4ZUXD

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Histone H3.2
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
source organism Xenopus laevis
total genus 37
structure length 95
sequence length 95
chains with identical sequence H, N, R
ec nomenclature
pdb deposition date 2015-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zuxD00
3AV1D 4LD9A 5B2JD 5CPKD 1P3KA 3AZKD 4Z5TA 1ULYA 3W98A 3X1SB 3WTPA 4J8XD 1P3FC 5F99B 5AVBC 5GT3B 2CV5D 1P3MD 1KX3C 2NQBA 3WKJA 5GSUA 5DNND 3A6NA 3LZ0D 5BT1C 5B32C 1Q9CA 4Z66D 5B24A 3AZNA 2FJ7A 2F8NK 3AZLB 1P3AA 3C1CC 4JJNB 5GXQD 5JRGA 5B0YA 1HQ3C 3KUYB 3W96C 5B2IC 3V9RA 4DRAA 3AZGD 1KX4C 3VH5W 1P34A 5B33D 1P3BB 3AV2C 4XZQB 5BO0B 1F66C 2PYOC 5AY8D 3B6GC 2RVQC 4WU9C 5B0ZC 3O62B 3VH6A 3MGPD 3RELD 1BH9A 4YM6C 2NZDA 5E5AA 3KWQC 5CP6C 1S32C 5BNXA 3AZJD 3UTBA 3AZMA 4R8PC 5AV5C 1P3FB 4H9OB 3X1VD 1M1AC 1ID3C 1TAFA 3AZFA 5AVBB 2HIOC 4YS3D 1KX3B 3W97D 3LZ1A 3AYWC 3REHC 5GT0D 5JA4A 3B6FA 5CHLB 5AV8A 3NQUB 1HQ3B 3LELD 3AZGA 1P3GB 5CPJC 1M18D 1EQZA 3W96B 2YFWB 4J8VC 5B33A 1KX4B 3UTAD 4E44A 5B1MB 3WAAC 3AV2B 1HTAA 2AROA 3B6GB 4J8WC 4WU9B 1U35A 5B0ZB 3MGSA 3C1BD 4YM6B 3W99A 3KWQB 4KGCA 5AVCA 3X1UC 1P3LC 4M6BA 1S32B 4J8UC 3UT9D 2F8NA 1ZLAD 3MNNC 2JSSA 4LD9D 2L5AA 3X1SC 4R8PB 5AV5B 1P3KD 1N1JA 3W98D 3WTPD 5BS7A 3AZHA 1P3MB 5KDMA 3REHB 3AFAA 3AZEA 4H9RB 2NQBD 3LZ0B 5GSUD 3A6ND 1R4VA 3LELA 5AV9C 3AZLC 4KUDC 3AZND 2FJ7D 2BYMB 5F99A 4KHAA 4CAYB 5CPJB 1P3AD 3REKA 4J8VB 5GT3A 5JRGD 5B0YD 1P3PC 3WAAB 4WU8D 1P34D 4H9QA 4J8WB 3KXBC 3AN2C 1KX5A 1ZLAA 3X1UB 4JJNA 5G49B 4J8UB 2F8NH 2NZDD 1M19A 5E5AD 3MNNB 3LJAD 1AOIC 3VH6W 3KUYA 3AZJB 3AZIC 3X1TD 4NE6A 4CSRB 3MVDA 3UTBD 4Z2MH 3TU4C 1P3BA 4NE5A 4Z5TC 3AZMD 4H9PA 5CPIC 4XZQA 5BO0A 4ZUXC 3O62A 4YS3B 3AZFD 1A7WA 1TZYC 5DNMA 3LZ1D 3WKJC 3B6FD 5B31D 5AV9B 1P3IC 4KUDB 1P3FA 4H9OA 4QLCD 5B24C 3REID 1BFMA 5AV8D 1P3GC 4NE3A 5AVBA 3REJC 4G92C 4WU8A 1KX3A 1EQZD 1P3PB 5B1MC 4H9SA 3MGRD 3NQJB 4X23D 5B32A 4G91C 2AROD 3KXBB 5B40D 3AN2B 1U35D 4XUJC 3LJAA 4WNNB 3C1CA 3NQUA 3MGSD 3MGQC 1B67A 1HQ3A 3W99D 5AV6C 3UT9B 3AV1C 3X1TA 1AOIB 4KGCD 3W96A 5AVCD 2YFWA 1P3OD 5B2JC 5B2IA 3AZIB 3AZKC 5CPKC 4LD9B 2F8ND 3TU4B 4Z5TB 4J8XC 5CPIB 1F66A 2PYOA 3B0BA 3B6GA 4ZUXB 5B1LD 4WU9A 5B0ZA 4YM6A 1TZYB 2CV5C 1P3MC 5CP6A 3AZHD 2BYKB 5DNNC 2LY8A 3LZ0C 5B31A 3AFAD 3AZED 3WKJB 3WA9D 4Z66C 4WV4B 4QLCA 3REIA 1P3IB 5B24B 3AZNB 1M1AA 1ID3A 3B0DC 5GXQC 3MGRA 3REJB 2HIOA 5F99D 4G92B 3AYWA 2IO5C 3REKD 3AZGC 4X23A 5GT3D 3REHA 4H9RA 3B0CT 3V9RB 5B33C 5B40A 4G91B 1P34B 5AY8C 4H9NB 4XUJB 5BNVB 3MGPC 3RELC 3MGQB 1P3OA 5AV6B 3AV1B 5CPJA 1KX5D 5B2JB 4JJND 5CPKB 3AZKB 3AZJC 1M19D 3KUYD 4J8XB 5B1LA 3AZMB 3X1VC 3MVDD 4J8WA 1P3BD 2YFVB 3WTPE 4XZQD 2CV5B 1TAFB 4YS3C 3W97C 1P3LA 3WA9A 3O62D 5DNNB 4HGAC 5GT0C 5DNMD 3MNNA 3X1SA 4Z66B 4CSRA 3AZIA 3B0DB 5GXQB 1P3FD 4WZSB 3LELC 1BH8B 1M18C 2IO5B 3AZGB 5AVBD 3UTAC 1KX3D 5B33B 1F1EA 1WWSA 5AY8B 5BT1D 3VH5T 3C1BC 5B32D 5AV9A 3MGPB 3RELB 3AZLA 4KUDA 4ZBJC 3R45B 3C1CD 3UT9C 1KX5C 1ZLAC 1HQ3D 4LD9C 1P3PA 3B0CW 3W96D 3NQJA 1P3KC 5B2ID 1KX4D 3W98C 3X1VB 3WTPC 3AV2D 3KXBA 1F66D 2PYOD 3AN2A 1H3OB 2RVQD 3B6GD 4WU9D 3W97B 4WNNA 5B0ZD 3AZHB 4HGAB 5GT0B 4YM6D 1JFIB 1AOIA 3KWQD 5CP6D 5KDMB 2NQBC 1S32D 5GSUC 3A6NC 3TU4A 4R8PD 3AZNC 5AV5D 5CPIA 2FJ7C 5FUGB 3LELB 4ZUXA 1P3AC 1M18B 1M1AD 1ID3D 4KHAB 5JRGC 3UTAB 1TZYA 5B0YC 3REKB 2HIOD 2BYKA 3AYWD 4WU8C 2HUEB 4H9SC 3REHD 1P34C 3C1BB 4H9QB 1P3IA 4ZBJB 1P3GA 2NZDC 1KX5B 3REJA 1ZLAB 5E5AC 4UUZB 3LJAC 1KX4A 5CPJD 5B1MA 1M19B 3X1TC 1P3KB 4J8VD 3AV2A 3W98B 3UTBC 4DRBA 3AZMC 3WTPB 4EO5C 4AWLC 3MVDB 3WAAD 4H9PB 4H9NA 4J8WD 4E45A 4XUJA 5BNVA 3KWQA 3AZFC 1WWIA 1B6WA 3MGQA 1S32A 5AV6A 3AV1A 2NQBB 3LZ1C 3X1UD 5DNMB 1P3LD 5B2JA 5CPKA 5GSUB 3A6NB 4J8UD 3AZKA 4R8PA 3MNND 5AV5A 3B6FC 5C3IC 5B31C 3X1SD 4J8XA 2FJ7B 4QLCC 3REIC 1P3AB 2YFVA 5AV8C 3KSYA 5JRGB 5B0YB 2CV5A 1P3MA 1EQZC 3MGRC 5DNNA 4WU8B 3LZ0A 4X23C 4Z66A 5B32G 2AROC 5B40C 5B32B 1U35C 2BYMA 4CAYA 3MGSC 5GXQA 5AV9D 3AZLD 4KUDD 1BH9B 2NZDB 3W99C 5E5AB 1BH8A 3LJAB 3C1CB 4J8VA 4KGCC 5AVCC 1P3OC 3VH5A 3X1TB 5BNXB 2CWEA 4UUZA 3WAAA 4NFTA 5B2IB 3UTBB 1P3PD 4EO5B 3VH6T 4AWLB 5AY8A 5B1LC 1F66B 3MGPA 3RELA 2PYOB 3AZFB 5BS7C 3X1UA 3KXBD 5G49A 4J8UA 3AZHC 3AN2D 3R45A 3LZ1B 5CP6B 3AFAC 5JA4B 3AZEC 3AZJA 1KU5A 1AOID 5B31G 3WA9C 3B6FB 5C3IB 5B31B 3AZID 3X1VA 4QLCB 3REIB 3TU4D 4Z5TD 5AV8B 5CPID 1M1AB 1ID3B 5F99C 4YS3A 1H3OA 3W97A 1EQZB 4ZUXD 3MGRB 3REKC 2HIOB 5GT0A 5GT3C 1JFIA 1TZYD 3AYWB 2HUEC 4X23B 2AROB 5B40B 3WKJD 1U35B 3MGSB 1P3ID 5FUGA 3W99B 1M18A 4KGCB 5B24D 5AVCB 1P3OB 2F8NG 4JJNC 1P3GD 3UTAA 2F8NB 1M19C 3REJD 3KUYC 5B1MD 4Z2MG 3MVDC 1N1JB 5B1LB 1P3BC 3C1BA 4XZQC 4XUJD 3O62C 3UT9A 3MGQD 5DNMC 1P3LB 3AFAB 3AZEB 3WA9B 5AV6D
