5CPJC

Nucleosome containing methylated sat2r dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Influence of DNA methylation on positioning and DNA flexibility of nucleosomes with pericentric satellite DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags "structural protein/dna
molecule keywords Histone H3.1
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cpjC00
5B31A 5DNND 5B2JA 5B33D 3REJC 5AV5B 4G91C 3B6GD 3REJB 4XZQB 4J8VA 3MGQA 4DRAA 5CPIB 4J8UA 1TZYA 3NQUA 1F66B 4LD9D 4H9RA 3MGSA 3AZFB 4KUDA 1P34C 5DNNB 1M18B 3UTAC 3NQJA 5CPJA 3LZ1D 1ZLAB 5AVCC 3MNNB 5BO0A 4H9NA 3W97C 4J8XC 4QLCA 3B6FB 2RVQD 1JFIB 5GT0C 5B32C 3RELB 1F66D 1KX5A 5DNMD 3WA9B 1M1AC 5AY8A 2FJ7D 1M1AD 3AN2B 3X1UD 5CP6C 5B32D 5GT0D 2RVQC 2YFWB 3W97D 5CPKA 1S32D 5B40A 3LELB 5B24D 3UTAD 3MGQB 1P3OA 3AZNB 3AN2D 1TAFA 3KWQA 5CP6A 4KGCB 4KUDB 5DNNA 5CPJB 3WAAA 3WAAC 5JRGC 1Q9CA 3UTAB 5DNNC 1JFIA 3AZFC 4J8UD 3REID 3AZGB 5E5AA 5CPJD 5FUGA 3LZ1A 5B40C 3AV2B 5GSUD 1P3AC 4J8UC 4QLCD 5JA4A 3MGQC 1EQZD 5BNVB 3X1TC 3W98A 5DNMA 3VH5T 3REJA 4YS3D 2HUEB 1KX5C 3O62A 1P3IC 5GT0A 5B32A 3AN2C 3AV1D 3W97A 5B32G 5BT1C 2PYOB 1P3OD 3MGSC 3AZKD 3MNNC 5CP6D 3AZGA 5AVBB 3RELA 3X1UC 2F8NG 4J8WC 1M18C 2FJ7C 1P34B 4DRBA 4J8VC 3AV2A 4E44A 3W96D 1F66C 1U35D 1H3OB 5JA4B 5B31C 4Z5TD 1P3BC 4WU9D 4CAYB 3REIA 5F99B 3LELA 5BS7A 1P34D 3KUYB 1ID3B 2CV5A 3AZNA 5BNXA 4LD9C 3W99C 5B1MD 3X1VA 3X1SB 3AZJA 3AZLA 1EQZA 3REHD 5AV8D 4EO5B 3WAAB 2BYKB 5AV6D 4YS3A 4H9SC 3O62D 1P3FA 3AZEC 1KX3C 3X1SD 5B0YD 4YM6B 3A6NC 3WKJB 5AV8B 2BYMA 3B0CW 5AV6B 3AZKA 4X23C 3AZMC 3RELD 1AOIC 1AOIB 3AZMB 4AWLC 3LZ0C 3KUYA 1ID3A 3V9RB 2NZDD 5B2IC 4CSRA 3REKC 3AZIC 3TU4D 1ZLAC 3AYWC 3W97B 3KXBC 5B24B 3B0DC 2CV5D 5CHLB 4JJND 3AZLD 5CPIC 5AVBA 3AZJD 4G92B 3REHA 5GT3C 4ZUXC 5AV6A 4G91B 4JJNC 5B0ZC 5B0ZB 5F99C 3AYWD 5F99A 4ZUXB 3V9RA 4WNNA 5GXQB 3TU4C 5AV9A 3REKD 3UT9A 3AZID 5GSUB 3C1CA 3X1VB 3LZ0D 4Z66D 1EQZB 4J8WB 5AVBC 3LJAD 5CPIA 3NQUB 2JSSA 4X23D 1P3FB 5AV9C 3UT9C 1ZLAA 4Z66B 1KX3D 1P3IB 1M19A 4HGAB 5AV6C 5AVBD 5GT3A 3LJAC 3AZMA 5AV8C 4WNNB 5GXQA 4H9OB 3WKJC 5G49A 5B1MC 2F8ND 3W99D 5CPKB 5B40B 5B33B 4XZQD 4Z5TC 1P3BD 4XUJA 5JRGB 2F8NB 1WWIA 3LZ0A 3KUYC 1ID3C 3WTPD 3AZHA 1M18D 2F8NK 1BH9B 4X23A 3MNND 2AROD 3AZKC 3AZNC 1WWSA 1P3BB 3B6FD 5FUGB 3LELC 4UUZB 5BT1D 3WTPE 1KX4D 1ZLAD 4H9OA 3AV1C 1P3GA 2FJ7B 3AZEA 2LY8A 3W98B 5KDMA 1P3FC 5DNMB 2NZDC 4H9SA 5B33A 3MGPA 1P3PA 4E45A 4J8WA 3AZMD 3X1TD 3MVDD 1EQZC 2YFVB 3MGQD 4XUJB 2F8NA 1TZYD 5AVCB 4Z2MH 1S32B 5GSUC 1P3AD 3W99A 4WU8D 4KUDD 3VH5A 3REIC 1P3IA 3O62C 1P3BA 1M19B 1N1JB 4XUJD 4J8UB 1F66A 1KU5A 3AV2C 5GT3B 1P3GB 3UTBA 2FJ7A 1HTAA 5B2JB 4R8PD 5AV5A 3MNNA 3AZGC 2AROA 5B1LC 2NQBC 4QLCB 4H9QA 1P3LB 3MGPB 5E5AC 5B24C 1P3PB 1KX4A 1S32C 4WU9C 1B6WA 3MGSB 3AZFA 1P3GD 1U35C 3KWQD 2PYOC 5JRGA 3W96C 5BO0B 2YFWA 4J8WD 1F1EA 5DNMC 3X1TA 3W98C 3MVDA 3KWQC 2PYOD 4X23B 3MGSD 5AY8B 4J8XD 1P3AA 1P3OC 3KWQB 4WU8A 3LZ1C 5E5AD 3UTBB 2NQBD 1P3ID 4WZSB 5AY8D 4J8XB 1M1AA 4EO5C 5E5AB 3REJD 4QLCC 2NQBB 5AV5D 5AVCA 5CPKD 1S32A 3W99B 5B40D 5B24A 3UTAA 3B0CT 5CPJC 4KUDC 5B1LA 4WU8C 5CPKC 1TZYC 5AV5C 1BFMA 3AZFD 3UTBC 3MVDC 3LZ1B 3O62B 5JRGD 3WAAD 3WA9D 5AY8C 3W96A 3VH6W 1BH8A 3R45B 5BNVA 2PYOA 1U35A 4NE5A 2AROB 4J8XA 4WU9A 1M1AB 4H9QB 1P3LA 1KX4B 5AV9B 3UT9B 4Z2MG 5GSUA 5GT0B 5B32B 3LELD 1KX4C 1P34A 3B6FC 2NQBA 2AROC 3AZND 4KHAA 3W98D 4KGCD 2L5AA 3MGPC 1P3PC 3WTPC 4CAYA 5B1LB 4ZBJB 3X1TB 5B2JC 3MVDB 1P3GC 3AV1A 2CV5B 4XZQC 5B31G 5BNXB 1TZYB 5AVCD 4WU8B 3X1SA 3AZLB 3AZJB 5B0YA 4M6BA 4JJNB 5B1LD 3REIB 3AZGD 2BYKA 4H9NB 1B67A 4R8PC 4NFTA 3AV2D 3B6GC 3WA9A 1HQ3D 5B33C 4XUJC 3VH5W 2NZDA 4Z5TA 3KXBB 3AYWB 3C1BD 3VH6T 4YS3B 1P3LD 3REKB 3AZIB 5B2IB 3MGRB 5B1MA 3X1VD 3AV1B 2HIOA 1P3KD 1P3MA 3WKJA 3AZHB 5AV8A 5CP6B 3AFAB 1BH9A 3AFAC 4KGCA 3AZHC 4Z66C 3AZKB 3W96B 3MGRC 1P3FD 4UUZA 1P3KB 4YM6C 3A6NB 2IO5C 4WU9B 1KX3B 3AZEB 5F99D 2CWEA 5KDMB 4CSRB 4Z5TB 2F8NH 3B6GB 4KHAB 5GXQC 3KUYD 1ID3D 3B0BA 3LJAA 5CPID 5B1MB 1HQ3A 2HIOB 5C3IC 3KSYA 3TU4A 1P3MB 3REHB 1M19C 3C1BA 5B0YB 4YM6D 4HGAC 4NE6A 5B0ZA 4G92C 4JJNA 4ZBJC 4ZUXA 2HIOD 1P3KA 1P3MD 3WKJD 3WTPB 4H9PA 3X1UB 1AOID 3C1CB 1P3KC 3C1CC 2NZDB 3KXBA 4NE3A 3AYWA 1H3OA 4AWLB 3C1BC 5AV9D 3REKA 3UT9D 3AZIA 5B2IA 3C1CD 3TU4B 3MGRA 1HQ3C 4Z66A 3AFAA 3REHC 1P3MC 2HIOC 5C3IB 1P3AB 3NQJB 4H9PB 3A6NA 5G49B 1KX3A 1M19D 4YM6A 3B0DB 5B31D 5B0ZD 2BYMB 5B2JD 4R8PB 3B6GA 4ZUXD 5GT3D 2IO5B 4J8VD 5GXQD 3MGPD 1P3PD 4KGCC 3AZJC 3AZLC 1AOIA 3LJAB 4LD9A 1HQ3B 1R4VA 2CV5C 4WV4B 5B31B 3LZ0B 5BS7C 3KXBD 3C1BB 1P3OB 4XZQA 4J8VB 1TAFB 5B2ID 3MGRD 1KX5D 4H9RB 4YS3C 3WTPA 3AZHD 1M18A 3WA9C 1A7WA 1BH8B 3R45A 3X1UA 3AFAD 3RELC 3VH6A 1U35B 3UTBD 4R8PA 3X1VC 3B6FA 1ULYA 1KX5B 1N1JA 1P3LC 2HUEC 2YFVA 5B0YC 3A6ND 3X1SC 3AN2A 3AZED 4LD9B
