5CPJC

Nucleosome containing methylated sat2r dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags "structural protein/dna
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpjC00
3AZKA 4G92C 1P3MD 3W96B 1P3PD 3W99D 5CPIC 1ID3B 3LZ0C 1P3GB 3X1SD 2FJ7A 3LZ1D 3AZHB 1B67A 1KX5D 4QLCC 3AZJC 4KUDA 3O62B 3W98B 5GT3C 1EQZC 1P3OD 3WAAD 4J8VC 3AN2B 4Z2MG 4CAYB 5JRGD 3C1CA 3AFAC 4ZUXC 3B6FB 3X1VB 3NQUB 3X1TC 1HQ3A 3MNNB 1M18B 4J8WA 3WA9B 5AV9C 3REKA 5B1LD 5B1MC 5B24D 3A6NC 1BH8B 2F8ND 1P3KB 2NQBB 5CP6A 4NE6A 5B31A 3NQJA 3B6GA 4XZQD 5DNMD 1TZYB 3MGPB 1P3FD 3AZID 5AVCC 4YM6A 4KGCB 3MGRD 3MGSD 3AZLA 3W99B 5B0YD 1P34D 5GSUC 2YFVA 1KX5B 5CPJD 4XUJC 3TU4A 2BYMA 2RVQC 1P3LB 1P3OB 4HGAB 3AZFB 3WAAB 3C1BC 5G49B 5KDMA 3UTAD 4ZBJC 4E45A 1ID3A 3REHD 3AZGD 5BNVB 3V9RB 3UT9A 1P3AD 2AROC 3AYWD 3VH5A 1ZLAD 5B1LB 3O62A 5GXQB 4WU8A 3AV1B 4Z5TD 1S32D 4WU9B 1U35C 2CV5C 1P3BD 3B6FA 3AZKB 4J8XC 3WKJD 3NQUA 4XZQB 3MGQC 5AV6A 4Z66C 2CWEA 5B40B 3MVDC 5DNMB 3MNNA 5C3IB 4JJNA 3AZNC 3VH6W 1M18A 4J8UC 1P3FB 3AZIB 5B0ZD 5BNXB 1P3IC 5AV5C 5DNND 3LELD 3MGRB 2NZDB 5BT1D 3KWQD 4X23C 3MGSB 5AV8B 3LJAC 1P34B 1KX4A 2FJ7C 5AVBD 1P3KA 2IO5B 5F99A 2NQBA 5B2JD 2F8NH 5CPJB 3REIC 4KUDC 4NE5A 1HQ3B 4H9SA 3AZED 4H9PB 4KGCA 1P3MA 5GT0C 1F66D 2L5AA 3REJC 3W99A 5B2ID 1R4VA 5B33B 3X1SA 5CPKC 3WTPD 3LZ1A 3REKC 1P3AB 5CP6B 1KX5A 5B31B 1KX3B 3B6GB 3LZ0D 1ZLAB 4H9OA 1P3OA 5AY8B 3WAAA 3RELC 5JRGA 4QLCD 3AZJD 3WKJB 5GT3D 1EQZD 3V9RA 2PYOC 3UTBD 4J8VD 5B0ZB 4ZUXD 4LD9B 3AZLC 3X1TD 1M19C 5B1LA 5B24A 3TU4B 2BYMB 3AV1A 5AVBB 2F8NA 4WU9A 5AV9D 5KDMB 5B1MD 4XZQA 5DNMA 3A6ND 5B40A 3KUYC 5B31G 1P3FA 3AZIA 3UT9B 5BNXA 3W96C 4EO5B 1HTAA 3MGRA 2NZDA 1P3GC 3MGSA 3WTPE 5BS7A 5AV8A 5B0YA 1P34A 4WU8B 5AVCD 3X1UD 3AZHC 3WTPB 3W97D 5CPJA 3O62C 3W98C 3LZ0B 5AV6B 3AZMB 1H3OA 4JJNB 3AN2C 5GSUD 4H9PA 3B6FC 4YS3D 3X1VC 5E5AD 4XUJD 4QLCB 4DRBA 3MNNC 3UTAA 2RVQD 5GT3B 3REHA 3WA9C 5B33A 1KX4B 3UTBB 1P3AA 5F99B 4WV4B 1KX3A 4H9NB 1ZLAA 1P3KC 2NQBC 4Z5TA 4R8PC 1S32A 2AROD 2HIOC 5AY8A 5B32D 1P3BA 2YFWB 1P3MB 3WKJA 5B1MB 3A6NB 1TZYC 1P3PB 3MGPC 4KGCC 3X1SB 3AV2D 5B0ZA 3LZ1B 1M1AC 4LD9A 4J8XD 5DNNA 3W99C 3LELA 3MGQD 4Z66D 4AWLB 3AZND 3MVDD 4UUZB 4H9OB 5AVBA 2BYKA 4J8UD 1BFMA 1N1JA 3X1UB 1P3ID 4WNNA 1KX5C 5AV5D 3W97B 5JRGB 1JFIB 4X23D 1P3LC 1P3OC 4HGAC 3LJAD 3AZEA 3AZFC 3WAAC 4YS3B 3REID 5E5AB 1F66A 5B24B 5B2IA 2F8NB 3R45A 5BO0B 3WTPA 5GT0D 5GXQC 3REJD 3LZ0A 3AV1C 3AZMA 4WU9C 5CPKD 3REKD 3KXBD 3AZKC 5B32B 1A7WA 4XZQC 5DNMC 4QLCA 3AZJA 5B40C 5GT3A 1EQZA 3VH6A 5B0YB 1P3FC 3UTBA 3AV2B 3RELD 2NZDC 4H9NA 5AV8C 5BS7C 3X1TA 2IO5C 2PYOD 1AOID 1H3OB 4J8UB 3C1CC 5AV9A 3B0DB 2YFWA 1M19D 2F8NG 5B1MA 1HQ3C 3A6NA 1P3PA 5FUGA 3UTAB 3REHB 3AZGB 4J8WC 4NFTA 3AYWB 5CPID 4UUZA 3KUYD 5B33C 5B32G 1P3AC 4Z5TB 5AVCA 5CP6C 3X1UA 1S32B 3W96D 5B31C 4G91B 3W97A 1P3BB 1KX3C 3B6GC 5JA4A 1P3GD 1ZLAC 1JFIA 2LY8A 5AY8C 4YM6C 5GSUA 3AZHD 3KXBB 4YS3A 1WWSA 3AFAD 3WKJC 5E5AA 3W98D 5DNNB 3LELB 3KWQB 3AN2D 2BYKB 1F1EA 4H9QB 5BO0A 4LD9C 3RELB 1N1JB 5B2JB 3X1VD 4WNNB 5BT1C 3TU4C 1TAFB 2HUEC 5AVBC 3WA9D 3AZEB 1AOIB 2AROA 1BH9B 5B32A 2F8NK 1ID3C 1F66B 1P3KD 5B2IB 4R8PD 3UT9C 2HIOD 3AV2A 3R45B 4EO5C 4J8XA 4G92B 3MGQA 1TZYD 4Z66A 3MGPD 3MVDA 5CPIB 4WU8C 3WTPC 4J8UA 1KU5A 1P3IA 1M1AD 5AV5A 5AV6C 3AZJB 3AZMC 4X23A 3LJAA 4JJNC 4Z2MH 3AZGA 1M18C 1EQZB 4KHAB 4J8VB 3C1BD 3AFAB 4ZUXB 4NE3A 3REIA 3AYWA 1P3LD 3X1TB 1KX4C 3AZFD 3UTBC 5F99C 5AV9B 5GT0A 3REJA 4H9SC 5FUGB 4E44A 5CPKA 3KXBA 1U35D 1ULYA 2CV5D 1P3MC 4M6BA 5GXQD 1P3PC 4WZSB 3AV1D 3KWQA 4CSRB 4WU9D 3X1SC 4R8PB 3LZ1C 4H9QA 2HIOB 5AVCB 3AZKD 3RELA 5B2JA 4AWLC 5B40D 5JA4B 1TAFA 2FJ7D 2PYOA 1AOIA 3X1UC 5GSUB 1BH9A 5JRGC 1M1AB 3W97C 2NZDD 4KUDD 5AV8D 4XUJB 1M19A 1B6WA 3KSYA 4YS3C 3C1CD 5E5AC 3B0BA 3C1BB 5B1LC 1HQ3D 5B24C 5CPIA 4ZBJB 3KUYA 4J8WD 2JSSA 2AROB 3VH5T 3W96A 1P3GA 3VH5W 5C3IC 5B33D 3AZIC 4KHAA 5B32C 5CP6D 3AZHA 5B31D 4J8VA 1U35B 2CV5B 1KX3D 4DRAA 3MGRC 3AFAA 4ZUXA 3B6GD 4H9RB 4J8XB 3W98A 3MGSC 5B0YC 4Z66B 3MGQB 3AZNB 3MVDB 1P34C 5AY8D 3AV2C 4YM6D 3AN2A 4CAYA 3X1VA 1P3IB 5CPJC 5AV5B 3VH6T 3AZLD 4X23B 3WA9A 3LJAB 2FJ7B 3B0DC 4LD9D 3TU4D 3UTAC 3REIB 1BH8A 4KUDB 3REHC 3AZGC 4CSRA 4R8PA 2HIOA 3C1CB 3AYWC 1ID3D 5GT0B 5CHLB 1TZYA 3MGPA 3REJB 4Z5TC 4J8WB 3UT9D 1S32C 4G91C 5CPKB 1P3BC 3REKB 1M1AA 1Q9CA 3O62D 4XUJA 4WU8D 3KXBC 5B0ZC 3B6FD 3C1BA 3NQJB 5DNNC 3LELC 5AV6D 3KWQC 3AZMD 1P3LA 3MNND 4JJND 1M18D 3AZFA 3B0CT 4YM6B 2PYOB 5B2JC 5G49A 3B0CW 3AZLB 5BNVA 1M19B 1KX4D 3AZEC 1AOIC 5F99D 2NQBD 2YFVB 1U35A 2CV5A 4H9RA 1F66C 5GXQA 1WWIA 2HUEB 3AZNA 5B2IC 3KUYB 4KGCD
