4ZUXD

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
b'KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Hydrolase/dna
total genus 37
structure length 95
sequence length 95
chains with identical sequence H, N, R
ec nomenclature
pdb deposition date 2015-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zuxD00
1P3MA 3W99A 5GT0C 5AV9A 4HGAB 5AV6C 5CPKB 3MNNB 1P3OD 4Z5TA 3VH6T 4R8PB 5B31C 1M19C 2YFWB 2LY8A 3V9RA 3MVDD 5DNMB 1U35C 5CPJA 1P3GC 3LJAD 3C1BB 5B1MD 3AZIA 1EQZA 3AZFD 3B0CT 5GT0B 3W97C 5GSUD 5AV6B 5FUGA 5B0ZD 4KGCA 3REHC 1BH8A 1ID3D 3MGPC 2AROD 5BS7A 5AV5D 3MNND 1M19B 5JA4A 3NQJA 3AN2C 3WTPE 4WNNA 5B24C 5CPIC 3LELA 5CPKD 1P3GB 3MGRA 1TZYA 3WKJA 4R8PD 3AZGC 2F8NA 5B1LC 3W97B 1S32C 5DNMD 3REHB 2F8NH 3X1TA 3C1BD 3UTBA 3W96A 3AN2B 5GT0D 3R45A 1P34C 5B24B 5AV6D 3AZHC 5CPIB 5AY8C 3X1SA 3X1UB 1KX4A 4XUJA 4QLCC 5CP6C 1P3IA 1ZLAC 5AVCC 4H9SA 3AZGB 3REJC 5B1LB 1M19D 4H9RA 1S32B 3KSYA 3TU4C 1P3GD 1N1JA 3AZKC 1P34B 3W97D 4JJNA 3AZHB 4EO5C 5G49A 4WV4B 2JSSA 5BT1D 5AY8B 5JRGC 5CP6B 5E5AB 4WZSB 4QLCB 3REHD 1M1AA 1ZLAB 5AVCB 3RELC 5C3IC 2RVQC 3REJB 3X1VB 3AN2D 1P3BC 5B24D 2NQBC 5CPID 3TU4B 4WU8A 3LZ0C 3X1UD 4J8VA 3MGSA 3WAAC 3AZGD 3AZKB 5B1LD 1P3LB 3MGQC 1P3AA 4EO5B 3AYWA 5JRGB 1F66C 5CHLB 4J8UC 4LD9B 5B32C 3RELB 1AOIC 5C3IB 1P3PA 3REIC 1P3BB 1P34D 1HQ3A 3KXBC 3AZHD 2NQBB 3KWQC 3LZ0B 5AY8D 1ZLAD 4QLCD 5E5AD 3AZNA 1M18A 5AVCD 3WAAB 4NFTA 3REJD 3X1VD 3MGQB 1BH9B 4H9NB 1P3PC 3WA9A 3TU4D 1F66B 4J8UB 3KUYA 5B32B 5GSUA 1AOIB 3B6GC 1KX5D 4KHAA 3AZKD 5AV8C 2AROA 1P3LD 3KXBB 5AV5A 3KWQB 3UT9A 5GT3C 4X23C 5JRGD 5B2IA 4J8XC 4LD9D 1P3KC 4ZUXD 3RELD 3AV2C 3UTAC 2RVQD 3C1CC 1P3BD 3A6NA 5AVBA 2NQBD 1P3FC 1H3OA 1TAFB 3LZ0D 2YFWA 5DNNA 3AZEA 5F99C 3B6GB 5B2JC 4G91C 3WTPC 5B33C 3WAAD 2HUEC 5AV8B 3MGQD 3AV1A 5GT3B 3VH5W 3REKB 