4ZUXD

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Hydrolase/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H, N, R
ec nomenclature
pdb deposition date 2015-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zuxD00
5DNMA 3LZ0B 3KUYD 3AZMC 5B31G 5B1LC 1P3AA 4J8VC 4ZBJC 1BH8B 1N1JA 5B32A 2RVQD 5FUGA 5B1MD 4XUJB 5AV8D 5B31C 5F99B 1KX3C 3WTPB 3LZ1A 1M19C 5DNNB 3AV1A 4CAYA 5GXQA 3AZND 5BO0B 3O62B 1ZLAA 1U35B 3W98D 3AZKD 4LD9A 5B0YA 1P3IC 3R45A 4J8UD 5BT1D 5AV5A 5AVCB 3KUYB 3X1UC 3UT9A 3AZGD 3REKA 3X1SD 1P3OC 3MVDD 3WKJC 5B1MB 5B2ID 5CPJC 5CPKA 5AY8B 3AZLD 5AV8B 2CWEA 3LZ0A 5B33C 3W96C 3C1CD 3AZNB 3W98B 2NQBD 2IO5C 3W97D 3B6FB 4XUJA 3AN2C 2F8NH 4J8UB 4Z2MH 4E45A 3AZFA 2HIOB 1P3FD 3WTPA 3C1BD 3AYWA 3KWQC 5DNNA 3AZGB 3MVDB 5BO0A 3O62A 3AZEC 1U35A 2AROC 3B0CT 3AFAD 3KXBD 4R8PC 3AZLB 4YM6D 1TZYA 5CPID 5AV9D 1TAFB 3KUYA 1P3LD 5JRGC 4WU8D 3NQUB 4E44A 1F66C 5B24C 2NZDC 5AV6D 3W97B 5B1MA 1P3PC 2CV5C 5AV8A 3B6GC 1P3FB 3C1BB 1BH9B 3AZNA 3W98A 5JA4B 3AFAB 3AZKA 3KXBB 3WA9B 5CPIB 5AV9B 4J8UA 4JJNC 3REID 4KGCD 1P3LB 3LZ1C 3AZGA 3WAAC 4EO5B 1P34D 2F8NK 3X1SA 5GXQC 2BYMB 3MVDA 1P3GC 5AV6B 5B0YC 5B2IA 5C3IC 3AZLA 2JSSA 1TAFA 1ULYA 4XZQD 3REHC 4NE6A 3C1CA 1WWSA 3UTAD 2NQBA 3REJD 3MGQC 5B0ZD 3W97A 4AWLB 3REIB 1HQ3C 5B2JD 3LZ0C 1P3FA 3C1BA 1P34B 1BH9A 3A6ND 4WNNB 2FJ7C 3AFAA 3W99C 3LJAD 3KXBA 4YM6A 5CPIA 5AV9A 1EQZD 5F99C 1P3LA 4WU8A 4G91B 3B0DB 3AV1B 5DNNC 2YFWB 2BYMA 3REJB 5AV6A 1WWIA 3AV2C 4LD9B 5G49B 4QLCD 5GT3D 3MGPA 4Z5TD 5CP6C 3WTPE 4J8XD 3NQJB 5B2JB 5AV5B 5AVCC 3A6NB 5B40C 4NE5A 3LJAB 5GSUD 2RVQC 5B1MC 3VH6W 1Q9CA 5AY8C 3REIA 1BFMA 4KGCA 1P34A 3AZNC 4WNNA 2PYOD 3AZHC 3VH6T 5GT3B 4NFTA 3TU4C 3B6FC 4J8XB 1KX5D 3KSYA 3AZFB 3MGSC 4XZQA 2HIOC 4KUDC 3UTBC 3X1VC 3AYWB 3AZGC 2YFWA 3UTAA 1P3BC 3REJA 3LELC 5B0ZA 1P3MD 5G49A 1TZYB 4ZUXD 3NQJA 5B2JA 1HTAA 5E5AD 1S32D 3A6NA 3MNNC 4WU9D 1P3KD 4J8WD 3LJAA 3B0BA 3MGRD 1KX5B 4WZSB 1EQZA 3AZMD 1ID3C 1M18C 5B1LD 2HUEB 4J8VD 3AZKB 1P3MB 3AFAC 4QLCA 5GT3A 3WA9C 3B0CW 4Z5TA 3X1TC 4ZUXB 5CPIC 4J8XA 5AV9C 5E5AB 1S32B 3VH5T 1P3LC 1KX3D 1M19D 3AZJC 1H3OA 3X1SB 1P3KB 4J8WB 5GSUA 1KX4C 5BNXB 1M1AC 5B2IB 3MGRB 1AOIC 1R4VA 4H9SC 3C1CB 3X1UD 4Z66D 5B1LB 5BS7A 4J8VB 2PYOA 2NQBB 2YFVB 1P3OD 4YS3C 3WKJD 5B32G 4UUZA 3MGPD 1KX5A 5AVBC 1KU5A 3VH6A 5DNMC 1KX3B 3W96D 1P3AC 1P3MA 5B32C 4YM6B 3AN2D 4ZUXA 5E5AA 4WU8B 3X1UB 4Z66B 4G91C 1S32A 1F1EA 3AV1C 4WU9A 1P3KA 4J8WA 3REJC 1ZLAC 2AROD 5BNXA 4LD9C 3MGPB 3MGRA 5GT0D 4H9OA 5AV5C 3AZMA 4NE3A 5JRGD 3W96B 5B1LA 3UT9C 3REKC 4J8VA 5B24D 2YFVA 1P3PD 2CV5D 5CPKC 3B6GD 4KGCB 1KX3A 1M19A 4DRBA 2AROB 3VH5A 3RELD 4X23D 5GT0B 4XUJC 4JJND 4J8XC 3AZFC 4XZQB 3X1UA 4Z66A 3WTPC 3AYWC 3WAAD 5B24B 3UTAB 1P3OA 3O62C 1P3GD 5B0ZB 1U35C 3WKJA 4KHAB 4G92B 1P3PB 1TZYC 3KUYC 3REHD 3W96A 5BS7C 4H9QA 1B67A 3RELB 4X23B 3MGQD 4HGAB 3AN2A 5AV8C 1HQ3D 1EQZB 2F8ND 3AZEA 1P3GB 2FJ7D 2AROA 3W98C 3AZKC 3W99D 4QLCB 5C3IB 4Z5TB 5GT0A 4J8UC 5BT1C 5F99D 5JRGA 1S32C 1H3OB 4WV4B 5B24A 3X1SC 3MVDC 3MGQB 5GSUB 3AV2D 4KHAA 5BNVB 2CV5A 5B2IC 1P3PA 3AZLC 3MGRC 5CP6D 3B6GA 1HQ3B 5AVCD 2L5AA 3C1CC 5B40D 2F8NB 3AZID 2FJ7B 2PYOB 2NQBC 3RELA 4M6BA 4X23A 3W99B 3W97C 4UUZB 5AY8D 4JJNA 2BYKA 1P3FC 3C1BC 3WAAA 3VH5W 1P3GA 3AV2B 3AZHD 3KXBC 3TU4D 5CP6B 4YM6C 3B6FD 3MGSD 4DRAA 2HIOD 5B31D 3REHA 4KUDD 4WU8C 5B40B 4Z66C 3UTBD 3X1VD 4WU9B 4EO5C 3AZIB 1P3BD 3MGQA 5KDMB 5AV6C 3LELD 5BNVA 1P3ID 3MGPC 1HQ3A 4H9OB 3AZMB 1JFIB 3MNND 2F8NA 2FJ7A 1A7WA 4ZBJB 1BH8A 3AZHB 3W99A 4AWLC 3TU4B 5CPJD 4H9RB 3MGSB 3REIC 5B31B 4KGCC 5F99A 4KUDB 5B33D 3UTBB 3X1VB 1M19B 1P34C 1ID3D 1M18D 1P3BB 4H9NB 3LELB 3AV2A 1P3IB 3WA9D 5CP6A 5GT0C 3X1TD 5AVCA 4XZQC 5B40A 3MNNB 3B0DC 3KWQD 3AZJD 3AZIA 3UTAC 1P3OB 3AZED 5KDMA 5B0ZC 1KX4D 3WKJB 1M1AD 5CPJB 4G92C 4R8PD 1AOID 5AY8A 3V9RB 5B33B 5B2JC 1ID3B 1JFIA 1M18B 3A6NC 4H9QB 1F66D 2NZDD 3AZHA 3RELC 2IO5B 4X23C 4YS3D 4HGAC 3LJAC 3TU4A 3AN2B 3X1TB 3B6FA 4H9RA 5AVBD 3MGSA 1B6WA 2HIOA 5B31A 5DNMD 1EQZC 4KUDA 3UTBA 3X1VA 3KWQB 3AZJB 1P3BA 4H9NA 1P3AD 3AZEB 3LELA 1KX4B 5B32D 1M1AB 1P3IA 4QLCC 5GT3C 4R8PB 1AOIB 4Z5TC 5JRGB 3LZ1D 3MNNA 3NQUA 3AV1D 1F66B 5GXQD 2NZDB 2F8NG 1ZLAD 4CSRB 4Z2MG 4YS3B 5GSUC 4LD9D 5B0YD 5CPJA 2CV5B 3B6GB 5AVBB 4H9PB 5DNMB 3V9RA 5B33A 5AV5D 1ID3A 1M18A 2LY8A 3UT9D 3REKD 5CHLB 1P3AB 2PYOC 5JA4A 1N1JB 5B32B 3WA9A 5FUGB 3X1TA 5CPKD 4JJNB 2BYKB 1KX5C 3LZ0D 3LZ1B 3KWQA 3AZJA 3WAAB 4CAYB 5GXQB 2HUEC 1ZLAB 1KX4A 1P3MC 5B0YB 1M1AA 4R8PA 1AOIA 3R45B 4XUJD 4ZUXC 4H9SA 3AZFD 3REHB 5E5AC 3WTPD 3UT9B 3AYWD 5DNND 3REKB 4WU9C 3AZIC 1F66A 1P3KC 4J8WC 2NZDA 4CSRA 3O62D 4YS3A 1U35D 5CPKB 1TZYD 5AVBA 4H9PA
