3H0MC

Structure of trna-dependent amidotransferase gatcab from aquifex aeolicus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
VDREWVLKIAKLARLELKEEEIEVFQKQLSDILDFIDQLKELDTENVEPYIQEFEETPMREDEPHPSLDREKALMNAPERKDGFFVVPRVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glutamyl-tRNA(Gln) amidotransferase subunit A
publication title Insights into tRNA-Dependent Amidotransferase Evolution and Catalysis from the Structure of the Aquifex aeolicus Enzyme
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 17
structure length 91
sequence length 91
chains with identical sequence F, I, L, O, R, U, X
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.60 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3h0mC01
3KFUG 3IP4C 3AL0C 3A1KA 2DF4C 3H0MC 3H0LC 3A1IA 2G5HC 2F2AC 2G5IC 3H0RC 4WJ3C 2DQNC
chains in the Genus database with same CATH superfamily
3EPKA 1P34C 5C3IB 4XUJD 5AV9B 5B33A 2NZDC 5BNVA 5AV8B 2RIQA 5B0YD 1KX5C 3TU4B 3MGSD 3AZKD 4J8UA 4KUDD 5B32C 1P3OB 3B6GD 2IO5B 3AZEB 1TZYA 4X23A 4R8PC 1P3KC 3MGPC 2PYOD 2AROD 5B2JA 3X1SA 4LD9C 3AZNC 1P3AD 1JFIB 4H9PB 3LJAB 3UTBA 4EO5C 1P3FB 1WWIA 1S32A 5GT3A 1M1AB 3VH5T 4H9OB 5AVCC 4JJNB 5CPJD 2Y2NA 3MGQB 3REKD 3AN2C 3AZLB 4WU8A 3REJA 4AWLC 3LZ1C 5B40D 4ZUXC 3AZMC 3X1TC 1U35A 3AZIB 4ZBJC 4QLCC 1M19C 5GSUB 2NZDD 3REHA 5B0ZB 2YFWA 5B1MC 1KX5D 5AV5C 5B32D 1AOIA 5GT0B 4H9RB 3R45A 4Z66B 5KDMB 5BNXB 4WU9C 3X1VD 2Y2QA 3MGPD 1BH9A 3WAAA 1P34B 5BO0A 3MNNC 3AZND 5CP6A 3MGRC 3H0RC 5GXQA 4J8VC 5G49B 3W97C 5B24C 5AV9A 5B2IB 3W96C 5AV8A 5DNND 3AYWC 1M18D 4R8PB 3X1TD 4YS3D 3AZMD 1P3KB 3W99B 3KXBD 1P3OA 1M19D 3AZEA 4NE5A 4J8XA 5B1MD 4YM6C 5AV5D 4NFTA 3VH5W 1F66C 1JFIA 4H9PA 3LJAA 4J8WD 4ZUXB 4H9OA 3VH6T 3MNND 4JJNA 4QLCB 3MGQA 3AV2A 3AZLA 1ID3A 5CPID 2FJ7B 1HTAA 3W98D 2LY8A 5B24D 3B0DC 5CPKD 1P3IB 3X1UB 2F8ND 5B0ZA 2F8NH 4X23C 4Z5TD 3C1CB 3UTAC 3AZJA 5GT0A 4H9RA 4Z66A 3AFAB 4J8VB 1F66D 3W97B 2NQBC 3LZ0A 5AV6C 5JRGB 3WTPD 3W96B 5G49A 5B31C 4DRAA 5B2IA 1P3PC 4G92C 4YM6B 3W99A 5B1LC 3LELC 4X23D 3C1BC 3UTAD 5B2JD 3VH6W 3X1SD 5CP6C 3AV1A 3AZFC 5B0YC 3AZGC 1ULYA 1S32D 4KGCC 3B6GC 3UT9C 3B0DB 2NQBD 5AV6D 2PYOC 2CV5B 2FJ7A 5B31D 3REIC 1P3IA 1P3PD 3X1UA 4DRBA 4XZQC 3C1CA 1EQZB 5CPJC 3LELD 3B6FC 1KX4A 3WKJA 3C1BD 5CP6D 3AZFD 1ZLAB 3AV2C 3A6NA 3A1KA 3AZGD 5JRGA 5GXQD 2ZY3A 4G91C 4KGCD 3UT9D 4HGAC 5AV9D 5B1LB 5AY8C 5JA4A 5AVBC 5BS7A 3AZHB 1H3OB 3X1VC 5AV8D 3AZJC 4XUJB 3REID 1P3GA 2HIOC 1P3OD 4WJ3C 3WKJB 1P3MB 3MGSB 1N1JB 4J8XD 3AZKB 3WA9C 4KUDB 4H9SA 4XZQD 1F1EA 3B6GB 1P3LC 5CHLB 1WWSA 1HQ3A 3RELB 5DNNC 1M18C 3B6FD 1KU5A 1P3BB 3F6TA 4YS3C 2PYOB 3WTPE 3KXBC 2AROB 1P3AB 1KX3B 3IP4C 5E5AC 3AV2D 1ID3D 3A1IA 4KHAB 2CV5A 3O62C 1TAFB 3EG5B 5CPJB 3REKB 2HUEC 3KSYA 5AY8D 5AVBD 4J8WC 5B40B 5FUGB 3AZJD 1EQZA 3KUYC 2HIOD 2NZDB 3AV1C 4UPKA 5GT0D 3KWQC 3AL0C 4UUZA 5CPIC 4WZSB 3NQUB 1KX5B 2Y2HA 3W98C 3WA9D 5CPKC 3EPHA 5B32B 4G91B 1P3LD 1ZLAA 3LZ0D 4Z5TC 5DNMC 2Y2MA 3TU4A 3MGPB 4CSRB 2F8NK 3AZNB 4LD9B 3AZHA 4EO5B 5E5AD 2BYKB 5F99C 3MVDC 5AVCB 4XUJA 3O62D 3AN2B 3KFUG 3WTPC 1KX4C 3H0LC 4AWLB 3LZ1B 5DNNB 1P3FA 1M1AA 