4CAYB 5GXQC 1F66D 4J8UD 4H9PA 5B40B 5B32D 1P3KB 1AOID 5BNVB 3UTAB 3W99C 5AV9C 1P3MC 3C1CB 3W98A 2CWEA 2HIOB 1KX3A 3KXBD 3KWQD 1P3FB 3NQUA 3VH6A 4Z5TC 5F99B 3O62A 3LZ1A 4G91B 4J8WA 2HUEB 5CPJC 5GXQB 5B31B 4KUDA 2FJ7A 3AZIC 3B6GD 1EQZC 1P3MB 1U35B 3W99B 5AV9B 4G92C 4WU9A 3LZ1C 5AV8D 4KGCC 5GT3D 4Z5TB 5BS7C 4YM6A 3REKD 4YS3A 4CSRA 2NZDA 5B40D 4H9QB 1P3KD 3AFAA 3UTAD 3C1CD 3MGPB 3X1UA 3V9RB 2HIOD 3LELC 5CPJB 3MGRC 1TZYC 5B0YA 1KU5A 1P3FD 3AZLA 3WKJC 4H9OA 5F99D 3AZIB 3B6FA 4G92B 3AZJA 5FUGB 4KGCB 1BH8B 5GXQD 5B31D 4XZQA 3X1TC 3UTBC 3W96C 5JA4B 3NQJB 1P3MD 1U35D 3W99D 4WNNB 5AV9D 5BNXA 3B6FC 5E5AA 3LELB 4E44A 1TZYB 3MGRB 4XUJC 3X1SC 1P3IC 1KX4C 3WKJB 4Z5TD 3X1VA 4ZBJC 4H9SC 2F8NB 3MGPD 5CPJD 1KX5A 3X1TB 4Z66A 3UTBB 3AZMA 2PYOA 1P3LA 3W96B 3AZID 2CV5A 4NE6A 4JJNC 2BYMB 4KGCD 4LD9A 3X1SB 1KX4B 4XUJB 4ZUXA 1P3IB 1M1AC 1S32D 1ULYA 4H9RB 3LELD 4WU8C 2BYKA 3MGRD 1TZYD 4J8VC 3MGSC 1P3OA 1N1JB 2F8ND 1P3AC 4JJNB 5CP6D 5G49B 3AYWC 5KDMB 3MVDA 1M1AB 3X1TD 3UTBD 3W96D 3LJAA 4Z2MH 4Z2MG 5B32G 5B1MA 1HQ3C 3AZFA 4WU8B 3X1SD 4XUJD 3AZNC 3REIB 5B0ZA 4J8VB 3MGSB 1P3ID 1M18C 1ID3A 4UUZB 2YFVA 1P3AB 3WA9C 3MNNA 3AYWB 3KUYC 5CPKA 5GSUC 1WWIA 1P3PB 2AROC 1HQ3B 4JJND 4R8PA 4CAYA 3REKA 5AV5C 3UT9C 5B40A 5B2IC 3AZNB 5DNMA 5BNVA 1M18B 2HIOA 5CPKC 2F8NK 3C1BA 4X23B 3WA9B 3A6NC 5AVBC 5GT0A 4J8XB 5AV6A 5DNNC 3KUYB 3AV2B 3REID 4J8VD 3AZEC 3MGSD 2AROB 1P3AD 3AV1C 1JFIB 5B31A 1M19A 3UT9B 3AYWD 5B2JB 5B2IB 3WTPB 5B33B 1U35A 5B31G 1P3GA 4NE3A 1P3PD 3W98C 3A6NB 1KX3C 1HQ3D 4AWLC 5AVBB 3VH6W 3W97A 1H3OB 4NE5A 5BO0B 5DNNB 4H9QA 3AZND 3AZEB 3O62C 3REHA 1M18D 3MGPA 4J8WC 3AV1B 4X23D 3WA9D 3AN2A 1A7WA 1HTAA 3B0CW 4J8XD 4KUDC 5B24A 3KUYD 3AV2D 5CPIA 4H9PB 2FJ7C 3W98B 4WU9C 5BT1C 1KX3B 4AWLB 3AZGA 5B1LA 3UT9D 3NQUB 4YS3C 5B2JD 4YM6C 1EQZB 5B2ID 1S32A 5B33D 3WTPD 