chains in the Genus database with same CATH superfamily
5DNMA 3LZ0B 3KUYD 3AZMC 5B31G 5B1LC 1P3AA 4J8VC 4ZBJC 1BH8B 1N1JA 5B32A 2RVQD 5FUGA 5B1MD 4XUJB 5AV8D 5B31C 5F99B 1KX3C 3WTPB 3LZ1A 1M19C 5DNNB 3AV1A 4CAYA 5GXQA 3AZND 2ZY4A 5BO0B 3O62B 1ZLAA 1U35B 3W98D 3AZKD 4LD9A 5B0YA 1P3IC 3R45A 4J8UD 5BT1D 5AV5A 5AVCB 3KUYB 3X1UC 3UT9A 3AZGD 3REKA 3X1SD 1P3OC 3MVDD 3WKJC 5B1MB 5B2ID 5CPJC 5CPKA 5AY8B 3AZLD 5AV8B 2CWEA 3LZ0A 5B33C 4WJ3C 2VQRA 3W96C 3C1CD 3AZNB 3W98B 2NQBD 2IO5C 3W97D 3B6FB 4XUJA 3AN2C 2FFFB 2F8NH 4J8UB 4Z2MH 4E45A 3AZFA 2HIOB 1P3FD 3WTPA 3C1BD 3AYWA 3KWQC 5DNNA 3AZGB 3MVDB 5BO0A 3O62A 3AZEC 1U35A 2AROC 3B0CT 3AFAD 3KXBD 4R8PC 3AZLB 4YM6D 1TZYA 5CPID 5AV9D 1TAFB 3KUYA 1P3LD 5JRGC 4WU8D 3NQUB 4E44A 1F66C 5B24C 2NZDC 5AV6D 3W97B 5B1MA 1P3PC 2CV5C 2G5HC 5AV8A 3B6GC 1P3FB 3C1BB 1BH9B 3AZNA 3W98A 2XD1A 5JA4B 3AFAB 3AZKA 1W2EA 3KXBB 3WA9B 2DQNC 5CPIB 5AV9B 4J8UA 4JJNC 3REID 4KGCD 1P3LB 3LZ1C 3AZGA 3WAAC 4EO5B 1P34D 2F8NK 3X1SA 5GXQC 2BYMB 3MVDA 1P3GC 5AV6B 5B0YC 5B2IA 2RIQA 5C3IC 3AZLA 2JSSA 1TAFA 1ULYA 4XZQD 3REHC 4NE6A 3C1CA 1WWSA 3A1KA 3UTAD 2NQBA 3REJD 3MGQC 5B0ZD 3W97A 4AWLB 3REIB 4UPKA 1HQ3C 5B2JD 3LZ0C 1P3FA 3C1BA 1P34B 1BH9A 3A6ND 2DF4C 4WNNB 2FJ7C 3AFAA 3W99C 2XD5A 3KXBA 3LJAD 4YM6A 5CPIA 5AV9A 1EQZD 5F99C 1P3LA 4WU8A 4G91B 3B0DB 3AV1B 5DNNC 2YFWB 2BYMA 3REJB 5AV6A 1WWIA 2ZY2A 3AV2C 4LD9B 5G49B 4QLCD 5GT3D 3MGPA 4Z5TD 5CP6C 3WTPE 4J8XD 3NQJB 5B2JB 5AV5B 5AVCC 3A6NB 5B40C 4NE5A 3LJAB 5GSUD 2RVQC 5B1MC 3VH6W 1Q9CA 5AY8C 3REIA 1BFMA 4KGCA 1P34A 2J8PA 3AZNC 4WNNA 2PYOD 2G5IC 3AZHC 3VH6T 5GT3B 4NFTA 3TU4C 3B6FC 4J8XB 2ZY5A 1KX5D 3KSYA 3AZFB 3MGSC 4XZQA 2HIOC 4KUDC 3UTBC 3X1VC 3AYWB 3AZGC 2YFWA 3UTAA 1P3BC 3REJA 3LELC 5B0ZA 3AL0C 1P3MD 5G49A 1TZYB 4ZUXD 3NQJA 5B2JA 3H0LC 1HTAA 5E5AD 1S32D 3A6NA 3MNNC 4WU9D 1P3KD 4J8WD 3H0MC 3LJAA 2Y2NA 3B0BA 3MGRD 1KX5B 4WZSB 1EQZA 3AZMD 1ID3C 1M18C 5B1LD 2HUEB 4J8VD 3AZKB 1P3MB 3AFAC 4QLCA 5GT3A 3WA9C 3B0CW 4Z5TA 3X1TC 4ZUXB 5CPIC 4J8XA 5AV9C 5E5AB 1S32B 3VH5T 1P3LC 1KX3D 1M19D 3AZJC 1H3OA 3IP4C 3X1SB 1P3KB 4J8WB 5GSUA 1KX4C 5BNXB 1M1AC 5B2IB 3MGRB 1AOIC 1R4VA 4H9SC 3C1CB 3X1UD 4Z66D 5B1LB 3EPKA 5BS7A 4J8VB 2PYOA 2NQBB 2YFVB 1P3OD 4YS3C 3WKJD 5B32G 2ZM5A 2Y2OA 4UUZA 3MGPD 1T3UA 1KX5A 5AVBC 1KU5A 3VH6A 5DNMC 1KX3B 3W96D 1P3AC 3F6TA 1P3MA 5B32C 4YM6B 3AN2D 4ZUXA 5E5AA 4WU8B 3X1UB 4Z66B 4G91C 1S32A 1F1EA 3AV1C 4WU9A 1P3KA 4J8WA 3REJC 1ZLAC 2AROD 5BNXA 4LD9C 3MGPB 3MGRA 5GT0D 2JE5A 4H9OA 5AV5C 3H0RC 3AZMA 4NE3A 5JRGD 3W96B 5B1LA 3UT9C 3REKC 4J8VA 5B24D 2YFVA 2UWXA 1P3PD 2CV5D 5CPKC 2F2AC 3B6GD 4KGCB 1KX3A 1M19A 4DRBA 2AROB 3VH5A 3RELD 4X23D 5GT0B 3EPLA 4XUJC 4JJND 4J8XC 3KFUG 3AZFC 4XZQB 3X1UA 4Z66A 3WTPC 3AYWC 3WAAD 5B24B 3UTAB 1P3OA 2W8SA 3O62C 5B0ZB 1U35C 1P3GD 3WKJA 4KHAB 4G92B 1P3PB 1TZYC 3KUYC 3REHD 3W96A 2ZY3A 5BS7C 4H9QA 1B67A 3RELB 4X23B 3MGQD 4HGAB 3AN2A 5AV8C 2Y2QA 1HQ3D 1EQZB 1PZRA 4DQYB 2F8ND 3AZEA 1P3GB 2FJ7D 2AROA 2Y2MA 3W98C 3AZKC 3W99D 4QLCB 5C3IB 4Z5TB 5GT0A 4J8UC 5BT1C 3A1IA 5F99D 5JRGA 1S32C 1H3OB 2Y2LA 4WV4B 5B24A 3X1SC 3MVDC 3MGQB 5GSUB 3AV2D 4KHAA 5BNVB 2CV5A 5B2IC 1P3PA 3AZLC 3MGRC 5CP6D 3B6GA 1HQ3B 5AVCD 2L5AA 3C1CC 5B40D 2F8NB 3AZID 2FJ7B 2PYOB 2NQBC 3RELA 4M6BA 4X23A 3W99B 3W97C 4UUZB 5AY8D 4JJNA 2BYKA 1P3FC 3C1BC 3WAAA 3VH5W 1P3GA 3AV2B 3AZHD 3KXBC 3TU4D 5CP6B 4YM6C 3B6FD 3MGSD 4DRAA 2HIOD 5B31D 3REHA 4KUDD 4WU8C 5B40B 4Z66C 3UTBD 3X1VD 4WU9B 4EO5C 3AZIB 1P3BD 3MGQA 5KDMB 5AV6C 3LELD 5BNVA 1P3ID 3EPJA 3MGPC 2Y2KA 1HQ3A 3EG5B 4H9OB 3AZMB 1JFIB 3MNND 2F8NA 2FJ7A 1A7WA 4ZBJB 1BH8A 3AZHB 3W99A 4AWLC 3TU4B 5CPJD 4H9RB 3MGSB 3REIC 5B31B 4KGCC 5F99A 4KUDB 5B33D 3UTBB 3X1VB 1M19B 3FDDA 1P34C 1ID3D 1M18D 1P3BB 4H9NB 2Y2HA 3LELB 3AV2A 1P3IB 3WA9D 5CP6A 5GT0C 3X1TD 5AVCA 4XZQC 5B40A 3MNNB 3B0DC 3KWQD 1Z2CB 3AZIA 3AZJD 3UTAC 1P3OB 3AZED 5KDMA 5B0ZC 1KX4D 3WKJB 1M1AD 5CPJB 4G92C 4R8PD 1AOID 5AY8A 3V9RB 5B33B 5B2JC 1ID3B 1JFIA 1M18B 3A6NC 4H9QB 1F66D 2NZDD 3AZHA 3RELC 2IO5B 4X23C 4YS3D 4HGAC 3LJAC 3TU4A 3AN2B 3X1TB 3B6FA 4H9RA 5AVBD 3MGSA 1B6WA 2HIOA 5B31A 5DNMD 1EQZC 4KUDA 3UTBA 3X1VA 3KWQB 3AZJB 1P3BA 4H9NA 1P3AD 3AZEB 3LELA 1KX4B 5B32D 1M1AB 1P3IA 4QLCC 5GT3C 4R8PB 2Y2JA 1AOIB 4Z5TC 5JRGB 3LZ1D 3MNNA 3NQUA 3AV1D 1F66B 5GXQD 2NZDB 2F8NG 1ZLAD 4CSRB 4Z2MG 4YS3B 5GSUC 4LD9D 5B0YD 5CPJA 2CV5B 3P5JB 3B6GB 5AVBB 4H9PB 5DNMB 5AV5D 3V9RA 5B33A 2JCHA 1ID3A 1M18A 2LY8A 3UT9D 3REKD 5CHLB 1P3AB 2PYOC 5JA4A 1N1JB 5B32B 3WA9A 5FUGB 3X1TA 5CPKD 4JJNB 2BYKB 1KX5C 3LZ0D 2Y2PA 3LZ1B 3KWQA 3AZJA 3WAAB 4CAYB 2Y2GA 5GXQB 2HUEC 1ZLAB 1KX4A 1P3MC 5B0YB 1M1AA 4R8PA 1AOIA 3R45B 4XUJD 4ZUXC 4H9SA 3EPHA 3AZFD 3REHB 5E5AC 3WTPD 3UT9B 3AYWD 5DNND 2Y2IA 3REKB 3AZIC 4WU9C 1P3KC 4J8WC 1F66A 2NZDA 4CSRA 3O62D 4YS3A 1U35D 5CPKB 2BG1A 1TZYD 5AVBA 4H9PA