chains in the Genus database with same CATH superfamily
3AV1D 4LD9A 5B2JD 5CPKD 1P3KA 3AZKD 4Z5TA 1ULYA 3W98A 3X1SB 3WTPA 4J8XD 1P3FC 5F99B 2ZY5A 5AVBC 5GT3B 3EPHA 2CV5D 1P3MD 1KX3C 2NQBA 3WKJA 5GSUA 5DNND 3A6NA 3H0MC 2Y2MA 3LZ0D 5BT1C 2UWXA 5B32C 1Q9CA 1PZRA 4Z66D 5B24A 3AZNA 2FJ7A 2F8NK 2G5IC 3AZLB 1P3AA 2BG1A 3C1CC 4JJNB 5GXQD 5JRGA 5B0YA 1HQ3C 3KUYB 3W96C 5B2IC 3V9RA 4DRAA 3AZGD 1KX4C 3A1KA 3VH5W 1P34A 5B33D 1P3BB 3AV2C 4XZQB 5BO0B 1F66C 2PYOC 5AY8D 3B6GC 2RVQC 4WU9C 5B0ZC 3O62B 3VH6A 3MGPD 3RELD 1BH9A 4YM6C 2NZDA 5E5AA 3KWQC 5CP6C 2XD5A 1S32C 5BNXA 3AZJD 3UTBA 3AZMA 4R8PC 5AV5C 1P3FB 4H9OB 3X1VD 1M1AC 1ID3C 1TAFA 3AZFA 5AVBB 2HIOC 2JCHA 4YS3D 1KX3B 3W97D 3LZ1A 3AYWC 1T3UA 3REHC 5GT0D 5JA4A 3EPLA 3B6FA 5CHLB 4UPKA 2Y2NA 1W2EA 5AV8A 3NQUB 1HQ3B 3LELD 3AZGA 1P3GB 5CPJC 1M18D 1EQZA 3W96B 2J8PA 2YFWB 4J8VC 5B33A 1KX4B 3UTAD 4E44A 5B1MB 3AL0C 3WAAC 3AV2B 1HTAA 2AROA 3B6GB 4J8WC 4WU9B 1U35A 5B0ZB 3MGSA 3C1BD 4YM6B 3W99A 3KWQB 4KGCA 5AVCA 3X1UC 1P3LC 4M6BA 1S32B 4J8UC 3UT9D 2F8NA 1ZLAD 3MNNC 2JSSA 4LD9D 2L5AA 3X1SC 4R8PB 5AV5B 1P3KD 1N1JA 3W98D 2Y2KA 3WTPD 5BS7A 3AZHA 4DQYB 1P3MB 5KDMA 3REHB 3AFAA 3AZEA 4H9RB 2NQBD 3LZ0B 5GSUD 3A6ND 1R4VA 3LELA 5AV9C 3AZLC 4KUDC 3AZND 2FJ7D 2BYMB 5F99A 4KHAA 4CAYB 5CPJB 1P3AD 3REKA 4J8VB 5GT3A 5JRGD 5B0YD 1P3PC 3WAAB 4WU8D 1P34D 4H9QA 4J8WB 3A1IA 2RIQA 3KXBC 3F6TA 3AN2C 1KX5A 1ZLAA 3X1UB 4JJNA 5G49B 4J8UB 2F8NH 2NZDD 1M19A 5E5AD 3MNNB 3LJAD 1AOIC 3VH6W 3KUYA 2Y2GA 3AZJB 3AZIC 3X1TD 4NE6A 2W8SA 4CSRB 3MVDA 3UTBD 4Z2MH 3TU4C 1P3BA 4NE5A 4Z5TC 3AZMD 4H9PA 3KFUG 5CPIC 4XZQA 5BO0A 2Y2JA 4ZUXC 3O62A 4YS3B 3AZFD 1A7WA 1TZYC 5DNMA 2ZY3A 3LZ1D 3WKJC 3B6FD 5B31D 5AV9B 1P3IC 4KUDB 1P3FA 2Y2OA 4H9OA 4QLCD 5B24C 3REID 1BFMA 5AV8D 1P3GC 4NE3A 5AVBA 3REJC 4G92C 4WU8A 1KX3A 1EQZD 1P3PB 5B1MC 4H9SA 3MGRD 3NQJB 4X23D 5B32A 4G91C 2AROD 3KXBB 5B40D 3AN2B 2DF4C 1U35D 4XUJC 3LJAA 4WNNB 3C1CA 3NQUA 3MGSD 3MGQC 1B67A 2ZM5A 1HQ3A 5AV6C 3W99D 3UT9B 3AV1C 3X1TA 1AOIB 2Y2IA 4KGCD 3W96A 5AVCD 2YFWA 1P3OD 5B2JC 5B2IA 3AZIB 3AZKC 5CPKC 4LD9B 2F8ND 3TU4B 4Z5TB 4J8XC 5CPIB 1F66A 2PYOA 3B0BA 3B6GA 4ZUXB 5B1LD 4WU9A 5B0ZA 4YM6A 2ZY2A 1TZYB 2CV5C 1P3MC 5CP6A 3AZHD 2BYKB 5DNNC 2ZY4A 2LY8A 3LZ0C 5B31A 3AFAD 3AZED 3WKJB 3WA9D 4Z66C 4WV4B 4QLCA 3REIA 1P3IB 5B24B 3AZNB 1M1AA 1ID3A 3B0DC 5GXQC 3MGRA 3REJB 2HIOA 5F99D 3EPJA 4G92B 3AYWA 2IO5C 3REKD 3AZGC 4X23A 5GT3D 3REHA 4H9RA 3B0CT 3V9RB 5B33C 3IP4C 5B40A 4G91B 1P34B 5AY8C 4H9NB 4XUJB 5BNVB 3MGPC 3RELC 3MGQB 1P3OA 5AV6B 3AV1B 5CPJA 1KX5D 5B2JB 4JJND 5CPKB 3AZKB 3AZJC 1M19D 3KUYD 4J8XB 5B1LA 3AZMB 3X1VC 3MVDD 4J8WA 1P3BD 2YFVB 3WTPE 4XZQD 2CV5B 1TAFB 4YS3C 3W97C 1P3LA 3WA9A 3O62D 5DNNB 4HGAC 5GT0C 5DNMD 3MNNA 3X1SA 4Z66B 4CSRA 3AZIA 3B0DB 5GXQB 1P3FD 4WZSB 3LELC 1BH8B 1M18C 2IO5B 3AZGB 5AVBD 3UTAC 1KX3D 3P5JB 5B33B 1F1EA 1WWSA 5AY8B 5BT1D 3VH5T 3C1BC 5B32D 5AV9A 3MGPB 3RELB 3AZLA 4KUDA 2Y2HA 4ZBJC 3R45B 3C1CD 3UT9C 1KX5C 1ZLAC 1HQ3D 4LD9C 1P3PA 3B0CW 3W96D 3NQJA 2Y2PA 1P3KC 5B2ID 1KX4D 3W98C 3X1VB 3WTPC 3AV2D 3KXBA 1F66D 2PYOD 3AN2A 1H3OB 2RVQD 2XD1A 4WU9D 3B6GD 3W97B 4WNNA 5B0ZD 2DQNC 3AZHB 4HGAB 5GT0B 4YM6D 1JFIB 1AOIA 3KWQD 5CP6D 5KDMB 2NQBC 1S32D 5GSUC 3A6NC 3TU4A 4R8PD 3AZNC 5AV5D 5CPIA 2FJ7C 5FUGB 3LELB 4ZUXA 1P3AC 1M18B 1M1AD 1ID3D 4KHAB 5JRGC 3UTAB 1TZYA 5B0YC 3REKB 2HIOD 2BYKA 3FDDA 3AYWD 4WU8C 2HUEB 4H9SC 3REHD 1P34C 3C1BB 4H9QB 1P3IA 4ZBJB 1P3GA 2NZDC 1KX5B 2Y2LA 3REJA 1ZLAB 5E5AC 4UUZB 3LJAC 4WJ3C 1KX4A 5CPJD 5B1MA 1M19B 3X1TC 1P3KB 4J8VD 3AV2A 3W98B 3UTBC 4DRBA 3AZMC 3WTPB 3H0RC 4EO5C 4AWLC 2F2AC 3MVDB 3WAAD 4H9PB 4H9NA 4J8WD 4E45A 4XUJA 5BNVA 3KWQA 3AZFC 1WWIA 1B6WA 3MGQA 1S32A 5AV6A 3AV1A 3EPKA 2NQBB 3LZ1C 3X1UD 5DNMB 1P3LD 5B2JA 5CPKA 5GSUB 3A6NB 4J8UD 3AZKA 4R8PA 3MNND 5AV5A 3B6FC 5C3IC 5B31C 2JE5A 3X1SD 4J8XA 2FJ7B 4QLCC 3REIC 1P3AB 2YFVA 5AV8C 3KSYA 5JRGB 5B0YB 2CV5A 1P3MA 1EQZC 1Z2CB 3MGRC 5DNNA 4WU8B 3LZ0A 4X23C 4Z66A 5B32G 2AROC 5B40C 5B32B 1U35C 2BYMA 4CAYA 3MGSC 5GXQA 5AV9D 3AZLD 4KUDD 1BH9B 2NZDB 3W99C 5E5AB 1BH8A 3LJAB 3C1CB 4J8VA 4KGCC 5AVCC 