chains in the Genus database with same CATH superfamily
5B31A 3P5JB 5DNND 5B2JA 5B33D 3REJC 5AV5B 4G91C 2F2AC 3B6GD 3REJB 4XZQB 4J8VA 3MGQA 4DRAA 5CPIB 4J8UA 1TZYA 3NQUA 1F66B 4LD9D 4H9RA 3MGSA 3AZFB 4KUDA 1P34C 5DNNB 1M18B 1W2EA 3NQJA 3UTAC 3LZ1D 5CPJA 1ZLAB 5AVCC 3MNNB 5BO0A 4H9NA 3W97C 4J8XC 4QLCA 3B6FB 2RVQD 1JFIB 5GT0C 5B32C 3RELB 1F66D 1KX5A 5DNMD 3WA9B 1M1AC 5AY8A 2FJ7D 1M1AD 3AN2B 3X1UD 5CP6C 5B32D 5GT0D 2RVQC 2YFWB 3W97D 5CPKA 1S32D 5B40A 3LELB 5B24D 3UTAD 3MGQB 1P3OA 2JE5A 3AZNB 3AN2D 1TAFA 3KWQA 5CP6A 4KGCB 4KUDB 5DNNA 5CPJB 3WAAA 3WAAC 5JRGC 1Q9CA 3UTAB 5DNNC 1JFIA 3AZFC 4J8UD 3REID 3AZGB 5E5AA 5CPJD 5FUGA 3LZ1A 5B40C 3AV2B 5GSUD 1P3AC 4J8UC 4QLCD 5JA4A 3MGQC 3A1KA 2FFFB 1EQZD 5BNVB 3X1TC 3W98A 2ZM5A 5DNMA 3VH5T 3REJA 4YS3D 2HUEB 2RIQA 1KX5C 3O62A 1P3IC 2Y2QA 5GT0A 5B32A 3AN2C 3AV1D 3W97A 5B32G 5BT1C 2PYOB 1P3OD 3MGSC 3AZKD 3MNNC 5CP6D 3AZGA 5AVBB 3RELA 3X1UC 2F8NG 4J8WC 1M18C 2FJ7C 1P34B 4DRBA 4J8VC 3AV2A 4E44A 3W96D 1F66C 1U35D 1H3OB 5JA4B 5B31C 4Z5TD 1P3BC 4WU9D 4CAYB 3REIA 5F99B 3LELA 5BS7A 1P34D 3KUYB 1ID3B 2CV5A 3AZNA 5BNXA 4LD9C 3W99C 5B1MD 3X1VA 3X1SB 3AZJA 3AZLA 1EQZA 3REHD 5AV8D 4EO5B 3WAAB 2XD5A 2BYKB 5AV6D 4YS3A 4H9SC 3O62D 1P3FA 3AZEC 1KX3C 3X1SD 5B0YD 4YM6B 3A6NC 3WKJB 5AV8B 2BYMA 3B0CW 5AV6B 3AZKA 4X23C 3AZMC 3RELD 1AOIC 1AOIB 3AZMB 2UWXA 4AWLC 3LZ0C 3KUYA 1ID3A 3V9RB 2NZDD 5B2IC 4CSRA 3REKC 3AZIC 3TU4D 3EG5B 2Y2IA 1ZLAC 3AYWC 3W97B 3KXBC 5B24B 3B0DC 2CV5D 5CHLB 4JJND 3AZLD 5CPIC 5AVBA 3AZJD 4G92B 3REHA 5GT3C 4ZUXC 5AV6A 4G91B 4JJNC 5B0ZC 5B0ZB 5F99C 2ZY4A 3AYWD 5F99A 4ZUXB 3EPJA 3AL0C 4WJ3C 3V9RA 4WNNA 5GXQB 2G5HC 3TU4C 5AV9A 3REKD 3UT9A 3AZID 5GSUB 3C1CA 3X1VB 3LZ0D 4Z66D 1EQZB 4J8WB 5AVBC 3LJAD 5CPIA 3NQUB 2JSSA 4X23D 3EPHA 2Y2JA 1P3FB 5AV9C 3UT9C 1ZLAA 1T3UA 4Z66B 1KX3D 1P3IB 1M19A 4HGAB 5AV6C 2W8SA 5GT3A 5AVBD 3LJAC 3AZMA 5AV8C 4WNNB 5GXQA 4H9OB 3WKJC 5G49A 5B1MC 2F8ND 3W99D 5CPKB 5B40B 5B33B 4XZQD 4Z5TC 1P3BD 1PZRA 4XUJA 5JRGB 2F8NB 1WWIA 3LZ0A 3KUYC 1ID3C 3WTPD 3AZHA 1M18D 2F8NK 1BH9B 4X23A 3MNND 2AROD 3H0LC 3AZKC 1WWSA 3AZNC 1P3BB 3B6FD 5FUGB 3LELC 4UUZB 5BT1D 3WTPE 1KX4D 1ZLAD 4H9OA 3AV1C 1P3GA 2FJ7B 3AZEA 2LY8A 3W98B 5KDMA 1P3FC 5DNMB 2NZDC 4H9SA 5B33A 3MGPA 1P3PA 4E45A 4J8WA 2Y2NA 3X1TD 3AZMD 3MVDD 1EQZC 2YFVB 3MGQD 4XUJB 2F8NA 1TZYD 5AVCB 4Z2MH 1S32B 5GSUC 1P3AD 3W99A 4WU8D 3F6TA 4KUDD 3VH5A 2Y2MA 3REIC 1P3IA 3O62C 1P3BA 1M19B 1N1JB 4XUJD 4J8UB 1F66A 1KU5A 1Z2CB 3AV2C 5GT3B 2ZY3A 1P3GB 3UTBA 2FJ7A 1HTAA 5B2JB 4R8PD 4UPKA 5AV5A 3MNNA 3AZGC 2AROA 5B1LC 2NQBC 4QLCB 3H0RC 4H9QA 1P3LB 3MGPB 5E5AC 5B24C 1P3PB 1KX4A 1S32C 4WU9C 1B6WA 3MGSB 3AZFA 1P3GD 1U35C 3KWQD 2PYOC 5JRGA 3W96C 5BO0B 2YFWA 4J8WD 1F1EA 5DNMC 3X1TA 3W98C 2DQNC 3MVDA 2Y2KA 3KWQC 4X23B 2PYOD 3MGSD 5AY8B 4J8XD 1P3AA 1P3OC 3KWQB 4WU8A 3LZ1C 5E5AD 3UTBB 2NQBD 1P3ID 4WZSB 2ZY5A 5AY8D 4J8XB 1M1AA 4EO5C 5E5AB 3REJD 4QLCC 2NQBB 5AV5D 5AVCA 5CPKD 1S32A 3W99B 5B40D 5B24A 3UTAA 3B0CT 5CPJC 4KUDC 5B1LA 4WU8C 5CPKC 1TZYC 5AV5C 1BFMA 3AZFD 3UTBC 3MVDC 3LZ1B 3O62B 5JRGD 3WAAD 3WA9D 5AY8C 3W96A 3VH6W 1BH8A 3R45B 5BNVA 2PYOA 1U35A 4NE5A 2AROB 2VQRA 4J8XA 4WU9A 1M1AB 4H9QB 2BG1A 1P3LA 1KX4B 5AV9B 3UT9B 4Z2MG 5GSUA 5GT0B 5B32B 3LELD 1KX4C 1P34A 3B6FC 2Y2HA 2NQBA 2AROC 3AZND 4KHAA 3W98D 4KGCD 2L5AA 3MGPC 1P3PC 3WTPC 4CAYA 5B1LB 4ZBJB 3X1TB 5B2JC 3MVDB 1P3GC 3AV1A 2CV5B 4XZQC 5B31G 5BNXB 1TZYB 5AVCD 4WU8B 3X1SA 3AZLB 3AZJB 5B0YA 4M6BA 4JJNB 5B1LD 3REIB 3EPKA 3AZGD 2BYKA 4H9NB 1B67A 4R8PC 4NFTA 3AV2D 4DQYB 3B6GC 3EPLA 3WA9A 1HQ3D 5B33C 4XUJC 3VH5W 2NZDA 4Z5TA 3KXBB 3AYWB 3C1BD 3VH6T 4YS3B 1P3LD 3REKB 3AZIB 5B2IB 3MGRB 5B1MA 3X1VD 3AV1B 2HIOA 1P3KD 1P3MA 3WKJA 3AZHB 5AV8A 5CP6B 3AFAB 1BH9A 3AFAC 4KGCA 3AZHC 4Z66C 3AZKB 3H0MC 3W96B 3MGRC 1P3FD 4UUZA 1P3KB 4YM6C 3A6NB 2IO5C 4WU9B 1KX3B 3AZEB 5F99D 2CWEA 5KDMB 4CSRB 2J8PA 4Z5TB 2F8NH 3B6GB 4KHAB 5GXQC 3KUYD 1ID3D 3B0BA 3LJAA 5CPID 5B1MB 1HQ3A 2HIOB 5C3IC 3KSYA 3TU4A 1P3MB 3REHB 1M19C 3C1BA 5B0YB 4YM6D 4HGAC 4NE6A 2JCHA 5B0ZA 4G92C 4JJNA 4ZBJC 4ZUXA 2HIOD 1P3KA 