3AZMB 3X1TB 1P3MA 3MGSA 1N1JA 3AZKA 4KUDA 4NE3A 3KXBB 5B33C 4ZBJB 3KUYD 1M19B 3AV1D 3FDDA 3KWQD 3RELA 5B1MB 1P3BA 5AV5B 1BH8B 4J8UC 3AZIA 2UWXA 2AROA 2JE5A 1P3AA 1KX3A 5GSUA 2HUEB 1TZYC 4E45A 5DNMD 2F2AC 4WU9B 4KHAA 5B2JC 3X1SC 4Z2MH 3MNNB 1P3GC 3REKA 3MGRB 2FFFB 3UTBC 1P3ID 5KDMA 5BNXA 3NQJB 4DQYB 5B40A 5GT3C 1S32C 5F99D 3MVDD 3W98B 5B24B 1P34A 3C1CD 5CPKB 5FUGA 2NZDA 4WU8C 1HQ3C 3REJC 2F8NB 1KX4D 4Z5TB 3NQUA 1U35C 3AYWB 1KX5A 2ZY5A 4WNNB 5B32A 5B33D 4H9QB 3REHC 2Y2IA 3A6ND 2W8SA 4R8PA 1P3KA 4J8UD 1F66B 4CSRA 1AOIC 4LD9A 3AZNA 5B32G 3WTPB 1TZYD 2BYKA 3WAAC 1W2EA 5AVCA 1P3GD 3UTBD 3AN2A 4H9NB 5GXQC 3LZ1A 5GT3D 4ZUXA 3AZMA 3X1TA 5C3IC 5AV9C 4QLCA 1M19A 4WU8D 1HQ3D 3REJD 5AV8C 4X23B 1U35D 5B1MA 5AV5A 3UTAB 2DQNC 1P3OC 3AZEC 3REHD 1R4VA 4J8XC 4WU9A 1AOID 1Q9CA 3MNNA 2NQBB 3LJAC 2DF4C 3MGRA 3VH6A 2YFVB 5AV6B 3AFAA 2BG1A 3NQJA 4J8VA 5B31B 3EPLA 3WAAD 3W97A 4JJNC 3MGQC 2BYMB 1B6WA 3AZLC 1P3PB 1ID3C 2YFWB 3W96A 4G92B 3AYWA 4WNNA 3LELB 4H9QA 5B0ZC 2G5HC 1ZLAD 2L5AA 2G5IC 2F8NG 3TU4D 4YM6A 3C1BB 1F66A 5BO0B 5GT0C 5CP6B 2Y2KA 3AZED 3AZFB 4Z66C 5B0YB 3AZGB 2ZY4A 4KGCB 3UT9B 3LZ0C 3LJAD 4H9NA 3WKJD 1P3FD 1M1AD 1P3MD 3REIB 4JJND 3MGQD 2Y2PA 5B2IC 3AZLD 3RELD 3V9RB 4J8XB 3W99C 1P3BD 3AZID 4XZQB 1A7WA 3UTAA 1B67A 1KX3D 5GSUD 5B0ZD 3B6FB 1BFMA 2NQBA 4Z66D 3AV2B 2YFVA 5AV6A 1ID3B 3P5JB 5B31A 1P34D 4HGAB 5AY8B 2BYMA 5AVBB 1P3PA 3X1VB 2FJ7C 4M6BA 2VQRA 3AZJB 5B31G 2HIOB 5B1LA 3LELA 3H0MC 1P3IC 5B2ID 3X1UC 1H3OA 3W99D 4R8PD 3C1CC 3C1BA 1P3KD 3WA9B 1P3LB 4LD9D 3AZFA 3LZ0B 3AFAC 5B0YA 3AZGA 1M18B 4YS3B 2JCHA 4KGCA 3B6GA 5BT1C 5AVCD 3UT9A 3AN2D 3A6NC 5E5AB 5JRGC 3LZ1D 2PYOA 4ZUXD 3REIA 3O62B 2J8PA 5BS7C 4CAYB 4QLCD 2CWEA 4J8WB 2Y2GA 3V9RA 2FJ7D 3EPJA 4XZQA 1TAFA 5CPJA 3VH5A 3KUYB 3AV1B 3KWQB 3X1UD 4WV4B 5CPIB 3B6FA 4H9SC 4WU9D 3MGRD 2ZY2A 3AFAD 5DNMB 4J8VD 3B0BA 3W97D 5BT1D 5AY8A 5AVBA 2RVQC 5JRGD 3W96D 3X1VA 5F99B 2CV5C 3MGPA 3MVDB 3AYWD 2Y2LA 2HIOA 1KX4B 4YM6D 1EQZC 3WA9A 5B33B 3B0CT 5BNVB 1P3LA 2Y2JA 3A6NB 5DNNA 2ZM5A 1M18A 4YS3A 4J8UB 3KXBA 5JA4B 1ZLAC 4E44A 1TZYB 5E5AA 2JSSA 3TU4C 1BH8A 5B2JB 3X1SB 3O62A 2IO5C 3AZHC 1P3GB 3UTBB 4CAYA 4J8WA 2RVQD 4NE6A 1S32B 5GT3B 2CV5D 1Z2CB 4XUJC 3KUYA 2Y2OA 4WU8B 1HQ3B 3KWQA 3REJB 1P3FC 3WKJC 1M1AC 5CPIA 1P3MC 1U35B 3MGSC 3AZKC 3W98A 4KUDC 5B24A 2XD5A 1EQZD 5CPKA 3REHB 2F8NA 1PZRA 3RELC 4Z5TA 1P3BC 5DNMA 3AZIC 2AROC 1P3AC 1KX3C 5GSUC 1AOIB 3R45B 5F99A 1BH9B 3WAAB 3MVDA 3B0CW 3REKC 4Z2MG 5B1LD 3AZHD 2XD1A 3WTPA 5GXQB 4UUZB 5B40C 1T3UA
chains in the Genus database with same CATH topology
3EPKA 1P34C 5C3IB 4XUJD 5AV9B 5B33A 2NZDC 5BNVA 5AV8B 2RIQA 5B0YD 1KX5C 3TU4B 3MGSD 3AZKD 4J8UA 4KUDD 5B32C 1P3OB 3B6GD 2IO5B 3AZEB 1TZYA 4X23A 4R8PC 1P3KC 3MGPC 2PYOD 2AROD 5B2JA 3X1SA 4LD9C 3AZNC 1P3AD 1JFIB 4H9PB 3LJAB 3UTBA 4EO5C 1P3FB 1WWIA 1S32A 5GT3A 1M1AB 3VH5T 4H9OB 5AVCC 4JJNB 5CPJD 2Y2NA 3MGQB 3REKD 3AN2C 3AZLB 4WU8A 3REJA 4AWLC 3LZ1C 5B40D 4ZUXC 3AZMC 3X1TC 1U35A 3AZIB 4ZBJC 4QLCC 1M19C 5GSUB 2NZDD 3REHA 5B0ZB 2YFWA 5B1MC 1KX5D 5AV5C 5B32D 1AOIA 5GT0B 4H9RB 3R45A 4Z66B 5KDMB 5BNXB 4WU9C 3X1VD 2Y2QA 3MGPD 