1P3OC 3VH5A 3X1TB 5BNXB 2CWEA 4UUZA 3WAAA 4NFTA 5B2IB 3UTBB 1P3PD 4EO5B 3VH6T 4AWLB 5AY8A 5B1LC 1F66B 3MGPA 3RELA 2PYOB 3AZFB 5BS7C 3X1UA 3KXBD 5G49A 4J8UA 3AZHC 3AN2D 3R45A 3LZ1B 5CP6B 3AFAC 5JA4B 3AZEC 3AZJA 1KU5A 1AOID 5B31G 3WA9C 3B6FB 2G5HC 5C3IB 5B31B 3AZID 3X1VA 4QLCB 3REIB 3TU4D 4Z5TD 5AV8B 5CPID 1M1AB 1ID3B 5F99C 4YS3A 1H3OA 3W97A 1EQZB 4ZUXD 3MGRB 3REKC 2HIOB 5GT0A 5GT3C 1JFIA 1TZYD 3AYWB 2HUEC 4X23B 2AROB 5B40B 3WKJD 1U35B 3MGSB 3EG5B 1P3ID 5FUGA 3W99B 1M18A 4KGCB 5B24D 5AVCB 1P3OB 2F8NG 4JJNC 1P3GD 3UTAA 2F8NB 1M19C 3REJD 2FFFB 3KUYC 5B1MD 2VQRA 4Z2MG 3MVDC 1N1JB 5B1LB 1P3BC 3C1BA 4XZQC 2Y2QA 3H0LC 4XUJD 3O62C 3UT9A 3MGQD 5DNMC 1P3LB 3AFAB 3AZEB 3WA9B 5AV6D
chains in the Genus database with same CATH topology
3AV1D 4LD9A 5B2JD 5CPKD 1P3KA 3AZKD 4Z5TA 1ULYA 3W98A 3X1SB 3WTPA 4J8XD 1P3FC 5F99B 2ZY5A 5AVBC 5GT3B 3EPHA 2CV5D 1P3MD 1KX3C 2NQBA 3WKJA 5GSUA 5DNND 3A6NA 3H0MC 2Y2MA 3LZ0D 5BT1C 2UWXA 5B32C 1Q9CA 1PZRA 4Z66D 5B24A 3AZNA 2FJ7A 2F8NK 2G5IC 3AZLB 1P3AA 2BG1A 3C1CC 4JJNB 5GXQD 5JRGA 5B0YA 1HQ3C 3KUYB 3W96C 5B2IC 3V9RA 4DRAA 3AZGD 1KX4C 3A1KA 3VH5W 1P34A 5B33D 1P3BB 3AV2C 4XZQB 5BO0B 1F66C 2PYOC 5AY8D 3B6GC 2RVQC 4WU9C 5B0ZC 3O62B 3VH6A 3MGPD 3RELD 1BH9A 4YM6C 2NZDA 5E5AA 3KWQC 5CP6C 2XD5A 1S32C 5BNXA 3AZJD 3UTBA 3AZMA 4R8PC 5AV5C 1P3FB 4H9OB 3X1VD 1M1AC 1ID3C 1TAFA 3AZFA 5AVBB 2HIOC 2JCHA 4YS3D 1KX3B 3W97D 3LZ1A 3AYWC 1T3UA 3REHC 5GT0D 5JA4A 3EPLA 3B6FA 5CHLB 4UPKA 2Y2NA 1W2EA 5AV8A 3NQUB 1HQ3B 3LELD 3AZGA 1P3GB 5CPJC 1M18D 1EQZA 3W96B 2J8PA 2YFWB 4J8VC 5B33A 1KX4B 3UTAD 4E44A 5B1MB 3AL0C 3WAAC 3AV2B 1HTAA 2AROA 3B6GB 4J8WC 4WU9B 1U35A 5B0ZB 3MGSA 3C1BD 4YM6B 3W99A 3KWQB 4KGCA 5AVCA 3X1UC 1P3LC 4M6BA 1S32B 4J8UC 3UT9D 2F8NA 1ZLAD 3MNNC 2JSSA 4LD9D 2L5AA 3X1SC 4R8PB 5AV5B 1P3KD 1N1JA 3W98D 2Y2KA 3WTPD 5BS7A 3AZHA 4DQYB 1P3MB 5KDMA 3REHB 3AFAA 3AZEA 4H9RB 2NQBD 3LZ0B 5GSUD 3A6ND 1R4VA 3LELA 5AV9C 3AZLC 4KUDC 3AZND 2FJ7D 2BYMB 5F99A 4KHAA 4CAYB 5CPJB 1P3AD 3REKA 4J8VB 5GT3A 5JRGD 5B0YD 1P3PC 3WAAB 4WU8D 1P34D 4H9QA 4J8WB 3A1IA 2RIQA 3KXBC 3F6TA 3AN2C 1KX5A 1ZLAA 3X1UB 4JJNA 5G49B 4J8UB 2F8NH 2NZDD 1M19A 5E5AD 3MNNB 3LJAD 1AOIC 3VH6W 3KUYA 2Y2GA 3AZJB 3AZIC 3X1TD 4NE6A 2W8SA 4CSRB 3MVDA 3UTBD 4Z2MH 3TU4C 1P3BA 4NE5A 4Z5TC 3AZMD 4H9PA 3KFUG 5CPIC 4XZQA 5BO0A 2Y2JA 4ZUXC 3O62A 4YS3B 3AZFD 1A7WA 1TZYC 5DNMA 2ZY3A 3LZ1D 3WKJC 3B6FD 5B31D 5AV9B 1P3IC 4KUDB 1P3FA 2Y2OA 4H9OA 4QLCD 5B24C 3REID 1BFMA 5AV8D 1P3GC 4NE3A 5AVBA 3REJC 4G92C 4WU8A 1KX3A 1EQZD 1P3PB 5B1MC 4H9SA 3MGRD 3NQJB 4X23D 5B32A 4G91C 2AROD 3KXBB 5B40D 3AN2B 2DF4C 1U35D 4XUJC 3LJAA 4WNNB 3C1CA 3NQUA 3MGSD 3MGQC 1B67A 2ZM5A 1HQ3A 5AV6C 3W99D 3UT9B 3AV1C 3X1TA 1AOIB 2Y2IA 4KGCD 3W96A 5AVCD 2YFWA 1P3OD 5B2JC 5B2IA 3AZIB 3AZKC 5CPKC 4LD9B 2F8ND 3TU4B 4Z5TB 4J8XC 5CPIB 1F66A 2PYOA 3B0BA 3B6GA 4ZUXB 5B1LD 4WU9A 5B0ZA 4YM6A 2ZY2A 1TZYB 2CV5C 1P3MC 5CP6A 3AZHD 2BYKB 5DNNC 2ZY4A 2LY8A 3LZ0C 5B31A 3AFAD 3AZED 3WKJB 3WA9D 4Z66C 4WV4B 4QLCA 3REIA 1P3IB 5B24B 3AZNB 1M1AA 1ID3A 3B0DC 5GXQC 3MGRA 3REJB 2HIOA 5F99D 3EPJA 4G92B 3AYWA 2IO5C 3REKD 3AZGC 4X23A 5GT3D 3REHA 4H9RA 3B0CT 3V9RB 5B33C 3IP4C 5B40A 4G91B 1P34B 5AY8C 4H9NB 4XUJB 5BNVB 3MGPC 3RELC 3MGQB 1P3OA 5AV6B 3AV1B 5CPJA 1KX5D 5B2JB 4JJND 5CPKB 3AZKB 3AZJC 1M19D 3KUYD 4J8XB 5B1LA 3AZMB 3X1VC 3MVDD 4J8WA 1P3BD 2YFVB 3WTPE 4XZQD 2CV5B 1TAFB 4YS3C 3W97C 1P3LA 3WA9A 3O62D 5DNNB 4HGAC 5GT0C 5DNMD 3MNNA 3X1SA 4Z66B 4CSRA 3AZIA 3B0DB 5GXQB 1P3FD 4WZSB 3LELC 1BH8B 1M18C 2IO5B 3AZGB 5AVBD 3UTAC 1KX3D 3P5JB 5B33B 1F1EA 1WWSA 5AY8B 5BT1D 3VH5T 3C1BC 5B32D 5AV9A 3MGPB 3RELB 3AZLA 4KUDA 2Y2HA 4ZBJC 3R45B 3C1CD 3UT9C 1KX5C 1ZLAC 1HQ3D 4LD9C 1P3PA 3B0CW 3W96D 3NQJA 2Y2PA 1P3KC 5B2ID 1KX4D 3W98C 3X1VB 3WTPC 3AV2D 3KXBA 1F66D 2PYOD 3AN2A 1H3OB 2RVQD 2XD1A 4WU9D 3B6GD 3W97B 4WNNA 5B0ZD 2DQNC 3AZHB 4HGAB 5GT0B 4YM6D 1JFIB 1AOIA 3KWQD 5CP6D 5KDMB 2NQBC 1S32D 5GSUC 3A6NC 3TU4A 4R8PD 3AZNC 5AV5D 5CPIA 2FJ7C 5FUGB 3LELB 4ZUXA 1P3AC 1M18B 1M1AD 1ID3D 4KHAB 5JRGC 3UTAB 1TZYA 5B0YC 3REKB 2HIOD 2BYKA 3FDDA 3AYWD 4WU8C 2HUEB 4H9SC 3REHD 1P34C 3C1BB 4H9QB 1P3IA 4ZBJB 1P3GA 2NZDC 1KX5B 2Y2LA 3REJA 1ZLAB 5E5AC 4UUZB 3LJAC 4WJ3C 1KX4A 5CPJD 5B1MA 1M19B 3X1TC 1P3KB 4J8VD 3AV2A 3W98B 3UTBC 4DRBA 3AZMC 3WTPB 3H0RC 4EO5C 4AWLC 2F2AC 3MVDB 3WAAD 4H9PB 4H9NA 4J8WD 4E45A 4XUJA 5BNVA 3KWQA 3AZFC 1WWIA 1B6WA 3MGQA 1S32A 5AV6A 3AV1A 3EPKA 2NQBB 3LZ1C 