chains in the Genus database with same CATH topology
5DNMA 3LZ0B 3KUYD 3AZMC 5B31G 5B1LC 1P3AA 4J8VC 4ZBJC 1BH8B 1N1JA 5B32A 2RVQD 5FUGA 5B1MD 4XUJB 5AV8D 5B31C 5F99B 1KX3C 3WTPB 3LZ1A 1M19C 5DNNB 3AV1A 4CAYA 5GXQA 3AZND 2ZY4A 5BO0B 3O62B 1ZLAA 1U35B 3W98D 3AZKD 4LD9A 5B0YA 1P3IC 3R45A 4J8UD 5BT1D 5AV5A 5AVCB 3KUYB 3X1UC 3UT9A 3AZGD 3REKA 3X1SD 1P3OC 3MVDD 3WKJC 5B1MB 5B2ID 5CPJC 5CPKA 5AY8B 3AZLD 5AV8B 2CWEA 3LZ0A 5B33C 4WJ3C 2VQRA 3W96C 3C1CD 3AZNB 3W98B 2NQBD 2IO5C 3W97D 3B6FB 4XUJA 3AN2C 2FFFB 2F8NH 4J8UB 4Z2MH 4E45A 3AZFA 2HIOB 1P3FD 3WTPA 3C1BD 3AYWA 3KWQC 5DNNA 3AZGB 3MVDB 5BO0A 3O62A 3AZEC 1U35A 2AROC 3B0CT 3AFAD 3KXBD 4R8PC 3AZLB 4YM6D 1TZYA 5CPID 5AV9D 1TAFB 3KUYA 1P3LD 5JRGC 4WU8D 3NQUB 4E44A 1F66C 5B24C 2NZDC 5AV6D 3W97B 5B1MA 1P3PC 2CV5C 2G5HC 5AV8A 3B6GC 1P3FB 3C1BB 1BH9B 3AZNA 3W98A 2XD1A 5JA4B 3AFAB 3AZKA 1W2EA 3KXBB 3WA9B 2DQNC 5CPIB 5AV9B 4J8UA 4JJNC 3REID 4KGCD 1P3LB 3LZ1C 3AZGA 3WAAC 4EO5B 1P34D 2F8NK 3X1SA 5GXQC 2BYMB 3MVDA 1P3GC 5AV6B 5B0YC 5B2IA 2RIQA 5C3IC 3AZLA 2JSSA 1TAFA 1ULYA 4XZQD 3REHC 4NE6A 3C1CA 1WWSA 3A1KA 3UTAD 2NQBA 3REJD 3MGQC 5B0ZD 3W97A 4AWLB 3REIB 4UPKA 1HQ3C 5B2JD 3LZ0C 1P3FA 3C1BA 1P34B 1BH9A 3A6ND 2DF4C 4WNNB 2FJ7C 3AFAA 3W99C 2XD5A 3KXBA 3LJAD 4YM6A 5CPIA 5AV9A 1EQZD 5F99C 1P3LA 4WU8A 4G91B 3B0DB 3AV1B 5DNNC 2YFWB 2BYMA 3REJB 5AV6A 1WWIA 2ZY2A 3AV2C 4LD9B 5G49B 4QLCD 5GT3D 3MGPA 4Z5TD 5CP6C 3WTPE 4J8XD 3NQJB 5B2JB 5AV5B 5AVCC 3A6NB 5B40C 4NE5A 3LJAB 5GSUD 2RVQC 5B1MC 3VH6W 1Q9CA 5AY8C 3REIA 1BFMA 4KGCA 1P34A 2J8PA 3AZNC 4WNNA 2PYOD 2G5IC 3AZHC 3VH6T 5GT3B 4NFTA 3TU4C 3B6FC 4J8XB 2ZY5A 1KX5D 3KSYA 3AZFB 3MGSC 4XZQA 2HIOC 4KUDC 3UTBC 3X1VC 3AYWB 3AZGC 2YFWA 3UTAA 1P3BC 3REJA 3LELC 5B0ZA 3AL0C 1P3MD 5G49A 1TZYB 4ZUXD 3NQJA 5B2JA 3H0LC 1HTAA 5E5AD 1S32D 3A6NA 3MNNC 4WU9D 1P3KD 4J8WD 3H0MC 3LJAA 2Y2NA 3B0BA 3MGRD 1KX5B 4WZSB 1EQZA 3AZMD 1ID3C 1M18C 5B1LD 2HUEB 4J8VD 3AZKB 1P3MB 3AFAC 4QLCA 5GT3A 3WA9C 3B0CW 4Z5TA 3X1TC 4ZUXB 5CPIC 4J8XA 5AV9C 5E5AB 1S32B 3VH5T 1P3LC 1KX3D 1M19D 3AZJC 1H3OA 3IP4C 3X1SB 1P3KB 4J8WB 5GSUA 1KX4C 5BNXB 1M1AC 5B2IB 3MGRB 1AOIC 1R4VA 4H9SC 3C1CB 3X1UD 4Z66D 5B1LB 3EPKA 5BS7A 4J8VB 2PYOA 2NQBB 2YFVB 1P3OD 4YS3C 3WKJD 5B32G 2ZM5A 2Y2OA 4UUZA 3MGPD 1T3UA 1KX5A 5AVBC 1KU5A 3VH6A 5DNMC 1KX3B 3W96D 1P3AC 3F6TA 1P3MA 5B32C 4YM6B 3AN2D 4ZUXA 5E5AA 4WU8B 3X1UB 4Z66B 4G91C 1S32A 1F1EA 3AV1C 4WU9A 1P3KA 4J8WA 3REJC 1ZLAC 2AROD 5BNXA 4LD9C 3MGPB 3MGRA 5GT0D 2JE5A 4H9OA 5AV5C 3H0RC 3AZMA 4NE3A 5JRGD 3W96B 5B1LA 3UT9C 3REKC 4J8VA 5B24D 2YFVA 2UWXA 1P3PD 2CV5D 5CPKC 2F2AC 3B6GD 4KGCB 1KX3A 1M19A 4DRBA 2AROB 3VH5A 3RELD 4X23D 5GT0B 3EPLA 4XUJC 4JJND 4J8XC 3KFUG 3AZFC 4XZQB 3X1UA 4Z66A 3WTPC 3AYWC 3WAAD 5B24B 3UTAB 1P3OA 2W8SA 3O62C 5B0ZB 1U35C 1P3GD 3WKJA 4KHAB 4G92B 1P3PB 1TZYC 3KUYC 3REHD 3W96A 2ZY3A 5BS7C 4H9QA 1B67A 3RELB 4X23B 3MGQD 4HGAB 3AN2A 5AV8C 2Y2QA 1HQ3D 1EQZB 1PZRA 4DQYB 2F8ND 3AZEA 1P3GB 2FJ7D 2AROA 2Y2MA 3W98C 3AZKC 3W99D 4QLCB 5C3IB 4Z5TB 5GT0A 4J8UC 5BT1C 3A1IA 5F99D 5JRGA 1S32C 1H3OB 2Y2LA 4WV4B 5B24A 3X1SC 3MVDC 3MGQB 5GSUB 3AV2D 4KHAA 5BNVB 2CV5A 5B2IC 1P3PA 3AZLC 3MGRC 5CP6D 3B6GA 1HQ3B 5AVCD 2L5AA 3C1CC 5B40D 2F8NB 3AZID 2FJ7B 2PYOB 2NQBC 3RELA 4M6BA 4X23A 3W99B 3W97C 4UUZB 5AY8D 4JJNA 2BYKA 1P3FC 3C1BC 3WAAA 3VH5W 1P3GA 3AV2B 3AZHD 3KXBC 3TU4D 5CP6B 4YM6C 3B6FD 3MGSD 4DRAA 2HIOD 5B31D 3REHA 4KUDD 4WU8C 5B40B 4Z66C 3UTBD 3X1VD 4WU9B 4EO5C 3AZIB 1P3BD 3MGQA 5KDMB 5AV6C 3LELD 5BNVA 1P3ID 3EPJA 3MGPC 2Y2KA 1HQ3A 3EG5B 4H9OB 3AZMB 1JFIB 3MNND 2F8NA 2FJ7A 1A7WA 4ZBJB 1BH8A 3AZHB 3W99A 4AWLC 3TU4B 5CPJD 4H9RB 3MGSB 3REIC 5B31B 4KGCC 5F99A 4KUDB 5B33D 3UTBB 3X1VB 1M19B 3FDDA 1P34C 1ID3D 1M18D 1P3BB 4H9NB 2Y2HA 3LELB 3AV2A 1P3IB 3WA9D 5CP6A 5GT0C 3X1TD 5AVCA 4XZQC 