3O62B 3LZ1B 2NZDC 4J8WB 3AFAC 3X1UC 3A6ND 5AVBD 5B0YC 1P34A 4KUDB 3AZLC 3AZHA 5DNND 3AZED 2FJ7B 5AY8A 1ZLAA 4QLCA 5CP6A 4WU9B 3AZJC 5AVCA 3AV1D 2F8NG 3REJA 4YS3B 4XZQC 4YM6B 3B0BA 4CSRB 2NZDB 3TU4A 2BYMA 3AFAB 3W98D 4DRBA 5E5AC 1KX3D 3AZKA 5B0YB 3AZLB 3X1VC 1EQZD 1B67A 4H9OB 3R45B 3O62D 3LZ1D 5JRGA 3B6FB 4J8WD 3AZJB 3RELA 1R4VA 1P3BA 1KX5C 4ZBJB 4XZQB 4KUDD 4Z66C 3AZMC 2PYOC 1P3LC 2NQBA 2FJ7D 3LZ0A 2CV5C 4WU9D 5KDMA 5BNXB 3WKJD 3WAAA 4LD9C 3MGQA 1BH9A 4ZUXC 4H9NA 4YS3D 4YM6D 1B6WA 2NZDD 1F66A 4J8UA 3AFAD 5B32A 1AOIA 3REIA 1KX5B 5B0YD 4UUZA 3AZLD 4Z66B 3KXBA 3AZMB 2PYOB 3KWQA 1P3OC 3B6FD 2CV5B 1F1EA 3AZJD 1KX4D 4DRAA 1WWSA 4ZUXB 3MVDC 4XZQD 3LJAC 1TAFA 5B1MC 3B6GA 3AZFC 2BYKB 5AV8A 5B0ZC 2IO5C 1P3OB 1ID3C 5GT3A 4X23A 3B0DC 2L5AA 3MNNC 4J8XA 1P3KA 3AV2A 3UTAA 1M1AD 3C1CA 1Q9CA 4HGAC 3MVDB 4Z66D 3AZMD 2PYOD 3LJAB 1P3FA 1JFIA 4E45A 3VH5T 5B1MB 2CV5D 5F99A 4WU8D 4R8PC 5B2JA 3REKC 3AZFB 1BFMA 5B33A 3WTPA 5GSUB 5B40C 4KHAB 2IO5B 5DNMC 5B0ZB 1ID3B 2HIOC 5GXQA 2YFVB 4M6BA 5AV5B 3C1BC 3VH5A 3B0DB 5BO0A
chains in the Genus database with same CATH superfamily
1P3MA 3W99A 5GT0C 5AV9A 4HGAB 5AV6C 5CPKB 3MNNB 1P3OD 4Z5TA 3VH6T 4R8PB 5B31C 1M19C 2YFWB 2ZY4A 2LY8A 3V9RA 3MVDD 5DNMB 1U35C 5CPJA 1P3GC 3LJAD 3C1BB 2JE5A 4UPKA 5B1MD 3AZIA 1EQZA 3AZFD 3B0CT 5GT0B 3W97C 5GSUD 5AV6B 5FUGA 5B0ZD 4KGCA 3REHC 1BH8A 1ID3D 3MGPC 2AROD 5BS7A 5AV5D 3MNND 1M19B 5JA4A 3NQJA 3AN2C 3WTPE 3P5JB 4WNNA 5B24C 5CPIC 3LELA 5CPKD 1P3GB 3MGRA 1TZYA 3WKJA 3EG5B 4R8PD 3AZGC 2F8NA 5B1LC 2F2AC 3W97B 1S32C 5DNMD 3REHB 2F8NH 3X1TA 3C1BD 3UTBA 3W96A 3AN2B 5GT0D 3R45A 1P34C 5B24B 5AV6D 3AZHC 5CPIB 5AY8C 3X1SA 3X1UB 1KX4A 4XUJA 4QLCC 5CP6C 1P3IA 1ZLAC 5AVCC 4H9SA 3AZGB 3REJC 5B1LB 1M19D 4H9RA 2XD5A 3KSYA 1S32B 3TU4C 1P3GD 1N1JA 3AZKC 2DQNC 3IP4C 1P34B 3W97D 4JJNA 