REJD 3AZNA 3AZFC 4J8UA 4ZBJC 4G92C 5B1LB 3MGRC 2UWXA 2BYKA 4DQYB 4X23D 4KUDB 5B1LC 2CV5B 3REHC 4YS3A 3A1IA 3EPKA 5AY8B 4CAYA 5B0ZD 3AZID 3AZEA 3LJAD 4KUDC 1R4VA 3C1CD 5AY8C 5C3IB 5AV6B 1P3OC 1P3FB 4R8PB 5JA4A 4H9PA 3H0LC 2AROD 5AV6C 4KHAA 1P3FC 3MGPC 5AV9D 4Z5TC 3W97B 4R8PC 1U35C 3AV2C 1P3AD 3LZ1B 1M1AD 5BNVA 2RVQC 4EO5C 2YFVA 3B6GC 1KX3D 3AZFD 5F99D 4QLCA 5B31C 3AFAA 4UPKA 3F6TA 3MGRD 5DNMB 2Y2LA 4M6BA 3KXBC 5B1MA 3AZMA 3LELA 3UT9B 3VH6T 3REHD 5DNMC 1A7WA 1F66B 4JJND 3UT9C 3X1SB 3AZGA 2BG1A 1KX4B 5GXQB 1P3OD 1M19B 3WA9B 5B40A 1KX4C 2DQNC 1ID3C 1M19C 3W98D 3WA9C 2Y2KA 3VH5W 3MGPD 4Z5TD 5CP6D 1U35D 3WTPA 3AV2D 1KX5B 3EPHA 2RVQD 5AV8A 3AYWC 3B6GD 4Z2MH 4J8XC 1EQZB 5B31D 1Z2CB 4WU9A 1W2EA 3KXBD 1BH9A 5CPIB 4WU8D 1EQZC 4ZUXB 3AZLD 2ZY5A 5AV5D 2F8NK 5CPIC 3AV1A 4ZUXC 5BT1D 3UT9D 3WAAA 4NE5A 2NZDC 3KWQC 2NQBB 2BYMB 4XZQB 3MNNA 3UTAA 4H9RB 5B33A 4KGCD 5DNNB 4J8UB 3NQJB 1ID3D 3MGQB 3WA9D 5G49A 3AZNC 2Y2HA 4J8UC 3EG5B 2F8ND 4WNNB 3AYWD 2JSSA 4NE6A 3UTBA 4YS3B 4E45A 4CAYB 1B6WA 4J8XD 1P3KB 3A6NB 2CV5A 4YS3C 3AZEC 3W99D 5JA4B 4H9PB 2DF4C 1TAFA 1PZRA 2NZDD 3KWQD 5GSUB 2Y2JA 2YFVB 3REKB 3W97A 4QLCB 3LZ1A 3AFAB 5B24D 3AZND 4QLCC 1P3PB 3EPLA 3AFAC 4YM6B 3AZMB 5E5AB 2FJ7D 2G5IC 5B1MC 2RIQA 3LELC 3AZMC 5B0YD 1AOIA 1F66A 4XUJB 3AZGB 4YS3D 3AZED 3X1SA 5B40B 3AZGC 5GXQA 2Y2PA 1N1JA 5B40C 3REIA 5CHLB 2XD5A 1KX5A 2PYOA 3WTPC 5AV8C 1BH9B 3MVDA 4QLCD 2CWEA 2IO5C 4WU9C 3TU4B 5CPJA 3AV1B 5B1MD 3LELD 4Z2MG 3LZ0D 1P3LA 4Z66B 3AV1C 5GT0D 5B33B 3WAAC 2NQBA 2BYMA 4XZQA 3MNNC 4H9RA 3UTAC 5G49B 5B33C 5DNNA 5B40D 3NQJA 1P3IA 4CSRB 5CPKD 3MGQA 3WKJB 4LD9B 3UTBB 3WTPD 3KSYA 4WNNA 5AV8D 3X1UA 3UTBC 2XD1A 1P3KA 3A6NA 1P3GB 4WU9D 2HIOA 2CV5C 4HGAB 4J8WB 1TAFB 5C3IC 3B0BA 3WAAD 5GSUA 4J8VB 3MNND 3MGSA 4NFTA 3REKA 3UTAD 5B33D 3W97C 3LZ1C 1P3PA 2ZY2A 4YM6A 3H0RC 5E5AA 1AOIB 5B1LD 1Q9CA 3VH5A 4KUDD 1AOIC 2CV5D 4XUJA 1F66C 4H9NB 3X1TA 5AY8D 5BNXB 1N1JB 3NQUB 5BS7A 3X1SC 5JRGB 5GXQC 3REIB 5AV6D 1P3FD 4R8PD 1P34B 2PYOB 4DRBA 1BH8A 3REIC 4G91B 1TZYB 3H0MC 3MVDB 3W97D 3AN2B 3W96B 1KX5C 3LZ1D 2PYOC 3B0DB 3RELB 4G91C 5CPJB 3MVDC 5AVBB 1P3MA 3A1KA 1P3LB 3TU4A 5DNMD 3AL0C 5CPJC 5AVCB 1AOID 1P3BB 1P3LC 1F66D 4Z66A 3KUYB 2L5AA 5B2JA 5GT3B 2NQBC 3X1SD 1KX4D 4XZQC 1P3IB 5GXQD 1M19D 3AZJB 5DNNC 4CSRA 5B0ZA 3AZIA 1P3IC 3WKJA 3MGQC 4LD9A 3X1UB 1KX5D 2PYOD 4DRAA 2HIOB 3X1UC 4H9QB 1EQZD 1P3KC 1P3GA 1HQ3B 3A6NC 2HIOC 5AV9A 5CPID 1M1AA 4J8WA 4ZUXD 1KX3A 5F99A 4WZSB 2LY8A 3MGSB 2NQBD 5GSUC 4J8VA 4XZQD 3VH5T 3MGSC 3REKC 3V9RA 5DNND 4J8UD 5B32B 3B0CW 3MGQD 4JJNA 3B6FB 1P3PC 4YM6C 5E5AC 3X1UD 2Y2GA 3X1TB 1HTAA 1S32B 1P3KD 3A6ND 2YFWB 3W98A 1KU5A 4XUJC 4H9NA 5CP6A 5B2IB 5BNXA 3X1TC 3NQUA 3AZKB 2JE5A 5BS7C 5JRGA 1M18B 1BH8B 1P34A 5GSUD 4WU8A 3AZLA 1TZYA 3REKD 5AV5A 1P3MB 3AN2A 3W96A 3AZHB 3AFAD 3RELA 5AVBA 1P3MC 1P3PD 3AZMD 4YM6D 3REJB 5E5AD 3TU4C 4KGCA 5AVCA 1WWIA 5B2JB 1P3BA 4XUJD 3AZGD 4Z66C 4X23B 3X1TD 3KUYA 5FUGA 5GT3A 5B2JC 2JCHA 3AZIB 5B0ZB 3LJAB 3AZJA 1WWSA 2VQRA 3VH6W
chains in the Genus database with same CATH topology