3IP4C 1P3MD 3WKJD 3WTPB 4H9PA 3X1UB 2G5IC 1AOID 3C1CB 3KFUG 1P3KC 3C1CC 2NZDB 3KXBA 4NE3A 3A1IA 3AYWA 1H3OA 4AWLB 3C1BC 5AV9D 3REKA 3UT9D 2Y2LA 3AZIA 5B2IA 3C1CD 3TU4B 3MGRA 2Y2PA 1HQ3C 4Z66A 3AFAA 3FDDA 3REHC 1P3MC 2HIOC 5C3IB 1P3AB 3NQJB 4H9PB 3A6NA 5G49B 2Y2OA 1KX3A 1M19D 4YM6A 3B0DB 5B31D 5B0ZD 2BYMB 5B2JD 4R8PB 2Y2GA 3B6GA 4ZUXD 5GT3D 2IO5B 4J8VD 5GXQD 3MGPD 1P3PD 4KGCC 3AZJC 3AZLC 1AOIA 3LJAB 2ZY2A 4LD9A 1HQ3B 1R4VA 2CV5C 4WV4B 5B31B 3LZ0B 5BS7C 3KXBD 3C1BB 1P3OB 2XD1A 4XZQA 4J8VB 1TAFB 5B2ID 3MGRD 1KX5D 4H9RB 4YS3C 3WTPA 3AZHD 1M18A 3WA9C 1A7WA 1BH8B 3R45A 3X1UA 3AFAD 3RELC 3VH6A 1U35B 3UTBD 4R8PA 3X1VC 3B6FA 1ULYA 1KX5B 1N1JA 1P3LC 2HUEC 2YFVA 5B0YC 3A6ND 3X1SC 3AN2A 3AZED 4LD9B 2DF4C
chains in the Genus database with same CATH topology
5B31A 3P5JB 5DNND 5B2JA 5B33D 3REJC 5AV5B 4G91C 2F2AC 3B6GD 3REJB 4XZQB 4J8VA 3MGQA 4DRAA 5CPIB 4J8UA 1TZYA 3NQUA 1F66B 4LD9D 4H9RA 3MGSA 3AZFB 4KUDA 1P34C 5DNNB 1M18B 1W2EA 3NQJA 3UTAC 3LZ1D 5CPJA 1ZLAB 5AVCC 3MNNB 5BO0A 4H9NA 3W97C 4J8XC 4QLCA 3B6FB 2RVQD 1JFIB 5GT0C 5B32C 3RELB 1F66D 1KX5A 5DNMD 3WA9B 1M1AC 5AY8A 2FJ7D 1M1AD 3AN2B 3X1UD 5CP6C 5B32D 5GT0D 2RVQC 2YFWB 3W97D 5CPKA 1S32D 5B40A 3LELB 5B24D 3UTAD 3MGQB 1P3OA 2JE5A 3AZNB 3AN2D 1TAFA 3KWQA 5CP6A 4KGCB 4KUDB 5DNNA 5CPJB 3WAAA 3WAAC 5JRGC 1Q9CA 3UTAB 5DNNC 1JFIA 3AZFC 4J8UD 3REID 3AZGB 5E5AA 5CPJD 5FUGA 3LZ1A 5B40C 3AV2B 5GSUD 1P3AC 4J8UC 4QLCD 5JA4A 3MGQC 3A1KA 2FFFB 1EQZD 5BNVB 3X1TC 3W98A 2ZM5A 5DNMA 3VH5T 3REJA 4YS3D 2HUEB 2RIQA 1KX5C 3O62A 1P3IC 2Y2QA 5GT0A 5B32A 3AN2C 3AV1D 3W97A 5B32G 5BT1C 2PYOB 1P3OD 3MGSC 3AZKD 3MNNC 5CP6D 3AZGA 5AVBB 3RELA 3X1UC 2F8NG 4J8WC 1M18C 2FJ7C 1P34B 4DRBA 4J8VC 3AV2A 4E44A 3W96D 1F66C 1U35D 1H3OB 5JA4B 5B31C 4Z5TD 1P3BC 4WU9D 4CAYB 3REIA 5F99B 3LELA 5BS7A 1P34D 3KUYB 1ID3B 2CV5A 3AZNA 5BNXA 4LD9C 3W99C 5B1MD 3X1VA 3X1SB 3AZJA 3AZLA 1EQZA 3REHD 5AV8D 4EO5B 3WAAB 2XD5A 2BYKB 5AV6D 4YS3A 4H9SC 3O62D 1P3FA 3AZEC 1KX3C 3X1SD 5B0YD 4YM6B 3A6NC 3WKJB 5AV8B 2BYMA 3B0CW 5AV6B 3AZKA 4X23C 3AZMC 3RELD 1AOIC 1AOIB 3AZMB 2UWXA 4AWLC 3LZ0C 3KUYA 1ID3A 3V9RB 2NZDD 5B2IC 4CSRA 3REKC 3AZIC 3TU4D 3EG5B 2Y2IA 1ZLAC 3AYWC 3W97B 3KXBC 5B24B 3B0DC 2CV5D 5CHLB 4JJND 3AZLD 5CPIC 5AVBA 3AZJD 4G92B 3REHA 5GT3C 4ZUXC 5AV6A 4G91B 4JJNC 5B0ZC 5B0ZB 5F99C 2ZY4A 3AYWD 5F99A 4ZUXB 3EPJA 3AL0C 4WJ3C 3V9RA 4WNNA 5GXQB 2G5HC 3TU4C 5AV9A 3REKD 3UT9A 3AZID 5GSUB 3C1CA 3X1VB 3LZ0D 4Z66D 1EQZB 4J8WB 5AVBC 3LJAD 5CPIA 3NQUB 2JSSA 4X23D 3EPHA 2Y2JA 1P3FB 5AV9C 3UT9C 1ZLAA 1T3UA 4Z66B 1KX3D 1P3IB 1M19A 4HGAB 5AV6C 2W8SA 5GT3A 5AVBD 3LJAC 3AZMA 5AV8C 4WNNB 5GXQA 4H9OB 3WKJC 5G49A 5B1MC 2F8ND 3W99D 5CPKB 5B40B 5B33B 4XZQD 4Z5TC 1P3BD 1PZRA 4XUJA 5JRGB 2F8NB 1WWIA 3LZ0A 3KUYC 1ID3C 3WTPD 3AZHA 1M18D 2F8NK 1BH9B 4X23A 3MNND 2AROD 3H0LC 3AZKC 1WWSA 3AZNC 1P3BB 3B6FD 5FUGB 3LELC 4UUZB 5BT1D 3WTPE 1KX4D 1ZLAD 4H9OA 3AV1C 1P3GA 2FJ7B 3AZEA 2LY8A 3W98B 5KDMA 1P3FC 5DNMB 2NZDC 4H9SA 5B33A 3MGPA 1P3PA 4E45A 4J8WA 2Y2NA 3X1TD 3AZMD 3MVDD 1EQZC 2YFVB 3MGQD 4XUJB 2F8NA 1TZYD 5AVCB 4Z2MH 1S32B 5GSUC 1P3AD 3W99A 4WU8D 3F6TA 4KUDD 3VH5A 2Y2MA 3REIC 1P3IA 3O62C 1P3BA 1M19B 1N1JB 4XUJD 4J8UB 1F66A 1KU5A 1Z2CB 3AV2C 5GT3B 2ZY3A 1P3GB 3UTBA 2FJ7A 1HTAA 5B2JB 4R8PD 4UPKA 5AV5A 3MNNA 3AZGC 2AROA 5B1LC 2NQBC 4QLCB 3H0RC 4H9QA 1P3LB 3MGPB 5E5AC 5B24C 1P3PB 1KX4A 1S32C 4WU9C 1B6WA 3MGSB 3AZFA 1P3GD 1U35C 3KWQD 2PYOC 5JRGA 3W96C 5BO0B 2YFWA 4J8WD 1F1EA 5DNMC 3X1TA 3W98C 2DQNC 3MVDA 2Y2KA 3KWQC 4X23B 2PYOD 3MGSD 5AY8B 4J8XD 1P3AA 1P3OC 3KWQB 4WU8A 3LZ1C 5E5AD 3UTBB 2NQBD 1P3ID 4WZSB 2ZY5A 5AY8D 4J8XB 1M1AA 4EO5C 5E5AB 3REJD 4QLCC 2NQBB 5AV5D 5AVCA 5CPKD 1S32A 3W99B 5B40D 5B24A 3UTAA 3B0CT 5CPJC 4KUDC 5B1LA 4WU8C 5CPKC 1TZYC 5AV5C 1BFMA 3AZFD 3UTBC 3MVDC 3LZ1B 3O62B 5JRGD 3WAAD 3WA9D 5AY8C 3W96A 3VH6W 1BH8A 3R45B 5BNVA 2PYOA 1U35A 4NE5A 2AROB 2VQRA 4J8XA 4WU9A 1M1AB 4H9QB 2BG1A 1P3LA 1KX4B 5AV9B 3UT9B 4Z2MG 5GSUA 5GT0B 5B32B 3LELD 1KX4C 1P34A 3B6FC 2Y2HA 2NQBA 2AROC 3AZND 4KHAA 3W98D 4KGCD 2L5AA 3MGPC 1P3PC 3WTPC 4CAYA 5B1LB 4ZBJB 3X1TB 5B2JC 3MVDB 1P3GC 3AV1A 2CV5B 4XZQC 5B31G 5BNXB 1TZYB 5AVCD 4WU8B 3X1SA 3AZLB 3AZJB 5B0YA 4M6BA 4JJNB 5B1LD 3REIB 3EPKA 3AZGD 2BYKA 4H9NB 1B67A 4R8PC 4NFTA 3AV2D 4DQYB 3B6GC 3EPLA 3WA9A 1HQ3D 5B33C 4XUJC 3VH5W 2NZDA 4Z5TA 3KXBB 3AYWB 3C1BD 3VH6T 4YS3B 1P3LD 3REKB 3AZIB 5B2IB 3MGRB 5B1MA 3X1VD 3AV1B 2HIOA 1P3KD 1P3MA 3WKJA 3AZHB 