3AZHB 4EO5C 5G49A 4WV4B 5AY8B 2JSSA 5BT1D 5JRGC 5CP6B 5E5AB 4WZSB 4QLCB 3REHD 1M1AA 1ZLAB 5AVCB 3RELC 5C3IC 2RVQC 3REJB 3X1VB 3AN2D 1P3BC 2Y2OA 5B24D 2NQBC 5CPID 3TU4B 4WU8A 3LZ0C 2Y2LA 3X1UD 4J8VA 3MGSA 3WAAC 3AZGD 3AZKB 5B1LD 1P3LB 3MGQC 1P3AA 2BG1A 4EO5B 3AYWA 5JRGB 1F66C 5CHLB 4J8UC 4LD9B 5B32C 3RELB 1AOIC 5C3IB 2VQRA 3REIC 1Z2CB 1P3PA 1P3BB 2JCHA 1P34D 1HQ3A 3KXBC 3AZHD 2NQBB 3KWQC 3LZ0B 5AY8D 1ZLAD 4QLCD 5E5AD 3AZNA 1M18A 5AVCD 3WAAB 4NFTA 3REJD 3X1VD 3MGQB 1BH9B 4H9NB 1P3PC 3WA9A 3TU4D 1F66B 4J8UB 3KUYA 5B32B 5GSUA 1AOIB 3B6GC 1KX5D 4KHAA 3FDDA 3AZKD 5AV8C 2AROA 1P3LD 3KXBB 5AV5A 3KWQB 3UT9A 5GT3C 4X23C 5JRGD 5B2IA 4J8XC 4LD9D 1P3KC 2Y2GA 4ZUXD 3RELD 3AV2C 3UTAC 2RVQD 3C1CC 1P3BD 3A6NA 2FFFB 5AVBA 2NQBD 1P3FC 1H3OA 1TAFB 3LZ0D 2YFWA 5DNNA 3AZEA 5F99C 3B6GB 5B2JC 4G91C 3WTPC 5B33C 3WAAD 2HUEC 5AV8B 3A1IA 3MGQD 3AV1A 5GT3B 3VH5W 2RIQA 4CAYB 5GXQC 3REKB 1F66D 4J8UD 4H9PA 5B40B 4WJ3C 5B32D 1P3KB 1AOID 5BNVB 3UTAB 3W99C 5AV9C 1P3MC 3C1CB 3W98A 2CWEA 2HIOB 1KX3A 3KXBD 3KWQD 1P3FB 3NQUA 3VH6A 4Z5TC 5F99B 3O62A 3LZ1A 4G91B 4J8WA 2HUEB 5CPJC 5GXQB 5B31B 4KUDA 2FJ7A 3AZIC 3B6GD 1EQZC 1P3MB 1U35B 3W99B 5AV9B 4G92C 4WU9A 3LZ1C 5AV8D 4KGCC 5GT3D 4Z5TB 5BS7C 4YM6A 2Y2PA 3REKD 4YS3A 4CSRA 2NZDA 5B40D 4H9QB 3H0LC 1P3KD 3AFAA 3UTAD 3C1CD 3MGPB 3V9RB 2HIOD 2Y2JA 3X1UA 3LELC 5CPJB 3MGRC 1TZYC 5B0YA 1KU5A 1P3FD 3AZLA 3WKJC 4H9OA 5F99D 2ZM5A 3AZIB 3B6FA 4G92B 2J8PA 3AZJA 5FUGB 4KGCB 1BH8B 3KFUG 5GXQD 5B31D 4XZQA 3X1TC 3UTBC 3W96C 5JA4B 3NQJB 1P3MD 1U35D 3W99D 4WNNB 5AV9D 5BNXA 3B6FC 5E5AA 3LELB 4E44A 1TZYB 3MGRB 4XUJC 3X1SC 1P3IC 1KX4C 3WKJB 4Z5TD 3X1VA 4ZBJC 4H9SC 2F8NB 3MGPD 5CPJD 1KX5A 3X1TB 4Z66A 3UTBB 3AZMA 2PYOA 1P3LA 3W96B 3AZID 2CV5A 4NE6A 4JJNC 2BYMB 4KGCD 4LD9A 3X1SB 1KX4B 4XUJB 4ZUXA 1P3IB 1M1AC 1S32D 1PZRA 1ULYA 