3C1CB 3AZIC 5B0ZC 3WKJC 4AWLB 4LD9C 2G5HC 3W99A 2AROB 3IP4C 2F8NH 3B0CT 3X1VA 4AWLC 1T3UA 5AV9B 5KDMB 1H3OB 1P3MD 4H9QA 1P3AB 1M1AB 1HQ3A 1P3GC 1KX3B 2Y2OA 3P5JB 5AV9C 5F99B 4HGAC 3TU4D 1M1AC 3AV1D 4J8WC 4H9SA 3MGRB 5B24A 2Y2QA 1KX3C 5F99C 4Z66D 1ZLAA 2FJ7A 3V9RB 5B2JD 3REHB 4J8VC 5B0YA 4JJNB 5B32A 3WTPE 1P3OB 3WKJD 3B6FA 3KFUG 4JJNC 4LD9D 3UTBD 3R45B 3FDDA 3W98B 3MGPB 4Z5TB 5CP6B 4WV4B 1U35B 3AV2B 1S32A 4EO5B 2YFWA 3C1BA 1P3GD 3W98C 3B6GB 5B2IA 1JFIA 5CP6C 5B31B 4J8WD 1F1EA 3AZKA 3KXBB 1M18A 5JRGC 4WU8B 3AZLB 5AV5B 1P34C 2ZY3A 4H9OB 4J8VD 4WU8C 2ZM5A 3AZLC 1TZYC 5AV5C 3LZ0A 3AZHA 3AN2C 3W96C 4E44A 5GT0A 3B0DC 3RELC 5BT1C 4KGCB 5AVBC 3O62A 3REJA 1ID3B 4KGCC 2F8NB 5AVCC 5CPKA 3AYWB 5FUGB 1P3BC 5B31G 4X23A 4J8XB 2F2AC 3KUYC 5BO0A 5GT3C 4UUZA 5JRGD 3REID 3LJAA 3AZJC 3W99B 1P34D 3C1CA 1B67A 3X1VB 1TZYD 3MVDD 2NZDB 3W99C 3KWQB 3AN2D 2AROA 3W96D 3RELD 3EPJA 3X1VC 5KDMA 1H3OA 5CPJD 5AVBD 1P3AA 1HQ3C 2ZY4A 5B24B 3AZNB 2Y2MA 3AZFA 1P3LD 2F8NG 5AVCD 3MGRA 4H9SC 1ZLAB 2FJ7B 2W8SA 1P3BD 5B24C 2BYKB 5B0YB 5B1LA 3KUYD 1ZLAC 2FJ7C 3REHA 5GT3D 1P3ID 2Y2NA 4KUDA 3AZEB 3AZJD 2J8PA 5B0YC 5B32C 5AY8A 1P3OA 3B6FC 3R45A 5AV6A 3C1BB 2HIOD 4KHAB 3MGPA 3X1VD 1P3FA 4Z5TA 4R8PA 1JFIB 1U35A 3AV2A 1S32C 5BNVB 1HQ3D 3C1BC 3B6GA 5B2IC 5B31A 3KXBA 3AZKC 1BFMA 1M18C 4NE3A 5B1MB 1ULYA 2HUEB 3LELB 3MGSD 1ZLAD 2FFFB 3LZ0B 5DNMA 5B32G 4H9OA 5GT0B 2HUEC 3UT9A 3LZ0C 3O62B 3AZHC 5B32D 5GT0C 3B6FD 4WJ3C 3O62C 1KX4A 1ID3A 5CPKB 3REJC 1M19A 3VH6A 3WA9A 1S32D 3WTPB 2F8NA 3AYWA 5CPKC 5AV8B 3C1BD 5BO0B 4UUZB 5B2ID 4J8XA 4X23C 2IO5B 4WU9B 3AZKD 1M18D 1EQZA 3LJAC 5CPIA 3C1CC 2Y2IA 4ZUXA 3WAAB 3KWQA 2NZDA 3AZHD 2AROC 3MNNB 3UTAB 3AZFB 1P3AC 4ZBJB 3O62D 4G92B 3REJD 3AZNA 3AZFC 4J8UA 4ZBJC 4G92C 5B1LB 3MGRC 2UWXA 2BYKA 4DQYB 4X23D 4KUDB 5B1LC 2CV5B 3REHC 4YS3A 3A1IA 3EPKA 5AY8B 4CAYA 5B0ZD 3AZID 3AZEA 3LJAD 4KUDC 1R4VA 3C1CD 5AY8C 5C3IB 5AV6B 1P3OC 1P3FB 4R8PB 5JA4A 4H9PA 3H0LC 2AROD 5AV6C 4KHAA 1P3FC 3MGPC 5AV9D 4Z5TC 3W97B 4R8PC 1U35C 3AV2C 1P3AD 3LZ1B 1M1AD 5BNVA 2RVQC 4EO5C 2YFVA 3B6GC 1KX3D 3AZFD 5F99D 4QLCA 5B31C 3AFAA 4UPKA 3F6TA 3MGRD 5DNMB 2Y2LA 4M6BA 3KXBC 5B1MA 3AZMA 3LELA 3UT9B 3VH6T 3REHD 5DNMC 1A7WA 1F66B 4JJND 3UT9C 3X1SB 3AZGA 2BG1A 1KX4B 5GXQB 1P3OD 1M19B 3WA9B 5B40A 1KX4C 2DQNC 1ID3C 1M19C 3W98D 3WA9C 2Y2KA 3VH5W 3MGPD 4Z5TD 5CP6D 1U35D 3WTPA 3AV2D 1KX5B 3EPHA 2RVQD 5AV8A 3AYWC 3B6GD 4Z2MH 4J8XC 1EQZB 5B31D 1Z2CB 4WU9A 1W2EA 3KXBD 1BH9A 5CPIB 4WU8D 1EQZC 4ZUXB 3AZLD 2ZY5A 5AV5D 2F8NK 5CPIC 3AV1A 4ZUXC 5BT1D 3UT9D 3WAAA 4NE5A 2NZDC 3KWQC 2NQBB 2BYMB 4XZQB 3MNNA 3UTAA 4H9RB 5B33A 4KGCD 5DNNB 4J8UB 3NQJB 1ID3D 3MGQB 3WA9D 5G49A 3AZNC 2Y2HA 4J8UC 3EG5B 2F8ND 4WNNB 3AYWD 2JSSA 4NE6A 3UTBA 4YS3B 4E45A 4CAYB 1B6WA 4J8XD 1P3KB 3A6NB 2CV5A 4YS3C 3AZEC 3W99D 5JA4B 4H9PB 2DF4C 1TAFA 1PZRA 2NZDD 3KWQD 5GSUB 2Y2JA 2YFVB 3REKB 3W97A 4QLCB 3LZ1A 3AFAB 5B24D 3AZND 4QLCC 1P3PB 3EPLA 3AFAC 4YM6B 3AZMB 5E5AB 2FJ7D 2G5IC 5B1MC 2RIQA 3LELC 3AZMC 5B0YD 1AOIA 1F66A 4XUJB 3AZGB 4YS3D 3AZED 3X1SA 5B40B 3AZGC 5GXQA 2Y2PA 1N1JA 5B40C 3REIA 5CHLB 2XD5A 1KX5A 2PYOA 3WTPC 5AV8C 1BH9B 3MVDA 4QLCD 2CWEA 2IO5C 4WU9C 3TU4B 5CPJA 3AV1B 5B1MD 3LELD 4Z2MG 3LZ0D 1P3LA 4Z66B 3AV1C 5GT0D 5B33B 3WAAC 2NQBA 2BYMA 4XZQA 3MNNC 4H9RA 3UTAC 5G49B 5B33C 5DNNA 5B40D 3NQJA 1P3IA 4CSRB 5CPKD 3MGQA 3WKJB 4LD9B 3UTBB 3WTPD 3KSYA 4WNNA 5AV8D 3X1UA 3UTBC 2XD1A 1P3KA 3A6NA 1P3GB 4WU9D 2HIOA 2CV5C 4HGAB 4J8WB 1TAFB 5C3IC 3B0BA 3WAAD 5GSUA 4J8VB 3MNND 3MGSA 4NFTA 3REKA 3UTAD 5B33D 3W97C 3LZ1C 1P3PA 2ZY2A 4YM6A 3H0RC 5E5AA 1AOIB 5B1LD 1Q9CA 3VH5A 4KUDD 1AOIC 2CV5D 4XUJA 1F66C 4H9NB 3X1TA 5AY8D 5BNXB 1N1JB 3NQUB 5BS7A 3X1SC 5JRGB 5GXQC 3REIB 5AV6D 1P3FD 4R8PD 1P34B 2PYOB 4DRBA 1BH8A 3REIC 4G91B 1TZYB 3H0MC 3MVDB 3W97D 3AN2B 3W96B 1KX5C 3LZ1D 2PYOC 3B0DB 3RELB 4G91C 5CPJB 3MVDC 5AVBB 1P3MA 3A1KA 1P3LB 3TU4A 5DNMD 3AL0C 5CPJC 5AVCB 1AOID 1P3BB 1P3LC 1F66D 4Z66A 3KUYB 2L5AA 5B2JA 5GT3B 2NQBC 3X1SD 1KX4D 4XZQC 1P3IB 5GXQD 1M19D 3AZJB 5DNNC 4CSRA 5B0ZA 3AZIA 1P3IC 3WKJA 3MGQC 4LD9A 3X1UB 1KX5D 2PYOD 4DRAA 2HIOB 3X1UC 4H9QB 1EQZD 1P3KC 1P3GA 1HQ3B 3A6NC 