5AV8A 5CP6B 3AFAB 1BH9A 3AFAC 4KGCA 3AZHC 4Z66C 3AZKB 3H0MC 3W96B 3MGRC 1P3FD 4UUZA 1P3KB 4YM6C 3A6NB 2IO5C 4WU9B 1KX3B 3AZEB 5F99D 2CWEA 5KDMB 4CSRB 2J8PA 4Z5TB 2F8NH 3B6GB 4KHAB 5GXQC 3KUYD 1ID3D 3B0BA 3LJAA 5CPID 5B1MB 1HQ3A 2HIOB 5C3IC 3KSYA 3TU4A 1P3MB 3REHB 1M19C 3C1BA 5B0YB 4YM6D 4HGAC 4NE6A 2JCHA 5B0ZA 4G92C 4JJNA 4ZBJC 4ZUXA 2HIOD 1P3KA 3IP4C 1P3MD 3WKJD 3WTPB 4H9PA 3X1UB 2G5IC 1AOID 3C1CB 3KFUG 1P3KC 3C1CC 2NZDB 3KXBA 4NE3A 3A1IA 3AYWA 1H3OA 4AWLB 3C1BC 5AV9D 3REKA 3UT9D 2Y2LA 3AZIA 5B2IA 3C1CD 3TU4B 3MGRA 2Y2PA 1HQ3C 4Z66A 3AFAA 3FDDA 3REHC 1P3MC 2HIOC 5C3IB 1P3AB 3NQJB 4H9PB 3A6NA 5G49B 2Y2OA 1KX3A 1M19D 4YM6A 3B0DB 5B31D 5B0ZD 2BYMB 5B2JD 4R8PB 2Y2GA 3B6GA 4ZUXD 5GT3D 2IO5B 4J8VD 5GXQD 3MGPD 1P3PD 4KGCC 3AZJC 3AZLC 1AOIA 3LJAB 2ZY2A 4LD9A 1HQ3B 1R4VA 2CV5C 4WV4B 5B31B 3LZ0B 5BS7C 3KXBD 3C1BB 1P3OB 2XD1A 4XZQA 4J8VB 1TAFB 5B2ID 3MGRD 1KX5D 4H9RB 4YS3C 3WTPA 3AZHD 1M18A 3WA9C 1A7WA 1BH8B 3R45A 3X1UA 3AFAD 3RELC 3VH6A 1U35B 3UTBD 4R8PA 3X1VC 3B6FA 1ULYA 1KX5B 1N1JA 1P3LC 2HUEC 2YFVA 5B0YC 3A6ND 3X1SC 3AN2A 3AZED 4LD9B 2DF4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 A;  5DNN D;  5B2J A;  5B33 D;  3REJ C;  5AV5 B;  4G91 C;  3B6G D;  3REJ B;  4XZQ B;  4J8V A;  3MGQ A;  4DRA A;  5CPI B;  4J8U A;  1TZY A;  3NQU A;  1F66 B;  4LD9 D;  4H9R A;  3MGS A;  3AZF B;  4KUD A;  1P34 C;  5DNN B;  1M18 B;  3UTA C;  3NQJ A;  5CPJ A;  3LZ1 D;  1ZLA B;  5AVC C;  3MNN B;  5BO0 A;  4H9N A;  3W97 C;  4J8X C;  4QLC A;  3B6F B;  2RVQ D;  1JFI B;  5GT0 C;  5B32 C;  3REL B;  1F66 D;  1KX5 A;  5DNM D;  3WA9 B;  1M1A C;  5AY8 A;  2FJ7 D;  1M1A D;  3AN2 B;  3X1U D;  5CP6 C;  5B32 D;  5GT0 D;  2RVQ C;  2YFW B;  3W97 D;  5CPK A;  1S32 D;  5B40 A;  3LEL B;  5B24 D;  3UTA D;  3MGQ B;  1P3O A;  3AZN B;  3AN2 D;  1TAF A;  3KWQ A;  5CP6 A;  4KGC B;  4KUD B;  5DNN A;  5CPJ B;  3WAA A;  3WAA C;  5JRG C;  1Q9C A;  3UTA B;  5DNN C;  1JFI A;  3AZF C;  4J8U D;  3REI D;  3AZG B;  5E5A A;  5CPJ D;  5FUG A;  3LZ1 A;  5B40 C;  3AV2 B;  5GSU D;  1P3A C;  4J8U C;  4QLC D;  5JA4 A;  3MGQ C;  1EQZ D;  5BNV B;  3X1T C;  3W98 A;  5DNM A;  3VH5 T;  3REJ A;  4YS3 D;  2HUE B;  1KX5 C;  3O62 A;  1P3I C;  5GT0 A;  5B32 A;  3AN2 C;  3AV1 D;  3W97 A;  5B32 G;  5BT1 C;  2PYO B;  1P3O D;  3MGS C;  3AZK D;  3MNN C;  5CP6 D;  3AZG A;  5AVB B;  3REL A;  3X1U C;  2F8N G;  4J8W C;  1M18 C;  2FJ7 C;  1P34 B;  4DRB A;  4J8V C;  3AV2 A;  4E44 A;  3W96 D;  1F66 C;  1U35 D;  1H3O B;  5JA4 B;  5B31 C;  4Z5T D;  1P3B C;  4WU9 D;  4CAY B;  3REI A;  5F99 B;  3LEL A;  5BS7 A;  1P34 D;  3KUY B;  1ID3 B;  2CV5 A;  3AZN A;  5BNX A;  4LD9 C;  3W99 C;  5B1M D;  3X1V A;  3X1S B;  3AZJ A;  3AZL A;  1EQZ A;  3REH D;  5AV8 D;  4EO5 B;  3WAA B;  2BYK B;  5AV6 D;  4YS3 A;  4H9S C;  3O62 D;  1P3F A;  3AZE C;  1KX3 C;  3X1S D;  5B0Y D;  4YM6 B;  3A6N C;  3WKJ B;  5AV8 B;  2BYM A;  3B0C W;  5AV6 B;  3AZK A;  4X23 C;  3AZM C;  3REL D;  1AOI C;  1AOI B;  3AZM B;  4AWL C;  3LZ0 C;  3KUY A;  1ID3 A;  3V9R B;  2NZD D;  5B2I C;  4CSR A;  3REK C;  3AZI C;  3TU4 D;  1ZLA C;  3AYW C;  3W97 B;  3KXB C;  5B24 B;  3B0D C;  2CV5 D;  5CHL B;  4JJN D;  3AZL D;  5CPI C;  5AVB A;  3AZJ D;  4G92 B;  3REH A;  5GT3 C;  4ZUX C;  5AV6 A;  4G91 B;  4JJN C;  5B0Z C;  5B0Z B;  5F99 C;  3AYW D;  5F99 A;  4ZUX B;  3V9R A;  4WNN A;  5GXQ B;  3TU4 C;  5AV9 A;  3REK D;  3UT9 A;  3AZI D;  5GSU B;  3C1C A;  3X1V B;  3LZ0 D;  4Z66 D;  1EQZ B;  4J8W B;  5AVB C;  3LJA D;  5CPI A;  3NQU B;  2JSS A;  4X23 D;  1P3F B;  5AV9 C;  3UT9 C;  1ZLA A;  4Z66 B;  1KX3 D;  1P3I B;  1M19 A;  4HGA B;  5AV6 C;  5AVB D;  5GT3 A;  3LJA C;  3AZM A;  5AV8 C;  4WNN B;  5GXQ A;  4H9O B;  3WKJ C;  5G49 A;  5B1M C;  2F8N D;  3W99 D;  5CPK B;  5B40 B;  5B33 B;  4XZQ D;  4Z5T C;  1P3B D;  4XUJ A;  5JRG B;  2F8N B;  1WWI A;  3LZ0 A;  3KUY C;  1ID3 C;  3WTP D;  3AZH A;  1M18 D;  2F8N K;  1BH9 B;  4X23 A;  3MNN D;  2ARO D;  3AZK C;  3AZN C;  1WWS A;  1P3B B;  3B6F D;  5FUG B;  3LEL C;  4UUZ B;  5BT1 D;  3WTP E;  1KX4 D;  1ZLA D;  4H9O A;  3AV1 C;  1P3G A;  2FJ7 B;  3AZE A;  2LY8 A;  3W98 B;  5KDM A;  1P3F C;  5DNM B;  2NZD C;  4H9S A;  5B33 A;  3MGP A;  1P3P A;  4E45 A;  4J8W A;  3AZM D;  3X1T D;  3MVD D;  1EQZ C;  2YFV B;  3MGQ D;  4XUJ B;  2F8N A;  1TZY D;  5AVC B;  4Z2M H;  1S32 B;  5GSU C;  1P3A D;  3W99 A;  4WU8 D;  4KUD D;  3VH5 A;  3REI C;  1P3I A;  