1BH9A 3WAAA 1P34B 5BO0A 3MNNC 3AZND 5CP6A 3MGRC 3H0RC 5GXQA 4J8VC 5G49B 3W97C 5B24C 5AV9A 5B2IB 3W96C 5AV8A 5DNND 3AYWC 1M18D 4R8PB 3X1TD 4YS3D 3AZMD 1P3KB 3W99B 3KXBD 1P3OA 1M19D 3AZEA 4NE5A 4J8XA 5B1MD 4YM6C 5AV5D 4NFTA 3VH5W 1F66C 1JFIA 4H9PA 3LJAA 4J8WD 4ZUXB 4H9OA 3VH6T 3MNND 4JJNA 4QLCB 3MGQA 3AV2A 3AZLA 1ID3A 5CPID 2FJ7B 1HTAA 3W98D 2LY8A 5B24D 3B0DC 5CPKD 1P3IB 3X1UB 2F8ND 5B0ZA 2F8NH 4X23C 4Z5TD 3C1CB 3UTAC 3AZJA 5GT0A 4H9RA 4Z66A 3AFAB 4J8VB 1F66D 3W97B 2NQBC 3LZ0A 5AV6C 5JRGB 3WTPD 3W96B 5G49A 5B31C 4DRAA 5B2IA 1P3PC 4G92C 4YM6B 3W99A 5B1LC 3LELC 4X23D 3C1BC 3UTAD 5B2JD 3VH6W 3X1SD 5CP6C 3AV1A 3AZFC 5B0YC 3AZGC 1ULYA 1S32D 4KGCC 3B6GC 3UT9C 3B0DB 2NQBD 5AV6D 2PYOC 2CV5B 2FJ7A 5B31D 3REIC 1P3IA 1P3PD 3X1UA 4DRBA 4XZQC 3C1CA 1EQZB 5CPJC 3LELD 3B6FC 1KX4A 3WKJA 3C1BD 5CP6D 3AZFD 1ZLAB 3AV2C 3A6NA 3A1KA 3AZGD 5JRGA 5GXQD 2ZY3A 4G91C 4KGCD 3UT9D 4HGAC 5AV9D 5B1LB 5AY8C 5JA4A 5AVBC 5BS7A 3AZHB 1H3OB 3X1VC 5AV8D 3AZJC 4XUJB 3REID 1P3GA 2HIOC 1P3OD 4WJ3C 3WKJB 1P3MB 3MGSB 1N1JB 4J8XD 3AZKB 3WA9C 4KUDB 4H9SA 4XZQD 1F1EA 3B6GB 1P3LC 5CHLB 1WWSA 1HQ3A 3RELB 5DNNC 1M18C 3B6FD 1KU5A 1P3BB 3F6TA 4YS3C 2PYOB 3WTPE 3KXBC 2AROB 1P3AB 1KX3B 3IP4C 5E5AC 3AV2D 1ID3D 3A1IA 4KHAB 2CV5A 3O62C 1TAFB 3EG5B 5CPJB 3REKB 2HUEC 3KSYA 5AY8D 5AVBD 4J8WC 5B40B 5FUGB 3AZJD 1EQZA 3KUYC 2HIOD 2NZDB 3AV1C 4UPKA 5GT0D 3KWQC 3AL0C 4UUZA 5CPIC 4WZSB 3NQUB 1KX5B 2Y2HA 3W98C 3WA9D 5CPKC 3EPHA 5B32B 4G91B 1P3LD 1ZLAA 3LZ0D 4Z5TC 5DNMC 2Y2MA 3TU4A 3MGPB 4CSRB 2F8NK 3AZNB 4LD9B 3AZHA 4EO5B 5E5AD 2BYKB 5F99C 3MVDC 5AVCB 4XUJA 3O62D 3AN2B 3KFUG 3WTPC 1KX4C 3H0LC 4AWLB 3LZ1B 5DNNB 1P3FA 1M1AA 3AZMB 3X1TB 1P3MA 3MGSA 1N1JA 3AZKA 4KUDA 4NE3A 3KXBB 5B33C 4ZBJB 3KUYD 1M19B 3AV1D 3FDDA 3KWQD 3RELA 5B1MB 1P3BA 5AV5B 1BH8B 4J8UC 3AZIA 2UWXA 2AROA 2JE5A 1P3AA 1KX3A 5GSUA 2HUEB 1TZYC 4E45A 5DNMD 2F2AC 4WU9B 4KHAA 5B2JC 3X1SC 4Z2MH 3MNNB 1P3GC 3REKA 3MGRB 2FFFB 3UTBC 1P3ID 5KDMA 5BNXA 3NQJB 4DQYB 5B40A 5GT3C 1S32C 5F99D 3MVDD 3W98B 5B24B 1P34A 3C1CD 5CPKB 5FUGA 2NZDA 4WU8C 1HQ3C 3REJC 2F8NB 1KX4D 4Z5TB 3NQUA 1U35C 3AYWB 1KX5A 2ZY5A 4WNNB 5B32A 5B33D 4H9QB 3REHC 2Y2IA 3A6ND 2W8SA 4R8PA 1P3KA 4J8UD 1F66B 4CSRA 1AOIC 4LD9A 3AZNA 5B32G 3WTPB 1TZYD 2BYKA 3WAAC 1W2EA 5AVCA 1P3GD 3UTBD 3AN2A 4H9NB 5GXQC 3LZ1A 5GT3D 4ZUXA 3AZMA 3X1TA 5C3IC 5AV9C 4QLCA 1M19A 4WU8D 1HQ3D 3REJD 5AV8C 4X23B 1U35D 5B1MA 5AV5A 3UTAB 2DQNC 1P3OC 3AZEC 3REHD 1R4VA 4J8XC 4WU9A 1AOID 1Q9CA 3MNNA 2NQBB 3LJAC 2DF4C 3MGRA 3VH6A 2YFVB 5AV6B 3AFAA 2BG1A 3NQJA 4J8VA 5B31B 3EPLA 3WAAD 3W97A 4JJNC 3MGQC 2BYMB 1B6WA 3AZLC 1P3PB 1ID3C 2YFWB 3W96A 4G92B 3AYWA 4WNNA 3LELB 4H9QA 5B0ZC 2G5HC 1ZLAD 2L5AA 2G5IC 2F8NG 3TU4D 4YM6A 3C1BB 1F66A 5BO0B 5GT0C 5CP6B 2Y2KA 3AZED 3AZFB 4Z66C 5B0YB 3AZGB 2ZY4A 4KGCB 3UT9B 3LZ0C 3LJAD 4H9NA 3WKJD 1P3FD 1M1AD 1P3MD 3REIB 4JJND 3MGQD 2Y2PA 5B2IC 3AZLD 3RELD 3V9RB 4J8XB 3W99C 1P3BD 3AZID 4XZQB 1A7WA 3UTAA 1B67A 1KX3D 5GSUD 5B0ZD 3B6FB 1BFMA 2NQBA 4Z66D 3AV2B 2YFVA 5AV6A 1ID3B 3P5JB 5B31A 1P34D 4HGAB 5AY8B 2BYMA 5AVBB 1P3PA 3X1VB 2FJ7C 4M6BA 2VQRA 3AZJB 5B31G 2HIOB 5B1LA 