2HIOC 5AV9A 5CPID 1M1AA 4J8WA 4ZUXD 1KX3A 5F99A 4WZSB 2LY8A 3MGSB 2NQBD 5GSUC 4J8VA 4XZQD 3VH5T 3MGSC 3REKC 3V9RA 5DNND 4J8UD 5B32B 3B0CW 3MGQD 4JJNA 3B6FB 1P3PC 4YM6C 5E5AC 3X1UD 2Y2GA 3X1TB 1HTAA 1S32B 1P3KD 3A6ND 2YFWB 3W98A 1KU5A 4XUJC 4H9NA 5CP6A 5B2IB 5BNXA 3X1TC 3NQUA 3AZKB 2JE5A 5BS7C 5JRGA 1M18B 1BH8B 1P34A 5GSUD 4WU8A 3AZLA 1TZYA 3REKD 5AV5A 1P3MB 3AN2A 3W96A 3AZHB 3AFAD 3RELA 5AVBA 1P3MC 1P3PD 3AZMD 4YM6D 3REJB 5E5AD 3TU4C 4KGCA 5AVCA 1WWIA 5B2JB 1P3BA 4XUJD 3AZGD 4Z66C 4X23B 3X1TD 3KUYA 5FUGA 5GT3A 5B2JC 2JCHA 3AZIB 5B0ZB 3LJAB 3AZJA 1WWSA 2VQRA 3VH6W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1C B;  3AZI C;  5B0Z C;  3WKJ C;  4AWL B;  4LD9 C;  3W99 A;  2ARO B;  2F8N H;  3B0C T;  3X1V A;  4AWL C;  5AV9 B;  5KDM B;  1H3O B;  1P3M D;  4H9Q A;  1P3A B;  1M1A B;  1HQ3 A;  1P3G C;  1KX3 B;  5AV9 C;  5F99 B;  4HGA C;  3TU4 D;  1M1A C;  3AV1 D;  4J8W C;  4H9S A;  3MGR B;  5B24 A;  1KX3 C;  5F99 C;  4Z66 D;  1ZLA A;  2FJ7 A;  3V9R B;  5B2J D;  3REH B;  4J8V C;  5B0Y A;  4JJN B;  5B32 A;  3WTP E;  1P3O B;  3WKJ D;  3B6F A;  4JJN C;  4LD9 D;  3UTB D;  3R45 B;  3W98 B;  3MGP B;  4Z5T B;  5CP6 B;  4WV4 B;  1U35 B;  3AV2 B;  1S32 A;  4EO5 B;  2YFW A;  3C1B A;  1P3G D;  3W98 C;  3B6G B;  5B2I A;  1JFI A;  5CP6 C;  5B31 B;  4J8W D;  1F1E A;  3AZK A;  3KXB B;  1M18 A;  5JRG C;  4WU8 B;  3AZL B;  5AV5 B;  1P34 C;  4H9O B;  4J8V D;  4WU8 C;  3AZL C;  1TZY C;  5AV5 C;  3LZ0 A;  3AZH A;  3AN2 C;  3W96 C;  4E44 A;  5GT0 A;  3B0D C;  3REL C;  5BT1 C;  4KGC B;  5AVB C;  3O62 A;  3REJ A;  1ID3 B;  4KGC C;  2F8N B;  5AVC C;  5CPK A;  3AYW B;  5FUG B;  1P3B C;  5B31 G;  4X23 A;  4J8X B;  3KUY C;  5BO0 A;  5GT3 C;  4UUZ A;  5JRG D;  3REI D;  3LJA A;  3AZJ C;  3W99 B;  1P34 D;  3C1C A;  1B67 A;  3X1V B;  1TZY D;  3MVD D;  2NZD B;  3W99 C;  3KWQ B;  3AN2 D;  2ARO A;  3W96 D;  3REL D;  3X1V C;  5KDM A;  1H3O A;  5CPJ D;  5AVB D;  1P3A A;  1HQ3 C;  5B24 B;  3AZN B;  3AZF A;  1P3L D;  2F8N G;  5AVC D;  3MGR A;  4H9S C;  1ZLA B;  2FJ7 B;  1P3B D;  5B24 C;  2BYK B;  5B0Y B;  5B1L A;  3KUY D;  1ZLA C;  2FJ7 C;  3REH A;  5GT3 D;  1P3I D;  4KUD A;  3AZE B;  3AZJ D;  5B0Y C;  5B32 C;  5AY8 A;  1P3O A;  3B6F C;  3R45 A;  5AV6 A;  3C1B B;  2HIO D;  4KHA B;  3MGP A;  3X1V D;  1P3F A;  4Z5T A;  4R8P A;  1JFI B;  1U35 A;  3AV2 A;  1S32 C;  5BNV B;  1HQ3 D;  3C1B C;  3B6G A;  5B2I C;  5B31 A;  3KXB A;  3AZK C;  1BFM A;  1M18 C;  4NE3 A;  5B1M B;  1ULY A;  2HUE B;  3LEL B;  3MGS D;  1ZLA D;  3LZ0 B;  5DNM A;  5B32 G;  4H9O A;  5GT0 B;  2HUE C;  3UT9 A;  3LZ0 C;  3O62 B;  3AZH C;  5B32 D;  5GT0 C;  3B6F D;  3O62 C;  1KX4 A;  1ID3 A;  5CPK B;  3REJ C;  1M19 A;  3VH6 A;  3WA9 A;  1S32 D;  3WTP B;  2F8N A;  3AYW A;  5CPK C;  5AV8 B;  3C1B D;  5BO0 B;  4UUZ B;  5B2I D;  4J8X A;  4X23 C;  2IO5 B;  4WU9 B;  3AZK D;  1M18 D;  1EQZ A;  3LJA C;  5CPI A;  3C1C C;  4ZUX A;  3WAA B;  3KWQ A;  2NZD A;  3AZH D;  2ARO C;  3MNN B;  3UTA B;  3AZF B;  1P3A C;  4ZBJ B;  3O62 D;  4G92 B;  3REJ D;  3AZN A;  3AZF C;  4J8U A;  4ZBJ C;  4G92 C;  5B1L B;  3MGR C;  2BYK A;  4X23 D;  4KUD B;  5B1L C;  2CV5 B;  3REH C;  4YS3 A;  5AY8 B;  4CAY A;  5B0Z D;  3AZI D;  3AZE A;  3LJA D;  4KUD C;  1R4V A;  3C1C D;  5AY8 C;  5C3I B;  5AV6 B;  1P3O C;  1P3F B;  4R8P B;  5JA4 A;  4H9P A;  2ARO D;  5AV6 C;  4KHA A;  1P3F C;  3MGP C;  5AV9 D;  4Z5T C;  3W97 B;  4R8P C;  1U35 C;  3AV2 C;  1P3A D;  3LZ1 B;  1M1A D;  5BNV A;  2RVQ C;  4EO5 C;  2YFV A;  3B6G C;  1KX3 D;  3AZF D;  5F99 D;  4QLC A;  5B31 C;  3AFA A;  3MGR D;  5DNM