4H9RB 3LELD 4WU8C 2BYKA 3MGRD 1TZYD 4J8VC 3MGSC 1P3OA 1N1JB 2F8ND 1P3AC 2G5IC 4JJNB 5CP6D 5G49B 3AYWC 5KDMB 3MVDA 2G5HC 1M1AB 3X1TD 3UTBD 3W96D 3LJAA 4Z2MH 4Z2MG 5B32G 5B1MA 1HQ3C 3AZFA 4WU8B 3AL0C 3X1SD 2Y2HA 4XUJD 3AZNC 3REIB 5B0ZA 4J8VB 3MGSB 1P3ID 1M18C 1ID3A 4UUZB 2ZY2A 2YFVA 1P3AB 3WA9C 3MNNA 3AYWB 3KUYC 1T3UA 5CPKA 5GSUC 1WWIA 1P3PB 2AROC 1HQ3B 4JJND 4R8PA 4CAYA 3REKA 5AV5C 3UT9C 5B40A 5B2IC 3AZNB 5DNMA 5BNVA 1M18B 2HIOA 5CPKC 2F8NK 3C1BA 4X23B 3EPKA 3A6NC 3WA9B 5AVBC 5GT0A 4J8XB 5AV6A 5DNNC 3KUYB 3AV2B 3REID 4J8VD 3AZEC 3MGSD 2AROB 1P3AD 3AV1C 1JFIB 1W2EA 5B31A 1M19A 3A1KA 3UT9B 3AYWD 5B2JB 5B2IB 3WTPB 5B33B 1U35A 5B31G 1P3GA 4NE3A 1P3PD 3W98C 3A6NB 1KX3C 1HQ3D 4AWLC 5AVBB 3VH6W 3W97A 1H3OB 4NE5A 5BO0B 5DNNB 4H9QA 3AZND 3AZEB 3O62C 3REHA 1M18D 3MGPA 4J8WC 3EPJA 3AV1B 4X23D 3WA9D 3AN2A 1A7WA 1HTAA 3B0CW 4J8XD 4KUDC 5B24A 3KUYD 3AV2D 5CPIA 4H9PB 2FJ7C 3W98B 4DQYB 4WU9C 5BT1C 1KX3B 4AWLB 3AZGA 5B1LA 2UWXA 3UT9D 3NQUB 2Y2IA 4YS3C 5B2JD 4YM6C 1EQZB 5B2ID 1S32A 5B33D 3WTPD 3O62B 3LZ1B 2NZDC 2Y2QA 4J8WB 3AFAC 2Y2NA 2W8SA 3X1UC 3A6ND 5AVBD 5B0YC 2ZY3A 1P34A 4KUDB 3AZLC 3H0RC 3AZHA 5DNND 3AZED 2FJ7B 5AY8A 1ZLAA 4QLCA 5CP6A 3F6TA 4WU9B 3AZJC 5AVCA 3AV1D 2F8NG 3REJA 4YS3B 4XZQC 4YM6B 2XD1A 3B0BA 4CSRB 2DF4C 3TU4A 2NZDB 2BYMA 3AFAB 3W98D 4DRBA 5E5AC 1KX3D 3AZKA 5B0YB 3AZLB 3X1VC 1EQZD 1B67A 4H9OB 3R45B 3O62D 3LZ1D 5JRGA 3B6FB 4J8WD 3AZJB 3RELA 1R4VA 1P3BA 1KX5C 4ZBJB 4XZQB 4KUDD 4Z66C 3AZMC 2PYOC 3EPHA 1P3LC 2NQBA 2FJ7D 3H0MC 3LZ0A 2CV5C 3EPLA 2Y2KA 4WU9D 5KDMA 5BNXB 3WKJD 3WAAA 4LD9C 3MGQA 1BH9A 4ZUXC 4H9NA 4YS3D 4YM6D 1B6WA 2NZDD 1F66A 4J8UA 3AFAD 5B32A 1AOIA 3REIA 1KX5B 5B0YD 4UUZA 3AZLD 4Z66B 3KXBA 3AZMB 2PYOB 3KWQA 1P3OC 3B6FD 2CV5B 1F1EA 3AZJD 1KX4D 4DRAA 1WWSA 4ZUXB 3MVDC 2ZY5A 4XZQD 3LJAC 1TAFA 5B1MC 3B6GA 3AZFC 