3X1UD 5DNMB 1P3LD 5B2JA 5CPKA 5GSUB 3A6NB 4J8UD 3AZKA 4R8PA 3MNND 5AV5A 3B6FC 5C3IC 5B31C 2JE5A 3X1SD 4J8XA 2FJ7B 4QLCC 3REIC 1P3AB 2YFVA 5AV8C 3KSYA 5JRGB 5B0YB 2CV5A 1P3MA 1EQZC 1Z2CB 3MGRC 5DNNA 4WU8B 3LZ0A 4X23C 4Z66A 5B32G 2AROC 5B40C 5B32B 1U35C 2BYMA 4CAYA 3MGSC 5GXQA 5AV9D 3AZLD 4KUDD 1BH9B 2NZDB 3W99C 5E5AB 1BH8A 3LJAB 3C1CB 4J8VA 4KGCC 5AVCC 1P3OC 3VH5A 3X1TB 5BNXB 2CWEA 4UUZA 3WAAA 4NFTA 5B2IB 3UTBB 1P3PD 4EO5B 3VH6T 4AWLB 5AY8A 5B1LC 1F66B 3MGPA 3RELA 2PYOB 3AZFB 5BS7C 3X1UA 3KXBD 5G49A 4J8UA 3AZHC 3AN2D 3R45A 3LZ1B 5CP6B 3AFAC 5JA4B 3AZEC 3AZJA 1KU5A 1AOID 5B31G 3WA9C 3B6FB 2G5HC 5C3IB 5B31B 3AZID 3X1VA 4QLCB 3REIB 3TU4D 4Z5TD 5AV8B 5CPID 1M1AB 1ID3B 5F99C 4YS3A 1H3OA 3W97A 1EQZB 4ZUXD 3MGRB 3REKC 2HIOB 5GT0A 5GT3C 1JFIA 1TZYD 3AYWB 2HUEC 4X23B 2AROB 5B40B 3WKJD 1U35B 3MGSB 3EG5B 1P3ID 5FUGA 3W99B 1M18A 4KGCB 5B24D 5AVCB 1P3OB 2F8NG 4JJNC 1P3GD 3UTAA 2F8NB 1M19C 3REJD 2FFFB 3KUYC 5B1MD 2VQRA 4Z2MG 3MVDC 1N1JB 5B1LB 1P3BC 3C1BA 4XZQC 2Y2QA 3H0LC 4XUJD 3O62C 3UT9A 3MGQD 5DNMC 1P3LB 3AFAB 3AZEB 3WA9B 5AV6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV1 D;  4LD9 A;  5B2J D;  5CPK D;  1P3K A;  3AZK D;  4Z5T A;  1ULY A;  3W98 A;  3X1S B;  3WTP A;  4J8X D;  1P3F C;  5F99 B;  5AVB C;  5GT3 B;  2CV5 D;  1P3M D;  1KX3 C;  2NQB A;  3WKJ A;  5GSU A;  5DNN D;  3A6N A;  3LZ0 D;  5BT1 C;  5B32 C;  1Q9C A;  4Z66 D;  5B24 A;  3AZN A;  2FJ7 A;  2F8N K;  3AZL B;  1P3A A;  3C1C C;  4JJN B;  5GXQ D;  5JRG A;  5B0Y A;  1HQ3 C;  3KUY B;  3W96 C;  5B2I C;  3V9R A;  4DRA A;  3AZG D;  1KX4 C;  3VH5 W;  1P34 A;  5B33 D;  1P3B B;  3AV2 C;  4XZQ B;  5BO0 B;  1F66 C;  2PYO C;  5AY8 D;  3B6G C;  2RVQ C;  4WU9 C;  5B0Z C;  3O62 B;  3VH6 A;  3MGP D;  3REL D;  1BH9 A;  4YM6 C;  2NZD A;  5E5A A;  3KWQ C;  5CP6 C;  1S32 C;  5BNX A;  3AZJ D;  3UTB A;  3AZM A;  4R8P C;  5AV5 C;  1P3F B;  4H9O B;  3X1V D;  1M1A C;  1ID3 C;  1TAF A;  3AZF A;  5AVB B;  2HIO C;  4YS3 D;  1KX3 B;  3W97 D;  3LZ1 A;  3AYW C;  3REH C;  5GT0 D;  5JA4 A;  3B6F A;  5CHL B;  5AV8 A;  3NQU B;  1HQ3 B;  3LEL D;  3AZG A;  1P3G B;  5CPJ C;  1M18 D;  1EQZ A;  3W96 B;  2YFW B;  4J8V C;  5B33 A;  1KX4 B;  3UTA D;  4E44 A;  5B1M B;  3WAA C;  3AV2 B;  1HTA A;  2ARO A;  3B6G B;  4J8W C;  4WU9 B;  1U35 A;  5B0Z B;  3MGS A;  3C1B D;  4YM6 B;  3W99 A;  3KWQ B;  4KGC A;  5AVC A;  3X1U C;  1P3L C;  4M6B A;  1S32 B;  4J8U C;  3UT9 D;  2F8N A;  1ZLA D;  3MNN C;  2JSS A;  4LD9 D;  2L5A A;  3X1S C;  4R8P B;  5AV5 B;  1P3K D;  1N1J A;  3W98 D;  3WTP D;  5BS7 A;  3AZH A;  1P3M B;  5KDM A;  3REH B;  3AFA A;  3AZE A;  4H9R B;  2NQB D;  3LZ0 B;  5GSU D;  3A6N D;  1R4V A;  3LEL A;  5AV9 C;  3AZL C;  4KUD C;  3AZN D;  2FJ7 D;  2BYM B;  5F99 A;  4KHA A;  4CAY B;  5CPJ B;  1P3A D;  3REK A;  4J8V B;  5GT3 A;  5JRG D;  5B0Y D;  1P3P C;  3WAA B;  4WU8 D;  1P34 D;  4H9Q A;  4J8W B;  3KXB C;  3AN2 C;  1KX5 A;  1ZLA A;  3X1U B;  4JJN A;  5G49 B;  4J8U B;  2F8N H;  2NZD D;  1M19 A;  5E5A D;  3MNN B;  3LJA D;  1AOI C;  3VH6 W;  3KUY A;  3AZJ B;  3AZI C;  3X1T D;  4NE6 A;  4CSR B;  3MVD A;  3UTB D;  4Z2M H;  3TU4 C;  1P3B A;  4NE5 A;  4Z5T C;  3AZM D;  4H9P A;  5CPI C;  4XZQ A;  5BO0 A;  4ZUX C;  3O62 A;  4YS3 B;  3AZF D;  1A7W A;  1TZY C;  5DNM A;  3LZ1 D;  3WKJ C;  3B6F D;  5B31 D;  5AV9 B;  1P3I C;  4KUD B;  1P3F A;  4H9O A;  4QLC D;  5B24 C;  3REI D;  1BFM A;  5AV8 D;  1P3G C;  4NE3 A;  5AVB A;  3REJ C;  4G92 C;  4WU8 A;  1KX3 A;  1EQZ D;  1P3P B;  5B1M C;  4H9S A;  3MGR D;  3NQJ B;  4X23 D;  5B32 A;  4G91 C;  2ARO D;  3KXB B;  5B40 D;  3AN2 B;  1U35 D;  4XUJ C;  3LJA A;  4WNN B;  3C1C A;  3NQU A;  3MGS D;  3MGQ C;  1B67 A;  1HQ3 A;  3W99 D;  5AV6 C;  3UT9 B;  3AV1 C;  3X1T A;  1AOI B;  4KGC D;  3W96 A;  5AVC D;  2YFW A;  1P3O D;  5B2J C;  5B2I A;  3AZI B;  3AZK C;  5CPK C;  4LD9 B;  2F8N D;  3TU4 B;  4Z5T B;  4J8X C;  5CPI B;  1F66 A;  2PYO A;  3B0B A;  3B6G A;  4ZUX B;  5B1L D;  4WU9 A;  5B0Z A;  4YM6 A;  1TZY B;  2CV5 C;  1P3M C;  5CP6 A;  3AZH D;  2BYK B;  5DNN C;  2LY8 A;  3LZ0 C;  5B31 A;  3AFA D;  3AZE D;  3WKJ B;  3WA9 D;  4Z66 C;  4WV4 B;  4QLC A;  3REI A;  1P3I B;  5B24 B;  3AZN B;  1M1A A;  1ID3 A;  3B0D C;  5GXQ C;  3MGR A;  3REJ B;  2HIO A;  5F99 D;  4G92 B;  3AYW A;  2IO5 C;  3REK D;  3AZG C;  4X23 A;  5GT3 D;  3REH A;  4H9R A;  3B0C T;  3V9R B;  5B33 C;  5B40 A;  4G91 B;  1P34 B;  5AY8 