5B40A 3MNNB 3B0DC 3KWQD 1Z2CB 3AZIA 3AZJD 3UTAC 1P3OB 3AZED 5KDMA 5B0ZC 1KX4D 3WKJB 1M1AD 5CPJB 4G92C 4R8PD 1AOID 5AY8A 3V9RB 5B33B 5B2JC 1ID3B 1JFIA 1M18B 3A6NC 4H9QB 1F66D 2NZDD 3AZHA 3RELC 2IO5B 4X23C 4YS3D 4HGAC 3LJAC 3TU4A 3AN2B 3X1TB 3B6FA 4H9RA 5AVBD 3MGSA 1B6WA 2HIOA 5B31A 5DNMD 1EQZC 4KUDA 3UTBA 3X1VA 3KWQB 3AZJB 1P3BA 4H9NA 1P3AD 3AZEB 3LELA 1KX4B 5B32D 1M1AB 1P3IA 4QLCC 5GT3C 4R8PB 2Y2JA 1AOIB 4Z5TC 5JRGB 3LZ1D 3MNNA 3NQUA 3AV1D 1F66B 5GXQD 2NZDB 2F8NG 1ZLAD 4CSRB 4Z2MG 4YS3B 5GSUC 4LD9D 5B0YD 5CPJA 2CV5B 3P5JB 3B6GB 5AVBB 4H9PB 5DNMB 5AV5D 3V9RA 5B33A 2JCHA 1ID3A 1M18A 2LY8A 3UT9D 3REKD 5CHLB 1P3AB 2PYOC 5JA4A 1N1JB 5B32B 3WA9A 5FUGB 3X1TA 5CPKD 4JJNB 2BYKB 1KX5C 3LZ0D 2Y2PA 3LZ1B 3KWQA 3AZJA 3WAAB 4CAYB 2Y2GA 5GXQB 2HUEC 1ZLAB 1KX4A 1P3MC 5B0YB 1M1AA 4R8PA 1AOIA 3R45B 4XUJD 4ZUXC 4H9SA 3EPHA 3AZFD 3REHB 5E5AC 3WTPD 3UT9B 3AYWD 5DNND 2Y2IA 3REKB 3AZIC 4WU9C 1P3KC 4J8WC 1F66A 2NZDA 4CSRA 3O62D 4YS3A 1U35D 5CPKB 2BG1A 1TZYD 5AVBA 4H9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNM A;  3LZ0 B;  3KUY D;  3AZM C;  5B31 G;  5B1L C;  1P3A A;  4J8V C;  4ZBJ C;  1BH8 B;  1N1J A;  5B32 A;  2RVQ D;  5FUG A;  5B1M D;  4XUJ B;  5AV8 D;  5B31 C;  5F99 B;  1KX3 C;  3WTP B;  3LZ1 A;  1M19 C;  5DNN B;  3AV1 A;  4CAY A;  5GXQ A;  3AZN D;  5BO0 B;  3O62 B;  1ZLA A;  1U35 B;  3W98 D;  3AZK D;  4LD9 A;  5B0Y A;  1P3I C;  3R45 A;  4J8U D;  5BT1 D;  5AV5 A;  5AVC B;  3KUY B;  3X1U C;  3UT9 A;  3AZG D;  3REK A;  3X1S D;  1P3O C;  3MVD D;  3WKJ C;  5B1M B;  5B2I D;  5CPJ C;  5CPK A;  5AY8 B;  3AZL D;  5AV8 B;  2CWE A;  3LZ0 A;  5B33 C;  3W96 C;  3C1C D;  3AZN B;  3W98 B;  2NQB D;  2IO5 C;  3W97 D;  3B6F B;  4XUJ A;  3AN2 C;  2F8N H;  4J8U B;  4Z2M H;  4E45 A;  3AZF A;  2HIO B;  1P3F D;  3WTP A;  3C1B D;  3AYW A;  3KWQ C;  5DNN A;  3AZG B;  3MVD B;  5BO0 A;  3O62 A;  3AZE C;  1U35 A;  2ARO C;  3B0C T;  3AFA D;  3KXB D;  4R8P C;  3AZL B;  4YM6 D;  1TZY A;  5CPI D;  5AV9 D;  1TAF B;  3KUY A;  1P3L D;  5JRG C;  4WU8 D;  3NQU B;  4E44 A;  1F66 C;  5B24 C;  2NZD C;  5AV6 D;  3W97 B;  5B1M A;  1P3P C;  2CV5 C;  5AV8 A;  3B6G C;  1P3F B;  3C1B B;  1BH9 B;  3AZN A;  3W98 A;  5JA4 B;  3AFA B;  3AZK A;  3KXB B;  3WA9 B;  5CPI B;  5AV9 B;  4J8U A;  4JJN C;  3REI D;  4KGC D;  1P3L B;  3LZ1 C;  3AZG A;  3WAA C;  4EO5 B;  1P34 D;  2F8N K;  3X1S A;  5GXQ C;  2BYM B;  3MVD A;  1P3G C;  5AV6 B;  5B0Y C;  5B2I A;  5C3I C;  3AZL A;  2JSS A;  1TAF A;  1ULY A;  4XZQ D;  3REH C;  4NE6 A;  3C1C A;  1WWS A;  3UTA D;  2NQB A;  3REJ D;  3MGQ C;  5B0Z D;  3W97 A;  4AWL B;  3REI B;  1HQ3 C;  5B2J D;  3LZ0 C;  1P3F A;  3C1B A;  1P34 B;  1BH9 A;  3A6N D;  4WNN B;  2FJ7 C;  3AFA A;  3W99 C;  3LJA D;  3KXB A;  4YM6 A;  5CPI A;  5AV9 A;  1EQZ D;  5F99 C;  1P3L A;  4WU8 A;  4G91 B;  3B0D B;  3AV1 B;  5DNN C;  2YFW B;  2BYM A;  3REJ B;  5AV6 A;  1WWI A;  3AV2 C;  4LD9 B;  5G49 B;  4QLC D;  5GT3 D;  3MGP A;  4Z5T D;  5CP6 C;  3WTP E;  4J8X D;  3NQJ B;  5B2J B;  5AV5 B;  5AVC C;  3A6N B;  5B40 C;  4NE5 A;  3LJA B;  5GSU D;  2RVQ C;  5B1M C;  3VH6 W;  1Q9C A;  5AY8 C;  3REI A;  1BFM A;  4KGC A;  1P34 A;  3AZN C;  4WNN A;  2PYO D;  3AZH C;  3VH6 T;  5GT3 B;  4NFT A;  3TU4 C;  3B6F C;  4J8X B;  1KX5 D;  3KSY A;  3AZF B;  3MGS C;  4XZQ A;  2HIO C;  4KUD C;  3UTB C;  3X1V C;  3AYW B;  3AZG C;  2YFW A;  3UTA A;  1P3B C;  3REJ A;  3LEL C;  5B0Z A;  1P3M D;  5G49 A;  1TZY B;  4ZUX D;  3NQJ A;  5B2J A;  1HTA A;  5E5A D;  1S32 D;  3A6N A;  3MNN C;  4WU9 D;  1P3K D;  4J8W D;  3LJA A;  3B0B A;  3MGR D;  1KX5 B;  4WZS B;  1EQZ A;  3AZM D;  1ID3 C;  1M18 C;  5B1L D;  2HUE B;  4J8V D;  3AZK B;  1P3M B;  3AFA C;  4QLC A;  5GT3 A;  3WA9 C;  3B0C W;  4Z5T A;  3X1T C;  4ZUX B;  5CPI C;  4J8X A;  5AV9 C;  5E5A B;  1S32 B;  3VH5 T;  1P3L C;  1KX3 D;  1M19 D;  3AZJ C;  1H3O A;  3X1S B;  1P3K B;  4J8W B;  5GSU A;  1KX4 C;  5BNX B;  1M1A C;  5B2I B;  3MGR B;  1AOI C;  1R4V A;  4H9S C;  3C1C B;  3X1U D;  4Z66 D;  5B1L B;  5BS7 A;  4J8V B;  2PYO A;  2NQB B;  2YFV B;  1P3O D;  4YS3 C;  3WKJ D;  5B32 G;  4UUZ A;  3MGP D;  1KX5 A;  5AVB C;  1KU5 A;  3VH6 A;  5DNM C;  1KX3 B;  3W96 D;  1P3A C;  1P3M A;  5B32 C;  4YM6 B;  3AN2 D;  4ZUX A;  5E5A A;  4WU8 B;  3X1U B;  4Z66 B;  4G91 C;  1S32 A;  1F1E A;  3AV1 C;  4WU9 A;  1P3K A;  4J8W A;  3REJ C;  1ZLA C;  2ARO D;  5BNX A;  4LD9 C;  