3O62 C;  1P3B A;  1M19 B;  1N1J B;  4XUJ D;  4J8U B;  1F66 A;  1KU5 A;  3AV2 C;  5GT3 B;  1P3G B;  3UTB A;  2FJ7 A;  1HTA A;  5B2J B;  4R8P D;  5AV5 A;  3MNN A;  3AZG C;  2ARO A;  5B1L C;  2NQB C;  4QLC B;  4H9Q A;  1P3L B;  3MGP B;  5E5A C;  5B24 C;  1P3P B;  1KX4 A;  1S32 C;  4WU9 C;  1B6W A;  3MGS B;  3AZF A;  1P3G D;  1U35 C;  3KWQ D;  2PYO C;  5JRG A;  3W96 C;  5BO0 B;  2YFW A;  4J8W D;  1F1E A;  5DNM C;  3X1T A;  3W98 C;  3MVD A;  3KWQ C;  2PYO D;  4X23 B;  3MGS D;  5AY8 B;  4J8X D;  1P3A A;  1P3O C;  3KWQ B;  4WU8 A;  3LZ1 C;  5E5A D;  3UTB B;  2NQB D;  1P3I D;  4WZS B;  5AY8 D;  4J8X B;  1M1A A;  4EO5 C;  5E5A B;  3REJ D;  4QLC C;  2NQB B;  5AV5 D;  5AVC A;  5CPK D;  1S32 A;  3W99 B;  5B40 D;  5B24 A;  3UTA A;  3B0C T;  5CPJ C;  4KUD C;  5B1L A;  4WU8 C;  5CPK C;  1TZY C;  5AV5 C;  1BFM A;  3AZF D;  3UTB C;  3MVD C;  3LZ1 B;  3O62 B;  5JRG D;  3WAA D;  3WA9 D;  5AY8 C;  3W96 A;  3VH6 W;  1BH8 A;  3R45 B;  5BNV A;  2PYO A;  1U35 A;  4NE5 A;  2ARO B;  4J8X A;  4WU9 A;  1M1A B;  4H9Q B;  1P3L A;  1KX4 B;  5AV9 B;  3UT9 B;  4Z2M G;  5GSU A;  5GT0 B;  5B32 B;  3LEL D;  1KX4 C;  1P34 A;  3B6F C;  2NQB A;  2ARO C;  3AZN D;  4KHA A;  3W98 D;  4KGC D;  2L5A A;  3MGP C;  1P3P C;  3WTP C;  4CAY A;  5B1L B;  4ZBJ B;  3X1T B;  5B2J C;  3MVD B;  1P3G C;  3AV1 A;  2CV5 B;  4XZQ C;  5B31 G;  5BNX B;  1TZY B;  5AVC D;  4WU8 B;  3X1S A;  3AZL B;  3AZJ B;  5B0Y A;  4M6B A;  4JJN B;  5B1L D;  3REI B;  3AZG D;  2BYK A;  4H9N B;  1B67 A;  4R8P C;  4NFT A;  3AV2 D;  3B6G C;  3WA9 A;  1HQ3 D;  5B33 C;  4XUJ C;  3VH5 W;  2NZD A;  4Z5T A;  3KXB B;  3AYW B;  3C1B D;  3VH6 T;  4YS3 B;  1P3L D;  3REK B;  3AZI B;  5B2I B;  3MGR B;  5B1M A;  3X1V D;  3AV1 B;  2HIO A;  1P3K D;  1P3M A;  3WKJ A;  3AZH B;  5AV8 A;  5CP6 B;  3AFA B;  1BH9 A;  3AFA C;  4KGC A;  3AZH C;  4Z66 C;  3AZK B;  3W96 B;  3MGR C;  1P3F D;  4UUZ A;  1P3K B;  4YM6 C;  3A6N B;  2IO5 C;  4WU9 B;  1KX3 B;  3AZE B;  5F99 D;  2CWE A;  5KDM B;  4CSR B;  4Z5T B;  2F8N H;  3B6G B;  4KHA B;  5GXQ C;  3KUY D;  1ID3 D;  3B0B A;  3LJA A;  5CPI D;  5B1M B;  1HQ3 A;  2HIO B;  5C3I C;  3KSY A;  3TU4 A;  1P3M B;  3REH B;  1M19 C;  3C1B A;  5B0Y B;  4YM6 D;  4HGA C;  4NE6 A;  5B0Z A;  4G92 C;  4JJN A;  4ZBJ C;  4ZUX A;  2HIO D;  1P3K A;  1P3M D;  3WKJ D;  3WTP B;  4H9P A;  3X1U B;  1AOI D;  3C1C B;  1P3K C;  3C1C C;  2NZD B;  3KXB A;  4NE3 A;  3AYW A;  1H3O A;  4AWL B;  3C1B C;  5AV9 D;  3REK A;  3UT9 D;  3AZI A;  5B2I A;  3C1C D;  3TU4 B;  3MGR A;  1HQ3 C;  4Z66 A;  3AFA A;  3REH C;  1P3M C;  2HIO C;  5C3I B;  1P3A B;  3NQJ B;  4H9P B;  3A6N A;  5G49 B;  1KX3 A;  1M19 D;  4YM6 A;  3B0D B;  5B31 D;  5B0Z D;  2BYM B;  5B2J D;  4R8P B;  3B6G A;  4ZUX D;  5GT3 D;  2IO5 B;  4J8V D;  5GXQ D;  3MGP D;  1P3P D;  4KGC C;  3AZJ C;  3AZL C;  1AOI A;  3LJA B;  4LD9 A;  1HQ3 B;  1R4V A;  2CV5 C;  4WV4 B;  5B31 B;  3LZ0 B;  5BS7 C;  3KXB D;  3C1B B;  1P3O B;  4XZQ A;  4J8V B;  1TAF B;  5B2I D;  3MGR D;  1KX5 D;  4H9R B;  4YS3 C;  3WTP A;  3AZH D;  1M18 A;  3WA9 C;  1A7W A;  1BH8 B;  3R45 A;  3X1U A;  3AFA D;  3REL C;  3VH6 A;  1U35 B;  3UTB D;  4R8P A;  3X1V C;  3B6F A;  1ULY A;  1KX5 B;  1N1J A;  1P3L C;  2HUE C;  2YFV A;  5B0Y C;  3A6N D;  3X1S C;  3AN2 A;  3AZE D;  4LD9 B; 
#chains in the Genus database with same CATH topology
 5B31 A;  3P5J B;  5DNN D;  5B2J A;  5B33 D;  3REJ C;  5AV5 B;  4G91 C;  2F2A C;  3B6G D;  3REJ B;  4XZQ B;  4J8V A;  3MGQ A;  4DRA A;  5CPI B;  4J8U A;  1TZY A;  3NQU A;  1F66 B;  4LD9 D;  4H9R A;  3MGS A;  3AZF B;  4KUD A;  1P34 C;  5DNN B;  1M18 B;  1W2E A;  3NQJ A;  3UTA C;  3LZ1 D;  5CPJ A;  1ZLA B;  5AVC C;  3MNN B;  5BO0 A;  4H9N A;  3W97 C;  4J8X C;  4QLC A;  3B6F B;  2RVQ D;  1JFI B;  5GT0 C;  5B32 C;  3REL B;  1F66 D;  1KX5 A;  5DNM D;  3WA9 B;  1M1A C;  5AY8 A;  2FJ7 D;  1M1A D;  3AN2 B;  3X1U D;  5CP6 C;  5B32 D;  5GT0 D;  2RVQ C;  2YFW B;  3W97 D;  5CPK A;  1S32 D;  5B40 A;  3LEL B;  5B24 D;  3UTA D;  3MGQ B;  1P3O A;  2JE5 A;  3AZN B;  3AN2 D;  1TAF A;  3KWQ A;  5CP6 A;  4KGC B;  4KUD B;  5DNN A;  5CPJ B;  3WAA A;  3WAA C;  5JRG C;  1Q9C A;  3UTA B;  5DNN C;  1JFI A;  3AZF C;  4J8U D;  3REI D;  3AZG B;  5E5A A;  5CPJ D;  5FUG A;  3LZ1 A;  5B40 C;  3AV2 B;  5GSU D;  1P3A C;  4J8U C;  4QLC D;  5JA4 A;  3MGQ C;  3A1K A;  2FFF B;  1EQZ D;  5BNV B;  3X1T C;  3W98 A;  2ZM5 A;  