B;  3KXB C;  4M6B A;  5B1M A;  3AZM A;  3LEL A;  3UT9 B;  3VH6 T;  3REH D;  5DNM C;  1A7W A;  1F66 B;  4JJN D;  3UT9 C;  3X1S B;  3AZG A;  1KX4 B;  5GXQ B;  1P3O D;  1M19 B;  3WA9 B;  5B40 A;  1KX4 C;  1ID3 C;  1M19 C;  3W98 D;  3WA9 C;  3VH5 W;  3MGP D;  4Z5T D;  5CP6 D;  1U35 D;  3WTP A;  3AV2 D;  1KX5 B;  2RVQ D;  5AV8 A;  3AYW C;  3B6G D;  4Z2M H;  4J8X C;  1EQZ B;  5B31 D;  4WU9 A;  3KXB D;  1BH9 A;  5CPI B;  4WU8 D;  1EQZ C;  4ZUX B;  3AZL D;  5AV5 D;  2F8N K;  5CPI C;  3AV1 A;  4ZUX C;  5BT1 D;  3UT9 D;  3WAA A;  4NE5 A;  2NZD C;  3KWQ C;  2NQB B;  2BYM B;  4XZQ B;  3MNN A;  3UTA A;  4H9R B;  5B33 A;  4KGC D;  5DNN B;  4J8U B;  3NQJ B;  1ID3 D;  3MGQ B;  3WA9 D;  5G49 A;  3AZN C;  4J8U C;  2F8N D;  4WNN B;  3AYW D;  2JSS A;  4NE6 A;  3UTB A;  4YS3 B;  4E45 A;  4CAY B;  1B6W A;  4J8X D;  1P3K B;  3A6N B;  2CV5 A;  4YS3 C;  3AZE C;  3W99 D;  5JA4 B;  4H9P B;  1TAF A;  2NZD D;  3KWQ D;  5GSU B;  2YFV B;  3REK B;  3W97 A;  4QLC B;  3LZ1 A;  3AFA B;  5B24 D;  3AZN D;  4QLC C;  1P3P B;  3AFA C;  4YM6 B;  3AZM B;  5E5A B;  2FJ7 D;  5B1M C;  3AZM C;  3LEL C;  1AOI A;  5B0Y D;  1F66 A;  4XUJ B;  3AZG B;  4YS3 D;  3AZE D;  3X1S A;  5B40 B;  3AZG C;  5GXQ A;  1N1J A;  5B40 C;  3REI A;  5CHL B;  1KX5 A;  2PYO A;  3WTP C;  5AV8 C;  1BH9 B;  3MVD A;  4QLC D;  2CWE A;  2IO5 C;  4WU9 C;  3TU4 B;  5CPJ A;  3AV1 B;  5B1M D;  3LEL D;  4Z2M G;  3LZ0 D;  1P3L A;  4Z66 B;  3AV1 C;  5GT0 D;  5B33 B;  3WAA C;  2NQB A;  2BYM A;  4XZQ A;  3MNN C;  4H9R A;  3UTA C;  5G49 B;  5B33 C;  5DNN A;  5B40 D;  3NQJ A;  1P3I A;  4CSR B;  5CPK D;  3MGQ A;  3WKJ B;  4LD9 B;  3UTB B;  3WTP D;  3KSY A;  4WNN A;  5AV8 D;  3X1U A;  3UTB C;  1P3K A;  3A6N A;  1P3G B;  4WU9 D;  2HIO A;  2CV5 C;  4HGA B;  4J8W B;  1TAF B;  5C3I C;  3B0B A;  3WAA D;  5GSU A;  4J8V B;  3MNN D;  3MGS A;  4NFT A;  3REK A;  3UTA D;  5B33 D;  3W97 C;  3LZ1 C;  1P3P A;  4YM6 A;  5E5A A;  1AOI B;  5B1L D;  1Q9C A;  3VH5 A;  4KUD D;  1AOI C;  2CV5 D;  4XUJ A;  1F66 C;  4H9N B;  3X1T A;  5AY8 D;  5BNX B;  1N1J B;  3NQU B;  5BS7 A;  3X1S C;  5JRG B;  5GXQ C;  3REI B;  5AV6 D;  1P3F D;  4R8P D;  1P34 B;  2PYO B;  4DRB A;  1BH8 A;  3REI C;  4G91 B;  1TZY B;  3MVD B;  3W97 D;  3AN2 B;  3W96 B;  1KX5 C;  3LZ1 D;  2PYO C;  3B0D B;  3REL B;  4G91 C;  5CPJ B;  3MVD C;  5AVB B;  1P3M A;  1P3L B;  3TU4 A;  5DNM D;  5CPJ C;  5AVC B;  1AOI D;  1P3B B;  1P3L C;  1F66 D;  4Z66 A;  3KUY B;  2L5A A;  5B2J A;  5GT3 B;  2NQB C;  3X1S D;  1KX4 D;  4XZQ C;  1P3I B;  5GXQ D;  1M19 D;  3AZJ B;  5DNN C;  4CSR A;  5B0Z A;  3AZI A;  1P3I C;  3WKJ A;  3MGQ C;  4LD9 A;  3X1U B;  1KX5 D;  2PYO D;  4DRA A;  2HIO B;  3X1U C;  4H9Q B;  1EQZ D;  1P3K C;  1P3G A;  1HQ3 B;  3A6N C;  2HIO C;  5AV9 A;  5CPI D;  1M1A A;  4J8W A;  4ZUX D;  1KX3 A;  5F99 A;  4WZS B;  2LY8 A;  3MGS B;  2NQB D;  5GSU C;  4J8V A;  4XZQ D;  3VH5 T;  3MGS C;  3REK C;  3V9R A;  5DNN D;  4J8U D;  5B32 B;  3B0C W;  3MGQ D;  4JJN A;  3B6F B;  1P3P C;  4YM6 C;  5E5A C;  3X1U D;  3X1T B;  1HTA A;  1S32 B;  1P3K D;  3A6N D;  2YFW B;  3W98 A;  1KU5 A;  4XUJ C;  4H9N A;  5CP6 A;  5B2I B;  5BNX A;  3X1T C;  3NQU A;  3AZK B;  5BS7 C;  5JRG A;  1M18 B;  1BH8 B;  1P34 A;  5GSU D;  4WU8 A;  3AZL A;  1TZY A;  3REK D;  5AV5 A;  1P3M B;  3AN2 A;  3W96 A;  3AZH B;  3AFA D;  3REL A;  5AVB A;  1P3M C;  1P3P D;  3AZM D;  4YM6 D;  3REJ B;  5E5A D;  3TU4 C;  4KGC A;  5AVC A;  1WWI A;  5B2J B;  1P3B A;  4XUJ D;  3AZG D;  4Z66 C;  4X23 B;  3X1T D;  3KUY A;  5FUG A;  5GT3 A;  5B2J C;  3AZI B;  5B0Z B;  3LJA B;  3AZJ A;  1WWS A;  3VH6 W; 