3MGP B;  3MGR A;  5GT0 D;  4H9O A;  5AV5 C;  3AZM A;  4NE3 A;  5JRG D;  3W96 B;  5B1L A;  3UT9 C;  3REK C;  4J8V A;  5B24 D;  2YFV A;  1P3P D;  2CV5 D;  5CPK C;  3B6G D;  4KGC B;  1KX3 A;  1M19 A;  4DRB A;  2ARO B;  3VH5 A;  3REL D;  4X23 D;  5GT0 B;  4XUJ C;  4JJN D;  4J8X C;  3AZF C;  4XZQ B;  3X1U A;  4Z66 A;  3WTP C;  3AYW C;  3WAA D;  5B24 B;  3UTA B;  1P3O A;  3O62 C;  1P3G D;  5B0Z B;  1U35 C;  3WKJ A;  4KHA B;  4G92 B;  1P3P B;  1TZY C;  3KUY C;  3REH D;  3W96 A;  5BS7 C;  4H9Q A;  1B67 A;  3REL B;  4X23 B;  3MGQ D;  4HGA B;  3AN2 A;  5AV8 C;  1HQ3 D;  1EQZ B;  2F8N D;  3AZE A;  1P3G B;  2FJ7 D;  2ARO A;  3W98 C;  3AZK C;  3W99 D;  4QLC B;  5C3I B;  4Z5T B;  5GT0 A;  4J8U C;  5BT1 C;  5F99 D;  5JRG A;  1S32 C;  1H3O B;  4WV4 B;  5B24 A;  3X1S C;  3MVD C;  3MGQ B;  5GSU B;  3AV2 D;  4KHA A;  5BNV B;  2CV5 A;  5B2I C;  1P3P A;  3AZL C;  3MGR C;  5CP6 D;  3B6G A;  1HQ3 B;  5AVC D;  2L5A A;  3C1C C;  5B40 D;  2F8N B;  3AZI D;  2FJ7 B;  2PYO B;  2NQB C;  3REL A;  4M6B A;  4X23 A;  3W99 B;  3W97 C;  4UUZ B;  5AY8 D;  4JJN A;  2BYK A;  1P3F C;  3C1B C;  3WAA A;  3VH5 W;  1P3G A;  3AV2 B;  3AZH D;  3KXB C;  3TU4 D;  5CP6 B;  4YM6 C;  3B6F D;  3MGS D;  4DRA A;  2HIO D;  5B31 D;  3REH A;  4KUD D;  4WU8 C;  5B40 B;  4Z66 C;  3UTB D;  3X1V D;  4WU9 B;  4EO5 C;  3AZI B;  1P3B D;  3MGQ A;  5KDM B;  5AV6 C;  3LEL D;  5BNV A;  1P3I D;  3MGP C;  1HQ3 A;  4H9O B;  3AZM B;  1JFI B;  3MNN D;  2F8N A;  2FJ7 A;  1A7W A;  4ZBJ B;  1BH8 A;  3AZH B;  3W99 A;  4AWL C;  3TU4 B;  5CPJ D;  4H9R B;  3MGS B;  3REI C;  5B31 B;  4KGC C;  5F99 A;  4KUD B;  5B33 D;  3UTB B;  3X1V B;  1M19 B;  1P34 C;  1ID3 D;  1M18 D;  1P3B B;  4H9N B;  3LEL B;  3AV2 A;  1P3I B;  3WA9 D;  5CP6 A;  5GT0 C;  3X1T D;  5AVC A;  4XZQ C;  5B40 A;  3MNN B;  3B0D C;  3KWQ D;  3AZJ D;  3AZI A;  3UTA C;  1P3O B;  3AZE D;  5KDM A;  5B0Z C;  1KX4 D;  3WKJ B;  1M1A D;  5CPJ B;  4G92 C;  4R8P D;  1AOI D;  5AY8 A;  3V9R B;  5B33 B;  5B2J C;  1ID3 B;  1JFI A;  1M18 B;  3A6N C;  4H9Q B;  1F66 D;  2NZD D;  3AZH A;  3REL C;  2IO5 B;  4X23 C;  4YS3 D;  4HGA C;  3LJA C;  3TU4 A;  3AN2 B;  3X1T B;  3B6F A;  4H9R A;  5AVB D;  3MGS A;  1B6W A;  2HIO A;  5B31 A;  5DNM D;  1EQZ C;  4KUD A;  3UTB A;  3X1V A;  3KWQ B;  3AZJ B;  1P3B A;  4H9N A;  1P3A D;  3AZE B;  3LEL A;  1KX4 B;  5B32 D;  1M1A B;  1P3I A;  4QLC C;  5GT3 C;  4R8P B;  1AOI B;  4Z5T C;  5JRG B;  3LZ1 D;  3MNN A;  3NQU A;  3AV1 D;  1F66 B;  5GXQ D;  2NZD B;  2F8N G;  1ZLA D;  4CSR B;  4Z2M G;  4YS3 B;  5GSU C;  4LD9 D;  5B0Y D;  5CPJ A;  2CV5 B;  3B6G B;  5AVB B;  4H9P B;  5DNM B;  3V9R A;  5B33 A;  5AV5 D;  1ID3 A;  1M18 A;  2LY8 A;  3UT9 D;  3REK D;  5CHL B;  1P3A B;  2PYO C;  5JA4 A;  1N1J B;  5B32 B;  3WA9 A;  5FUG B;  3X1T A;  5CPK D;  4JJN B;  2BYK B;  1KX5 C;  3LZ0 D;  3LZ1 B;  3KWQ A;  3AZJ A;  3WAA B;  4CAY B;  5GXQ B;  2HUE C;  1ZLA B;  1KX4 A;  1P3M C;  5B0Y B;  1M1A A;  4R8P A;  1AOI A;  3R45 B;  4XUJ D;  4ZUX C;  4H9S A;  3AZF D;  3REH B;  5E5A C;  3WTP D;  3UT9 B;  3AYW D;  5DNN D;  3REK B;  4WU9 C;  3AZI C;  1F66 A;  1P3K C;  4J8W C;  2NZD A;  4CSR A;  3O62 D;  4YS3 A;  1U35 D;  5CPK B;  1TZY D;  5AVB A;  4H9P A; 
#chains in the Genus database with same CATH topology
 5DNM A;  3LZ0 B;  3KUY D;  3AZM C;  5B31 G;  5B1L C;  1P3A A;  4J8V C;  4ZBJ C;  1BH8 B;  1N1J A;  5B32 A;  2RVQ D;  5FUG A;  5B1M D;  4XUJ B;  5AV8 D;  5B31 C;  5F99 B;  1KX3 C;  3WTP B;  3LZ1 A;  1M19 C;  5DNN B;  3AV1 A;  4CAY A;  5GXQ A;  3AZN D;  2ZY4 A;  5BO0 B;  3O62 B;  1ZLA A;  1U35 B;  3W98 D;  3AZK D;  4LD9 A;  5B0Y A;  1P3I C;  3R45 A;  4J8U D;  5BT1 D;  5AV5 A;  5AVC B;  3KUY B;  3X1U C;  3UT9 A;  3AZG D;  3REK A;  3X1S D;  1P3O C;  3MVD D;  3WKJ C;  5B1M B;  5B2I D;  5CPJ C;  5CPK A;  5AY8 B;  3AZL D;  5AV8 B;  2CWE A;  3LZ0 A;  5B33 C;  4WJ3 C;  2VQR A;  3W96 C;  3C1C D;  3AZN B;  3W98 B;  2NQB D;  2IO5 C;  3W97 D;  3B6F B;  4XUJ A;  3AN2 C;  2FFF B;  2F8N H;  4J8U B;  4Z2M H;  4E45 A;  3AZF A;  2HIO B;  1P3F D;  3WTP A;  3C1B D;  3AYW A;  3KWQ C;  5DNN A;  3AZG B;  3MVD B;  5BO0 A;  3O62 A;  3AZE C;  1U35 A;  2ARO C;  3B0C T;  3AFA D;  3KXB D;  4R8P C;  3AZL B;  4YM6 D;  1TZY A;  5CPI D;  5AV9 D;  1TAF B;  3KUY A;  1P3L D;  5JRG C;  4WU8 D;  3NQU B;  4E44 A;  1F66 C;  5B24 C;  2NZD C;  5AV6 D;  3W97 B;  5B1M A;  1P3P C;  