3LELA 3H0MC 1P3IC 5B2ID 3X1UC 1H3OA 3W99D 4R8PD 3C1CC 3C1BA 1P3KD 3WA9B 1P3LB 4LD9D 3AZFA 3LZ0B 3AFAC 5B0YA 3AZGA 1M18B 4YS3B 2JCHA 4KGCA 3B6GA 5BT1C 5AVCD 3UT9A 3AN2D 3A6NC 5E5AB 5JRGC 3LZ1D 2PYOA 4ZUXD 3REIA 3O62B 2J8PA 5BS7C 4CAYB 4QLCD 2CWEA 4J8WB 2Y2GA 3V9RA 2FJ7D 3EPJA 4XZQA 1TAFA 5CPJA 3VH5A 3KUYB 3AV1B 3KWQB 3X1UD 4WV4B 5CPIB 3B6FA 4H9SC 4WU9D 3MGRD 2ZY2A 3AFAD 5DNMB 4J8VD 3B0BA 3W97D 5BT1D 5AY8A 5AVBA 2RVQC 5JRGD 3W96D 3X1VA 5F99B 2CV5C 3MGPA 3MVDB 3AYWD 2Y2LA 2HIOA 1KX4B 4YM6D 1EQZC 3WA9A 5B33B 3B0CT 5BNVB 1P3LA 2Y2JA 3A6NB 5DNNA 2ZM5A 1M18A 4YS3A 4J8UB 3KXBA 5JA4B 1ZLAC 4E44A 1TZYB 5E5AA 2JSSA 3TU4C 1BH8A 5B2JB 3X1SB 3O62A 2IO5C 3AZHC 1P3GB 3UTBB 4CAYA 4J8WA 2RVQD 4NE6A 1S32B 5GT3B 2CV5D 1Z2CB 4XUJC 3KUYA 2Y2OA 4WU8B 1HQ3B 3KWQA 3REJB 1P3FC 3WKJC 1M1AC 5CPIA 1P3MC 1U35B 3MGSC 3AZKC 3W98A 4KUDC 5B24A 2XD5A 1EQZD 5CPKA 3REHB 2F8NA 1PZRA 3RELC 4Z5TA 1P3BC 5DNMA 3AZIC 2AROC 1P3AC 1KX3C 5GSUC 1AOIB 3R45B 5F99A 1BH9B 3WAAB 3MVDA 3B0CW 3REKC 4Z2MG 5B1LD 3AZHD 2XD1A 3WTPA 5GXQB 4UUZB 5B40C 1T3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFU G;  3IP4 C;  3AL0 C;  3A1K A;  2DF4 C;  3H0M C;  3H0L C;  3A1I A;  2G5H C;  2F2A C;  2G5I C;  3H0R C;  4WJ3 C;  2DQN C; 
#chains in the Genus database with same CATH topology
 3EPK A;  1P34 C;  5C3I B;  4XUJ D;  5AV9 B;  5B33 A;  2NZD C;  5BNV A;  5AV8 B;  2RIQ A;  5B0Y D;  1KX5 C;  3TU4 B;  3MGS D;  3AZK D;  4J8U A;  4KUD D;  5B32 C;  1P3O B;  3B6G D;  2IO5 B;  3AZE B;  1TZY A;  4X23 A;  4R8P C;  1P3K C;  3MGP C;  2PYO D;  2ARO D;  5B2J A;  3X1S A;  4LD9 C;  3AZN C;  1P3A D;  1JFI B;  4H9P B;  3LJA B;  3UTB A;  4EO5 C;  1P3F B;  1WWI A;  1S32 A;  5GT3 A;  1M1A B;  3VH5 T;  4H9O B;  5AVC C;  4JJN B;  5CPJ D;  2Y2N A;  3MGQ B;  3REK D;  3AN2 C;  3AZL B;  4WU8 A;  3REJ A;  4AWL C;  3LZ1 C;  5B40 D;  4ZUX C;  3AZM C;  3X1T C;  1U35 A;  3AZI B;  4ZBJ C;  4QLC C;  1M19 C;  5GSU B;  2NZD D;  3REH A;  5B0Z B;  2YFW A;  5B1M C;  1KX5 D;  5AV5 C;  5B32 D;  1AOI A;  5GT0 B;  4H9R B;  3R45 A;  4Z66 B;  5KDM B;  5BNX B;  4WU9 C;  3X1V D;  2Y2Q A;  3MGP D;  1BH9 A;  3WAA A;  1P34 B;  5BO0 A;  3MNN C;  3AZN D;  5CP6 A;  3MGR C;  3H0R C;  5GXQ A;  4J8V C;  5G49 B;  3W97 C;  5B24 C;  5AV9 A;  5B2I B;  3W96 C;  5AV8 A;  5DNN D;  3AYW C;  1M18 D;  4R8P B;  3X1T D;  4YS3 D;  3AZM D;  1P3K B;  3W99 B;  3KXB D;  1P3O A;  1M19 D;  3AZE A;  4NE5 A;  4J8X A;  5B1M D;  4YM6 C;  5AV5 D;  4NFT A;  3VH5 W;  1F66 C;  1JFI A;  4H9P A;  3LJA A;  4J8W D;  4ZUX B;  4H9O A;  3VH6 T;  3MNN D;  4JJN A;  4QLC B;  3MGQ A;  3AV2 A;  3AZL A;  1ID3 A;  5CPI D;  2FJ7 B;  1HTA A;  3W98 D;  2LY8 A;  5B24 D;  3B0D C;  5CPK D;  1P3I B;  3X1U B;  2F8N D;  5B0Z A;  2F8N H;  4X23 C;  4Z5T D;  3C1C B;  3UTA C;  3AZJ A;  5GT0 A;  4H9R A;  4Z66 A;  3AFA B;  4J8V B;  1F66 D;  3W97 B;  2NQB C;  3LZ0 A;  5AV6 C;  5JRG B;  3WTP D;  3W96 B;  5G49 A;  5B31 C;  4DRA A;  5B2I A;  1P3P C;  4G92 C;  4YM6 B;  3W99 A;  5B1L C;  3LEL C;  4X23 D;  3C1B C;  3UTA D;  5B2J D;  3VH6 W;  3X1S D;  5CP6 C;  3AV1 A;  3AZF C;  5B0Y C;  3AZG C;  