chains in the Genus database with same CATH superfamily
3AZKA 4G92C 1P3MD 3W96B 1P3PD 3W99D 5CPIC 1ID3B 3LZ0C 1P3GB 2DF4C 3X1SD 2FJ7A 2BG1A 3LZ1D 3AZHB 1B67A 1KX5D 4QLCC 3AZJC 2Y2PA 4KUDA 3O62B 2Y2JA 5GT3C 1EQZC 1P3OD 3W98B 3WAAD 4J8VC 2F2AC 3AN2B 4Z2MG 4CAYB 5JRGD 3C1CA 3AFAC 4ZUXC 3B6FB 3X1VB 3NQUB 3X1TC 1HQ3A 2ZY3A 3MNNB 1M18B 4J8WA 3WA9B 5AV9C 3REKA 2RIQA 5B1LD 5B1MC 5B24D 3A6NC 1BH8B 2Y2QA 2F8ND 1P3KB 2NQBB 3IP4C 5CP6A 4NE6A 5B31A 3NQJA 3B6GA 4XZQD 5DNMD 1TZYB 3MGPB 1P3FD 3AZID 5AVCC 2ZY4A 4YM6A 4KGCB 3MGRD 2W8SA 3H0MC 3MGSD 3AZLA 3W99B 5B0YD 1P34D 5GSUC 2YFVA 1KX5B 5CPJD 4XUJC 3TU4A 2BYMA 2RVQC 1P3LB 1P3OB 4HGAB 3AZFB 3WAAB 3C1BC 5G49B 5KDMA 3UTAD 4ZBJC 4E45A 1ID3A 3REHD 3AZGD 5BNVB 3V9RB 3UT9A 1P3AD 2AROC 3AYWD 3VH5A 1ZLAD 5B1LB 3O62A 5GXQB 4WU8A 3AV1B 4Z5TD 1S32D 4WU9B 1U35C 2CV5C 1P3BD 3B6FA 3AZKB 4J8XC 3WKJD 3NQUA 4XZQB 3MGQC 5AV6A 4Z66C 2CWEA 5B40B 3MVDC 5DNMB 3MNNA 5C3IB 4JJNA 3AZNC 3VH6W 1M18A 4J8UC 1P3FB 3AZIB 5B0ZD 5BNXB 1P3IC 5AV5C 5DNND 3LELD 3MGRB 2NZDB 5BT1D 3KWQD 4X23C 3MGSB 5AV8B 3LJAC 1P34B 1KX4A 2FJ7C 5AVBD 1P3KA 2IO5B 5F99A 2NQBA 5B2JD 3H0LC 2F8NH 5CPJB 3REIC 4KUDC 4NE5A 1HQ3B 4H9SA 3AZED 4H9PB 4KGCA 1P3MA 5GT0C 1F66D 2L5AA 3REJC 3W99A 5B2ID 1R4VA 5B33B 3X1SA 5CPKC 3WTPD 3LZ1A 3REKC 1P3AB 5CP6B 2Y2NA 1KX5A 5B31B 3EG5B 1KX3B 3B6GB 3LZ0D 1ZLAB 4H9OA 2DQNC 1P3OA 5AY8B 3WAAA 3RELC 5JRGA 4QLCD 3AZJD 3WKJB 5GT3D 1EQZD 3V9RA 3EPLA 2PYOC 3UTBD 4J8VD 5B0ZB 3FDDA 4ZUXD 4LD9B 3AZLC 3X1TD 1M19C 5B1LA 5B24A 3TU4B 2BYMB 1W2EA 3AV1A 5AVBB 2F8NA 4WU9A 5AV9D 2XD5A 5KDMB 5B1MD 4XZQA 5DNMA 3A6ND 5B40A 3KUYC 5B31G 1P3FA 3AZIA 3UT9B 5BNXA 3W96C 4EO5B 1HTAA 3MGRA 2NZDA 1P3GC 3MGSA 5AV8A 5BS7A 5B0YA 3WTPE 1P34A 4WU8B 5AVCD 3X1UD 3AZHC 3WTPB 3W97D 5CPJA 3O62C 3W98C 3LZ0B 5AV6B 3AZMB 1H3OA 4JJNB 3AN2C 5GSUD 4H9PA 3B6FC 4YS3D 3X1VC 5E5AD 4XUJD 4DRBA 4QLCB 3MNNC 3UTAA 2RVQD 5GT3B 3REHA 3WA9C 5B33A 1KX4B 3UTBB 1P3AA 5F99B 4WV4B 1KX3A 4H9NB 2Y2GA 1ZLAA 1P3KC 2NQBC 4Z5TA 4R8PC 1S32A 2AROD 2HIOC 1T3UA 5AY8A 5B32D 1P3BA 2YFWB 3A1KA 1P3MB 3WKJA 5B1MB 3A6NB 1TZYC 1P3PB 3MGPC 4KGCC 3X1SB 3AV2D 5B0ZA 3LZ1B 1M1AC 4LD9A 4J8XD 5DNNA 3W99C 3LELA 3MGQD 4Z66D 4AWLB 3AZND 3MVDD 4UUZB 4H9OB 5AVBA 2BYKA 4J8UD 1BFMA 1N1JA 3X1UB 1P3ID 4WNNA 1KX5C 5AV5D 3W97B 5JRGB 1JFIB 4X23D 1P3LC 1P3OC 1PZRA 4HGAC 2ZY5A 3LJAD 3AZEA 3AZFC 3WAAC 4YS3B 3F6TA 3REID 5E5AB 1F66A 5B24B 5B2IA 2F8NB 3R45A 5BO0B 3WTPA 5GT0D 3EPKA 5GXQC 3REJD 3LZ0A 3AV1C 3AZMA 4WU9C 5CPKD 3REKD 3KXBD 3AZKC 5B32B 1A7WA 4XZQC 5DNMC 4QLCA 3AZJA 5B40C 5GT3A 1EQZA 3VH6A 5B0YB 1P3FC 3UTBA 3AV2B 3RELD 2NZDC 4H9NA 5AV8C 5BS7C 3X1TA 2IO5C 2Y2MA 2PYOD 1AOID 1H3OB 4J8UB 3C1CC 5AV9A 3B0DB 2YFWA 1M19D 2F8NG 5B1MA 1HQ3C 3A6NA 1P3PA 5FUGA 3UTAB 3REHB 3AZGB 4J8WC 4NFTA 3AYWB 5CPID 4UUZA 3KUYD 5B33C 5B32G 1P3AC 4Z5TB 5AVCA 5CP6C 3X1UA 1S32B 3W96D 5B31C 4G91B 3W97A 1P3BB 1KX3C 3B6GC 5JA4A 1P3GD 1ZLAC 1JFIA 2LY8A 5AY8C 4YM6C 5GSUA 3AZHD 3KXBB 4YS3A 1WWSA 3AFAD 3WKJC 5E5AA 3W98D 5DNNB 3LELB 3KWQB 3KFUG 3AN2D 2BYKB 1F1EA 4H9QB 5BO0A 4LD9C 3RELB 1N1JB 2XD1A 5B2JB 4WNNB 3X1VD 5BT1C 3TU4C 1TAFB 2HUEC 5AVBC 3WA9D 2Y2IA 3AZEB 1AOIB 2AROA 1BH9B 5B32A 2F8NK 1ID3C 1F66B 1P3KD 5B2IB 4R8PD 2Y2KA 3UT9C 2HIOD 3AV2A 3R45B 4EO5C 4J8XA 4G92B 3MGQA 1TZYD 4Z66A 3MGPD 3MVDA 5CPIB 4WU8C 3WTPC 4J8UA 1KU5A 1P3IA 1M1AD 5AV5A 3P5JB 5AV6C 3AZJB 3AZMC 4X23A 3LJAA 4JJNC 4Z2MH 3AZGA 1M18C 1EQZB 2Y2OA 4KHAB 4J8VB 3C1BD 3AFAB 4ZUXB 3H0RC 4NE3A 2VQRA 3REIA 3AYWA 1P3LD 3X1TB 1KX4C 3AZFD 3UTBC 5F99C 5AV9B 5GT0A 2ZM5A 3REJA 4H9SC 5FUGB 4E44A 5CPKA 3KXBA 1U35D 1ULYA 2CV5D 1P3MC 4M6BA 5GXQD 1P3PC 4WZSB 3AV1D 3KWQA 4CSRB 4WU9D 3X1SC 4R8PB 3LZ1C 4H9QA 2HIOB 5AVCB 3AZKD 3RELA 5B2JA 4AWLC 5B40D 5JA4B 1TAFA 2Y2LA 2FJ7D 2PYOA 1Z2CB 3X1UC 3EPJA 1AOIA 5GSUB 1BH9A 5JRGC 1M1AB 3W97C 2NZDD 4KUDD 5AV8D 2JE5A 4XUJB 1M19A 1B6WA 3KSYA 4YS3C 3C1CD 5E5AC 3B0BA 3C1BB 4UPKA 5B1LC 1HQ3D 5B24C 2J8PA 5CPIA 4ZBJB 3KUYA 3EPHA 4J8WD 2G5IC 2JSSA 2AROB 3VH5T 3W96A 1P3GA 3VH5W 5C3IC 5B33D 3AZIC 4KHAA 5B32C 5CP6D 3AZHA 5B31D 4J8VA 1U35B 2CV5B 1KX3D 4DRAA 3MGRC 3AFAA 4ZUXA 3B6GD 4H9RB 4J8XB 3W98A 3MGSC 5B0YC 4Z66B 3MGQB 3AZNB 3MVDB 1P34C 5AY8D 3AV2C 4YM6D 3AN2A 4CAYA 3X1VA 1P3IB 5CPJC 5AV5B 3VH6T 3AZLD 3A1IA 4X23B 3WA9A 3LJAB 2FJ7B 3B0DC 4LD9D 3TU4D 2ZY2A 3UTAC 3REIB 1BH8A 4KUDB 3REHC 3AZGC 4CSRA 4DQYB 2Y2HA 4R8PA 2HIOA 3C1CB 3AYWC 1ID3D 5GT0B 5CHLB 1TZYA 2FFFB 3MGPA 3REJB 2G5HC 4Z5TC 4J8WB 3UT9D 1S32C 4WJ3C 4G91C 5CPKB 1P3BC 3REKB 1M1AA 1Q9CA 3O62D 4XUJA 4WU8D 3KXBC 5B0ZC 3B6FD 3C1BA 3NQJB 5DNNC 3LELC 5AV6D 3KWQC 3AZMD 1P3LA 3MNND 4JJND 1M18D 3AZFA 3B0CT 4YM6B 2PYOB 5B2JC 5G49A 3B0CW 2UWXA 3AZLB 5BNVA 1M19B 1KX4D 3AZEC 1AOIC 5F99D 2NQBD 2YFVB 1U35A 2CV5A 4H9RA 1F66C 5GXQA 1WWIA 2JCHA 2HUEB 3AZNA 5B2IC 3KUYB 4KGCD 3AL0C