2CV5 C;  2G5H C;  5AV8 A;  3B6G C;  1P3F B;  3C1B B;  1BH9 B;  3AZN A;  3W98 A;  2XD1 A;  5JA4 B;  3AFA B;  3AZK A;  1W2E A;  3KXB B;  3WA9 B;  2DQN C;  5CPI B;  5AV9 B;  4J8U A;  4JJN C;  3REI D;  4KGC D;  1P3L B;  3LZ1 C;  3AZG A;  3WAA C;  4EO5 B;  1P34 D;  2F8N K;  3X1S A;  5GXQ C;  2BYM B;  3MVD A;  1P3G C;  5AV6 B;  5B0Y C;  5B2I A;  2RIQ A;  5C3I C;  3AZL A;  2JSS A;  1TAF A;  1ULY A;  4XZQ D;  3REH C;  4NE6 A;  3C1C A;  1WWS A;  3A1K A;  3UTA D;  2NQB A;  3REJ D;  3MGQ C;  5B0Z D;  3W97 A;  4AWL B;  3REI B;  4UPK A;  1HQ3 C;  5B2J D;  3LZ0 C;  1P3F A;  3C1B A;  1P34 B;  1BH9 A;  3A6N D;  2DF4 C;  4WNN B;  2FJ7 C;  3AFA A;  3W99 C;  2XD5 A;  3KXB A;  3LJA D;  4YM6 A;  5CPI A;  5AV9 A;  1EQZ D;  5F99 C;  1P3L A;  4WU8 A;  4G91 B;  3B0D B;  3AV1 B;  5DNN C;  2YFW B;  2BYM A;  3REJ B;  5AV6 A;  1WWI A;  2ZY2 A;  3AV2 C;  4LD9 B;  5G49 B;  4QLC D;  5GT3 D;  3MGP A;  4Z5T D;  5CP6 C;  3WTP E;  4J8X D;  3NQJ B;  5B2J B;  5AV5 B;  5AVC C;  3A6N B;  5B40 C;  4NE5 A;  3LJA B;  5GSU D;  2RVQ C;  5B1M C;  3VH6 W;  1Q9C A;  5AY8 C;  3REI A;  1BFM A;  4KGC A;  1P34 A;  2J8P A;  3AZN C;  4WNN A;  2PYO D;  2G5I C;  3AZH C;  3VH6 T;  5GT3 B;  4NFT A;  3TU4 C;  3B6F C;  4J8X B;  2ZY5 A;  1KX5 D;  3KSY A;  3AZF B;  3MGS C;  4XZQ A;  2HIO C;  4KUD C;  3UTB C;  3X1V C;  3AYW B;  3AZG C;  2YFW A;  3UTA A;  1P3B C;  3REJ A;  3LEL C;  5B0Z A;  3AL0 C;  1P3M D;  5G49 A;  1TZY B;  4ZUX D;  3NQJ A;  5B2J A;  3H0L C;  1HTA A;  5E5A D;  1S32 D;  3A6N A;  3MNN C;  4WU9 D;  1P3K D;  4J8W D;  3H0M C;  3LJA A;  2Y2N A;  3B0B A;  3MGR D;  1KX5 B;  4WZS B;  1EQZ A;  3AZM D;  1ID3 C;  1M18 C;  5B1L D;  2HUE B;  4J8V D;  3AZK B;  1P3M B;  3AFA C;  4QLC A;  5GT3 A;  3WA9 C;  3B0C W;  4Z5T A;  3X1T C;  4ZUX B;  5CPI C;  4J8X A;  5AV9 C;  5E5A B;  1S32 B;  3VH5 T;  1P3L C;  1KX3 D;  1M19 D;  3AZJ C;  1H3O A;  3IP4 C;  3X1S B;  1P3K B;  4J8W B;  5GSU A;  1KX4 C;  5BNX B;  1M1A C;  5B2I B;  3MGR B;  1AOI C;  1R4V A;  4H9S C;  3C1C B;  3X1U D;  4Z66 D;  5B1L B;  3EPK A;  5BS7 A;  4J8V B;  2PYO A;  2NQB B;  2YFV B;  1P3O D;  4YS3 C;  3WKJ D;  5B32 G;  2ZM5 A;  2Y2O A;  4UUZ A;  3MGP D;  1T3U A;  1KX5 A;  5AVB C;  1KU5 A;  3VH6 A;  5DNM C;  1KX3 B;  3W96 D;  1P3A C;  3F6T A;  1P3M A;  5B32 C;  4YM6 B;  3AN2 D;  4ZUX A;  5E5A A;  4WU8 B;  3X1U B;  4Z66 B;  4G91 C;  1S32 A;  1F1E A;  3AV1 C;  4WU9 A;  1P3K A;  4J8W A;  3REJ C;  1ZLA C;  2ARO D;  5BNX A;  4LD9 C;  3MGP B;  3MGR A;  5GT0 D;  2JE5 A;  4H9O A;  5AV5 C;  3H0R C;  3AZM A;  4NE3 A;  5JRG D;  3W96 B;  5B1L A;  3UT9 C;  3REK C;  4J8V A;  5B24 D;  2YFV A;  2UWX A;  1P3P D;  2CV5 D;  5CPK C;  2F2A C;  3B6G D;  4KGC B;  1KX3 A;  1M19 A;  4DRB A;  2ARO B;  3VH5 A;  3REL D;  4X23 D;  5GT0 B;  3EPL A;  4XUJ C;  4JJN D;  4J8X C;  3KFU G;  3AZF C;  4XZQ B;  3X1U A;  4Z66 A;  3WTP C;  3AYW C;  3WAA D;  5B24 B;  3UTA B;  1P3O A;  2W8S A;  3O62 C;  5B0Z B;  1U35 C;  1P3G D;  3WKJ A;  4KHA B;  4G92 B;  1P3P B;  1TZY C;  3KUY C;  3REH D;  3W96 A;  2ZY3 A;  5BS7 C;  4H9Q A;  1B67 A;  3REL B;  4X23 B;  3MGQ D;  4HGA B;  3AN2 A;  5AV8 C;  2Y2Q A;  1HQ3 D;  1EQZ B;  1PZR A;  4DQY B;  2F8N D;  3AZE A;  1P3G B;  2FJ7 D;  2ARO A;  2Y2M A;  3W98 C;  3AZK C;  3W99 D;  4QLC B;  5C3I B;  4Z5T B;  5GT0 A;  4J8U C;  5BT1 C;  3A1I A;  5F99 D;  5JRG A;  1S32 C;  1H3O B;  2Y2L A;  4WV4 B;  5B24 A;  3X1S C;  3MVD C;  3MGQ B;  5GSU B;  3AV2 D;  4KHA A;  5BNV B;  2CV5 A;  5B2I C;  1P3P A;  3AZL C;  3MGR C;  5CP6 D;  3B6G A;  1HQ3 B;  5AVC D;  2L5A A;  3C1C C;  5B40 D;  2F8N B;  3AZI D;  2FJ7 B;  2PYO B;  2NQB C;  3REL A;  4M6B A;  4X23 A;  3W99 B;  3W97 C;  4UUZ B;  5AY8 D;  4JJN A;  2BYK A;  1P3F C;  3C1B C;  3WAA A;  3VH5 W;  1P3G A;  3AV2 B;  3AZH D;  3KXB C;  3TU4 D;  5CP6 B;  4YM6 C;  3B6F D;  3MGS D;  4DRA A;  2HIO D;  5B31 D;  3REH A;  4KUD D;  4WU8 C;  5B40 B;  4Z66 C;  3UTB D;  3X1V D;  4WU9 B;  4EO5 C;  3AZI B;  1P3B D;  3MGQ A;  5KDM B;  5AV6 C;  3LEL D;  5BNV A;  1P3I D;  3EPJ A;  3MGP C;  2Y2K A;  1HQ3 A;  3EG5 B;  4H9O B;  3AZM B;  1JFI B;  3MNN D;  2F8N A;  2FJ7 A;  1A7W A;  4ZBJ B;  1BH8 A;  3AZH B;  3W99 A;  4AWL C;  3TU4 B;  5CPJ D;  4H9R B;  3MGS B;  3REI C;  5B31 B;  4KGC C;  5F99 A;  4KUD B;  5B33 D;  3UTB B;  3X1V B;  1M19 B;  3FDD A;  1P34 C;  1ID3 D;  1M18 D;  1P3B B;  4H9N B;  2Y2H A;  3LEL B;  