C;  4H9N B;  4XUJ B;  5BNV B;  3MGP C;  3REL C;  3MGQ B;  1P3O A;  5AV6 B;  3AV1 B;  5CPJ A;  1KX5 D;  5B2J B;  4JJN D;  5CPK B;  3AZK B;  3AZJ C;  1M19 D;  3KUY D;  4J8X B;  5B1L A;  3AZM B;  3X1V C;  3MVD D;  4J8W A;  1P3B D;  2YFV B;  3WTP E;  4XZQ D;  2CV5 B;  1TAF B;  4YS3 C;  3W97 C;  1P3L A;  3WA9 A;  3O62 D;  5DNN B;  4HGA C;  5GT0 C;  5DNM D;  3MNN A;  3X1S A;  4Z66 B;  4CSR A;  3AZI A;  3B0D B;  5GXQ B;  1P3F D;  4WZS B;  3LEL C;  1BH8 B;  1M18 C;  2IO5 B;  3AZG B;  5AVB D;  3UTA C;  1KX3 D;  5B33 B;  1F1E A;  1WWS A;  5AY8 B;  5BT1 D;  3VH5 T;  3C1B C;  5B32 D;  5AV9 A;  3MGP B;  3REL B;  3AZL A;  4KUD A;  4ZBJ C;  3R45 B;  3C1C D;  3UT9 C;  1KX5 C;  1ZLA C;  1HQ3 D;  4LD9 C;  1P3P A;  3B0C W;  3W96 D;  3NQJ A;  1P3K C;  5B2I D;  1KX4 D;  3W98 C;  3X1V B;  3WTP C;  3AV2 D;  3KXB A;  1F66 D;  2PYO D;  3AN2 A;  1H3O B;  2RVQ D;  3B6G D;  4WU9 D;  3W97 B;  4WNN A;  5B0Z D;  3AZH B;  4HGA B;  5GT0 B;  4YM6 D;  1JFI B;  1AOI A;  3KWQ D;  5CP6 D;  5KDM B;  2NQB C;  1S32 D;  5GSU C;  3A6N C;  3TU4 A;  4R8P D;  3AZN C;  5AV5 D;  5CPI A;  2FJ7 C;  5FUG B;  3LEL B;  4ZUX A;  1P3A C;  1M18 B;  1M1A D;  1ID3 D;  4KHA B;  5JRG C;  3UTA B;  1TZY A;  5B0Y C;  3REK B;  2HIO D;  2BYK A;  3AYW D;  4WU8 C;  2HUE B;  4H9S C;  3REH D;  1P34 C;  3C1B B;  4H9Q B;  1P3I A;  4ZBJ B;  1P3G A;  2NZD C;  1KX5 B;  3REJ A;  1ZLA B;  5E5A C;  4UUZ B;  3LJA C;  1KX4 A;  5CPJ D;  5B1M A;  1M19 B;  3X1T C;  1P3K B;  4J8V D;  3AV2 A;  3W98 B;  3UTB C;  4DRB A;  3AZM C;  3WTP B;  4EO5 C;  4AWL C;  3MVD B;  3WAA D;  4H9P B;  4H9N A;  4J8W D;  4E45 A;  4XUJ A;  5BNV A;  3KWQ A;  3AZF C;  1WWI A;  1B6W A;  3MGQ A;  1S32 A;  5AV6 A;  3AV1 A;  2NQB B;  3LZ1 C;  3X1U D;  5DNM B;  1P3L D;  5B2J A;  5CPK A;  5GSU B;  3A6N B;  4J8U D;  3AZK A;  4R8P A;  3MNN D;  5AV5 A;  3B6F C;  5C3I C;  5B31 C;  3X1S D;  4J8X A;  2FJ7 B;  4QLC C;  3REI C;  1P3A B;  2YFV A;  5AV8 C;  3KSY A;  5JRG B;  5B0Y B;  2CV5 A;  1P3M A;  1EQZ C;  3MGR C;  5DNN A;  4WU8 B;  3LZ0 A;  4X23 C;  4Z66 A;  5B32 G;  2ARO C;  5B40 C;  5B32 B;  1U35 C;  2BYM A;  4CAY A;  3MGS C;  5GXQ A;  5AV9 D;  3AZL D;  4KUD D;  1BH9 B;  2NZD B;  3W99 C;  5E5A B;  1BH8 A;  3LJA B;  3C1C B;  4J8V A;  4KGC C;  5AVC C;  1P3O C;  3VH5 A;  3X1T B;  5BNX B;  2CWE A;  4UUZ A;  3WAA A;  4NFT A;  5B2I B;  3UTB B;  1P3P D;  4EO5 B;  3VH6 T;  4AWL B;  5AY8 A;  5B1L C;  1F66 B;  3MGP A;  3REL A;  2PYO B;  3AZF B;  5BS7 C;  3X1U A;  3KXB D;  5G49 A;  4J8U A;  3AZH C;  3AN2 D;  3R45 A;  3LZ1 B;  5CP6 B;  3AFA C;  5JA4 B;  3AZE C;  3AZJ A;  1KU5 A;  1AOI D;  5B31 G;  3WA9 C;  3B6F B;  5C3I B;  5B31 B;  3AZI D;  3X1V A;  4QLC B;  3REI B;  3TU4 D;  4Z5T D;  5AV8 B;  5CPI D;  1M1A B;  1ID3 B;  5F99 C;  4YS3 A;  1H3O A;  3W97 A;  1EQZ B;  4ZUX D;  3MGR B;  3REK C;  2HIO B;  5GT0 A;  5GT3 C;  1JFI A;  1TZY D;  3AYW B;  2HUE C;  4X23 B;  2ARO B;  5B40 B;  3WKJ D;  1U35 B;  3MGS B;  1P3I D;  5FUG A;  3W99 B;  1M18 A;  4KGC B;  5B24 D;  5AVC B;  1P3O B;  2F8N G;  4JJN C;  1P3G D;  3UTA A;  2F8N B;  1M19 C;  3REJ D;  3KUY C;  5B1M D;  4Z2M G;  3MVD C;  1N1J B;  5B1L B;  1P3B C;  3C1B A;  4XZQ C;  4XUJ D;  3O62 C;  3UT9 A;  3MGQ D;  5DNM C;  1P3L B;  3AFA B;  3AZE B;  3WA9 B;  5AV6 D; 
#chains in the Genus database with same CATH topology
 3AV1 D;  4LD9 A;  5B2J D;  5CPK D;  1P3K A;  3AZK D;  4Z5T A;  1ULY A;  3W98 A;  3X1S B;  3WTP A;  4J8X D;  1P3F C;  5F99 B;  2ZY5 A;  5AVB C;  5GT3 B;  3EPH A;  2CV5 D;  1P3M D;  1KX3 C;  2NQB A;  3WKJ A;  5GSU A;  5DNN D;  3A6N A;  3H0M C;  2Y2M A;  3LZ0 D;  5BT1 C;  2UWX A;  5B32 C;  1Q9C A;  1PZR A;  4Z66 D;  5B24 A;  3AZN A;  2FJ7 A;  2F8N K;  2G5I C;  3AZL B;  1P3A A;  2BG1 A;  3C1C C;  4JJN B;  5GXQ D;  5JRG A;  5B0Y A;  1HQ3 C;  3KUY B;  3W96 C;  5B2I C;  3V9R A;  4DRA A;  3AZG D;  1KX4 C;  3A1K A;  3VH5 W;  1P34 A;  5B33 D;  1P3B B;  3AV2 C;  4XZQ B;  5BO0 B;  1F66 C;  2PYO C;  5AY8 D;  3B6G C;  2RVQ C;  4WU9 C;  5B0Z C;  3O62 B;  3VH6 A;  3MGP D;  3REL D;  1BH9 A;  4YM6 C;  2NZD A;  5E5A A;  3KWQ C;  5CP6 C;  2XD5 A;  1S32 C;  5BNX A;  3AZJ D;  3UTB A;  3AZM A;  4R8P C;  5AV5 C;  1P3F B;  4H9O B;  3X1V D;  1M1A C;  1ID3 C;  1TAF A;  3AZF A;  5AVB B;  2HIO C;  2JCH A;  4YS3 D;  1KX3 B;  3W97 D;  3LZ1 A;  3AYW C;  1T3U A;  3REH C;  5GT0 D;  5JA4 A;  3EPL A;  3B6F A;  5CHL B;  4UPK A;  