chains in the Genus database with same CATH topology
3AZKA 4G92C 1P3MD 3W96B 1P3PD 3W99D 5CPIC 1ID3B 3LZ0C 1P3GB 2DF4C 3X1SD 2FJ7A 2BG1A 3LZ1D 3AZHB 1B67A 1KX5D 4QLCC 3AZJC 2Y2PA 4KUDA 3O62B 2Y2JA 5GT3C 1EQZC 1P3OD 3W98B 3WAAD 4J8VC 2F2AC 3AN2B 4Z2MG 4CAYB 5JRGD 3C1CA 3AFAC 4ZUXC 3B6FB 3X1VB 3NQUB 3X1TC 1HQ3A 2ZY3A 3MNNB 1M18B 4J8WA 3WA9B 5AV9C 3REKA 2RIQA 5B1LD 5B1MC 5B24D 3A6NC 1BH8B 2Y2QA 2F8ND 1P3KB 2NQBB 3IP4C 5CP6A 4NE6A 5B31A 3NQJA 3B6GA 4XZQD 5DNMD 1TZYB 3MGPB 1P3FD 3AZID 5AVCC 2ZY4A 4YM6A 4KGCB 3MGRD 2W8SA 3H0MC 3MGSD 3AZLA 3W99B 5B0YD 1P34D 5GSUC 2YFVA 1KX5B 5CPJD 4XUJC 3TU4A 2BYMA 2RVQC 1P3LB 1P3OB 4HGAB 3AZFB 3WAAB 3C1BC 5G49B 5KDMA 3UTAD 4ZBJC 4E45A 1ID3A 3REHD 3AZGD 5BNVB 3V9RB 3UT9A 1P3AD 2AROC 3AYWD 3VH5A 1ZLAD 5B1LB 3O62A 5GXQB 4WU8A 3AV1B 4Z5TD 1S32D 4WU9B 1U35C 2CV5C 1P3BD 3B6FA 3AZKB 4J8XC 3WKJD 3NQUA 4XZQB 3MGQC 5AV6A 4Z66C 2CWEA 5B40B 3MVDC 5DNMB 3MNNA 5C3IB 4JJNA 3AZNC 3VH6W 1M18A 4J8UC 1P3FB 3AZIB 5B0ZD 5BNXB 1P3IC 5AV5C 5DNND 3LELD 3MGRB 2NZDB 5BT1D 3KWQD 4X23C 3MGSB 5AV8B 3LJAC 1P34B 1KX4A 2FJ7C 5AVBD 1P3KA 2IO5B 5F99A 2NQBA 5B2JD 3H0LC 2F8NH 5CPJB 3REIC 4KUDC 4NE5A 1HQ3B 4H9SA 3AZED 4H9PB 4KGCA 1P3MA 5GT0C 1F66D 2L5AA 3REJC 3W99A 5B2ID 1R4VA 5B33B 3X1SA 5CPKC 3WTPD 3LZ1A 3REKC 1P3AB 5CP6B 2Y2NA 1KX5A 5B31B 3EG5B 1KX3B 3B6GB 3LZ0D 1ZLAB 4H9OA 2DQNC 1P3OA 5AY8B 3WAAA 3RELC 5JRGA 4QLCD 3AZJD 3WKJB 5GT3D 1EQZD 3V9RA 3EPLA 2PYOC 3UTBD 4J8VD 5B0ZB 3FDDA 4ZUXD 4LD9B 3AZLC 3X1TD 1M19C 5B1LA 5B24A 3TU4B 2BYMB 1W2EA 3AV1A 5AVBB 2F8NA 4WU9A 5AV9D 2XD5A 5KDMB 5B1MD 4XZQA 5DNMA 3A6ND 5B40A 3KUYC 5B31G 1P3FA 3AZIA 3UT9B 5BNXA 3W96C 4EO5B 1HTAA 3MGRA 2NZDA 1P3GC 3MGSA 5AV8A 5BS7A 5B0YA 3WTPE 1P34A 4WU8B 5AVCD 3X1UD 3AZHC 3WTPB 3W97D 5CPJA 3O62C 3W98C 3LZ0B 5AV6B 3AZMB 1H3OA 4JJNB 3AN2C 5GSUD 4H9PA 3B6FC 4YS3D 3X1VC 5E5AD 4XUJD 4DRBA 4QLCB 3MNNC 3UTAA 2RVQD 5GT3B 3REHA 3WA9C 5B33A 1KX4B 3UTBB 1P3AA 5F99B 4WV4B 1KX3A 4H9NB 2Y2GA 1ZLAA 1P3KC 2NQBC 4Z5TA 4R8PC 1S32A 2AROD 2HIOC 1T3UA 5AY8A 5B32D 1P3BA 2YFWB 3A1KA 1P3MB 3WKJA 5B1MB 3A6NB 1TZYC 1P3PB 3MGPC 4KGCC 3X1SB 3AV2D 5B0ZA 3LZ1B 1M1AC 4LD9A 4J8XD 5DNNA 3W99C 3LELA 3MGQD 4Z66D 4AWLB 3AZND 3MVDD 4UUZB 4H9OB 5AVBA 2BYKA 4J8UD 1BFMA 1N1JA 3X1UB 1P3ID 4WNNA 1KX5C 5AV5D 3W97B 5JRGB 1JFIB 4X23D 1P3LC 1P3OC 1PZRA 4HGAC 2ZY5A 3LJAD 3AZEA 3AZFC 3WAAC 4YS3B 3F6TA 3REID 5E5AB 1F66A 5B24B 5B2IA 2F8NB 3R45A 5BO0B 3WTPA 5GT0D 3EPKA 5GXQC 3REJD 3LZ0A 3AV1C 3AZMA 4WU9C 5CPKD 3REKD 3KXBD 3AZKC 5B32B 1A7WA 4XZQC 5DNMC 4QLCA 3AZJA 5B40C 5GT3A 1EQZA 3VH6A 5B0YB 1P3FC 3UTBA 3AV2B 3RELD 2NZDC 4H9NA 5AV8C 5BS7C 3X1TA 2IO5C 2Y2MA 2PYOD 1AOID 1H3OB 4J8UB 3C1CC 5AV9A 3B0DB 2YFWA 1M19D 2F8NG 5B1MA 1HQ3C 3A6NA 1P3PA 5FUGA 3UTAB 3REHB 3AZGB 4J8WC 4NFTA 3AYWB 5CPID 4UUZA 3KUYD 5B33C 5B32G 1P3AC 4Z5TB 5AVCA 5CP6C 3X1UA 1S32B 3W96D 5B31C 4G91B 3W97A 1P3BB 1KX3C 3B6GC 5JA4A 1P3GD 1ZLAC 1JFIA 2LY8A 5AY8C 4YM6C 5GSUA 3AZHD 3KXBB 4YS3A 1WWSA 3AFAD 3WKJC 5E5AA 3W98D 5DNNB 3LELB 3KWQB 3KFUG 3AN2D 2BYKB 1F1EA 4H9QB 5BO0A 4LD9C 3RELB 1N1JB 2XD1A 5B2JB 4WNNB 3X1VD 5BT1C 3TU4C 1TAFB 2HUEC 5AVBC 3WA9D 2Y2IA 3AZEB 1AOIB 2AROA 1BH9B 5B32A 2F8NK 1ID3C 1F66B 1P3KD 5B2IB 4R8PD 2Y2KA 3UT9C 2HIOD 3AV2A 3R45B 4EO5C 4J8XA 4G92B 3MGQA 1TZYD 4Z66A 3MGPD 3MVDA 5CPIB 4WU8C 3WTPC 4J8UA 1KU5A 1P3IA 1M1AD 5AV5A 3P5JB 5AV6C 3AZJB 3AZMC 4X23A 3LJAA 4JJNC 4Z2MH 3AZGA 1M18C 1EQZB 2Y2OA 4KHAB 4J8VB 3C1BD 3AFAB 4ZUXB 3H0RC 4NE3A 2VQRA 3REIA 3AYWA 1P3LD 3X1TB 1KX4C 3AZFD 3UTBC 5F99C 5AV9B 5GT0A 2ZM5A 3REJA 4H9SC 5FUGB 4E44A 5CPKA 3KXBA 1U35D 1ULYA 2CV5D 1P3MC 4M6BA 5GXQD 1P3PC 4WZSB 3AV1D 3KWQA 4CSRB 4WU9D 3X1SC 4R8PB 3LZ1C 4H9QA 2HIOB 5AVCB 3AZKD 3RELA 5B2JA 4AWLC 5B40D 5JA4B 1TAFA 2Y2LA 2FJ7D 2PYOA 1Z2CB 3X1UC 3EPJA 1AOIA 5GSUB 1BH9A 5JRGC 1M1AB 3W97C 2NZDD 