5DNM A;  3VH5 T;  3REJ A;  4YS3 D;  2HUE B;  2RIQ A;  1KX5 C;  3O62 A;  1P3I C;  2Y2Q A;  5GT0 A;  5B32 A;  3AN2 C;  3AV1 D;  3W97 A;  5B32 G;  5BT1 C;  2PYO B;  1P3O D;  3MGS C;  3AZK D;  3MNN C;  5CP6 D;  3AZG A;  5AVB B;  3REL A;  3X1U C;  2F8N G;  4J8W C;  1M18 C;  2FJ7 C;  1P34 B;  4DRB A;  4J8V C;  3AV2 A;  4E44 A;  3W96 D;  1F66 C;  1U35 D;  1H3O B;  5JA4 B;  5B31 C;  4Z5T D;  1P3B C;  4WU9 D;  4CAY B;  3REI A;  5F99 B;  3LEL A;  5BS7 A;  1P34 D;  3KUY B;  1ID3 B;  2CV5 A;  3AZN A;  5BNX A;  4LD9 C;  3W99 C;  5B1M D;  3X1V A;  3X1S B;  3AZJ A;  3AZL A;  1EQZ A;  3REH D;  5AV8 D;  4EO5 B;  3WAA B;  2XD5 A;  2BYK B;  5AV6 D;  4YS3 A;  4H9S C;  3O62 D;  1P3F A;  3AZE C;  1KX3 C;  3X1S D;  5B0Y D;  4YM6 B;  3A6N C;  3WKJ B;  5AV8 B;  2BYM A;  3B0C W;  5AV6 B;  3AZK A;  4X23 C;  3AZM C;  3REL D;  1AOI C;  1AOI B;  3AZM B;  2UWX A;  4AWL C;  3LZ0 C;  3KUY A;  1ID3 A;  3V9R B;  2NZD D;  5B2I C;  4CSR A;  3REK C;  3AZI C;  3TU4 D;  3EG5 B;  2Y2I A;  1ZLA C;  3AYW C;  3W97 B;  3KXB C;  5B24 B;  3B0D C;  2CV5 D;  5CHL B;  4JJN D;  3AZL D;  5CPI C;  5AVB A;  3AZJ D;  4G92 B;  3REH A;  5GT3 C;  4ZUX C;  5AV6 A;  4G91 B;  4JJN C;  5B0Z C;  5B0Z B;  5F99 C;  2ZY4 A;  3AYW D;  5F99 A;  4ZUX B;  3EPJ A;  3AL0 C;  4WJ3 C;  3V9R A;  4WNN A;  5GXQ B;  2G5H C;  3TU4 C;  5AV9 A;  3REK D;  3UT9 A;  3AZI D;  5GSU B;  3C1C A;  3X1V B;  3LZ0 D;  4Z66 D;  1EQZ B;  4J8W B;  5AVB C;  3LJA D;  5CPI A;  3NQU B;  2JSS A;  4X23 D;  3EPH A;  2Y2J A;  1P3F B;  5AV9 C;  3UT9 C;  1ZLA A;  1T3U A;  4Z66 B;  1KX3 D;  1P3I B;  1M19 A;  4HGA B;  5AV6 C;  2W8S A;  5GT3 A;  5AVB D;  3LJA C;  3AZM A;  5AV8 C;  4WNN B;  5GXQ A;  4H9O B;  3WKJ C;  5G49 A;  5B1M C;  2F8N D;  3W99 D;  5CPK B;  5B40 B;  5B33 B;  4XZQ D;  4Z5T C;  1P3B D;  1PZR A;  4XUJ A;  5JRG B;  2F8N B;  1WWI A;  3LZ0 A;  3KUY C;  1ID3 C;  3WTP D;  3AZH A;  1M18 D;  2F8N K;  1BH9 B;  4X23 A;  3MNN D;  2ARO D;  3H0L C;  3AZK C;  1WWS A;  3AZN C;  1P3B B;  3B6F D;  5FUG B;  3LEL C;  4UUZ B;  5BT1 D;  3WTP E;  1KX4 D;  1ZLA D;  4H9O A;  3AV1 C;  1P3G A;  2FJ7 B;  3AZE A;  2LY8 A;  3W98 B;  5KDM A;  1P3F C;  5DNM B;  2NZD C;  4H9S A;  5B33 A;  3MGP A;  1P3P A;  4E45 A;  4J8W A;  2Y2N A;  3X1T D;  3AZM D;  3MVD D;  1EQZ C;  2YFV B;  3MGQ D;  4XUJ B;  2F8N A;  1TZY D;  5AVC B;  4Z2M H;  1S32 B;  5GSU C;  1P3A D;  3W99 A;  4WU8 D;  3F6T A;  4KUD D;  3VH5 A;  2Y2M A;  3REI C;  1P3I A;  3O62 C;  1P3B A;  1M19 B;  1N1J B;  4XUJ D;  4J8U B;  1F66 A;  1KU5 A;  1Z2C B;  3AV2 C;  5GT3 B;  2ZY3 A;  1P3G B;  3UTB A;  2FJ7 A;  1HTA A;  5B2J B;  4R8P D;  4UPK A;  5AV5 A;  3MNN A;  3AZG C;  2ARO A;  5B1L C;  2NQB C;  4QLC B;  3H0R C;  4H9Q A;  1P3L B;  3MGP B;  5E5A C;  5B24 C;  1P3P B;  1KX4 A;  1S32 C;  4WU9 C;  1B6W A;  3MGS B;  3AZF A;  1P3G D;  1U35 C;  3KWQ D;  2PYO C;  5JRG A;  3W96 C;  5BO0 B;  2YFW A;  4J8W D;  1F1E A;  5DNM C;  3X1T A;  3W98 C;  2DQN C;  3MVD A;  2Y2K A;  3KWQ C;  4X23 B;  2PYO D;  3MGS D;  5AY8 B;  4J8X D;  1P3A A;  1P3O C;  3KWQ B;  4WU8 A;  3LZ1 C;  5E5A D;  3UTB B;  2NQB D;  1P3I D;  4WZS B;  2ZY5 A;  5AY8 D;  4J8X B;  1M1A A;  4EO5 C;  5E5A B;  3REJ D;  4QLC C;  2NQB B;  5AV5 D;  5AVC A;  5CPK D;  1S32 A;  3W99 B;  5B40 D;  5B24 A;  3UTA A;  3B0C T;  5CPJ C;  4KUD C;  5B1L A;  4WU8 C;  5CPK C;  1TZY C;  5AV5 C;  1BFM A;  3AZF D;  3UTB C;  3MVD C;  3LZ1 B;  3O62 B;  5JRG D;  3WAA D;  3WA9 D;  5AY8 C;  3W96 A;  3VH6 W;  1BH8 A;  3R45 B;  5BNV A;  2PYO A;  1U35 A;  4NE5 A;  2ARO B;  2VQR A;  4J8X A;  4WU9 A;  1M1A B;  4H9Q B;  2BG1 A;  1P3L A;  1KX4 B;  5AV9 B;  3UT9 B;  4Z2M G;  5GSU A;  5GT0 B;  5B32 B;  3LEL D;  1KX4 C;  1P34 A;  3B6F C;  2Y2H A;  2NQB A;  2ARO C;  3AZN D;  4KHA A;  3W98 D;  4KGC D;  2L5A A;  3MGP C;  1P3P C;  3WTP C;  4CAY A;  5B1L B;  4ZBJ B;  3X1T B;  5B2J C;  3MVD B;  1P3G C;  3AV1 A;  2CV5 B;  4XZQ C;  5B31 G;  5BNX B;  1TZY B;  5AVC D;  4WU8 B;  3X1S A;  3AZL B;  3AZJ B;  5B0Y A;  4M6B A;  4JJN B;  5B1L D;  3REI B;  3EPK A;  3AZG D;  2BYK A;  4H9N B;  1B67 A;  4R8P C;  4NFT A;  3AV2 D;  4DQY B;  3B6G C;  3EPL A;  3WA9 A;  1HQ3 D;  5B33 C;  4XUJ C;  3VH5 W;  2NZD A;  4Z5T A;  3KXB B;  3AYW B;  3C1B D;  3VH6 T;  4YS3 B;  1P3L D;  3REK B;  3AZI B;  5B2I B;  3MGR B;  5B1M A;  3X1V D;  3AV1 B;  2HIO A;  1P3K D;  1P3M A;  3WKJ A;  3AZH B;  5AV8 A;  5CP6 B;  3AFA B;  