2Y2N A;  1W2E A;  5AV8 A;  3NQU B;  1HQ3 B;  3LEL D;  3AZG A;  1P3G B;  5CPJ C;  1M18 D;  1EQZ A;  3W96 B;  2J8P A;  2YFW B;  4J8V C;  5B33 A;  1KX4 B;  3UTA D;  4E44 A;  5B1M B;  3AL0 C;  3WAA C;  3AV2 B;  1HTA A;  2ARO A;  3B6G B;  4J8W C;  4WU9 B;  1U35 A;  5B0Z B;  3MGS A;  3C1B D;  4YM6 B;  3W99 A;  3KWQ B;  4KGC A;  5AVC A;  3X1U C;  1P3L C;  4M6B A;  1S32 B;  4J8U C;  3UT9 D;  2F8N A;  1ZLA D;  3MNN C;  2JSS A;  4LD9 D;  2L5A A;  3X1S C;  4R8P B;  5AV5 B;  1P3K D;  1N1J A;  3W98 D;  2Y2K A;  3WTP D;  5BS7 A;  3AZH A;  4DQY B;  1P3M B;  5KDM A;  3REH B;  3AFA A;  3AZE A;  4H9R B;  2NQB D;  3LZ0 B;  5GSU D;  3A6N D;  1R4V A;  3LEL A;  5AV9 C;  3AZL C;  4KUD C;  3AZN D;  2FJ7 D;  2BYM B;  5F99 A;  4KHA A;  4CAY B;  5CPJ B;  1P3A D;  3REK A;  4J8V B;  5GT3 A;  5JRG D;  5B0Y D;  1P3P C;  3WAA B;  4WU8 D;  1P34 D;  4H9Q A;  4J8W B;  3A1I A;  2RIQ A;  3KXB C;  3F6T A;  3AN2 C;  1KX5 A;  1ZLA A;  3X1U B;  4JJN A;  5G49 B;  4J8U B;  2F8N H;  2NZD D;  1M19 A;  5E5A D;  3MNN B;  3LJA D;  1AOI C;  3VH6 W;  3KUY A;  2Y2G A;  3AZJ B;  3AZI C;  3X1T D;  4NE6 A;  2W8S A;  4CSR B;  3MVD A;  3UTB D;  4Z2M H;  3TU4 C;  1P3B A;  4NE5 A;  4Z5T C;  3AZM D;  4H9P A;  3KFU G;  5CPI C;  4XZQ A;  5BO0 A;  2Y2J A;  4ZUX C;  3O62 A;  4YS3 B;  3AZF D;  1A7W A;  1TZY C;  5DNM A;  2ZY3 A;  3LZ1 D;  3WKJ C;  3B6F D;  5B31 D;  5AV9 B;  1P3I C;  4KUD B;  1P3F A;  2Y2O A;  4H9O A;  4QLC D;  5B24 C;  3REI D;  1BFM A;  5AV8 D;  1P3G C;  4NE3 A;  5AVB A;  3REJ C;  4G92 C;  4WU8 A;  1KX3 A;  1EQZ D;  1P3P B;  5B1M C;  4H9S A;  3MGR D;  3NQJ B;  4X23 D;  5B32 A;  4G91 C;  2ARO D;  3KXB B;  5B40 D;  3AN2 B;  2DF4 C;  1U35 D;  4XUJ C;  3LJA A;  4WNN B;  3C1C A;  3NQU A;  3MGS D;  3MGQ C;  1B67 A;  2ZM5 A;  1HQ3 A;  5AV6 C;  3W99 D;  3UT9 B;  3AV1 C;  3X1T A;  1AOI B;  2Y2I A;  4KGC D;  3W96 A;  5AVC D;  2YFW A;  1P3O D;  5B2J C;  5B2I A;  3AZI B;  3AZK C;  5CPK C;  4LD9 B;  2F8N D;  3TU4 B;  4Z5T B;  4J8X C;  5CPI B;  1F66 A;  2PYO A;  3B0B A;  3B6G A;  4ZUX B;  5B1L D;  4WU9 A;  5B0Z A;  4YM6 A;  2ZY2 A;  1TZY B;  2CV5 C;  1P3M C;  5CP6 A;  3AZH D;  2BYK B;  5DNN C;  2ZY4 A;  2LY8 A;  3LZ0 C;  5B31 A;  3AFA D;  3AZE D;  3WKJ B;  3WA9 D;  4Z66 C;  4WV4 B;  4QLC A;  3REI A;  1P3I B;  5B24 B;  3AZN B;  1M1A A;  1ID3 A;  3B0D C;  5GXQ C;  3MGR A;  3REJ B;  2HIO A;  5F99 D;  3EPJ A;  4G92 B;  3AYW A;  2IO5 C;  3REK D;  3AZG C;  4X23 A;  5GT3 D;  3REH A;  4H9R A;  3B0C T;  3V9R B;  5B33 C;  3IP4 C;  5B40 A;  4G91 B;  1P34 B;  5AY8 C;  4H9N B;  4XUJ B;  5BNV B;  3MGP C;  3REL C;  3MGQ B;  1P3O A;  5AV6 B;  3AV1 B;  5CPJ A;  1KX5 D;  5B2J B;  4JJN D;  5CPK B;  3AZK B;  3AZJ C;  1M19 D;  3KUY D;  4J8X B;  5B1L A;  3AZM B;  3X1V C;  3MVD D;  4J8W A;  1P3B D;  2YFV B;  3WTP E;  4XZQ D;  2CV5 B;  1TAF B;  4YS3 C;  3W97 C;  1P3L A;  3WA9 A;  3O62 D;  5DNN B;  4HGA C;  5GT0 C;  5DNM D;  3MNN A;  3X1S A;  4Z66 B;  4CSR A;  3AZI A;  3B0D B;  5GXQ B;  1P3F D;  4WZS B;  3LEL C;  1BH8 B;  1M18 C;  2IO5 B;  3AZG B;  5AVB D;  3UTA C;  1KX3 D;  3P5J B;  5B33 B;  1F1E A;  1WWS A;  5AY8 B;  5BT1 D;  3VH5 T;  3C1B C;  5B32 D;  5AV9 A;  3MGP B;  3REL B;  3AZL A;  4KUD A;  2Y2H A;  4ZBJ C;  3R45 B;  3C1C D;  3UT9 C;  1KX5 C;  1ZLA C;  1HQ3 D;  4LD9 C;  1P3P A;  3B0C W;  3W96 D;  3NQJ A;  2Y2P A;  1P3K C;  5B2I D;  1KX4 D;  3W98 C;  3X1V B;  3WTP C;  3AV2 D;  3KXB A;  1F66 D;  2PYO D;  3AN2 A;  1H3O B;  2RVQ D;  2XD1 A;  4WU9 D;  3B6G D;  3W97 B;  4WNN A;  5B0Z D;  2DQN C;  3AZH B;  4HGA B;  5GT0 B;  4YM6 D;  1JFI B;  1AOI A;  3KWQ D;  5CP6 D;  5KDM B;  2NQB C;  1S32 D;  5GSU C;  3A6N C;  3TU4 A;  4R8P D;  3AZN C;  5AV5 D;  5CPI A;  2FJ7 C;  5FUG B;  3LEL B;  4ZUX A;  1P3A C;  1M18 B;  1M1A D;  1ID3 D;  4KHA B;  5JRG C;  3UTA B;  1TZY A;  5B0Y C;  3REK B;  2HIO D;  2BYK A;  3FDD A;  3AYW D;  4WU8 C;  2HUE B;  4H9S C;  3REH D;  1P34 C;  3C1B B;  4H9Q B;  1P3I A;  4ZBJ B;  1P3G A;  2NZD C;  1KX5 B;  2Y2L A;  3REJ A;  1ZLA B;  5E5A C;  4UUZ B;  3LJA C;  4WJ3 C;  1KX4 A;  5CPJ D;  5B1M A;  1M19 B;  3X1T C;  1P3K B;  4J8V D;  3AV2 A;  3W98 B;  3UTB C;  4DRB A;  3AZM C;  3WTP B;  3H0R C;  4EO5 C;  4AWL C;  2F2A C;  3MVD B;  3WAA D;  4H9P B;  4H9N A;  4J8W D;  4E45 A;  4XUJ A;  5BNV A;  3KWQ A;  3AZF C;  1WWI A;  1B6W A;  3MGQ A;  1S32 A;  5AV6 A;  3AV1 A;  3EPK A;  2NQB B;  3LZ1 C;  3X1U