#chains in the Genus database with same CATH topology
 3C1C B;  3AZI C;  5B0Z C;  3WKJ C;  4AWL B;  4LD9 C;  2G5H C;  3W99 A;  2ARO B;  3IP4 C;  2F8N H;  3B0C T;  3X1V A;  4AWL C;  1T3U A;  5AV9 B;  5KDM B;  1H3O B;  1P3M D;  4H9Q A;  1P3A B;  1M1A B;  1HQ3 A;  1P3G C;  1KX3 B;  2Y2O A;  3P5J B;  5AV9 C;  5F99 B;  4HGA C;  3TU4 D;  1M1A C;  3AV1 D;  4J8W C;  4H9S A;  3MGR B;  5B24 A;  2Y2Q A;  1KX3 C;  5F99 C;  4Z66 D;  1ZLA A;  2FJ7 A;  3V9R B;  5B2J D;  3REH B;  4J8V C;  5B0Y A;  4JJN B;  5B32 A;  3WTP E;  1P3O B;  3WKJ D;  3B6F A;  3KFU G;  4JJN C;  4LD9 D;  3UTB D;  3R45 B;  3FDD A;  3W98 B;  3MGP B;  4Z5T B;  5CP6 B;  4WV4 B;  1U35 B;  3AV2 B;  1S32 A;  4EO5 B;  2YFW A;  3C1B A;  1P3G D;  3W98 C;  3B6G B;  5B2I A;  1JFI A;  5CP6 C;  5B31 B;  4J8W D;  1F1E A;  3AZK A;  3KXB B;  1M18 A;  5JRG C;  4WU8 B;  3AZL B;  5AV5 B;  1P34 C;  2ZY3 A;  4H9O B;  4J8V D;  4WU8 C;  2ZM5 A;  3AZL C;  1TZY C;  5AV5 C;  3LZ0 A;  3AZH A;  3AN2 C;  3W96 C;  4E44 A;  5GT0 A;  3B0D C;  3REL C;  5BT1 C;  4KGC B;  5AVB C;  3O62 A;  3REJ A;  1ID3 B;  4KGC C;  2F8N B;  5AVC C;  5CPK A;  3AYW B;  5FUG B;  1P3B C;  5B31 G;  4X23 A;  4J8X B;  2F2A C;  3KUY C;  5BO0 A;  5GT3 C;  4UUZ A;  5JRG D;  3REI D;  3LJA A;  3AZJ C;  3W99 B;  1P34 D;  3C1C A;  1B67 A;  3X1V B;  1TZY D;  3MVD D;  2NZD B;  3W99 C;  3KWQ B;  3AN2 D;  2ARO A;  3W96 D;  3REL D;  3EPJ A;  3X1V C;  5KDM A;  1H3O A;  5CPJ D;  5AVB D;  1P3A A;  1HQ3 C;  2ZY4 A;  5B24 B;  3AZN B;  2Y2M A;  3AZF A;  1P3L D;  2F8N G;  5AVC D;  3MGR A;  4H9S C;  1ZLA B;  2FJ7 B;  2W8S A;  1P3B D;  5B24 C;  2BYK B;  5B0Y B;  5B1L A;  3KUY D;  1ZLA C;  2FJ7 C;  3REH A;  5GT3 D;  1P3I D;  2Y2N A;  4KUD A;  3AZE B;  3AZJ D;  2J8P A;  5B0Y C;  5B32 C;  5AY8 A;  1P3O A;  3B6F C;  3R45 A;  5AV6 A;  3C1B B;  2HIO D;  4KHA B;  3MGP A;  3X1V D;  1P3F A;  4Z5T A;  4R8P A;  1JFI B;  1U35 A;  3AV2 A;  1S32 C;  5BNV B;  1HQ3 D;  3C1B C;  3B6G A;  5B2I C;  5B31 A;  3KXB A;  3AZK C;  1BFM A;  1M18 C;  4NE3 A;  5B1M B;  1ULY A;  2HUE B;  3LEL B;  3MGS D;  1ZLA D;  2FFF B;  3LZ0 B;  5DNM A;  5B32 G;  4H9O A;  5GT0 B;  2HUE C;  3UT9 A;  3LZ0 C;  3O62 B;  3AZH C;  5B32 D;  5GT0 C;  3B6F D;  4WJ3 C;  3O62 C;  1KX4 A;  1ID3 A;  5CPK B;  3REJ C;  1M19 A;  3VH6 A;  3WA9 A;  1S32 D;  3WTP B;  2F8N A;  3AYW A;  5CPK C;  5AV8 B;  3C1B D;  5BO0 B;  4UUZ B;  5B2I D;  4J8X A;  4X23 C;  2IO5 B;  4WU9 B;  3AZK D;  1M18 D;  1EQZ A;  3LJA C;  5CPI A;  3C1C C;  2Y2I A;  4ZUX A;  3WAA B;  3KWQ A;  2NZD A;  3AZH D;  2ARO C;  3MNN B;  3UTA B;  3AZF B;  1P3A C;  4ZBJ B;  3O62 D;  4G92 B;  3REJ D;  3AZN A;  3AZF C;  4J8U A;  4ZBJ C;  4G92 C;  5B1L B;  3MGR C;  2UWX A;  2BYK A;  4DQY B;  4X23 D;  4KUD B;  5B1L C;  2CV5 B;  3REH C;  4YS3 A;  3A1I A;  3EPK A;  5AY8 B;  4CAY A;  5B0Z D;  3AZI D;  3AZE A;  3LJA D;  4KUD C;  1R4V A;  3C1C D;  5AY8 C;  5C3I B;  5AV6 B;  1P3O C;  1P3F B;  4R8P B;  5JA4 A;  4H9P A;  3H0L C;  2ARO D;  5AV6 C;  4KHA A;  1P3F C;  3MGP C;  5AV9 D;  4Z5T C;  3W97 B;  4R8P C;  1U35 C;  3AV2 C;  1P3A D;  3LZ1 B;  1M1A D;  5BNV A;  2RVQ C;  4EO5 C;  2YFV A;  3B6G C;  1KX3 D;  3AZF D;  5F99 D;  4QLC A;  5B31 C;  3AFA A;  4UPK A;  3F6T A;  3MGR D;  5DNM B;  2Y2L A;  4M6B A;  3KXB C;  5B1M A;  3AZM A;  3LEL A;  3UT9 B;  3VH6 T;  3REH D;  5DNM C;  1A7W A;  1F66 B;  4JJN D;  3UT9 C;  3X1S B;  3AZG A;  2BG1 A;  1KX4 B;  5GXQ B;  1P3O D;  1M19 B;  3WA9 B;  5B40 A;  1KX4 C;  2DQN C;  1ID3 C;  1M19 C;  3W98 D;  3WA9 C;  2Y2K A;  3VH5 W;  3MGP D;  