4KUDD 5AV8D 2JE5A 4XUJB 1M19A 1B6WA 3KSYA 4YS3C 3C1CD 5E5AC 3B0BA 3C1BB 4UPKA 5B1LC 1HQ3D 5B24C 2J8PA 5CPIA 4ZBJB 3KUYA 3EPHA 4J8WD 2G5IC 2JSSA 2AROB 3VH5T 3W96A 1P3GA 3VH5W 5C3IC 5B33D 3AZIC 4KHAA 5B32C 5CP6D 3AZHA 5B31D 4J8VA 1U35B 2CV5B 1KX3D 4DRAA 3MGRC 3AFAA 4ZUXA 3B6GD 4H9RB 4J8XB 3W98A 3MGSC 5B0YC 4Z66B 3MGQB 3AZNB 3MVDB 1P34C 5AY8D 3AV2C 4YM6D 3AN2A 4CAYA 3X1VA 1P3IB 5CPJC 5AV5B 3VH6T 3AZLD 3A1IA 4X23B 3WA9A 3LJAB 2FJ7B 3B0DC 4LD9D 3TU4D 2ZY2A 3UTAC 3REIB 1BH8A 4KUDB 3REHC 3AZGC 4CSRA 4DQYB 2Y2HA 4R8PA 2HIOA 3C1CB 3AYWC 1ID3D 5GT0B 5CHLB 1TZYA 2FFFB 3MGPA 3REJB 2G5HC 4Z5TC 4J8WB 3UT9D 1S32C 4WJ3C 4G91C 5CPKB 1P3BC 3REKB 1M1AA 1Q9CA 3O62D 4XUJA 4WU8D 3KXBC 5B0ZC 3B6FD 3C1BA 3NQJB 5DNNC 3LELC 5AV6D 3KWQC 3AZMD 1P3LA 3MNND 4JJND 1M18D 3AZFA 3B0CT 4YM6B 2PYOB 5B2JC 5G49A 3B0CW 2UWXA 3AZLB 5BNVA 1M19B 1KX4D 3AZEC 1AOIC 5F99D 2NQBD 2YFVB 1U35A 2CV5A 4H9RA 1F66C 5GXQA 1WWIA 2JCHA 2HUEB 3AZNA 5B2IC 3KUYB 4KGCD 3AL0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZK A;  4G92 C;  1P3M D;  3W96 B;  1P3P D;  3W99 D;  5CPI C;  1ID3 B;  3LZ0 C;  1P3G B;  3X1S D;  2FJ7 A;  3LZ1 D;  3AZH B;  1B67 A;  1KX5 D;  4QLC C;  3AZJ C;  4KUD A;  3O62 B;  3W98 B;  5GT3 C;  1EQZ C;  1P3O D;  3WAA D;  4J8V C;  3AN2 B;  4Z2M G;  4CAY B;  5JRG D;  3C1C A;  3AFA C;  4ZUX C;  3B6F B;  3X1V B;  3NQU B;  3X1T C;  1HQ3 A;  3MNN B;  1M18 B;  4J8W A;  3WA9 B;  5AV9 C;  3REK A;  5B1L D;  5B1M C;  5B24 D;  3A6N C;  1BH8 B;  2F8N D;  1P3K B;  2NQB B;  5CP6 A;  4NE6 A;  5B31 A;  3NQJ A;  3B6G A;  4XZQ D;  5DNM D;  1TZY B;  3MGP B;  1P3F D;  3AZI D;  5AVC C;  4YM6 A;  4KGC B;  3MGR D;  3MGS D;  3AZL A;  3W99 B;  5B0Y D;  1P34 D;  5GSU C;  2YFV A;  1KX5 B;  5CPJ D;  4XUJ C;  3TU4 A;  2BYM A;  2RVQ C;  1P3L B;  1P3O B;  4HGA B;  3AZF B;  3WAA B;  3C1B C;  5G49 B;  5KDM A;  3UTA D;  4ZBJ C;  4E45 A;  1ID3 A;  3REH D;  3AZG D;  5BNV B;  3V9R B;  3UT9 A;  1P3A D;  2ARO C;  3AYW D;  3VH5 A;  1ZLA D;  5B1L B;  3O62 A;  5GXQ B;  4WU8 A;  3AV1 B;  4Z5T D;  1S32 D;  4WU9 B;  1U35 C;  2CV5 C;  1P3B D;  3B6F A;  3AZK B;  4J8X C;  3WKJ D;  3NQU A;  4XZQ B;  3MGQ C;  5AV6 A;  4Z66 C;  2CWE A;  5B40 B;  3MVD C;  5DNM B;  3MNN A;  5C3I B;  4JJN A;  3AZN C;  3VH6 W;  1M18 A;  4J8U C;  1P3F B;  3AZI B;  5B0Z D;  5BNX B;  1P3I C;  5AV5 C;  5DNN D;  3LEL D;  3MGR B;  2NZD B;  5BT1 D;  3KWQ D;  4X23 C;  3MGS B;  5AV8 B;  3LJA C;  1P34 B;  1KX4 A;  2FJ7 C;  5AVB D;  1P3K A;  2IO5 B;  5F99 A;  2NQB A;  5B2J D;  2F8N H;  5CPJ B;  3REI C;  4KUD C;  4NE5 A;  1HQ3 B;  4H9S A;  3AZE D;  4H9P B;  4KGC A;  1P3M A;  5GT0 C;  1F66 D;  2L5A A;  3REJ C;  3W99 A;  5B2I D;  1R4V A;  5B33 B;  3X1S A;  5CPK C;  3WTP D;  3LZ1 A;  3REK C;  1P3A B;  5CP6 B;  1KX5 A;  5B31 B;  1KX3 B;  3B6G B;  3LZ0 D;  1ZLA B;  4H9O A;  1P3O A;  5AY8 B;  3WAA A;  3REL C;  5JRG A;  4QLC D;  3AZJ D;  3WKJ B;  5GT3 D;  1EQZ D;  3V9R A;  2PYO C;  3UTB D;  4J8V D;  5B0Z B;  4ZUX D;  4LD9 B;  3AZL C;  3X1T D;  1M19 C;  5B1L A;  5B24 A;  3TU4 B;  2BYM B;  3AV1 A;  5AVB B;  2F8N A;  4WU9 A;  5AV9 D;  5KDM B;  5B1M D;  4XZQ A;  5DNM A;  3A6N D;  5B40 A;  3KUY C;  5B31 G;  1P3F A;  3AZI A;  3UT9 B;  5BNX A;  3W96 C;  4EO5 B;  1HTA A;  3MGR A;  2NZD A;  1P3G C;  3MGS A;  3WTP E;  5BS7 A;  5AV8 A;  5B0Y A;  1P34 A;  4WU8 B;  5AVC D;  3X1U D;  3AZH C;  3WTP B;  3W97 D;  5CPJ A;  3O62 C;  3W98 C;  3LZ0 B;  5AV6 B;  3AZM B;  1H3O A;  4JJN B;  3AN2 C;  5GSU D;  4H9P A;  3B6F C;  4YS3 D;  3X1V C;  5E5A D;  4XUJ D;  4QLC B;  4DRB A;  3MNN C;  3UTA A;  2RVQ D;  5GT3 B;  3REH A;  3WA9 C;  5B33 A;  1KX4 B;  3UTB B;  1P3A A;  5F99 B;  4WV4 B;  1KX3 A;  4H9N B;  1ZLA A;  1P3K C;  2NQB C;  4Z5T A;  4R8P C;  1S32 A;  2ARO D;  2HIO C;  5AY8 A;  5B32 D;  1P3B A;  2YFW B;  1P3M B;  3WKJ A;  5B1M B;  3A6N B;  1TZY C;  1P3P B;  3MGP C;  4KGC C;  3X1S B;  3AV2 D;  5B0Z A;  3LZ1 B;  1M1A C;  4LD9 A;  4J8X D;  5DNN A;  3W99 C;  3LEL A;  3MGQ D;  4Z66 D;  4AWL B;  3AZN D;  3MVD D;  4UUZ B;  4H9O B;  5AVB A;  2BYK A;  4J8U D;  1BFM A;  1N1J A;  3X1U B;  1P3I D;  4WNN A;  1KX5 C;  5AV5 D;  3W97 B;  5JRG B;  1JFI B;  4X23 D;  1P3L C;  1P3O C;  4HGA C;  3LJA D;  3AZE A;  3AZF C;  3WAA C;  4YS3 B;  3REI D;  5E5A B;  1F66 A;  5B24 B;  5B2I A;  2F8N B;  3R45 A;  5BO0 B;  3WTP A;  5GT0 D;  5GXQ C;  3REJ D;  3LZ0 A;  3AV1 C;  3AZM