1ULY A;  1S32 D;  4KGC C;  3B6G C;  3UT9 C;  3B0D B;  2NQB D;  5AV6 D;  2PYO C;  2CV5 B;  2FJ7 A;  5B31 D;  3REI C;  1P3I A;  1P3P D;  3X1U A;  4DRB A;  4XZQ C;  3C1C A;  1EQZ B;  5CPJ C;  3LEL D;  3B6F C;  1KX4 A;  3WKJ A;  3C1B D;  5CP6 D;  3AZF D;  1ZLA B;  3AV2 C;  3A6N A;  3A1K A;  3AZG D;  5JRG A;  5GXQ D;  2ZY3 A;  4G91 C;  4KGC D;  3UT9 D;  4HGA C;  5AV9 D;  5B1L B;  5AY8 C;  5JA4 A;  5AVB C;  5BS7 A;  3AZH B;  1H3O B;  3X1V C;  5AV8 D;  3AZJ C;  4XUJ B;  3REI D;  1P3G A;  2HIO C;  1P3O D;  4WJ3 C;  3WKJ B;  1P3M B;  3MGS B;  1N1J B;  4J8X D;  3AZK B;  3WA9 C;  4KUD B;  4H9S A;  4XZQ D;  1F1E A;  3B6G B;  1P3L C;  5CHL B;  1WWS A;  1HQ3 A;  3REL B;  5DNN C;  1M18 C;  3B6F D;  1KU5 A;  1P3B B;  3F6T A;  4YS3 C;  2PYO B;  3WTP E;  3KXB C;  2ARO B;  1P3A B;  1KX3 B;  3IP4 C;  5E5A C;  3AV2 D;  1ID3 D;  3A1I A;  4KHA B;  2CV5 A;  3O62 C;  1TAF B;  3EG5 B;  5CPJ B;  3REK B;  2HUE C;  3KSY A;  5AY8 D;  5AVB D;  4J8W C;  5B40 B;  5FUG B;  3AZJ D;  1EQZ A;  3KUY C;  2HIO D;  2NZD B;  3AV1 C;  4UPK A;  5GT0 D;  3KWQ C;  3AL0 C;  4UUZ A;  5CPI C;  4WZS B;  3NQU B;  1KX5 B;  2Y2H A;  3W98 C;  3WA9 D;  5CPK C;  3EPH A;  5B32 B;  4G91 B;  1P3L D;  1ZLA A;  3LZ0 D;  4Z5T C;  5DNM C;  2Y2M A;  3TU4 A;  3MGP B;  4CSR B;  2F8N K;  3AZN B;  4LD9 B;  3AZH A;  4EO5 B;  5E5A D;  2BYK B;  5F99 C;  3MVD C;  5AVC B;  4XUJ A;  3O62 D;  3AN2 B;  3KFU G;  3WTP C;  1KX4 C;  3H0L C;  4AWL B;  3LZ1 B;  5DNN B;  1P3F A;  1M1A A;  3AZM B;  3X1T B;  1P3M A;  3MGS A;  1N1J A;  3AZK A;  4KUD A;  4NE3 A;  3KXB B;  5B33 C;  4ZBJ B;  3KUY D;  1M19 B;  3AV1 D;  3FDD A;  3KWQ D;  3REL A;  5B1M B;  1P3B A;  5AV5 B;  1BH8 B;  4J8U C;  3AZI A;  2UWX A;  2ARO A;  2JE5 A;  1P3A A;  1KX3 A;  5GSU A;  2HUE B;  1TZY C;  4E45 A;  5DNM D;  2F2A C;  4WU9 B;  4KHA A;  5B2J C;  3X1S C;  4Z2M H;  3MNN B;  1P3G C;  3REK A;  3MGR B;  2FFF B;  3UTB C;  1P3I D;  5KDM A;  5BNX A;  3NQJ B;  4DQY B;  5B40 A;  5GT3 C;  1S32 C;  5F99 D;  3MVD D;  3W98 B;  5B24 B;  1P34 A;  3C1C D;  5CPK B;  5FUG A;  2NZD A;  4WU8 C;  1HQ3 C;  3REJ C;  2F8N B;  1KX4 D;  4Z5T B;  3NQU A;  1U35 C;  3AYW B;  1KX5 A;  2ZY5 A;  4WNN B;  5B32 A;  5B33 D;  4H9Q B;  3REH C;  2Y2I A;  3A6N D;  2W8S A;  4R8P A;  1P3K A;  4J8U D;  1F66 B;  4CSR A;  1AOI C;  4LD9 A;  3AZN A;  5B32 G;  3WTP B;  1TZY D;  2BYK A;  3WAA C;  1W2E A;  5AVC A;  1P3G D;  3UTB D;  3AN2 A;  4H9N B;  5GXQ C;  3LZ1 A;  5GT3 D;  4ZUX A;  3AZM A;  3X1T A;  5C3I C;  5AV9 C;  4QLC A;  1M19 A;  4WU8 D;  1HQ3 D;  3REJ D;  5AV8 C;  4X23 B;  1U35 D;  5B1M A;  5AV5 A;  3UTA B;  2DQN C;  1P3O C;  3AZE C;  3REH D;  1R4V A;  4J8X C;  4WU9 A;  1AOI D;  1Q9C A;  3MNN A;  2NQB B;  3LJA C;  2DF4 C;  3MGR A;  3VH6 A;  2YFV B;  5AV6 B;  3AFA A;  2BG1 A;  3NQJ A;  4J8V A;  5B31 B;  3EPL A;  3WAA D;  3W97 A;  4JJN C;  3MGQ C;  2BYM B;  1B6W A;  3AZL C;  1P3P B;  1ID3 C;  2YFW B;  3W96 A;  4G92 B;  3AYW A;  4WNN A;  3LEL B;  4H9Q A;  5B0Z C;  2G5H C;  1ZLA D;  2L5A A;  2G5I C;  2F8N G;  3TU4 D;  4YM6 A;  3C1B B;  1F66 A;  5BO0 B;  5GT0 C;  5CP6 B;  