D;  5DNM B;  1P3L D;  5B2J A;  5CPK A;  5GSU B;  3A6N B;  4J8U D;  3AZK A;  4R8P A;  3MNN D;  5AV5 A;  3B6F C;  5C3I C;  5B31 C;  2JE5 A;  3X1S D;  4J8X A;  2FJ7 B;  4QLC C;  3REI C;  1P3A B;  2YFV A;  5AV8 C;  3KSY A;  5JRG B;  5B0Y B;  2CV5 A;  1P3M A;  1EQZ C;  1Z2C B;  3MGR C;  5DNN A;  4WU8 B;  3LZ0 A;  4X23 C;  4Z66 A;  5B32 G;  2ARO C;  5B40 C;  5B32 B;  1U35 C;  2BYM A;  4CAY A;  3MGS C;  5GXQ A;  5AV9 D;  3AZL D;  4KUD D;  1BH9 B;  2NZD B;  3W99 C;  5E5A B;  1BH8 A;  3LJA B;  3C1C B;  4J8V A;  4KGC C;  5AVC C;  1P3O C;  3VH5 A;  3X1T B;  5BNX B;  2CWE A;  4UUZ A;  3WAA A;  4NFT A;  5B2I B;  3UTB B;  1P3P D;  4EO5 B;  3VH6 T;  4AWL B;  5AY8 A;  5B1L C;  1F66 B;  3MGP A;  3REL A;  2PYO B;  3AZF B;  5BS7 C;  3X1U A;  3KXB D;  5G49 A;  4J8U A;  3AZH C;  3AN2 D;  3R45 A;  3LZ1 B;  5CP6 B;  3AFA C;  5JA4 B;  3AZE C;  3AZJ A;  1KU5 A;  1AOI D;  5B31 G;  3WA9 C;  3B6F B;  2G5H C;  5C3I B;  5B31 B;  3AZI D;  3X1V A;  4QLC B;  3REI B;  3TU4 D;  4Z5T D;  5AV8 B;  5CPI D;  1M1A B;  1ID3 B;  5F99 C;  4YS3 A;  1H3O A;  3W97 A;  1EQZ B;  4ZUX D;  3MGR B;  3REK C;  2HIO B;  5GT0 A;  5GT3 C;  1JFI A;  1TZY D;  3AYW B;  2HUE C;  4X23 B;  2ARO B;  5B40 B;  3WKJ D;  1U35 B;  3MGS B;  3EG5 B;  1P3I D;  5FUG A;  3W99 B;  1M18 A;  4KGC B;  5B24 D;  5AVC B;  1P3O B;  2F8N G;  4JJN C;  1P3G D;  3UTA A;  2F8N B;  1M19 C;  3REJ D;  2FFF B;  3KUY C;  5B1M D;  2VQR A;  4Z2M G;  3MVD C;  1N1J B;  5B1L B;  1P3B C;  3C1B A;  4XZQ C;  2Y2Q A;  3H0L C;  4XUJ D;  3O62 C;  3UT9 A;  3MGQ D;  5DNM C;  1P3L B;  3AFA B;  3AZE B;  3WA9 B;  5AV6 D; 
#chains in the Genus database with same CATH homology
 3AV1 D;  4LD9 A;  5B2J D;  5CPK D;  1P3K A;  3AZK D;  4Z5T A;  1ULY A;  3W98 A;  3X1S B;  3WTP A;  4J8X D;  1P3F C;  5F99 B;  2ZY5 A;  5AVB C;  5GT3 B;  3EPH A;  2CV5 D;  1P3M D;  1KX3 C;  2NQB A;  3WKJ A;  5GSU A;  5DNN D;  3A6N A;  3H0M C;  2Y2M A;  3LZ0 D;  5BT1 C;  2UWX A;  5B32 C;  1Q9C A;  1PZR A;  4Z66 D;  5B24 A;  3AZN A;  2FJ7 A;  2F8N K;  2G5I C;  3AZL B;  1P3A A;  2BG1 A;  3C1C C;  4JJN B;  5GXQ D;  5JRG A;  5B0Y A;  1HQ3 C;  3KUY B;  3W96 C;  5B2I C;  3V9R A;  4DRA A;  3AZG D;  1KX4 C;  3A1K A;  3VH5 W;  1P34 A;  5B33 D;  1P3B B;  3AV2 C;  4XZQ B;  5BO0 B;  1F66 C;  2PYO C;  5AY8 D;  3B6G C;  2RVQ C;  4WU9 C;  5B0Z C;  3O62 B;  3VH6 A;  3MGP D;  3REL D;  1BH9 A;  4YM6 C;  2NZD A;  5E5A A;  3KWQ C;  5CP6 C;  2XD5 A;  1S32 C;  5BNX A;  3AZJ D;  3UTB A;  3AZM A;  4R8P C;  5AV5 C;  1P3F B;  4H9O B;  3X1V D;  1M1A C;  1ID3 C;  1TAF A;  3AZF A;  5AVB B;  2HIO C;  2JCH A;  4YS3 D;  1KX3 B;  3W97 D;  3LZ1 A;  3AYW C;  1T3U A;  3REH C;  5GT0 D;  5JA4 A;  3EPL A;  3B6F A;  5CHL B;  4UPK A;  2Y2N A;  1W2E A;  5AV8 A;  3NQU B;  1HQ3 B;  3LEL D;  3AZG A;  1P3G B;  5CPJ C;  1M18 D;  1EQZ A;  3W96 B;  2J8P A;  2YFW B;  4J8V C;  5B33 A;  1KX4 B;  3UTA D;  4E44 A;  5B1M B;  3AL0 C;  3WAA C;  3AV2 B;  1HTA A;  2ARO A;  3B6G B;  4J8W C;  4WU9 B;  1U35 A;  5B0Z B;  3MGS A;  3C1B D;  4YM6 B;  3W99 A;  3KWQ B;  4KGC A;  5AVC A;  3X1U C;  1P3L C;  4M6B A;  1S32 B;  4J8U C;  3UT9 D;  2F8N A;  1ZLA D;  3MNN C;  2JSS A;  4LD9 D;  2L5A A;  3X1S C;  4R8P B;  5AV5 B;  1P3K D;  1N1J A;  3W98 D;  2Y2K A;  3WTP D;  5BS7 A;  3AZH A;  4DQY B;  1P3M B;  5KDM A;  3REH B;  3AFA A;  3AZE A;  4H9R B;  2NQB D;  3LZ0 B;  5GSU D;  3A6N D;  1R4V A;  3LEL A;  5AV9 C;  3AZL C;  4KUD C;  3AZN D;  2FJ7 D;  2BYM B;  5F99 A;  4KHA A;  4CAY B;  5CPJ B;  1P3A D;  3REK A;  4J8V B;  5GT3 A;  5JRG D;  5B0Y D;  1P3P C;  3WAA B;  4WU8 D;  1P34 D;  4H9Q A;  4J8W B;  3A1I A;  2RIQ A;  3KXB C;  3F6T A;  3AN2 C;  1KX5 A;  1ZLA A;  3X1U B;  4JJN A;  5G49 B;  4J8U B;  2F8N H;  2NZD D;  1M19 A;  5E5A D;  3MNN B;  3LJA D;  1AOI C;  3VH6 W;  3KUY A;  2Y2G A;  3AZJ B;  3AZI C;  3X1T D;  4NE6 A;  2W8S A;  4CSR B;  3MVD A;  3UTB D;  4Z2M H;  3TU4 C;  1P3B A;  4NE5 A;  4Z5T C;  3AZM D;  4H9P A;  3KFU G;  5CPI C;  4XZQ A;  5BO0 A;  2Y2J A;  4ZUX C;  3O62 A;  4YS3 B;  3AZF D;  1A7W A;  1TZY C;  5DNM A;  2ZY3 A;  3LZ1 D;  3WKJ C;  3B6F D;  5B31 D;  5AV9 B;  1P3I C;  4KUD B;  1P3F A;  2Y2O A;  4H9O A;  4QLC D;  5B24 C;  3REI D;  1BFM A;  5AV8 D;  1P3G C;  4NE3 A;  5AVB A;  3REJ C;  4G92 C;  4WU8 A;  1KX3 A;  1EQZ D;  1P3P B;  5B1M C;  4H9S A;  3MGR D;  3NQJ B;  4X23 D;  5B32 A;  4G91 C;  2ARO D;  3KXB B;  5B40 D;  