A;  4WU9 C;  5CPK D;  3REK D;  3KXB D;  3AZK C;  5B32 B;  1A7W A;  4XZQ C;  5DNM C;  4QLC A;  3AZJ A;  5B40 C;  5GT3 A;  1EQZ A;  3VH6 A;  5B0Y B;  1P3F C;  3UTB A;  3AV2 B;  3REL D;  2NZD C;  4H9N A;  5AV8 C;  5BS7 C;  3X1T A;  2IO5 C;  2PYO D;  1AOI D;  1H3O B;  4J8U B;  3C1C C;  5AV9 A;  3B0D B;  2YFW A;  1M19 D;  2F8N G;  5B1M A;  1HQ3 C;  3A6N A;  1P3P A;  5FUG A;  3UTA B;  3REH B;  3AZG B;  4J8W C;  4NFT A;  3AYW B;  5CPI D;  4UUZ A;  3KUY D;  5B33 C;  5B32 G;  1P3A C;  4Z5T B;  5AVC A;  5CP6 C;  3X1U A;  1S32 B;  3W96 D;  5B31 C;  4G91 B;  3W97 A;  1P3B B;  1KX3 C;  3B6G C;  5JA4 A;  1P3G D;  1ZLA C;  1JFI A;  2LY8 A;  5AY8 C;  4YM6 C;  5GSU A;  3AZH D;  3KXB B;  4YS3 A;  1WWS A;  3AFA D;  3WKJ C;  5E5A A;  3W98 D;  5DNN B;  3LEL B;  3KWQ B;  3AN2 D;  2BYK B;  1F1E A;  4H9Q B;  5BO0 A;  4LD9 C;  3REL B;  1N1J B;  5B2J B;  3X1V D;  4WNN B;  5BT1 C;  3TU4 C;  1TAF B;  2HUE C;  5AVB C;  3WA9 D;  3AZE B;  1AOI B;  2ARO A;  1BH9 B;  5B32 A;  2F8N K;  1ID3 C;  1F66 B;  1P3K D;  5B2I B;  4R8P D;  3UT9 C;  2HIO D;  3AV2 A;  3R45 B;  4EO5 C;  4J8X A;  4G92 B;  3MGQ A;  1TZY D;  4Z66 A;  3MGP D;  3MVD A;  5CPI B;  4WU8 C;  3WTP C;  4J8U A;  1KU5 A;  1P3I A;  1M1A D;  5AV5 A;  5AV6 C;  3AZJ B;  3AZM C;  4X23 A;  3LJA A;  4JJN C;  4Z2M H;  3AZG A;  1M18 C;  1EQZ B;  4KHA B;  4J8V B;  3C1B D;  3AFA B;  4ZUX B;  4NE3 A;  3REI A;  3AYW A;  1P3L D;  3X1T B;  1KX4 C;  3AZF D;  3UTB C;  5F99 C;  5AV9 B;  5GT0 A;  3REJ A;  4H9S C;  5FUG B;  4E44 A;  5CPK A;  3KXB A;  1U35 D;  1ULY A;  2CV5 D;  1P3M C;  4M6B A;  5GXQ D;  1P3P C;  4WZS B;  3AV1 D;  3KWQ A;  4CSR B;  4WU9 D;  3X1S C;  4R8P B;  3LZ1 C;  4H9Q A;  2HIO B;  5AVC B;  3AZK D;  3REL A;  5B2J A;  4AWL C;  5B40 D;  5JA4 B;  1TAF A;  2FJ7 D;  2PYO A;  1AOI A;  3X1U C;  5GSU B;  1BH9 A;  5JRG C;  1M1A B;  3W97 C;  2NZD D;  4KUD D;  5AV8 D;  4XUJ B;  1M19 A;  1B6W A;  3KSY A;  4YS3 C;  3C1C D;  5E5A C;  3B0B A;  3C1B B;  5B1L C;  1HQ3 D;  5B24 C;  5CPI A;  4ZBJ B;  3KUY A;  4J8W D;  2JSS A;  2ARO B;  3VH5 T;  3W96 A;  1P3G A;  3VH5 W;  5C3I C;  5B33 D;  3AZI C;  4KHA A;  5B32 C;  5CP6 D;  3AZH A;  5B31 D;  4J8V A;  1U35 B;  2CV5 B;  1KX3 D;  4DRA A;  3MGR C;  3AFA A;  4ZUX A;  3B6G D;  4H9R B;  4J8X B;  3W98 A;  3MGS C;  5B0Y C;  4Z66 B;  3MGQ B;  3AZN B;  3MVD B;  1P34 C;  5AY8 D;  3AV2 C;  4YM6 D;  3AN2 A;  4CAY A;  3X1V A;  1P3I B;  5CPJ C;  5AV5 B;  3VH6 T;  3AZL D;  4X23 B;  3WA9 A;  3LJA B;  2FJ7 B;  3B0D C;  4LD9 D;  3TU4 D;  3UTA C;  3REI B;  1BH8 A;  4KUD B;  3REH C;  3AZG C;  4CSR A;  4R8P A;  2HIO A;  3C1C B;  3AYW C;  1ID3 D;  5GT0 B;  5CHL B;  1TZY A;  3MGP A;  3REJ B;  4Z5T C;  4J8W B;  3UT9 D;  1S32 C;  4G91 C;  5CPK B;  1P3B C;  3REK B;  1M1A A;  1Q9C A;  3O62 D;  4XUJ A;  4WU8 D;  3KXB C;  5B0Z C;  3B6F D;  3C1B A;  3NQJ B;  5DNN C;  3LEL C;  5AV6 D;  3KWQ C;  3AZM D;  1P3L A;  3MNN D;  4JJN D;  1M18 D;  3AZF A;  3B0C T;  4YM6 B;  2PYO B;  5B2J C;  5G49 A;  3B0C W;  3AZL B;  5BNV A;  1M19 B;  1KX4 D;  3AZE C;  1AOI C;  5F99 D;  2NQB D;  2YFV B;  1U35 A;  2CV5 A;  4H9R A;  1F66 C;  5GXQ A;  1WWI A;  2HUE B;  3AZN A;  5B2I C;  3KUY B;  4KGC D; 
#chains in the Genus database with same CATH topology
 3AZK A;  4G92 C;  1P3M D;  3W96 B;  1P3P D;  3W99 D;  5CPI C;  1ID3 B;  3LZ0 C;  1P3G B;  2DF4 C;  3X1S D;  2FJ7 A;  2BG1 A;  3LZ1 D;  3AZH B;  1B67 A;  1KX5 D;  4QLC C;  3AZJ C;  2Y2P A;  4KUD A;  3O62 B;  2Y2J A;  5GT3 C;  1EQZ C;  1P3O D;  3W98 B;  3WAA D;  4J8V C;  2F2A C;  3AN2 B;  4Z2M G;  4CAY B;  5JRG D;  3C1C A;  3AFA C;  4ZUX C;  3B6F B;  3X1V B;  3NQU B;  3X1T C;  1HQ3 A;  2ZY3 A;  3MNN B;  1M18 B;  4J8W A;  3WA9 B;  5AV9 C;  3REK A;  2RIQ A;  5B1L D;  5B1M C;  5B24 D;  3A6N C;  1BH8 B;  2Y2Q A;  2F8N D;  1P3K B;  2NQB B;  3IP4 C;  5CP6 A;  4NE6 A;  5B31 A;  3NQJ A;  3B6G A;  4XZQ D;  5DNM D;  1TZY B;  3MGP B;  1P3F D;  3AZI D;  5AVC C;  2ZY4 A;  4YM6 A;  4KGC B;  3MGR D;  2W8S A;  3H0M C;  3MGS D;  3AZL A;  3W99 B;  5B0Y D;  1P34 D;  5GSU C;  2YFV A;  1KX5 B;  5CPJ D;  4XUJ C;  3TU4 A;  2BYM A;  2RVQ C;  1P3L B;  1P3O B;  4HGA B;  3AZF B;  3WAA B;  3C1B C;  5G49 B;  5KDM A;  3UTA D;  4ZBJ C;  4E45 A;  1ID3 A;  3REH D;  3AZG D;  5BNV B;  3V9R B;  3UT9 A;  1P3A D;  2ARO C;  3AYW D;  3VH5 A;  1ZLA D;  5B1L B;  3O62 A;  5GXQ B;  4WU8 A;  3AV1 B;  