2Y2K A;  3AZE D;  3AZF B;  4Z66 C;  5B0Y B;  3AZG B;  2ZY4 A;  4KGC B;  3UT9 B;  3LZ0 C;  3LJA D;  4H9N A;  3WKJ D;  1P3F D;  1M1A D;  1P3M D;  3REI B;  4JJN D;  3MGQ D;  2Y2P A;  5B2I C;  3AZL D;  3REL D;  3V9R B;  4J8X B;  3W99 C;  1P3B D;  3AZI D;  4XZQ B;  1A7W A;  3UTA A;  1B67 A;  1KX3 D;  5GSU D;  5B0Z D;  3B6F B;  1BFM A;  2NQB A;  4Z66 D;  3AV2 B;  2YFV A;  5AV6 A;  1ID3 B;  3P5J B;  5B31 A;  1P34 D;  4HGA B;  5AY8 B;  2BYM A;  5AVB B;  1P3P A;  3X1V B;  2FJ7 C;  4M6B A;  2VQR A;  3AZJ B;  5B31 G;  2HIO B;  5B1L A;  3LEL A;  3H0M C;  1P3I C;  5B2I D;  3X1U C;  1H3O A;  3W99 D;  4R8P D;  3C1C C;  3C1B A;  1P3K D;  3WA9 B;  1P3L B;  4LD9 D;  3AZF A;  3LZ0 B;  3AFA C;  5B0Y A;  3AZG A;  1M18 B;  4YS3 B;  2JCH A;  4KGC A;  3B6G A;  5BT1 C;  5AVC D;  3UT9 A;  3AN2 D;  3A6N C;  5E5A B;  5JRG C;  3LZ1 D;  2PYO A;  4ZUX D;  3REI A;  3O62 B;  2J8P A;  5BS7 C;  4CAY B;  4QLC D;  2CWE A;  4J8W B;  2Y2G A;  3V9R A;  2FJ7 D;  3EPJ A;  4XZQ A;  1TAF A;  5CPJ A;  3VH5 A;  3KUY B;  3AV1 B;  3KWQ B;  3X1U D;  4WV4 B;  5CPI B;  3B6F A;  4H9S C;  4WU9 D;  3MGR D;  2ZY2 A;  3AFA D;  5DNM B;  4J8V D;  3B0B A;  3W97 D;  5BT1 D;  5AY8 A;  5AVB A;  2RVQ C;  5JRG D;  3W96 D;  3X1V A;  5F99 B;  2CV5 C;  3MGP A;  3MVD B;  3AYW D;  2Y2L A;  2HIO A;  1KX4 B;  4YM6 D;  1EQZ C;  3WA9 A;  5B33 B;  3B0C T;  5BNV B;  1P3L A;  2Y2J A;  3A6N B;  5DNN A;  2ZM5 A;  1M18 A;  4YS3 A;  4J8U B;  3KXB A;  5JA4 B;  1ZLA C;  4E44 A;  1TZY B;  5E5A A;  2JSS A;  3TU4 C;  1BH8 A;  5B2J B;  3X1S B;  3O62 A;  2IO5 C;  3AZH C;  1P3G B;  3UTB B;  4CAY A;  4J8W A;  2RVQ D;  4NE6 A;  1S32 B;  5GT3 B;  2CV5 D;  1Z2C B;  4XUJ C;  3KUY A;  2Y2O A;  4WU8 B;  1HQ3 B;  3KWQ A;  3REJ B;  1P3F C;  3WKJ C;  1M1A C;  5CPI A;  1P3M C;  1U35 B;  3MGS C;  3AZK C;  3W98 A;  4KUD C;  5B24 A;  2XD5 A;  1EQZ D;  5CPK A;  3REH B;  2F8N A;  1PZR A;  3REL C;  4Z5T A;  1P3B C;  5DNM A;  3AZI C;  2ARO C;  1P3A C;  1KX3 C;  5GSU C;  1AOI B;  3R45 B;  5F99 A;  1BH9 B;  3WAA B;  3MVD A;  3B0C W;  3REK C;  4Z2M G;  5B1L D;  3AZH D;  2XD1 A;  3WTP A;  5GXQ B;  4UUZ B;  5B40 C;  1T3U A; 
#chains in the Genus database with same CATH homology
 3EPK A;  1P34 C;  5C3I B;  4XUJ D;  5AV9 B;  5B33 A;  2NZD C;  5BNV A;  5AV8 B;  2RIQ A;  5B0Y D;  1KX5 C;  3TU4 B;  3MGS D;  3AZK D;  4J8U A;  4KUD D;  5B32 C;  1P3O B;  3B6G D;  2IO5 B;  3AZE B;  1TZY A;  4X23 A;  4R8P C;  1P3K C;  3MGP C;  2PYO D;  2ARO D;  5B2J A;  3X1S A;  4LD9 C;  3AZN C;  1P3A D;  1JFI B;  4H9P B;  3LJA B;  3UTB A;  4EO5 C;  1P3F B;  1WWI A;  1S32 A;  5GT3 A;  1M1A B;  3VH5 T;  4H9O B;  5AVC C;  4JJN B;  5CPJ D;  2Y2N A;  3MGQ B;  3REK D;  3AN2 C;  3AZL B;  4WU8 A;  3REJ A;  4AWL C;  3LZ1 C;  5B40 D;  4ZUX C;  3AZM C;  3X1T C;  1U35 A;  3AZI B;  4ZBJ C;  4QLC C;  1M19 C;  5GSU B;  2NZD D;  3REH A;  5B0Z B;  2YFW A;  5B1M C;  1KX5 D;  5AV5 C;  5B32 D;  1AOI A;  5GT0 B;  4H9R B;  3R45 A;  4Z66 B;  5KDM B;  5BNX B;  4WU9 C;  3X1V D;  2Y2Q A;  3MGP D;  1BH9 A;  3WAA A;  1P34 B;  5BO0 A;  3MNN C;  3AZN D;  5CP6 A;  3MGR C;  3H0R