4Z5T D;  5CP6 D;  1U35 D;  3WTP A;  3AV2 D;  1KX5 B;  3EPH A;  2RVQ D;  5AV8 A;  3AYW C;  3B6G D;  4Z2M H;  4J8X C;  1EQZ B;  5B31 D;  1Z2C B;  4WU9 A;  1W2E A;  3KXB D;  1BH9 A;  5CPI B;  4WU8 D;  1EQZ C;  4ZUX B;  3AZL D;  2ZY5 A;  5AV5 D;  2F8N K;  5CPI C;  3AV1 A;  4ZUX C;  5BT1 D;  3UT9 D;  3WAA A;  4NE5 A;  2NZD C;  3KWQ C;  2NQB B;  2BYM B;  4XZQ B;  3MNN A;  3UTA A;  4H9R B;  5B33 A;  4KGC D;  5DNN B;  4J8U B;  3NQJ B;  1ID3 D;  3MGQ B;  3WA9 D;  5G49 A;  3AZN C;  2Y2H A;  4J8U C;  3EG5 B;  2F8N D;  4WNN B;  3AYW D;  2JSS A;  4NE6 A;  3UTB A;  4YS3 B;  4E45 A;  4CAY B;  1B6W A;  4J8X D;  1P3K B;  3A6N B;  2CV5 A;  4YS3 C;  3AZE C;  3W99 D;  5JA4 B;  4H9P B;  2DF4 C;  1TAF A;  1PZR A;  2NZD D;  3KWQ D;  5GSU B;  2Y2J A;  2YFV B;  3REK B;  3W97 A;  4QLC B;  3LZ1 A;  3AFA B;  5B24 D;  3AZN D;  4QLC C;  1P3P B;  3EPL A;  3AFA C;  4YM6 B;  3AZM B;  5E5A B;  2FJ7 D;  2G5I C;  5B1M C;  2RIQ A;  3LEL C;  3AZM C;  5B0Y D;  1AOI A;  1F66 A;  4XUJ B;  3AZG B;  4YS3 D;  3AZE D;  3X1S A;  5B40 B;  3AZG C;  5GXQ A;  2Y2P A;  1N1J A;  5B40 C;  3REI A;  5CHL B;  2XD5 A;  1KX5 A;  2PYO A;  3WTP C;  5AV8 C;  1BH9 B;  3MVD A;  4QLC D;  2CWE A;  2IO5 C;  4WU9 C;  3TU4 B;  5CPJ A;  3AV1 B;  5B1M D;  3LEL D;  4Z2M G;  3LZ0 D;  1P3L A;  4Z66 B;  3AV1 C;  5GT0 D;  5B33 B;  3WAA C;  2NQB A;  2BYM A;  4XZQ A;  3MNN C;  4H9R A;  3UTA C;  5G49 B;  5B33 C;  5DNN A;  5B40 D;  3NQJ A;  1P3I A;  4CSR B;  5CPK D;  3MGQ A;  3WKJ B;  4LD9 B;  3UTB B;  3WTP D;  3KSY A;  4WNN A;  5AV8 D;  3X1U A;  3UTB C;  2XD1 A;  1P3K A;  3A6N A;  1P3G B;  4WU9 D;  2HIO A;  2CV5 C;  4HGA B;  4J8W B;  1TAF B;  5C3I C;  3B0B A;  3WAA D;  5GSU A;  4J8V B;  3MNN D;  3MGS A;  4NFT A;  3REK A;  3UTA D;  5B33 D;  3W97 C;  3LZ1 C;  1P3P A;  2ZY2 A;  4YM6 A;  3H0R C;  5E5A A;  1AOI B;  5B1L D;  1Q9C A;  3VH5 A;  4KUD D;  1AOI C;  2CV5 D;  4XUJ A;  1F66 C;  4H9N B;  3X1T A;  5AY8 D;  5BNX B;  1N1J B;  3NQU B;  5BS7 A;  3X1S C;  5JRG B;  5GXQ C;  3REI B;  5AV6 D;  1P3F D;  4R8P D;  1P34 B;  2PYO B;  4DRB A;  1BH8 A;  3REI C;  4G91 B;  1TZY B;  3H0M C;  3MVD B;  3W97 D;  3AN2 B;  3W96 B;  1KX5 C;  3LZ1 D;  2PYO C;  3B0D B;  3REL B;  4G91 C;  5CPJ B;  3MVD C;  5AVB B;  1P3M A;  3A1K A;  1P3L B;  3TU4 A;  5DNM D;  3AL0 C;  5CPJ C;  5AVC B;  1AOI D;  1P3B B;  1P3L C;  1F66 D;  4Z66 A;  3KUY B;  2L5A A;  5B2J A;  5GT3 B;  2NQB C;  3X1S D;  1KX4 D;  4XZQ C;  1P3I B;  5GXQ D;  1M19 D;  3AZJ B;  5DNN C;  4CSR A;  5B0Z A;  3AZI A;  1P3I C;  3WKJ A;  3MGQ C;  4LD9 A;  3X1U B;  1KX5 D;  2PYO D;  4DRA A;  2HIO B;  3X1U C;  4H9Q B;  1EQZ D;  1P3K C;  1P3G A;  1HQ3 B;  3A6N C;  2HIO C;  5AV9 A;  5CPI D;  1M1A A;  4J8W A;  4ZUX D;  1KX3 A;  5F99 A;  4WZS B;  2LY8 A;  3MGS B;  2NQB D;  5GSU C;  4J8V A;  4XZQ D;  3VH5 T;  3MGS C;  3REK C;  3V9R A;  5DNN D;  4J8U D;  5B32 B;  3B0C W;  3MGQ D;  4JJN A;  3B6F B;  1P3P C;  4YM6 C;  5E5A C;  3X1U D;  2Y2G A;  3X1T B;  1HTA A;  1S32 B;  1P3K D;  3A6N D;  2YFW B;  3W98 A;  1KU5 A;  4XUJ C;  4H9N A;  5CP6 A;  5B2I B;  5BNX A;  3X1T C;  3NQU A;  3AZK B;  2JE5 A;  5BS7 C;  5JRG A;  1M18 B;  1BH8 B;  1P34 A;  5GSU D;  4WU8 A;  3AZL A;  1TZY A;  3REK D;  5AV5 A;  1P3M B;  3AN2 A;  3W96 A;  3AZH B;  3AFA D;  3REL A;  5AVB A;  1P3M C;  1P3P D;  3AZM D;  4YM6 D;  3REJ B;  5E5A D;  3TU4 C;  4KGC A;  5AVC A;  1WWI A;  5B2J B;  1P3B A;  4XUJ D;  3AZG D;  4Z66 C;  4X23 B;  3X1T D;  3KUY A;  5FUG A;  5GT3 A;  5B2J C;  2JCH A;  3AZI B;  5B0Z B;  3LJA B;  3AZJ A;  1WWS A;  2VQR A;  3VH6 W; 