1BH9 A;  3AFA C;  4KGC A;  3AZH C;  4Z66 C;  3AZK B;  3H0M C;  3W96 B;  3MGR C;  1P3F D;  4UUZ A;  1P3K B;  4YM6 C;  3A6N B;  2IO5 C;  4WU9 B;  1KX3 B;  3AZE B;  5F99 D;  2CWE A;  5KDM B;  4CSR B;  2J8P A;  4Z5T B;  2F8N H;  3B6G B;  4KHA B;  5GXQ C;  3KUY D;  1ID3 D;  3B0B A;  3LJA A;  5CPI D;  5B1M B;  1HQ3 A;  2HIO B;  5C3I C;  3KSY A;  3TU4 A;  1P3M B;  3REH B;  1M19 C;  3C1B A;  5B0Y B;  4YM6 D;  4HGA C;  4NE6 A;  2JCH A;  5B0Z A;  4G92 C;  4JJN A;  4ZBJ C;  4ZUX A;  2HIO D;  1P3K A;  3IP4 C;  1P3M D;  3WKJ D;  3WTP B;  4H9P A;  3X1U B;  2G5I C;  1AOI D;  3C1C B;  3KFU G;  1P3K C;  3C1C C;  2NZD B;  3KXB A;  4NE3 A;  3A1I A;  3AYW A;  1H3O A;  4AWL B;  3C1B C;  5AV9 D;  3REK A;  3UT9 D;  2Y2L A;  3AZI A;  5B2I A;  3C1C D;  3TU4 B;  3MGR A;  2Y2P A;  1HQ3 C;  4Z66 A;  3AFA A;  3FDD A;  3REH C;  1P3M C;  2HIO C;  5C3I B;  1P3A B;  3NQJ B;  4H9P B;  3A6N A;  5G49 B;  2Y2O A;  1KX3 A;  1M19 D;  4YM6 A;  3B0D B;  5B31 D;  5B0Z D;  2BYM B;  5B2J D;  4R8P B;  2Y2G A;  3B6G A;  4ZUX D;  5GT3 D;  2IO5 B;  4J8V D;  5GXQ D;  3MGP D;  1P3P D;  4KGC C;  3AZJ C;  3AZL C;  1AOI A;  3LJA B;  2ZY2 A;  4LD9 A;  1HQ3 B;  1R4V A;  2CV5 C;  4WV4 B;  5B31 B;  3LZ0 B;  5BS7 C;  3KXB D;  3C1B B;  1P3O B;  2XD1 A;  4XZQ A;  4J8V B;  1TAF B;  5B2I D;  3MGR D;  1KX5 D;  4H9R B;  4YS3 C;  3WTP A;  3AZH D;  1M18 A;  3WA9 C;  1A7W A;  1BH8 B;  3R45 A;  3X1U A;  3AFA D;  3REL C;  3VH6 A;  1U35 B;  3UTB D;  4R8P A;  3X1V C;  3B6F A;  1ULY A;  1KX5 B;  1N1J A;  1P3L C;  2HUE C;  2YFV A;  5B0Y C;  3A6N D;  3X1S C;  3AN2 A;  3AZE D;  4LD9 B;  2DF4 C; 
#chains in the Genus database with same CATH homology
 5B31 A;  3P5J B;  5DNN D;  5B2J A;  5B33 D;  3REJ C;  5AV5 B;  4G91 C;  2F2A C;  3B6G D;  3REJ B;  4XZQ B;  4J8V A;  3MGQ A;  4DRA A;  5CPI B;  4J8U A;  1TZY A;  3NQU A;  1F66 B;  4LD9 D;  4H9R A;  3MGS A;  3AZF B;  4KUD A;  1P34 C;  5DNN B;  1M18 B;  1W2E A;  3NQJ A;  3UTA C;  3LZ1 D;  5CPJ A;  1ZLA B;  5AVC C;  3MNN B;  5BO0 A;  4H9N A;  3W97 C;  4J8X C;  4QLC A;  3B6F B;  2RVQ D;  1JFI B;  5GT0 C;  5B32 C;  3REL B;  1F66 D;  1KX5 A;  5DNM D;  3WA9 B;  1M1A C;  5AY8 A;  2FJ7 D;  1M1A D;  3AN2 B;  3X1U D;  5CP6 C;  5B32 D;  5GT0 D;  2RVQ C;  2YFW B;  3W97 D;  5CPK A;  1S32 D;  5B40 A;  3LEL B;  5B24 D;  3UTA D;  3MGQ B;  1P3O A;  2JE5 A;  3AZN B;  3AN2 D;  1TAF A;  3KWQ A;  5CP6 A;  4KGC B;  4KUD B;  5DNN A;  5CPJ B;  3WAA A;  3WAA C;  5JRG C;  1Q9C A;  3UTA B;  5DNN C;  1JFI A;  3AZF C;  4J8U D;  3REI D;  3AZG B;  5E5A A;  5CPJ D;  5FUG A;  3LZ1 A;  5B40 C;  3AV2 B;  5GSU D;  1P3A C;  4J8U C;  4QLC D;  5JA4 A;  3MGQ C;  3A1K A;  2FFF B;  1EQZ D;  5BNV B;  3X1T C;  3W98 A;  2ZM5 A;  5DNM A;  3VH5 T;  3REJ A;  4YS3 D;  2HUE B;  2RIQ A;  1KX5 C;  3O62 A;  1P3I C;  2Y2Q A;  5GT0 A;  5B32 A;  3AN2 C;  3AV1 D;  3W97 A;  5B32 G;  5BT1 C;  2PYO B;  1P3O D;  3MGS C;  3AZK D;  3MNN C;  5CP6 D;  3AZG A;  5AVB B;  3REL A;  3X1U C;  2F8N G;  4J8W C;  1M18 C;  2FJ7 C;  1P34 B;  4DRB A;  4J8V C;  3AV2 A;  4E44 A;  3W96 D;  1F66 C;  1U35 D;  1H3O B;  5JA4 B;  5B31 C;  4Z5T D;  1P3B C;  4WU9 D;  4CAY B;  3REI A;  5F99 B;  3LEL A;  5BS7 A;  1P34 D;  3KUY B;  1ID3 B;  2CV5 A;  3AZN A;  5BNX A;  4LD9 C;  3W99 C;  5B1M D;  3X1V A;  3X1S B;  3AZJ A;  3AZL A;  1EQZ A;  3REH D;  5AV8 D;  4EO5 B;  3WAA B;  2XD5 A;  2BYK B;  5AV6 D;  4YS3 A;  4H9S C;  3O62 D;  1P3F A;  3AZE C;  1KX3 C;  3X1S D;  5B0Y D;  4YM6 B;  3A6N C;  3WKJ B;  5AV8 B;  2BYM A;  3B0C W;  5AV6 B;  3AZK A;  4X23 C;  3AZM C;  3REL D;  1AOI C;  1AOI B;  3AZM B;  2UWX A;  4AWL C;  3LZ0 C;  3KUY A;  1ID3 A;  3V9R B;  2NZD D;  5B2I C;  4CSR A;  3REK C;  3AZI C;  3TU4 D;  3EG5 B;  2Y2I A;  1ZLA C;  3AYW C;  3W97 B;  3KXB C;  5B24 B;  3B0D C;  2CV5 D;  5CHL B;  4JJN D;  3AZL D;  5CPI C;  5AVB A;  3AZJ D;  4G92 B;  3REH A;  5GT3 C;  4ZUX C;  5AV6 A;  4G91 B;  4JJN C;  5B0Z C;  5B0Z B;  5F99 C;  2ZY4 A;  3AYW D;  5F99 A;  4ZUX B;  3EPJ A;  3AL0 C;  4WJ3 C;  3V9R A;  4WNN A;  5GXQ B;  2G5H C;  3TU4 C;  5AV9 A;  3REK D;  3UT9 A;  3AZI D;  5GSU B;  3C1C A;  3X1V B;  3LZ0 D;  4Z66 D;  1EQZ B;  4J8W B;  5AVB C;  3LJA D;  5CPI A;  3NQU B;  2JSS A;  4X23 D;  3EPH A;  2Y2J A;  1P3F B;  5AV9 C;  3UT9 C;  1ZLA A;  1T3U A;  4Z66 B;  1KX3 D;  1P3I B;  1M19 A;  4HGA B;  5AV6 C;  2W8S A;  5GT3 A;  5AVB D;  3LJA C;  3AZM A;  5AV8 