C;  5GXQ A;  4J8V C;  5G49 B;  3W97 C;  5B24 C;  5AV9 A;  5B2I B;  3W96 C;  5AV8 A;  5DNN D;  3AYW C;  1M18 D;  4R8P B;  3X1T D;  4YS3 D;  3AZM D;  1P3K B;  3W99 B;  3KXB D;  1P3O A;  1M19 D;  3AZE A;  4NE5 A;  4J8X A;  5B1M D;  4YM6 C;  5AV5 D;  4NFT A;  3VH5 W;  1F66 C;  1JFI A;  4H9P A;  3LJA A;  4J8W D;  4ZUX B;  4H9O A;  3VH6 T;  3MNN D;  4JJN A;  4QLC B;  3MGQ A;  3AV2 A;  3AZL A;  1ID3 A;  5CPI D;  2FJ7 B;  1HTA A;  3W98 D;  2LY8 A;  5B24 D;  3B0D C;  5CPK D;  1P3I B;  3X1U B;  2F8N D;  5B0Z A;  2F8N H;  4X23 C;  4Z5T D;  3C1C B;  3UTA C;  3AZJ A;  5GT0 A;  4H9R A;  4Z66 A;  3AFA B;  4J8V B;  1F66 D;  3W97 B;  2NQB C;  3LZ0 A;  5AV6 C;  5JRG B;  3WTP D;  3W96 B;  5G49 A;  5B31 C;  4DRA A;  5B2I A;  1P3P C;  4G92 C;  4YM6 B;  3W99 A;  5B1L C;  3LEL C;  4X23 D;  3C1B C;  3UTA D;  5B2J D;  3VH6 W;  3X1S D;  5CP6 C;  3AV1 A;  3AZF C;  5B0Y C;  3AZG C;  1ULY A;  1S32 D;  4KGC C;  3B6G C;  3UT9 C;  3B0D B;  2NQB D;  5AV6 D;  2PYO C;  2CV5 B;  2FJ7 A;  5B31 D;  3REI C;  1P3I A;  1P3P D;  3X1U A;  4DRB A;  4XZQ C;  3C1C A;  1EQZ B;  5CPJ C;  3LEL D;  3B6F C;  1KX4 A;  3WKJ A;  3C1B D;  5CP6 D;  3AZF D;  1ZLA B;  3AV2 C;  3A6N A;  3A1K A;  3AZG D;  5JRG A;  5GXQ D;  2ZY3 A;  4G91 C;  4KGC D;  3UT9 D;  4HGA C;  5AV9 D;  5B1L B;  5AY8 C;  5JA4 A;  5AVB C;  5BS7 A;  3AZH B;  1H3O B;  3X1V C;  5AV8 D;  3AZJ C;  4XUJ B;  3REI D;  1P3G A;  2HIO C;  1P3O D;  4WJ3 C;  3WKJ B;  1P3M B;  3MGS B;  1N1J B;  4J8X D;  3AZK B;  3WA9 C;  4KUD B;  4H9S A;  4XZQ D;  1F1E A;  3B6G B;  1P3L C;  5CHL B;  1WWS A;  1HQ3 A;  3REL B;  5DNN C;  1M18 C;  3B6F D;  1KU5 A;  1P3B B;  3F6T A;  4YS3 C;  2PYO B;  3WTP E;  3KXB C;  2ARO B;  1P3A B;  1KX3 B;  3IP4 C;  5E5A C;  3AV2 D;  1ID3 D;  3A1I A;  4KHA B;  2CV5 A;  3O62 C;  1TAF B;  3EG5 B;  5CPJ B;  3REK B;  2HUE C;  3KSY A;  5AY8 D;  5AVB D;  4J8W C;  5B40 B;  5FUG B;  3AZJ D;  1EQZ A;  3KUY C;  2HIO D;  2NZD B;  3AV1 C;  4UPK A;  5GT0 D;  3KWQ C;  3AL0 C;  4UUZ A;  5CPI C;  4WZS B;  3NQU B;  1KX5 B;  2Y2H A;  3W98 C;  3WA9 D;  5CPK C;  3EPH A;  5B32 B;  4G91 B;  1P3L D;  1ZLA A;  3LZ0 D;  4Z5T C;  5DNM C;  2Y2M A;  3TU4 A;  3MGP B;  4CSR B;  2F8N K;  3AZN B;  4LD9 B;  3AZH A;  4EO5 B;  5E5A D;  2BYK B;  5F99 C;  3MVD C;  5AVC B;  4XUJ A;  3O62 D;  3AN2 B;  3KFU G;  3WTP C;  1KX4 C;  3H0L C;  4AWL B;  3LZ1 B;  5DNN B;  1P3F A;  1M1A A;  3AZM B;  3X1T B;  1P3M A;  3MGS A;  1N1J A;  3AZK A;  4KUD A;  4NE3 A;  3KXB B;  5B33 C;  4ZBJ B;  3KUY D;  1M19 B;  3AV1 D;  3FDD A;  3KWQ D;  3REL A;  5B1M B;  1P3B A;  5AV5 B;  1BH8 B;  4J8U C;  3AZI A;  2UWX A;  2ARO A;  2JE5 A;  1P3A A;  1KX3 A;  5GSU A;  2HUE B;  1TZY C;  4E45 A;  5DNM D;  2F2A C;  4WU9 B;  4KHA A;  5B2J C;  3X1S C;  4Z2M H;  3MNN B;  1P3G C;  3REK A;  3MGR B;  2FFF B;  3UTB C;  1P3I D;  5KDM A;  5BNX A;  3NQJ B;  4DQY B;  5B40 A;  5GT3 C;  1S32 C;  5F99 D;  3MVD D;  3W98 B;  5B24 B;  1P34 A;  3C1C D;  5CPK B;  5FUG A;  2NZD A;  4WU8 C;  1HQ3 C;  3REJ C;  2F8N B;  1KX4 D;  4Z5T B;  3NQU A;  1U35 C;  3AYW B;  1KX5 A;  2ZY5 A;  4WNN B;  5B32 