2BYKB 5AV8A 5B0ZC 2IO5C 1P3OB 1ID3C 5GT3A 4X23A 3B0DC 2L5AA 3MNNC 4J8XA 1P3KA 3AV2A 3UTAA 1M1AD 3C1CA 1Q9CA 4HGAC 3MVDB 4Z66D 3AZMD 2PYOD 3LJAB 1P3FA 1JFIA 4E45A 3VH5T 5B1MB 2CV5D 5F99A 4WU8D 2Y2MA 4R8PC 5B2JA 3REKC 3AZFB 1BFMA 5B33A 3WTPA 5GSUB 5B40C 4KHAB 2IO5B 5DNMC 5B0ZB 1ID3B 2HIOC 5GXQA 2YFVB 4M6BA 5AV5B 3C1BC 3VH5A 3B0DB 5BO0A
chains in the Genus database with same CATH topology
1P3MA 3W99A 5GT0C 5AV9A 4HGAB 5AV6C 5CPKB 3MNNB 1P3OD 4Z5TA 3VH6T 4R8PB 5B31C 1M19C 2YFWB 2ZY4A 2LY8A 3V9RA 3MVDD 5DNMB 1U35C 5CPJA 1P3GC 3LJAD 3C1BB 2JE5A 4UPKA 5B1MD 3AZIA 1EQZA 3AZFD 3B0CT 5GT0B 3W97C 5GSUD 5AV6B 5FUGA 5B0ZD 4KGCA 3REHC 1BH8A 1ID3D 3MGPC 2AROD 5BS7A 5AV5D 3MNND 1M19B 5JA4A 3NQJA 3AN2C 3WTPE 3P5JB 4WNNA 5B24C 5CPIC 3LELA 5CPKD 1P3GB 3MGRA 1TZYA 3WKJA 3EG5B 4R8PD 3AZGC 2F8NA 5B1LC 2F2AC 3W97B 1S32C 5DNMD 3REHB 2F8NH 3X1TA 3C1BD 3UTBA 3W96A 3AN2B 5GT0D 3R45A 1P34C 5B24B 5AV6D 3AZHC 5CPIB 5AY8C 3X1SA 3X1UB 1KX4A 4XUJA 4QLCC 5CP6C 1P3IA 1ZLAC 5AVCC 4H9SA 3AZGB 3REJC 5B1LB 1M19D 4H9RA 2XD5A 3KSYA 1S32B 3TU4C 1P3GD 1N1JA 3AZKC 2DQNC 3IP4C 1P34B 3W97D 4JJNA 3AZHB 4EO5C 5G49A 4WV4B 5AY8B 2JSSA 5BT1D 5JRGC 5CP6B 5E5AB 4WZSB 4QLCB 3REHD 1M1AA 1ZLAB 5AVCB 3RELC 5C3IC 2RVQC 3REJB 3X1VB 3AN2D 1P3BC 2Y2OA 5B24D 2NQBC 5CPID 3TU4B 4WU8A 3LZ0C 2Y2LA 3X1UD 4J8VA 3MGSA 3WAAC 3AZGD 3AZKB 5B1LD 1P3LB 3MGQC 1P3AA 2BG1A 4EO5B 3AYWA 5JRGB 1F66C 5CHLB 4J8UC 4LD9B 5B32C 3RELB 1AOIC 5C3IB 2VQRA 3REIC 1Z2CB 1P3PA 1P3BB 2JCHA 1P34D 1HQ3A 3KXBC 3AZHD 2NQBB 3KWQC 3LZ0B 5AY8D 1ZLAD 4QLCD 5E5AD 3AZNA 1M18A 5AVCD 3WAAB 4NFTA 3REJD 3X1VD 3MGQB 1BH9B 4H9NB 1P3PC 3WA9A 3TU4D 1F66B 4J8UB 3KUYA 5B32B 5GSUA 1AOIB 3B6GC 1KX5D 4KHAA 3FDDA 3AZKD 5AV8C 2AROA 1P3LD 3KXBB 5AV5A 3KWQB 3UT9A 5GT3C 4X23C 5JRGD 5B2IA 4J8XC 4LD9D 1P3KC 2Y2GA 4ZUXD 3RELD 3AV2C 