C;  4WNN B;  5GXQ A;  4H9O B;  3WKJ C;  5G49 A;  5B1M C;  2F8N D;  3W99 D;  5CPK B;  5B40 B;  5B33 B;  4XZQ D;  4Z5T C;  1P3B D;  1PZR A;  4XUJ A;  5JRG B;  2F8N B;  1WWI A;  3LZ0 A;  3KUY C;  1ID3 C;  3WTP D;  3AZH A;  1M18 D;  2F8N K;  1BH9 B;  4X23 A;  3MNN D;  2ARO D;  3H0L C;  3AZK C;  1WWS A;  3AZN C;  1P3B B;  3B6F D;  5FUG B;  3LEL C;  4UUZ B;  5BT1 D;  3WTP E;  1KX4 D;  1ZLA D;  4H9O A;  3AV1 C;  1P3G A;  2FJ7 B;  3AZE A;  2LY8 A;  3W98 B;  5KDM A;  1P3F C;  5DNM B;  2NZD C;  4H9S A;  5B33 A;  3MGP A;  1P3P A;  4E45 A;  4J8W A;  2Y2N A;  3X1T D;  3AZM D;  3MVD D;  1EQZ C;  2YFV B;  3MGQ D;  4XUJ B;  2F8N A;  1TZY D;  5AVC B;  4Z2M H;  1S32 B;  5GSU C;  1P3A D;  3W99 A;  4WU8 D;  3F6T A;  4KUD D;  3VH5 A;  2Y2M A;  3REI C;  1P3I A;  3O62 C;  1P3B A;  1M19 B;  1N1J B;  4XUJ D;  4J8U B;  1F66 A;  1KU5 A;  1Z2C B;  3AV2 C;  5GT3 B;  2ZY3 A;  1P3G B;  3UTB A;  2FJ7 A;  1HTA A;  5B2J B;  4R8P D;  4UPK A;  5AV5 A;  3MNN A;  3AZG C;  2ARO A;  5B1L C;  2NQB C;  4QLC B;  3H0R C;  4H9Q A;  1P3L B;  3MGP B;  5E5A C;  5B24 C;  1P3P B;  1KX4 A;  1S32 C;  4WU9 C;  1B6W A;  3MGS B;  3AZF A;  1P3G D;  1U35 C;  3KWQ D;  2PYO C;  5JRG A;  3W96 C;  5BO0 B;  2YFW A;  4J8W D;  1F1E A;  5DNM C;  3X1T A;  3W98 C;  2DQN C;  3MVD A;  2Y2K A;  3KWQ C;  4X23 B;  2PYO D;  3MGS D;  5AY8 B;  4J8X D;  1P3A A;  1P3O C;  3KWQ B;  4WU8 A;  3LZ1 C;  5E5A D;  3UTB B;  2NQB D;  1P3I D;  4WZS B;  2ZY5 A;  5AY8 D;  4J8X B;  1M1A A;  4EO5 C;  5E5A B;  3REJ D;  4QLC C;  2NQB B;  5AV5 D;  5AVC A;  5CPK D;  1S32 A;  3W99 B;  5B40 D;  5B24 A;  3UTA A;  3B0C T;  5CPJ C;  4KUD C;  5B1L A;  4WU8 C;  5CPK C;  1TZY C;  5AV5 C;  1BFM A;  3AZF D;  3UTB C;  3MVD C;  3LZ1 B;  3O62 B;  5JRG D;  3WAA D;  3WA9 D;  5AY8 C;  3W96 A;  3VH6 W;  1BH8 A;  3R45 B;  5BNV A;  2PYO A;  1U35 A;  4NE5 A;  2ARO B;  2VQR A;  4J8X A;  4WU9 A;  1M1A B;  4H9Q B;  2BG1 A;  1P3L A;  1KX4 B;  5AV9 B;  3UT9 B;  4Z2M G;  5GSU A;  5GT0 B;  5B32 B;  3LEL D;  1KX4 C;  1P34 A;  3B6F C;  2Y2H A;  2NQB A;  2ARO C;  3AZN D;  4KHA A;  3W98 D;  4KGC D;  2L5A A;  3MGP C;  1P3P C;  3WTP C;  4CAY A;  5B1L B;  4ZBJ B;  3X1T B;  5B2J C;  3MVD B;  1P3G C;  3AV1 A;  2CV5 B;  4XZQ C;  5B31 G;  5BNX B;  1TZY B;  5AVC D;  4WU8 B;  3X1S A;  3AZL B;  3AZJ B;  5B0Y A;  4M6B A;  4JJN B;  5B1L D;  3REI B;  3EPK A;  3AZG D;  2BYK A;  4H9N B;  1B67 A;  4R8P C;  4NFT A;  3AV2 D;  4DQY B;  3B6G C;  3EPL A;  3WA9 A;  1HQ3 D;  5B33 C;  4XUJ C;  3VH5 W;  2NZD A;  4Z5T A;  3KXB B;  3AYW B;  3C1B D;  3VH6 T;  4YS3 B;  1P3L D;  3REK B;  3AZI B;  5B2I B;  3MGR B;  5B1M A;  3X1V D;  3AV1 B;  2HIO A;  1P3K D;  1P3M A;  3WKJ A;  3AZH B;  5AV8 A;  5CP6 B;  3AFA B;  1BH9 A;  3AFA C;  4KGC A;  3AZH C;  4Z66 C;  3AZK B;  3H0M C;  3W96 B;  3MGR C;  1P3F D;  4UUZ A;  1P3K B;  4YM6 C;  3A6N B;  2IO5 C;  4WU9 B;  1KX3 B;  3AZE B;  5F99 D;  2CWE A;  5KDM B;  4CSR B;  2J8P A;  4Z5T B;  2F8N H;  3B6G B;  4KHA B;  5GXQ C;  3KUY D;  1ID3 D;  3B0B A;  3LJA A;  5CPI D;  5B1M B;  1HQ3 A;  2HIO B;  5C3I C;  3KSY A;  3TU4 A;  1P3M B;  3REH B;  1M19 C;  3C1B A;  5B0Y B;  4YM6 D;  4HGA C;  4NE6 A;  2JCH A;  5B0Z A;  4G92 C;  4JJN A;  4ZBJ C;  4ZUX A;  2HIO D;  1P3K A;  3IP4 C;  1P3M D;  3WKJ D;  3WTP B;  4H9P A;  3X1U B;  2G5I C;  1AOI D;  3C1C B;  3KFU G;  1P3K C;  3C1C C;  2NZD B;  3KXB A;  4NE3 A;  3A1I A;  3AYW A;  1H3O A;  4AWL B;  3C1B C;  5AV9 D;  3REK A;  3UT9 D;  2Y2L A;  3AZI A;  5B2I A;  3C1C D;  3TU4 B;  3MGR A;  2Y2P A;  1HQ3 C;  4Z66 A;  3AFA A;  3FDD A;  3REH C;  1P3M C;  2HIO C;  5C3I B;  1P3A B;  3NQJ B;  4H9P B;  3A6N A;  5G49 B;  2Y2O A;  1KX3 A;  1M19 D;  4YM6 A;  3B0D B;  5B31 D;  5B0Z D;  2BYM B;  5B2J D;  4R8P B;  2Y2G A;  3B6G A;  4ZUX D;  5GT3 D;  2IO5 B;  4J8V D;  5GXQ D;  3MGP D;  1P3P D;  4KGC C;  3AZJ C;  3AZL C;  1AOI A;  3LJA B;  2ZY2 A;  4LD9 A;  1HQ3 B;  1R4V A;  2CV5 C;  4WV4 B;  5B31 B;  3LZ0 B;  5BS7 C;  3KXB D;  3C1B B;  1P3O B;  2XD1 A;  4XZQ A;  4J8V B;  1TAF B;  5B2I D;  3MGR D;  1KX5 D;  4H9R B;  4YS3 C;  3WTP A;  3AZH D;  1M18 A;  3WA9 C;  1A7W A;  1BH8 B;  3R45 A;  3X1U A;  3AFA D;  3REL C;  3VH6 A;  1U35 B;  3UTB D;  4R8P A;  3X1V C;  3B6F A;  1ULY A;  1KX5 B;  1N1J A;  1P3L C;  2HUE C;  2YFV A;  5B0Y C;  3A6N D;  3X1S C;  3AN2 A;  3AZE D;  4LD9 B;  2DF4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...