4Z5T D;  1S32 D;  4WU9 B;  1U35 C;  2CV5 C;  1P3B D;  3B6F A;  3AZK B;  4J8X C;  3WKJ D;  3NQU A;  4XZQ B;  3MGQ C;  5AV6 A;  4Z66 C;  2CWE A;  5B40 B;  3MVD C;  5DNM B;  3MNN A;  5C3I B;  4JJN A;  3AZN C;  3VH6 W;  1M18 A;  4J8U C;  1P3F B;  3AZI B;  5B0Z D;  5BNX B;  1P3I C;  5AV5 C;  5DNN D;  3LEL D;  3MGR B;  2NZD B;  5BT1 D;  3KWQ D;  4X23 C;  3MGS B;  5AV8 B;  3LJA C;  1P34 B;  1KX4 A;  2FJ7 C;  5AVB D;  1P3K A;  2IO5 B;  5F99 A;  2NQB A;  5B2J D;  3H0L C;  2F8N H;  5CPJ B;  3REI C;  4KUD C;  4NE5 A;  1HQ3 B;  4H9S A;  3AZE D;  4H9P B;  4KGC A;  1P3M A;  5GT0 C;  1F66 D;  2L5A A;  3REJ C;  3W99 A;  5B2I D;  1R4V A;  5B33 B;  3X1S A;  5CPK C;  3WTP D;  3LZ1 A;  3REK C;  1P3A B;  5CP6 B;  2Y2N A;  1KX5 A;  5B31 B;  3EG5 B;  1KX3 B;  3B6G B;  3LZ0 D;  1ZLA B;  4H9O A;  2DQN C;  1P3O A;  5AY8 B;  3WAA A;  3REL C;  5JRG A;  4QLC D;  3AZJ D;  3WKJ B;  5GT3 D;  1EQZ D;  3V9R A;  3EPL A;  2PYO C;  3UTB D;  4J8V D;  5B0Z B;  3FDD A;  4ZUX D;  4LD9 B;  3AZL C;  3X1T D;  1M19 C;  5B1L A;  5B24 A;  3TU4 B;  2BYM B;  1W2E A;  3AV1 A;  5AVB B;  2F8N A;  4WU9 A;  5AV9 D;  2XD5 A;  5KDM B;  5B1M D;  4XZQ A;  5DNM A;  3A6N D;  5B40 A;  3KUY C;  5B31 G;  1P3F A;  3AZI A;  3UT9 B;  5BNX A;  3W96 C;  4EO5 B;  1HTA A;  3MGR A;  2NZD A;  1P3G C;  3MGS A;  5AV8 A;  5BS7 A;  5B0Y A;  3WTP E;  1P34 A;  4WU8 B;  5AVC D;  3X1U D;  3AZH C;  3WTP B;  3W97 D;  5CPJ A;  3O62 C;  3W98 C;  3LZ0 B;  5AV6 B;  3AZM B;  1H3O A;  4JJN B;  3AN2 C;  5GSU D;  4H9P A;  3B6F C;  4YS3 D;  3X1V C;  5E5A D;  4XUJ D;  4DRB A;  4QLC B;  3MNN C;  3UTA A;  2RVQ D;  5GT3 B;  3REH A;  3WA9 C;  5B33 A;  1KX4 B;  3UTB B;  1P3A A;  5F99 B;  4WV4 B;  1KX3 A;  4H9N B;  2Y2G A;  1ZLA A;  1P3K C;  2NQB C;  4Z5T A;  4R8P C;  1S32 A;  2ARO D;  2HIO C;  1T3U A;  5AY8 A;  5B32 D;  1P3B A;  2YFW B;  3A1K A;  1P3M B;  3WKJ A;  5B1M B;  3A6N B;  1TZY C;  1P3P B;  3MGP C;  4KGC C;  3X1S B;  3AV2 D;  5B0Z A;  3LZ1 B;  1M1A C;  4LD9 A;  4J8X D;  5DNN A;  3W99 C;  3LEL A;  3MGQ D;  4Z66 D;  4AWL B;  3AZN D;  3MVD D;  4UUZ B;  4H9O B;  5AVB A;  2BYK A;  4J8U D;  1BFM A;  1N1J A;  3X1U B;  1P3I D;  4WNN A;  1KX5 C;  5AV5 D;  3W97 B;  5JRG B;  1JFI B;  4X23 D;  1P3L C;  1P3O C;  1PZR A;  4HGA C;  2ZY5 A;  3LJA D;  3AZE A;  3AZF C;  3WAA C;  4YS3 B;  3F6T A;  3REI D;  5E5A B;  1F66 A;  5B24 B;  5B2I A;  2F8N B;  3R45 A;  5BO0 B;  3WTP A;  5GT0 D;  3EPK A;  5GXQ C;  3REJ D;  3LZ0 A;  3AV1 C;  3AZM A;  4WU9 C;  5CPK D;  3REK D;  3KXB D;  3AZK C;  5B32 B;  1A7W A;  4XZQ C;  5DNM C;  4QLC A;  3AZJ A;  5B40 C;  5GT3 A;  1EQZ A;  3VH6 A;  5B0Y B;  1P3F C;  3UTB A;  3AV2 B;  3REL D;  2NZD C;  4H9N A;  5AV8 C;  5BS7 C;  3X1T A;  2IO5 C;  2Y2M A;  2PYO D;  1AOI D;  1H3O B;  4J8U B;  3C1C C;  5AV9 A;  3B0D B;  2YFW A;  1M19 D;  2F8N G;  5B1M A;  1HQ3 C;  3A6N A;  1P3P A;  5FUG A;  3UTA B;  3REH B;  3AZG B;  4J8W C;  4NFT A;  3AYW B;  5CPI D;  4UUZ A;  3KUY D;  5B33 C;  5B32 G;  1P3A C;  4Z5T B;  5AVC A;  5CP6 C;  3X1U A;  1S32 B;  3W96 D;  5B31 C;  4G91 B;  3W97 A;  1P3B B;  1KX3 C;  3B6G C;  5JA4 A;  1P3G D;  1ZLA C;  1JFI A;  2LY8 A;  5AY8 C;  4YM6 C;  5GSU A;  3AZH D;  3KXB B;  4YS3 A;  1WWS A;  3AFA D;  3WKJ C;  5E5A A;  3W98 D;  5DNN B;  3LEL B;  3KWQ B;  3KFU G;  3AN2 D;  2BYK B;  1F1E A;  4H9Q B;  5BO0 A;  4LD9 C;  3REL B;  1N1J B;  2XD1 A;  5B2J B;  4WNN B;  3X1V D;  5BT1 C;  3TU4 C;  1TAF B;  2HUE C;  5AVB C;  3WA9 D;  2Y2I A;  3AZE B;  1AOI B;  2ARO A;  1BH9 B;  5B32 A;  2F8N K;  1ID3 C;  1F66 B;  1P3K D;  5B2I B;  4R8P D;  2Y2K A;  3UT9 C;  2HIO D;  3AV2 A;  3R45 B;  4EO5 C;  4J8X A;  4G92 B;  3MGQ A;  1TZY D;  4Z66 A;  3MGP D;  3MVD A;  5CPI B;  4WU8 C;  3WTP C;  4J8U A;  1KU5 A;  1P3I A;  1M1A D;  5AV5 A;  3P5J B;  5AV6 C;  3AZJ B;  3AZM C;  4X23 A;  3LJA A;  4JJN C;  4Z2M H;  3AZG A;  1M18 C;  1EQZ B;  2Y2O A;  4KHA B;  4J8V B;  3C1B D;  3AFA B;  4ZUX B;  3H0R C;  4NE3 A;  2VQR A;  3REI A;  3AYW A;  1P3L D;  3X1T B;  1KX4 C;  3AZF D;  3UTB C;  5F99 C;  5AV9 B;  5GT0 A;  2ZM5 A;  3REJ A;  4H9S C;  5FUG B;  4E44 A;  5CPK A;  3KXB A;  1U35 D;  1ULY A;  2CV5 D;  1P3M C;  4M6B A;  5GXQ D;  1P3P C;  4WZS B;  3AV1 D;  3KWQ A;  4CSR B;  4WU9 D;  3X1S C;  4R8P B;  3LZ1 C;  4H9Q A;  2HIO B;  5AVC B;  3AZK D;  3REL A;  5B2J A;  4AWL C;  5B40 D;  5JA4 B;  1TAF A;  2Y2L A;  