3UTAC 2RVQD 3C1CC 1P3BD 3A6NA 2FFFB 5AVBA 2NQBD 1P3FC 1H3OA 1TAFB 3LZ0D 2YFWA 5DNNA 3AZEA 5F99C 3B6GB 5B2JC 4G91C 3WTPC 5B33C 3WAAD 2HUEC 5AV8B 3A1IA 3MGQD 3AV1A 5GT3B 3VH5W 2RIQA 4CAYB 5GXQC 3REKB 1F66D 4J8UD 4H9PA 5B40B 4WJ3C 5B32D 1P3KB 1AOID 5BNVB 3UTAB 3W99C 5AV9C 1P3MC 3C1CB 3W98A 2CWEA 2HIOB 1KX3A 3KXBD 3KWQD 1P3FB 3NQUA 3VH6A 4Z5TC 5F99B 3O62A 3LZ1A 4G91B 4J8WA 2HUEB 5CPJC 5GXQB 5B31B 4KUDA 2FJ7A 3AZIC 3B6GD 1EQZC 1P3MB 1U35B 3W99B 5AV9B 4G92C 4WU9A 3LZ1C 5AV8D 4KGCC 5GT3D 4Z5TB 5BS7C 4YM6A 2Y2PA 3REKD 4YS3A 4CSRA 2NZDA 5B40D 4H9QB 3H0LC 1P3KD 3AFAA 3UTAD 3C1CD 3MGPB 3V9RB 2HIOD 2Y2JA 3X1UA 3LELC 5CPJB 3MGRC 1TZYC 5B0YA 1KU5A 1P3FD 3AZLA 3WKJC 4H9OA 5F99D 2ZM5A 3AZIB 3B6FA 4G92B 2J8PA 3AZJA 5FUGB 4KGCB 1BH8B 3KFUG 5GXQD 5B31D 4XZQA 3X1TC 3UTBC 3W96C 5JA4B 3NQJB 1P3MD 1U35D 3W99D 4WNNB 5AV9D 5BNXA 3B6FC 5E5AA 3LELB 4E44A 1TZYB 3MGRB 4XUJC 3X1SC 1P3IC 1KX4C 3WKJB 4Z5TD 3X1VA 4ZBJC 4H9SC 2F8NB 3MGPD 5CPJD 1KX5A 3X1TB 4Z66A 3UTBB 3AZMA 2PYOA 1P3LA 3W96B 3AZID 2CV5A 4NE6A 4JJNC 2BYMB 4KGCD 4LD9A 3X1SB 1KX4B 4XUJB 4ZUXA 1P3IB 1M1AC 1S32D 1PZRA 1ULYA 4H9RB 3LELD 4WU8C 2BYKA 3MGRD 1TZYD 4J8VC 3MGSC 1P3OA 1N1JB 2F8ND 1P3AC 2G5IC 4JJNB 5CP6D 5G49B 3AYWC 5KDMB 3MVDA 2G5HC 1M1AB 3X1TD 3UTBD 3W96D 3LJAA 4Z2MH 4Z2MG 5B32G 5B1MA 1HQ3C 3AZFA 4WU8B 3AL0C 3X1SD 2Y2HA 4XUJD 3AZNC 3REIB 5B0ZA 4J8VB 3MGSB 1P3ID 1M18C 1ID3A 4UUZB 2ZY2A 2YFVA 1P3AB 3WA9C 3MNNA 3AYWB 3KUYC 1T3UA 5CPKA 5GSUC 1WWIA 1P3PB 2AROC 1HQ3B 4JJND 4R8PA 4CAYA 3REKA 5AV5C 3UT9C 5B40A 5B2IC 3AZNB 5DNMA 5BNVA 1M18B 2HIOA 5CPKC 2F8NK 3C1BA 4X23B 3EPKA 3A6NC 3WA9B 5AVBC 5GT0A 4J8XB 5AV6A 5DNNC 3KUYB 3AV2B 3REID 4J8VD 3AZEC 3MGSD 2AROB 1P3AD 3AV1C 1JFIB 1W2EA 5B31A 1M19A 3A1KA 3UT9B 3AYWD 5B2JB 5B2IB 3WTPB 5B33B 1U35A 5B31G 1P3GA 4NE3A 1P3PD 3W98C 3A6NB 1KX3C 1HQ3D 