#chains in the Genus database with same CATH homology
 3C1C B;  3AZI C;  5B0Z C;  3WKJ C;  4AWL B;  4LD9 C;  2G5H C;  3W99 A;  2ARO B;  3IP4 C;  2F8N H;  3B0C T;  3X1V A;  4AWL C;  1T3U A;  5AV9 B;  5KDM B;  1H3O B;  1P3M D;  4H9Q A;  1P3A B;  1M1A B;  1HQ3 A;  1P3G C;  1KX3 B;  2Y2O A;  3P5J B;  5AV9 C;  5F99 B;  4HGA C;  3TU4 D;  1M1A C;  3AV1 D;  4J8W C;  4H9S A;  3MGR B;  5B24 A;  2Y2Q A;  1KX3 C;  5F99 C;  4Z66 D;  1ZLA A;  2FJ7 A;  3V9R B;  5B2J D;  3REH B;  4J8V C;  5B0Y A;  4JJN B;  5B32 A;  3WTP E;  1P3O B;  3WKJ D;  3B6F A;  3KFU G;  4JJN C;  4LD9 D;  3UTB D;  3R45 B;  3FDD A;  3W98 B;  3MGP B;  4Z5T B;  5CP6 B;  4WV4 B;  1U35 B;  3AV2 B;  1S32 A;  4EO5 B;  2YFW A;  3C1B A;  1P3G D;  3W98 C;  3B6G B;  5B2I A;  1JFI A;  5CP6 C;  5B31 B;  4J8W D;  1F1E A;  3AZK A;  3KXB B;  1M18 A;  5JRG C;  4WU8 B;  3AZL B;  5AV5 B;  1P34 C;  2ZY3 A;  4H9O B;  4J8V D;  4WU8 C;  2ZM5 A;  3AZL C;  1TZY C;  5AV5 C;  3LZ0 A;  3AZH A;  3AN2 C;  3W96 C;  4E44 A;  5GT0 A;  3B0D C;  3REL C;  5BT1 C;  4KGC B;  5AVB C;  3O62 A;  3REJ A;  1ID3 B;  4KGC C;  2F8N B;  5AVC C;  5CPK A;  3AYW B;  5FUG B;  1P3B C;  5B31 G;  4X23 A;  4J8X B;  2F2A C;  3KUY C;  5BO0 A;  5GT3 C;  4UUZ A;  5JRG D;  3REI D;  3LJA A;  3AZJ C;  3W99 B;  1P34 D;  3C1C A;  1B67 A;  3X1V B;  1TZY D;  3MVD D;  2NZD B;  3W99 C;  3KWQ B;  3AN2 D;  2ARO A;  3W96 D;  3REL D;  3EPJ A;  3X1V C;  5KDM A;  1H3O A;  5CPJ D;  5AVB D;  1P3A A;  1HQ3 C;  2ZY4 A;  5B24 B;  3AZN B;  2Y2M A;  3AZF A;  1P3L D;  2F8N G;  5AVC D;  3MGR A;  4H9S C;  1ZLA B;  2FJ7 B;  2W8S A;  1P3B D;  5B24 C;  2BYK B;  5B0Y B;  5B1L A;  3KUY D;  1ZLA C;  2FJ7 C;  3REH A;  5GT3 D;  1P3I D;  2Y2N A;  4KUD A;  3AZE B;  3AZJ D;  2J8P A;  5B0Y C;  5B32 C;  5AY8 A;  1P3O A;  3B6F C;  3R45 A;  5AV6 A;  3C1B B;  2HIO D;  4KHA B;  3MGP A;  3X1V D;  1P3F A;  4Z5T A;  4R8P A;  1JFI B;  1U35 A;  3AV2 A;  1S32 C;  5BNV B;  1HQ3 D;  3C1B C;  3B6G A;  5B2I C;  5B31 A;  3KXB A;  3AZK C;  1BFM A;  1M18 C;  4NE3 A;  5B1M B;  1ULY A;  2HUE B;  3LEL B;  3MGS D;  1ZLA D;  2FFF B;  3LZ0 B;  5DNM A;  5B32 G;  4H9O A;  5GT0 B;  2HUE C;  3UT9 A;  3LZ0 C;  3O62 B;  3AZH C;  5B32 D;  5GT0 C;  3B6F D;  4WJ3 C;  3O62 C;  1KX4 A;  1ID3 A;  5CPK B;  3REJ C;  1M19 A;  3VH6 A;  3WA9 A;  1S32 D;  3WTP B;  2F8N A;  3AYW A;  5CPK C;  5AV8 B;  3C1B D;  5BO0 B;  4UUZ B;  5B2I D;  4J8X A;  4X23 C;  2IO5 B;  4WU9 B;  3AZK D;  1M18 D;  1EQZ A;  3LJA C;  5CPI A;  3C1C C;  2Y2I A;  4ZUX A;  3WAA B;  3KWQ A;  2NZD A;  3AZH D;  2ARO C;  3MNN B;  3UTA B;  3AZF B;  1P3A C;  4ZBJ B;  3O62 D;  4G92 B;  3REJ D;  3AZN A;  3AZF C;  4J8U A;  4ZBJ C;  4G92 C;  5B1L B;  3MGR C;  2UWX A;  2BYK A;  4DQY B;  4X23 D;  4KUD B;  5B1L C;  2CV5 B;  3REH C;  4YS3 A;  3A1I A;  3EPK A;  5AY8 B;  4CAY A;  5B0Z D;  3AZI D;  3AZE A;  3LJA D;  4KUD C;  1R4V A;  3C1C D;  5AY8 C;  5C3I B;  5AV6 B;  1P3O C;  1P3F B;  4R8P B;  5JA4 A;  4H9P A;  3H0L C;  2ARO D;  5AV6 C;  4KHA A;  1P3F C;  3MGP C;  5AV9 D;  4Z5T C;  3W97 B;  4R8P C;  1U35 C;  3AV2 C;  1P3A D;  3LZ1 B;  1M1A D;  5BNV A;  2RVQ C;  4EO5 C;  2YFV A;  3B6G C;  1KX3 D;  3AZF D;  5F99 D;  4QLC A;  5B31 C;  3AFA A;  4UPK A;  3F6T A;  3MGR D;  5DNM B;  2Y2L A;  4M6B A;  3KXB C;  5B1M A;  3AZM A;  3LEL A;  3UT9 B;  3VH6 T;  3REH D;  5DNM C;  1A7W A;  1F66 B;  4JJN D;  3UT9 C;  3X1S B;  3AZG A;  2BG1 A;  1KX4 B;  5GXQ B;  1P3O D;  1M19 B;  3WA9 B;  5B40 A;  1KX4 C;  2DQN C;  1ID3 C;  1M19 C;  3W98 D;  3WA9 C;  2Y2K A;  3VH5 W;  3MGP D;  4Z5T D;  5CP6 D;  1U35 D;  3WTP A;  3AV2 D;  1KX5 B;  3EPH A;  2RVQ D;  5AV8 A;  3AYW C;  3B6G D;  4Z2M H;  4J8X C;  1EQZ B;  5B31 D;  1Z2C B;  4WU9 A;  1W2E A;  3KXB D;  1BH9 A;  5CPI B;  4WU8 D;  1EQZ C;  4ZUX B;  3AZL D;  2ZY5 A;  5AV5 D;  2F8N K;  5CPI C;  3AV1 A;  4ZUX C;  5BT1 D;  3UT9 D;  3WAA A;  4NE5 A;  2NZD C;  3KWQ C;  2NQB B;  2BYM B;  4XZQ B;  3MNN A;  3UTA A;  4H9R B;  5B33 A;  4KGC D;  5DNN B;  4J8U B;  3NQJ B;  1ID3 D;  3MGQ B;  3WA9 D;  5G49 A;  3AZN C;  2Y2H A;  4J8U C;  3EG5 B;  2F8N D;  4WNN B;  3AYW D;  2JSS A;  4NE6 A;  3UTB A;  4YS3 B;  4E45 A;  4CAY B;  1B6W A;  4J8X D;  1P3K B;  3A6N B;  2CV5 A;  4YS3 C;  3AZE C;  3W99 D;  5JA4 B;  4H9P B;  2DF4 C;  1TAF A;  1PZR A;  2NZD D;  3KWQ D;  5GSU B;  2Y2J A;  2YFV B;  3REK B;  3W97 A;  4QLC B;  3LZ1 A;  3AFA B;  5B24 D;  3AZN D;  4QLC C;  1P3P B;  3EPL A;  3AFA C;  4YM6 B;  3AZM B;  5E5A B;  2FJ7 D;  2G5I C;  5B1M C;  2RIQ A;  3LEL C;  3AZM C;  5B0Y D;  1AOI A;  1F66 A;  4XUJ B;  3AZG B;  4YS3 D;  3AZE D;  3X1S A;  5B40 B;  3AZG C;  5GXQ A;  2Y2P A;  1N1J A;  5B40 C;  3REI A;  5CHL B;  2XD5 A;  1KX5 A;  2PYO A;  3WTP C;  5AV8 C;  1BH9 B;  3MVD A;  4QLC D;  2CWE A;  2IO5 C;  4WU9 C;  3TU4 B;  5CPJ A;  3AV1 B;  5B1M D;  3LEL D;  4Z2M G;  3LZ0 D;  1P3L A;  4Z66 B;  3AV1 C;  5GT0 D;  5B33 B;  3WAA C;  2NQB A;  2BYM A;  4XZQ A;  3MNN C;  4H9R A;  3UTA C;  5G49 B;  5B33 C;  5DNN A;  5B40 D;  3NQJ A;  1P3I A;  4CSR B;  5CPK D;  3MGQ A;  3WKJ B;  4LD9 B;  3UTB B;  3WTP D;  3KSY A;  4WNN A;  5AV8 D;  3X1U A;  3UTB C;  2XD1 A;  1P3K A;  3A6N A;  1P3G B;  4WU9 D;  2HIO A;  2CV5 C;  4HGA B;  4J8W B;  1TAF B;  5C3I C;  3B0B A;  3WAA D;  5GSU A;  4J8V B;  3MNN D;  3MGS A;  4NFT A;  3REK A;  3UTA D;  5B33 D;  3W97 C;  3LZ1 C;  1P3P A;  2ZY2 A;  4YM6 A;  3H0R C;  5E5A A;  1AOI B;  5B1L D;  1Q9C A;  3VH5 A;  4KUD D;  1AOI C;  2CV5 D;  4XUJ A;  1F66 C;  4H9N B;  3X1T A;  5AY8 D;  5BNX B;  1N1J B;  3NQU B;  5BS7 A;  3X1S C;  5JRG B;  5GXQ C;  3REI B;  5AV6 D;  1P3F D;  4R8P D;  1P34 B;  2PYO B;  4DRB A;  1BH8 A;  3REI C;  4G91 B;  1TZY B;  3H0M C;  3MVD B;  3W97 D;  3AN2 B;  3W96 B;  1KX5 C;  3LZ1 D;  2PYO C;  3B0D B;  3REL B;  4G91 C;  5CPJ B;  3MVD C;  5AVB B;  1P3M A;  3A1K A;  1P3L B;  3TU4 A;  5DNM D;  3AL0 C;  5CPJ C;  5AVC B;  1AOI D;  1P3B B;  1P3L C;  1F66 D;  4Z66 A;  3KUY B;  2L5A A;  5B2J A;  5GT3 B;  2NQB C;  3X1S D;  1KX4 D;  4XZQ C;  1P3I B;  5GXQ D;  1M19 D;  3AZJ B;  5DNN C;  4CSR A;  5B0Z A;  3AZI A;  1P3I C;  3WKJ A;  3MGQ C;  4LD9 A;  3X1U B;  1KX5 D;  2PYO D;  4DRA A;  2HIO B;  3X1U C;  4H9Q B;  1EQZ D;  1P3K C;  1P3G A;  1HQ3 B;  3A6N C;  2HIO C;  5AV9 A;  5CPI D;  1M1A A;  4J8W A;  4ZUX D;  1KX3 A;  5F99 A;  4WZS B;  2LY8 A;  3MGS B;  2NQB D;  5GSU C;  4J8V A;  4XZQ D;  3VH5 T;  3MGS C;  3REK C;  3V9R A;  5DNN D;  4J8U D;  5B32 B;  3B0C W;  3MGQ D;  4JJN A;  3B6F B;  1P3P C;  4YM6 C;  5E5A C;  3X1U D;  2Y2G A;  3X1T B;  1HTA A;  1S32 B;  1P3K D;  3A6N D;  2YFW B;  3W98 A;  1KU5 A;  4XUJ C;  4H9N A;  5CP6 A;  5B2I B;  5BNX A;  3X1T C;  3NQU A;  3AZK B;  2JE5 A;  5BS7 C;  5JRG A;  1M18 B;  1BH8 B;  1P34 A;  5GSU D;  4WU8 A;  3AZL A;  1TZY A;  3REK D;  5AV5 A;  1P3M B;  3AN2 A;  3W96 A;  3AZH B;  3AFA D;  3REL A;  5AVB A;  1P3M C;  1P3P D;  3AZM D;  4YM6 D;  3REJ B;  5E5A D;  3TU4 C;  4KGC A;  5AVC A;  1WWI A;  5B2J B;  1P3B A;  4XUJ D;  3AZG D;  4Z66 C;  4X23 B;  3X1T D;  3KUY A;  5FUG A;  5GT3 A;  5B2J C;  2JCH A;  3AZI B;  5B0Z B;  3LJA B;  3AZJ A;  1WWS A;  2VQR A;  3VH6 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...