2FJ7 D;  2PYO A;  1Z2C B;  3X1U C;  3EPJ A;  1AOI A;  5GSU B;  1BH9 A;  5JRG C;  1M1A B;  3W97 C;  2NZD D;  4KUD D;  5AV8 D;  2JE5 A;  4XUJ B;  1M19 A;  1B6W A;  3KSY A;  4YS3 C;  3C1C D;  5E5A C;  3B0B A;  3C1B B;  4UPK A;  5B1L C;  1HQ3 D;  5B24 C;  2J8P A;  5CPI A;  4ZBJ B;  3KUY A;  3EPH A;  4J8W D;  2G5I C;  2JSS A;  2ARO B;  3VH5 T;  3W96 A;  1P3G A;  3VH5 W;  5C3I C;  5B33 D;  3AZI C;  4KHA A;  5B32 C;  5CP6 D;  3AZH A;  5B31 D;  4J8V A;  1U35 B;  2CV5 B;  1KX3 D;  4DRA A;  3MGR C;  3AFA A;  4ZUX A;  3B6G D;  4H9R B;  4J8X B;  3W98 A;  3MGS C;  5B0Y C;  4Z66 B;  3MGQ B;  3AZN B;  3MVD B;  1P34 C;  5AY8 D;  3AV2 C;  4YM6 D;  3AN2 A;  4CAY A;  3X1V A;  1P3I B;  5CPJ C;  5AV5 B;  3VH6 T;  3AZL D;  3A1I A;  4X23 B;  3WA9 A;  3LJA B;  2FJ7 B;  3B0D C;  4LD9 D;  3TU4 D;  2ZY2 A;  3UTA C;  3REI B;  1BH8 A;  4KUD B;  3REH C;  3AZG C;  4CSR A;  4DQY B;  2Y2H A;  4R8P A;  2HIO A;  3C1C B;  3AYW C;  1ID3 D;  5GT0 B;  5CHL B;  1TZY A;  2FFF B;  3MGP A;  3REJ B;  2G5H C;  4Z5T C;  4J8W B;  3UT9 D;  1S32 C;  4WJ3 C;  4G91 C;  5CPK B;  1P3B C;  3REK B;  1M1A A;  1Q9C A;  3O62 D;  4XUJ A;  4WU8 D;  3KXB C;  5B0Z C;  3B6F D;  3C1B A;  3NQJ B;  5DNN C;  3LEL C;  5AV6 D;  3KWQ C;  3AZM D;  1P3L A;  3MNN D;  4JJN D;  1M18 D;  3AZF A;  3B0C T;  4YM6 B;  2PYO B;  5B2J C;  5G49 A;  3B0C W;  2UWX A;  3AZL B;  5BNV A;  1M19 B;  1KX4 D;  3AZE C;  1AOI C;  5F99 D;  2NQB D;  2YFV B;  1U35 A;  2CV5 A;  4H9R A;  1F66 C;  5GXQ A;  1WWI A;  2JCH A;  2HUE B;  3AZN A;  5B2I C;  3KUY B;  4KGC D;  3AL0 C; 
#chains in the Genus database with same CATH homology
 3AZK A;  4G92 C;  1P3M D;  3W96 B;  1P3P D;  3W99 D;  5CPI C;  1ID3 B;  3LZ0 C;  1P3G B;  2DF4 C;  3X1S D;  2FJ7 A;  2BG1 A;  3LZ1 D;  3AZH B;  1B67 A;  1KX5 D;  4QLC C;  3AZJ C;  2Y2P A;  4KUD A;  3O62 B;  2Y2J A;  5GT3 C;  1EQZ C;  1P3O D;  3W98 B;  3WAA D;  4J8V C;  2F2A C;  3AN2 B;  4Z2M G;  4CAY B;  5JRG D;  3C1C A;  3AFA C;  4ZUX C;  3B6F B;  3X1V B;  3NQU B;  3X1T C;  1HQ3 A;  2ZY3 A;  3MNN B;  1M18 B;  4J8W A;  3WA9 B;  5AV9 C;  3REK A;  2RIQ A;  5B1L D;  5B1M C;  5B24 D;  3A6N C;  1BH8 B;  2Y2Q A;  2F8N D;  1P3K B;  2NQB B;  3IP4 C;  5CP6 A;  4NE6 A;  5B31 A;  3NQJ A;  3B6G A;  4XZQ D;  5DNM D;  1TZY B;  3MGP B;  1P3F D;  3AZI D;  5AVC C;  2ZY4 A;  4YM6 A;  4KGC B;  3MGR D;  2W8S A;  3H0M C;  3MGS D;  3AZL A;  3W99 B;  5B0Y D;  1P34 D;  5GSU C;  2YFV A;  1KX5 B;  5CPJ D;  4XUJ C;  3TU4 A;  2BYM A;  2RVQ C;  1P3L B;  1P3O B;  4HGA B;  3AZF B;  3WAA B;  3C1B C;  5G49 B;  5KDM A;  3UTA D;  4ZBJ C;  4E45 A;  1ID3 A;  3REH D;  3AZG D;  5BNV B;  3V9R B;  3UT9 A;  1P3A D;  2ARO C;  3AYW D;  3VH5 A;  1ZLA D;  5B1L B;  3O62 A;  5GXQ B;  4WU8 A;  3AV1 B;  4Z5T D;  1S32 D;  4WU9 B;  1U35 C;  2CV5 C;  1P3B D;  3B6F A;  3AZK B;  4J8X C;  3WKJ D;  3NQU A;  4XZQ B;  3MGQ C;  5AV6 A;  4Z66 C;  2CWE A;  5B40 B;  3MVD C;  5DNM B;  3MNN A;  5C3I B;  4JJN A;  3AZN C;  3VH6 W;  1M18 A;  4J8U C;  1P3F B;  3AZI B;  5B0Z D;  5BNX B;  1P3I C;  5AV5 C;  5DNN D;  3LEL D;  3MGR B;  2NZD B;  5BT1 D;  3KWQ D;  4X23 C;  3MGS B;  5AV8 B;  3LJA C;  1P34 B;  1KX4 A;  2FJ7 C;  5AVB D;  1P3K A;  2IO5 B;  5F99 A;  2NQB A;  5B2J D;  3H0L C;  2F8N H;  5CPJ B;  3REI C;  4KUD C;  4NE5 A;  1HQ3 B;  4H9S A;  3AZE D;  4H9P B;  4KGC A;  1P3M A;  5GT0 C;  1F66 D;  2L5A A;  3REJ C;  3W99 A;  5B2I D;  1R4V A;  5B33 B;  3X1S A;  5CPK C;  3WTP D;  3LZ1 A;  3REK C;  1P3A B;  5CP6 B;  2Y2N A;  1KX5 A;  5B31 B;  3EG5 B;  1KX3 B;  3B6G B;  3LZ0 D;  1ZLA B;  4H9O A;  2DQN C;  1P3O A;  5AY8 B;  3WAA A;  3REL C;  5JRG A;  4QLC D;  3AZJ D;  3WKJ B;  5GT3 D;  1EQZ D;  3V9R A;  3EPL A;  2PYO C;  3UTB D;  4J8V D;  5B0Z B;  3FDD A;  4ZUX D;  4LD9 B;  3AZL C;  3X1T D;  1M19 C;  5B1L A;  5B24 A;  3TU4 B;  2BYM B;  1W2E A;  3AV1 A;  5AVB B;  2F8N A;  4WU9 A;  5AV9 D;  2XD5 A;  5KDM B;  5B1M D;  4XZQ A;  5DNM A;  3A6N D;  5B40 A;  3KUY C;  5B31 G;  1P3F A;  3AZI A;  3UT9 B;  5BNX A;  3W96 C;  4EO5 B;  1HTA A;  3MGR A;  2NZD A;  1P3G C;  3MGS A;  5AV8 A;  5BS7 A;  5B0Y A;  3WTP E;  1P34 A;  4WU8 B;  5AVC D;  3X1U D;  3AZH C;  3WTP B;  3W97 D;  5CPJ A;  3O62 C;  3W98 C;  3LZ0 B;  5AV6 B;  3AZM B;  1H3O A;  4JJN B;  3AN2 C;  5GSU D;  4H9P A;  3B6F C;  4YS3 D;  3X1V C;  5E5A D;  4XUJ D;  4DRB A;  4QLC B;  3MNN C;  3UTA A;  2RVQ D;  5GT3 