3AV2 A;  1P3I B;  3WA9 D;  5CP6 A;  5GT0 C;  3X1T D;  5AVC A;  4XZQ C;  5B40 A;  3MNN B;  3B0D C;  3KWQ D;  1Z2C B;  3AZI A;  3AZJ D;  3UTA C;  1P3O B;  3AZE D;  5KDM A;  5B0Z C;  1KX4 D;  3WKJ B;  1M1A D;  5CPJ B;  4G92 C;  4R8P D;  1AOI D;  5AY8 A;  3V9R B;  5B33 B;  5B2J C;  1ID3 B;  1JFI A;  1M18 B;  3A6N C;  4H9Q B;  1F66 D;  2NZD D;  3AZH A;  3REL C;  2IO5 B;  4X23 C;  4YS3 D;  4HGA C;  3LJA C;  3TU4 A;  3AN2 B;  3X1T B;  3B6F A;  4H9R A;  5AVB D;  3MGS A;  1B6W A;  2HIO A;  5B31 A;  5DNM D;  1EQZ C;  4KUD A;  3UTB A;  3X1V A;  3KWQ B;  3AZJ B;  1P3B A;  4H9N A;  1P3A D;  3AZE B;  3LEL A;  1KX4 B;  5B32 D;  1M1A B;  1P3I A;  4QLC C;  5GT3 C;  4R8P B;  2Y2J A;  1AOI B;  4Z5T C;  5JRG B;  3LZ1 D;  3MNN A;  3NQU A;  3AV1 D;  1F66 B;  5GXQ D;  2NZD B;  2F8N G;  1ZLA D;  4CSR B;  4Z2M G;  4YS3 B;  5GSU C;  4LD9 D;  5B0Y D;  5CPJ A;  2CV5 B;  3P5J B;  3B6G B;  5AVB B;  4H9P B;  5DNM B;  5AV5 D;  3V9R A;  5B33 A;  2JCH A;  1ID3 A;  1M18 A;  2LY8 A;  3UT9 D;  3REK D;  5CHL B;  1P3A B;  2PYO C;  5JA4 A;  1N1J B;  5B32 B;  3WA9 A;  5FUG B;  3X1T A;  5CPK D;  4JJN B;  2BYK B;  1KX5 C;  3LZ0 D;  2Y2P A;  3LZ1 B;  3KWQ A;  3AZJ A;  3WAA B;  4CAY B;  2Y2G A;  5GXQ B;  2HUE C;  1ZLA B;  1KX4 A;  1P3M C;  5B0Y B;  1M1A A;  4R8P A;  1AOI A;  3R45 B;  4XUJ D;  4ZUX C;  4H9S A;  3EPH A;  3AZF D;  3REH B;  5E5A C;  3WTP D;  3UT9 B;  3AYW D;  5DNN D;  2Y2I A;  3REK B;  3AZI C;  4WU9 C;  1P3K C;  4J8W C;  1F66 A;  2NZD A;  4CSR A;  3O62 D;  4YS3 A;  1U35 D;  5CPK B;  2BG1 A;  1TZY D;  5AVB A;  4H9P A; 
#chains in the Genus database with same CATH homology
 5DNM A;  3LZ0 B;  3KUY D;  3AZM C;  5B31 G;  5B1L C;  1P3A A;  4J8V C;  4ZBJ C;  1BH8 B;  1N1J A;  5B32 A;  2RVQ D;  5FUG A;  5B1M D;  4XUJ B;  5AV8 D;  5B31 C;  5F99 B;  1KX3 C;  3WTP B;  3LZ1 A;  1M19 C;  5DNN B;  3AV1 A;  4CAY A;  5GXQ A;  3AZN D;  2ZY4 A;  5BO0 B;  3O62 B;  1ZLA A;  1U35 B;  3W98 D;  3AZK D;  4LD9 A;  5B0Y A;  1P3I C;  3R45 A;  4J8U D;  5BT1 D;  5AV5 A;  5AVC B;  3KUY B;  3X1U C;  3UT9 A;  3AZG D;  3REK A;  3X1S D;  1P3O C;  3MVD D;  3WKJ C;  5B1M B;  5B2I D;  5CPJ C;  5CPK A;  5AY8 B;  3AZL D;  5AV8 B;  2CWE A;  3LZ0 A;  5B33 C;  4WJ3 C;  2VQR A;  3W96 C;  3C1C D;  3AZN B;  3W98 B;  2NQB D;  2IO5 C;  3W97 D;  3B6F B;  4XUJ A;  3AN2 C;  2FFF B;  2F8N H;  4J8U B;  4Z2M H;  4E45 A;  3AZF A;  2HIO B;  1P3F D;  3WTP A;  3C1B D;  3AYW A;  3KWQ C;  5DNN A;  3AZG B;  3MVD B;  5BO0 A;  3O62 A;  3AZE C;  1U35 A;  2ARO C;  3B0C T;  3AFA D;  3KXB D;  4R8P C;  3AZL B;  4YM6 D;  1TZY A;  5CPI D;  5AV9 D;  1TAF B;  3KUY A;  1P3L D;  5JRG C;  4WU8 D;  3NQU B;  4E44 A;  1F66 C;  5B24 C;  2NZD C;  5AV6 D;  3W97 B;  5B1M A;  1P3P C;  2CV5 C;  2G5H C;  5AV8 A;  3B6G C;  1P3F B;  3C1B B;  1BH9 B;  3AZN A;  3W98 A;  2XD1 A;  5JA4 B;  3AFA B;  3AZK A;  1W2E A;  3KXB B;  3WA9 B;  2DQN C;  5CPI B;  5AV9 B;  4J8U A;  4JJN C;  3REI D;  4KGC D;  1P3L B;  3LZ1 C;  3AZG A;  3WAA C;  4EO5 B;  1P34 D;  2F8N K;  3X1S A;  5GXQ C;  2BYM B;  3MVD A;  1P3G C;  5AV6 B;  5B0Y C;  5B2I A;  2RIQ A;  5C3I C;  3AZL A;  2JSS A;  1TAF A;  1ULY A;  4XZQ D;  3REH C;  4NE6 A;  3C1C A;  1WWS A;  3A1K A;  3UTA D;  2NQB A;  3REJ D;  3MGQ C;  5B0Z D;  3W97 A;  4AWL B;  3REI B;  4UPK A;  1HQ3 C;  5B2J D;  3LZ0 C;  1P3F A;  3C1B A;  1P34 B;  1BH9 A;  3A6N D;  2DF4 C;  4WNN B;  2FJ7 C;  3AFA A;  3W99 C;  2XD5 A;  3KXB A;  3LJA D;  4YM6 A;  5CPI A;  5AV9 A;  1EQZ D;  5F99 C;  1P3L A;  4WU8 A;  4G91 B;  3B0D B;  3AV1 B;  5DNN C;  2YFW B;  2BYM A;  3REJ B;  5AV6 A;  1WWI A;  2ZY2 A;  3AV2 C;  4LD9 B;  5G49 B;  4QLC D;  5GT3 D;  3MGP A;  4Z5T D;  5CP6 C;  3WTP E;  4J8X D;  3NQJ B;  5B2J B;  5AV5 B;  5AVC C;  3A6N B;  5B40 C;  4NE5 A;  3LJA B;  5GSU D;  2RVQ C;  5B1M C;  3VH6 W;  1Q9C A;  5AY8 C;  3REI A;  1BFM A;  4KGC A;  1P34 A;  2J8P A;  3AZN C;  4WNN A;  2PYO D;  2G5I C;  3AZH C;  3VH6 T;  5GT3 B;  4NFT A;  3TU4 C;  3B6F C;  4J8X B;  2ZY5 A;  1KX5 D;  3KSY A;  3AZF B;  3MGS C;  4XZQ A;  2HIO C;  4KUD C;  3UTB C;  3X1V C;  3AYW B;  3AZG C;  2YFW A;  3UTA A;  1P3B C;  3REJ A;  3LEL C;  5B0Z A;  3AL0 C;  1P3M D;  5G49 A;  1TZY B;  4ZUX D;  3NQJ A;  5B2J A;  3H0L C;  1HTA A;  5E5A D;  1S32 D;  3A6N A;  3MNN C;  4WU9 D;  1P3K D;  4J8W D;  3H0M C;  3LJA A;  2Y2N A;  3B0B A;  3MGR D;  1KX5 B;  4WZS B;  1EQZ A;  3AZM D;  1ID3 C;  1M18 C;  5B1L D;  2HUE B;  4J8V D;  3AZK B;  1P3M B;  3AFA C;  4QLC A;  5GT3 A;  3WA9 C;  3B0C W;  4Z5T A;  3X1T C;  4ZUX B;  5CPI C;  4J8X A;  5AV9 C;  5E5A B;  1S32 B;  3VH5 T;  1P3L C;  1KX3 D;  1M19 D;  3AZJ C;  1H3O A;  3IP4 C;  3X1S B;  1P3K B;  4J8W B;  5GSU A;  1KX4 C;  5BNX B;  1M1A C;  5B2I B;  3MGR B;  1AOI C;  1R4V A;  4H9S C;  3C1C B;  3X1U D;  4Z66 D;  5B1L B;  3EPK A;  5BS7 A;  4J8V B;  2PYO A;  2NQB B;  2YFV B;  1P3O D;  4YS3 C;  3WKJ D;  5B32 G;  2ZM5 A;  2Y2O A;  4UUZ A;  3MGP D;  1T3U A;  1KX5 A;  5AVB C;  1KU5 A;  3VH6 A;  5DNM C;  1KX3 B;  3W96 D;  1P3A C;  3F6T A;  1P3M A;  5B32 C;  4YM6 B;  3AN2 D;  4ZUX A;  5E5A A;  4WU8 B;  3X1U B;  4Z66 B;  4G91 C;  1S32 A;  1F1E A;  3AV1 C;  4WU9 A;  1P3K A;  4J8W A;  3REJ C;  1ZLA C;  2ARO D;  5BNX A;  4LD9 C;  3MGP B;  3MGR A;  5GT0 D;  2JE5 A;  4H9O A;  5AV5 C;  3H0R C;  3AZM A;  4NE3 A;  5JRG D;  3W96 B;  5B1L A;  3UT9 C;  3REK C;  4J8V A;  5B24 D;  2YFV A;  2UWX A;  1P3P D;  2CV5 D;  5CPK C;  2F2A C;  3B6G D;  4KGC B;  1KX3 A;  1M19 A;  4DRB A;  2ARO B;  3VH5 A;  3REL D;  4X23 D;  5GT0 B;  3EPL A;  4XUJ C;  4JJN D;  4J8X C;  3KFU G;  3AZF C;  4XZQ B;  3X1U A;  4Z66 A;  3WTP C;  3AYW C;  3WAA D;  5B24 B;  3UTA B;  1P3O A;  2W8S A;  3O62 C;  5B0Z B;  1U35 C;  1P3G D;  3WKJ A;  4KHA B;  4G92 B;  1P3P B;  1TZY C;  3KUY C;  3REH D;  3W96 A;  2ZY3 A;  5BS7 C;  4H9Q A;  1B67 A;  3REL B;  4X23 B;  3MGQ D;  4HGA B;  3AN2 A;  5AV8 C;  2Y2Q A;  1HQ3 D;  1EQZ B;  1PZR A;  4DQY B;  2F8N D;  3AZE A;  1P3G B;  2FJ7 D;  2ARO A;  2Y2M A;  3W98 C;  3AZK C;  3W99 D;  4QLC B;  5C3I B;  4Z5T B;  5GT0 A;  4J8U C;  5BT1 C;  3A1I A;  5F99 D;  5JRG A;  1S32 C;  1H3O B;  2Y2L A;  4WV4 B;  5B24 A;  3X1S C;  3MVD C;  3MGQ B;  5GSU B;  3AV2 D;  4KHA A;  5BNV B;  2CV5 A;  5B2I C;  1P3P A;  3AZL C;  3MGR C;  5CP6 D;  3B6G A;  1HQ3 B;  5AVC D;  2L5A A;  3C1C C;  5B40 D;  2F8N B;  3AZI D;  2FJ7 B;  2PYO B;  2NQB C;  3REL A;  4M6B A;  4X23 A;  3W99 B;  3W97 C;  4UUZ B;  5AY8 D;  4JJN A;  2BYK A;  1P3F C;  3C1B C;  3WAA A;  3VH5 W;  1P3G A;  3AV2 B;  3AZH D;  3KXB C;  3TU4 D;  5CP6 B;  4YM6 C;  3B6F D;  3MGS D;  4DRA A;  2HIO D;  5B31 D;  3REH A;  4KUD D;  4WU8 C;  5B40 B;  4Z66 C;  3UTB D;  3X1V D;  4WU9 B;  4EO5 C;  3AZI B;  1P3B D;  3MGQ A;  5KDM B;  5AV6 C;  3LEL D;  5BNV A;  1P3I D;  3EPJ A;  3MGP C;  2Y2K A;  1HQ3 A;  3EG5 B;  4H9O B;  3AZM B;  1JFI B;  3MNN D;  2F8N A;  2FJ7 A;  1A7W A;  4ZBJ B;  1BH8 A;  3AZH B;  3W99 A;  4AWL C;  3TU4 B;  5CPJ D;  4H9R B;  3MGS B;  3REI C;  5B31 B;  4KGC C;  5F99 A;  4KUD B;  5B33 D;  3UTB B;  3X1V B;  1M19 B;  3FDD A;  1P34 C;  1ID3 D;  1M18 D;  1P3B B;  4H9N B;  2Y2H A;  3LEL B;  3AV2 A;  1P3I B;  3WA9 D;  5CP6 A;  5GT0 C;  3X1T D;  5AVC A;  4XZQ C;  5B40 A;  3MNN B;  3B0D C;  3KWQ D;  1Z2C B;  3AZI A;  3AZJ D;  3UTA C;  1P3O B;  3AZE D;  5KDM A;  5B0Z C;  1KX4 D;  3WKJ B;  1M1A D;  5CPJ B;  4G92 C;  4R8P D;  1AOI D;  5AY8 A;  3V9R B;  5B33 B;  5B2J C;  1ID3 B;  1JFI A;  1M18 B;  3A6N C;  4H9Q B;  1F66 D;  2NZD D;  3AZH A;  3REL C;  2IO5 B;  4X23 C;  4YS3 D;  4HGA C;  3LJA C;  3TU4 A;  3AN2 B;  3X1T B;  3B6F A;  4H9R A;  5AVB D;  3MGS A;  1B6W A;  2HIO A;  5B31 A;  5DNM D;  1EQZ C;  4KUD A;  3UTB A;  3X1V A;  3KWQ B;  3AZJ B;  1P3B A;  4H9N A;  1P3A D;  3AZE B;  3LEL A;  1KX4 B;  5B32 D;  1M1A B;  1P3I A;  4QLC C;  5GT3 C;  4R8P B;  2Y2J A;  1AOI B;  4Z5T C;  5JRG B;  3LZ1 D;  3MNN A;  3NQU A;  3AV1 D;  1F66 B;  5GXQ D;  2NZD B;  2F8N G;  1ZLA D;  4CSR B;  4Z2M G;  4YS3 B;  5GSU C;  4LD9 D;  5B0Y D;  5CPJ A;  2CV5 B;  3P5J B;  3B6G B;  5AVB B;  4H9P B;  5DNM B;  5AV5 D;  3V9R A;  5B33 A;  2JCH A;  1ID3 A;  1M18 A;  2LY8 A;  3UT9 D;  3REK D;  5CHL B;  1P3A B;  2PYO C;  5JA4 A;  1N1J B;  5B32 B;  3WA9 A;  5FUG B;  3X1T A;  5CPK D;  4JJN B;  2BYK B;  1KX5 C;  3LZ0 D;  2Y2P A;  3LZ1 B;  3KWQ A;  3AZJ A;  3WAA B;  4CAY B;  2Y2G A;  5GXQ B;  2HUE C;  1ZLA B;  1KX4 A;  1P3M C;  5B0Y B;  1M1A A;  4R8P A;  1AOI A;  3R45 B;  4XUJ D;  4ZUX C;  4H9S A;  3EPH A;  3AZF D;  3REH B;  5E5A C;  3WTP D;  3UT9 B;  3AYW D;  5DNN D;  2Y2I A;  3REK B;  3AZI C;  4WU9 C;  1P3K C;  4J8W C;  1F66 A;  2NZD A;  4CSR A;  3O62 D;  4YS3 A;  1U35 D;  5CPK B;  2BG1 A;  1TZY D;  5AVB A;  4H9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...