3AN2 B;  2DF4 C;  1U35 D;  4XUJ C;  3LJA A;  4WNN B;  3C1C A;  3NQU A;  3MGS D;  3MGQ C;  1B67 A;  2ZM5 A;  1HQ3 A;  5AV6 C;  3W99 D;  3UT9 B;  3AV1 C;  3X1T A;  1AOI B;  2Y2I A;  4KGC D;  3W96 A;  5AVC D;  2YFW A;  1P3O D;  5B2J C;  5B2I A;  3AZI B;  3AZK C;  5CPK C;  4LD9 B;  2F8N D;  3TU4 B;  4Z5T B;  4J8X C;  5CPI B;  1F66 A;  2PYO A;  3B0B A;  3B6G A;  4ZUX B;  5B1L D;  4WU9 A;  5B0Z A;  4YM6 A;  2ZY2 A;  1TZY B;  2CV5 C;  1P3M C;  5CP6 A;  3AZH D;  2BYK B;  5DNN C;  2ZY4 A;  2LY8 A;  3LZ0 C;  5B31 A;  3AFA D;  3AZE D;  3WKJ B;  3WA9 D;  4Z66 C;  4WV4 B;  4QLC A;  3REI A;  1P3I B;  5B24 B;  3AZN B;  1M1A A;  1ID3 A;  3B0D C;  5GXQ C;  3MGR A;  3REJ B;  2HIO A;  5F99 D;  3EPJ A;  4G92 B;  3AYW A;  2IO5 C;  3REK D;  3AZG C;  4X23 A;  5GT3 D;  3REH A;  4H9R A;  3B0C T;  3V9R B;  5B33 C;  3IP4 C;  5B40 A;  4G91 B;  1P34 B;  5AY8 C;  4H9N B;  4XUJ B;  5BNV B;  3MGP C;  3REL C;  3MGQ B;  1P3O A;  5AV6 B;  3AV1 B;  5CPJ A;  1KX5 D;  5B2J B;  4JJN D;  5CPK B;  3AZK B;  3AZJ C;  1M19 D;  3KUY D;  4J8X B;  5B1L A;  3AZM B;  3X1V C;  3MVD D;  4J8W A;  1P3B D;  2YFV B;  3WTP E;  4XZQ D;  2CV5 B;  1TAF B;  4YS3 C;  3W97 C;  1P3L A;  3WA9 A;  3O62 D;  5DNN B;  4HGA C;  5GT0 C;  5DNM D;  3MNN A;  3X1S A;  4Z66 B;  4CSR A;  3AZI A;  3B0D B;  5GXQ B;  1P3F D;  4WZS B;  3LEL C;  1BH8 B;  1M18 C;  2IO5 B;  3AZG B;  5AVB D;  3UTA C;  1KX3 D;  3P5J B;  5B33 B;  1F1E A;  1WWS A;  5AY8 B;  5BT1 D;  3VH5 T;  3C1B C;  5B32 D;  5AV9 A;  3MGP B;  3REL B;  3AZL A;  4KUD A;  2Y2H A;  4ZBJ C;  3R45 B;  3C1C D;  3UT9 C;  1KX5 C;  1ZLA C;  1HQ3 D;  4LD9 C;  1P3P A;  3B0C W;  3W96 D;  3NQJ A;  2Y2P A;  1P3K C;  5B2I D;  1KX4 D;  3W98 C;  3X1V B;  3WTP C;  3AV2 D;  3KXB A;  1F66 D;  2PYO D;  3AN2 A;  1H3O B;  2RVQ D;  2XD1 A;  4WU9 D;  3B6G D;  3W97 B;  4WNN A;  5B0Z D;  2DQN C;  3AZH B;  4HGA B;  5GT0 B;  4YM6 D;  1JFI B;  1AOI A;  3KWQ D;  5CP6 D;  5KDM B;  2NQB C;  1S32 D;  5GSU C;  3A6N C;  3TU4 A;  4R8P D;  3AZN C;  5AV5 D;  5CPI A;  2FJ7 C;  5FUG B;  3LEL B;  4ZUX A;  1P3A C;  1M18 B;  1M1A D;  1ID3 D;  4KHA B;  5JRG C;  3UTA B;  1TZY A;  5B0Y C;  3REK B;  2HIO D;  2BYK A;  3FDD A;  3AYW D;  4WU8 C;  2HUE B;  4H9S C;  3REH D;  1P34 C;  3C1B B;  4H9Q B;  1P3I A;  4ZBJ B;  1P3G A;  2NZD C;  1KX5 B;  2Y2L A;  3REJ A;  1ZLA B;  5E5A C;  4UUZ B;  3LJA C;  4WJ3 C;  1KX4 A;  5CPJ D;  5B1M A;  1M19 B;  3X1T C;  1P3K B;  4J8V D;  3AV2 A;  3W98 B;  3UTB C;  4DRB A;  3AZM C;  3WTP B;  3H0R C;  4EO5 C;  4AWL C;  2F2A C;  3MVD B;  3WAA D;  4H9P B;  4H9N A;  4J8W D;  4E45 A;  4XUJ A;  5BNV A;  3KWQ A;  3AZF C;  1WWI A;  1B6W A;  3MGQ A;  1S32 A;  5AV6 A;  3AV1 A;  3EPK A;  2NQB B;  3LZ1 C;  3X1U D;  5DNM B;  1P3L D;  5B2J A;  5CPK A;  5GSU B;  3A6N B;  4J8U D;  3AZK A;  4R8P A;  3MNN D;  5AV5 A;  3B6F C;  5C3I C;  5B31 C;  2JE5 A;  3X1S D;  4J8X A;  2FJ7 B;  4QLC C;  3REI C;  1P3A B;  2YFV A;  5AV8 C;  3KSY A;  5JRG B;  5B0Y B;  2CV5 A;  1P3M A;  1EQZ C;  1Z2C B;  3MGR C;  5DNN A;  4WU8 B;  3LZ0 A;  4X23 C;  4Z66 A;  5B32 G;  2ARO C;  5B40 C;  5B32 B;  1U35 C;  2BYM A;  4CAY A;  3MGS C;  5GXQ A;  5AV9 D;  3AZL D;  4KUD D;  1BH9 B;  2NZD B;  3W99 C;  5E5A B;  1BH8 A;  3LJA B;  3C1C B;  4J8V A;  4KGC C;  5AVC C;  1P3O C;  3VH5 A;  3X1T B;  5BNX B;  2CWE A;  4UUZ A;  3WAA A;  4NFT A;  5B2I B;  3UTB B;  1P3P D;  4EO5 B;  3VH6 T;  4AWL B;  5AY8 A;  5B1L C;  1F66 B;  3MGP A;  3REL A;  2PYO B;  3AZF B;  5BS7 C;  3X1U A;  3KXB D;  5G49 A;  4J8U A;  3AZH C;  3AN2 D;  3R45 A;  3LZ1 B;  5CP6 B;  3AFA C;  5JA4 B;  3AZE C;  3AZJ A;  1KU5 A;  1AOI D;  5B31 G;  3WA9 C;  3B6F B;  2G5H C;  5C3I B;  5B31 B;  3AZI D;  3X1V A;  4QLC B;  3REI B;  3TU4 D;  4Z5T D;  5AV8 B;  5CPI D;  1M1A B;  1ID3 B;  5F99 C;  4YS3 A;  1H3O A;  3W97 A;  1EQZ B;  4ZUX D;  3MGR B;  3REK C;  2HIO B;  5GT0 A;  5GT3 C;  1JFI A;  1TZY D;  3AYW B;  2HUE C;  4X23 B;  2ARO B;  5B40 B;  3WKJ D;  1U35 B;  3MGS B;  3EG5 B;  1P3I D;  5FUG A;  3W99 B;  1M18 A;  4KGC B;  5B24 D;  5AVC B;  1P3O B;  2F8N G;  4JJN C;  1P3G D;  3UTA A;  2F8N B;  1M19 C;  3REJ D;  2FFF B;  3KUY C;  5B1M D;  2VQR A;  4Z2M G;  3MVD C;  1N1J B;  5B1L B;  1P3B C;  3C1B A;  4XZQ C;  2Y2Q A;  3H0L C;  4XUJ D;  3O62 C;  3UT9 A;  3MGQ D;  5DNM C;  1P3L B;  3AFA B;  3AZE B;  3WA9 B;  5AV6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...