B;  3REH A;  3WA9 C;  5B33 A;  1KX4 B;  3UTB B;  1P3A A;  5F99 B;  4WV4 B;  1KX3 A;  4H9N B;  2Y2G A;  1ZLA A;  1P3K C;  2NQB C;  4Z5T A;  4R8P C;  1S32 A;  2ARO D;  2HIO C;  1T3U A;  5AY8 A;  5B32 D;  1P3B A;  2YFW B;  3A1K A;  1P3M B;  3WKJ A;  5B1M B;  3A6N B;  1TZY C;  1P3P B;  3MGP C;  4KGC C;  3X1S B;  3AV2 D;  5B0Z A;  3LZ1 B;  1M1A C;  4LD9 A;  4J8X D;  5DNN A;  3W99 C;  3LEL A;  3MGQ D;  4Z66 D;  4AWL B;  3AZN D;  3MVD D;  4UUZ B;  4H9O B;  5AVB A;  2BYK A;  4J8U D;  1BFM A;  1N1J A;  3X1U B;  1P3I D;  4WNN A;  1KX5 C;  5AV5 D;  3W97 B;  5JRG B;  1JFI B;  4X23 D;  1P3L C;  1P3O C;  1PZR A;  4HGA C;  2ZY5 A;  3LJA D;  3AZE A;  3AZF C;  3WAA C;  4YS3 B;  3F6T A;  3REI D;  5E5A B;  1F66 A;  5B24 B;  5B2I A;  2F8N B;  3R45 A;  5BO0 B;  3WTP A;  5GT0 D;  3EPK A;  5GXQ C;  3REJ D;  3LZ0 A;  3AV1 C;  3AZM A;  4WU9 C;  5CPK D;  3REK D;  3KXB D;  3AZK C;  5B32 B;  1A7W A;  4XZQ C;  5DNM C;  4QLC A;  3AZJ A;  5B40 C;  5GT3 A;  1EQZ A;  3VH6 A;  5B0Y B;  1P3F C;  3UTB A;  3AV2 B;  3REL D;  2NZD C;  4H9N A;  5AV8 C;  5BS7 C;  3X1T A;  2IO5 C;  2Y2M A;  2PYO D;  1AOI D;  1H3O B;  4J8U B;  3C1C C;  5AV9 A;  3B0D B;  2YFW A;  1M19 D;  2F8N G;  5B1M A;  1HQ3 C;  3A6N A;  1P3P A;  5FUG A;  3UTA B;  3REH B;  3AZG B;  4J8W C;  4NFT A;  3AYW B;  5CPI D;  4UUZ A;  3KUY D;  5B33 C;  5B32 G;  1P3A C;  4Z5T B;  5AVC A;  5CP6 C;  3X1U A;  1S32 B;  3W96 D;  5B31 C;  4G91 B;  3W97 A;  1P3B B;  1KX3 C;  3B6G C;  5JA4 A;  1P3G D;  1ZLA C;  1JFI A;  2LY8 A;  5AY8 C;  4YM6 C;  5GSU A;  3AZH D;  3KXB B;  4YS3 A;  1WWS A;  3AFA D;  3WKJ C;  5E5A A;  3W98 D;  5DNN B;  3LEL B;  3KWQ B;  3KFU G;  3AN2 D;  2BYK B;  1F1E A;  4H9Q B;  5BO0 A;  4LD9 C;  3REL B;  1N1J B;  2XD1 A;  5B2J B;  4WNN B;  3X1V D;  5BT1 C;  3TU4 C;  1TAF B;  2HUE C;  5AVB C;  3WA9 D;  2Y2I A;  3AZE B;  1AOI B;  2ARO A;  1BH9 B;  5B32 A;  2F8N K;  1ID3 C;  1F66 B;  1P3K D;  5B2I B;  4R8P D;  2Y2K A;  3UT9 C;  2HIO D;  3AV2 A;  3R45 B;  4EO5 C;  4J8X A;  4G92 B;  3MGQ A;  1TZY D;  4Z66 A;  3MGP D;  3MVD A;  5CPI B;  4WU8 C;  3WTP C;  4J8U A;  1KU5 A;  1P3I A;  1M1A D;  5AV5 A;  3P5J B;  5AV6 C;  3AZJ B;  3AZM C;  4X23 A;  3LJA A;  4JJN C;  4Z2M H;  3AZG A;  1M18 C;  1EQZ B;  2Y2O A;  4KHA B;  4J8V B;  3C1B D;  3AFA B;  4ZUX B;  3H0R C;  4NE3 A;  2VQR A;  3REI A;  3AYW A;  1P3L D;  3X1T B;  1KX4 C;  3AZF D;  3UTB C;  5F99 C;  5AV9 B;  5GT0 A;  2ZM5 A;  3REJ A;  4H9S C;  5FUG B;  4E44 A;  5CPK A;  3KXB A;  1U35 D;  1ULY A;  2CV5 D;  1P3M C;  4M6B A;  5GXQ D;  1P3P C;  4WZS B;  3AV1 D;  3KWQ A;  4CSR B;  4WU9 D;  3X1S C;  4R8P B;  3LZ1 C;  4H9Q A;  2HIO B;  5AVC B;  3AZK D;  3REL A;  5B2J A;  4AWL C;  5B40 D;  5JA4 B;  1TAF A;  2Y2L A;  2FJ7 D;  2PYO A;  1Z2C B;  3X1U C;  3EPJ A;  1AOI A;  5GSU B;  1BH9 A;  5JRG C;  1M1A B;  3W97 C;  2NZD D;  4KUD D;  5AV8 D;  2JE5 A;  4XUJ B;  1M19 A;  1B6W A;  3KSY A;  4YS3 C;  3C1C D;  5E5A C;  3B0B A;  3C1B B;  4UPK A;  5B1L C;  1HQ3 D;  5B24 C;  2J8P A;  5CPI A;  4ZBJ B;  3KUY A;  3EPH A;  4J8W D;  2G5I C;  2JSS A;  2ARO B;  3VH5 T;  3W96 A;  1P3G A;  3VH5 W;  5C3I C;  5B33 D;  3AZI C;  4KHA A;  5B32 C;  5CP6 D;  3AZH A;  5B31 D;  4J8V A;  1U35 B;  2CV5 B;  1KX3 D;  4DRA A;  3MGR C;  3AFA A;  4ZUX A;  3B6G D;  4H9R B;  4J8X B;  3W98 A;  3MGS C;  5B0Y C;  4Z66 B;  3MGQ B;  3AZN B;  3MVD B;  1P34 C;  5AY8 D;  3AV2 C;  4YM6 D;  3AN2 A;  4CAY A;  3X1V A;  1P3I B;  5CPJ C;  5AV5 B;  3VH6 T;  3AZL D;  3A1I A;  4X23 B;  3WA9 A;  3LJA B;  2FJ7 B;  3B0D C;  4LD9 D;  3TU4 D;  2ZY2 A;  3UTA C;  3REI B;  1BH8 A;  4KUD B;  3REH C;  3AZG C;  4CSR A;  4DQY B;  2Y2H A;  4R8P A;  2HIO A;  3C1C B;  3AYW C;  1ID3 D;  5GT0 B;  5CHL B;  1TZY A;  2FFF B;  3MGP A;  3REJ B;  2G5H C;  4Z5T C;  4J8W B;  3UT9 D;  1S32 C;  4WJ3 C;  4G91 C;  5CPK B;  1P3B C;  3REK B;  1M1A A;  1Q9C A;  3O62 D;  4XUJ A;  4WU8 D;  3KXB C;  5B0Z C;  3B6F D;  3C1B A;  3NQJ B;  5DNN C;  3LEL C;  5AV6 D;  3KWQ C;  3AZM D;  1P3L A;  3MNN D;  4JJN D;  1M18 D;  3AZF A;  3B0C T;  4YM6 B;  2PYO B;  5B2J C;  5G49 A;  3B0C W;  2UWX A;  3AZL B;  5BNV A;  1M19 B;  1KX4 D;  3AZE C;  1AOI C;  5F99 D;  2NQB D;  2YFV B;  1U35 A;  2CV5 A;  4H9R A;  1F66 C;  5GXQ A;  1WWI A;  2JCH A;  2HUE B;  3AZN A;  5B2I C;  3KUY B;  4KGC D;  3AL0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...