A;  5B33 D;  4H9Q B;  3REH C;  2Y2I A;  3A6N D;  2W8S A;  4R8P A;  1P3K A;  4J8U D;  1F66 B;  4CSR A;  1AOI C;  4LD9 A;  3AZN A;  5B32 G;  3WTP B;  1TZY D;  2BYK A;  3WAA C;  1W2E A;  5AVC A;  1P3G D;  3UTB D;  3AN2 A;  4H9N B;  5GXQ C;  3LZ1 A;  5GT3 D;  4ZUX A;  3AZM A;  3X1T A;  5C3I C;  5AV9 C;  4QLC A;  1M19 A;  4WU8 D;  1HQ3 D;  3REJ D;  5AV8 C;  4X23 B;  1U35 D;  5B1M A;  5AV5 A;  3UTA B;  2DQN C;  1P3O C;  3AZE C;  3REH D;  1R4V A;  4J8X C;  4WU9 A;  1AOI D;  1Q9C A;  3MNN A;  2NQB B;  3LJA C;  2DF4 C;  3MGR A;  3VH6 A;  2YFV B;  5AV6 B;  3AFA A;  2BG1 A;  3NQJ A;  4J8V A;  5B31 B;  3EPL A;  3WAA D;  3W97 A;  4JJN C;  3MGQ C;  2BYM B;  1B6W A;  3AZL C;  1P3P B;  1ID3 C;  2YFW B;  3W96 A;  4G92 B;  3AYW A;  4WNN A;  3LEL B;  4H9Q A;  5B0Z C;  2G5H C;  1ZLA D;  2L5A A;  2G5I C;  2F8N G;  3TU4 D;  4YM6 A;  3C1B B;  1F66 A;  5BO0 B;  5GT0 C;  5CP6 B;  2Y2K A;  3AZE D;  3AZF B;  4Z66 C;  5B0Y B;  3AZG B;  2ZY4 A;  4KGC B;  3UT9 B;  3LZ0 C;  3LJA D;  4H9N A;  3WKJ D;  1P3F D;  1M1A D;  1P3M D;  3REI B;  4JJN D;  3MGQ D;  2Y2P A;  5B2I C;  3AZL D;  3REL D;  3V9R B;  4J8X B;  3W99 C;  1P3B D;  3AZI D;  4XZQ B;  1A7W A;  3UTA A;  1B67 A;  1KX3 D;  5GSU D;  5B0Z D;  3B6F B;  1BFM A;  2NQB A;  4Z66 D;  3AV2 B;  2YFV A;  5AV6 A;  1ID3 B;  3P5J B;  5B31 A;  1P34 D;  4HGA B;  5AY8 B;  2BYM A;  5AVB B;  1P3P A;  3X1V B;  2FJ7 C;  4M6B A;  2VQR A;  3AZJ B;  5B31 G;  2HIO B;  5B1L A;  3LEL A;  3H0M C;  1P3I C;  5B2I D;  3X1U C;  1H3O A;  3W99 D;  4R8P D;  3C1C C;  3C1B A;  1P3K D;  3WA9 B;  1P3L B;  4LD9 D;  3AZF A;  3LZ0 B;  3AFA C;  5B0Y A;  3AZG A;  1M18 B;  4YS3 B;  2JCH A;  4KGC A;  3B6G A;  5BT1 C;  5AVC D;  3UT9 A;  3AN2 D;  3A6N C;  5E5A B;  5JRG C;  3LZ1 D;  2PYO A;  4ZUX D;  3REI A;  3O62 B;  2J8P A;  5BS7 C;  4CAY B;  4QLC D;  2CWE A;  4J8W B;  2Y2G A;  3V9R A;  2FJ7 D;  3EPJ A;  4XZQ A;  1TAF A;  5CPJ A;  3VH5 A;  3KUY B;  3AV1 B;  3KWQ B;  3X1U D;  4WV4 B;  5CPI B;  3B6F A;  4H9S C;  4WU9 D;  3MGR D;  2ZY2 A;  3AFA D;  5DNM B;  4J8V D;  3B0B A;  3W97 D;  5BT1 D;  5AY8 A;  5AVB A;  2RVQ C;  5JRG D;  3W96 D;  3X1V A;  5F99 B;  2CV5 C;  3MGP A;  3MVD B;  3AYW D;  2Y2L A;  2HIO A;  1KX4 B;  4YM6 D;  1EQZ C;  3WA9 A;  5B33 B;  3B0C T;  5BNV B;  1P3L A;  2Y2J A;  3A6N B;  5DNN A;  2ZM5 A;  1M18 A;  4YS3 A;  4J8U B;  3KXB A;  5JA4 B;  1ZLA C;  4E44 A;  1TZY B;  5E5A A;  2JSS A;  3TU4 C;  1BH8 A;  5B2J B;  3X1S B;  3O62 A;  2IO5 C;  3AZH C;  1P3G B;  3UTB B;  4CAY A;  4J8W A;  2RVQ D;  4NE6 A;  1S32 B;  5GT3 B;  2CV5 D;  1Z2C B;  4XUJ C;  3KUY A;  2Y2O A;  4WU8 B;  1HQ3 B;  3KWQ A;  3REJ B;  1P3F C;  3WKJ C;  1M1A C;  5CPI A;  1P3M C;  1U35 B;  3MGS C;  3AZK C;  3W98 A;  4KUD C;  5B24 A;  2XD5 A;  1EQZ D;  5CPK A;  3REH B;  2F8N A;  1PZR A;  3REL C;  4Z5T A;  1P3B C;  5DNM A;  3AZI C;  2ARO C;  1P3A C;  1KX3 C;  5GSU C;  1AOI B;  3R45 B;  5F99 A;  1BH9 B;  3WAA B;  3MVD A;  3B0C W;  3REK C;  4Z2M G;  5B1L D;  3AZH D;  2XD1 A;  3WTP A;  5GXQ B;  4UUZ B;  5B40 C;  1T3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...