4AWLC 5AVBB 3VH6W 3W97A 1H3OB 4NE5A 5BO0B 5DNNB 4H9QA 3AZND 3AZEB 3O62C 3REHA 1M18D 3MGPA 4J8WC 3EPJA 3AV1B 4X23D 3WA9D 3AN2A 1A7WA 1HTAA 3B0CW 4J8XD 4KUDC 5B24A 3KUYD 3AV2D 5CPIA 4H9PB 2FJ7C 3W98B 4DQYB 4WU9C 5BT1C 1KX3B 4AWLB 3AZGA 5B1LA 2UWXA 3UT9D 3NQUB 2Y2IA 4YS3C 5B2JD 4YM6C 1EQZB 5B2ID 1S32A 5B33D 3WTPD 3O62B 3LZ1B 2NZDC 2Y2QA 4J8WB 3AFAC 2Y2NA 2W8SA 3X1UC 3A6ND 5AVBD 5B0YC 2ZY3A 1P34A 4KUDB 3AZLC 3H0RC 3AZHA 5DNND 3AZED 2FJ7B 5AY8A 1ZLAA 4QLCA 5CP6A 3F6TA 4WU9B 3AZJC 5AVCA 3AV1D 2F8NG 3REJA 4YS3B 4XZQC 4YM6B 2XD1A 3B0BA 4CSRB 2DF4C 3TU4A 2NZDB 2BYMA 3AFAB 3W98D 4DRBA 5E5AC 1KX3D 3AZKA 5B0YB 3AZLB 3X1VC 1EQZD 1B67A 4H9OB 3R45B 3O62D 3LZ1D 5JRGA 3B6FB 4J8WD 3AZJB 3RELA 1R4VA 1P3BA 1KX5C 4ZBJB 4XZQB 4KUDD 4Z66C 3AZMC 2PYOC 3EPHA 1P3LC 2NQBA 2FJ7D 3H0MC 3LZ0A 2CV5C 3EPLA 2Y2KA 4WU9D 5KDMA 5BNXB 3WKJD 3WAAA 4LD9C 3MGQA 1BH9A 4ZUXC 4H9NA 4YS3D 4YM6D 1B6WA 2NZDD 1F66A 4J8UA 3AFAD 5B32A 1AOIA 3REIA 1KX5B 5B0YD 4UUZA 3AZLD 4Z66B 3KXBA 3AZMB 2PYOB 3KWQA 1P3OC 3B6FD 2CV5B 1F1EA 3AZJD 1KX4D 4DRAA 1WWSA 4ZUXB 3MVDC 2ZY5A 4XZQD 3LJAC 1TAFA 5B1MC 3B6GA 3AZFC 2BYKB 5AV8A 5B0ZC 2IO5C 1P3OB 1ID3C 5GT3A 4X23A 3B0DC 2L5AA 3MNNC 4J8XA 1P3KA 3AV2A 3UTAA 1M1AD 3C1CA 1Q9CA 4HGAC 3MVDB 4Z66D 3AZMD 2PYOD 3LJAB 1P3FA 1JFIA 4E45A 3VH5T 5B1MB 2CV5D 5F99A 4WU8D 2Y2MA 4R8PC 5B2JA 3REKC 3AZFB 1BFMA 5B33A 3WTPA 5GSUB 5B40C 4KHAB 2IO5B 5DNMC 5B0ZB 1ID3B 2HIOC 5GXQA 2YFVB 4M6BA 5AV5B 3C1BC 3VH5A 3B0DB 5BO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3M A;  3W99 A;  5GT0 C;  5AV9 A;  4HGA B;  5AV6 C;  5CPK B;  3MNN B;  1P3O D;  4Z5T A;  3VH6 T;  4R8P B;  5B31 C;  1M19 C;  2YFW B;  2LY8 A;  3V9R A;  3MVD D;  5DNM B;  1U35 C;  5CPJ A;  1P3G C;  3LJA D;  3C1B B;  5B1M D;  3AZI A;  1EQZ A;  3AZF D;  3B0C T;  5GT0 B;  3W97 C;  5GSU D;  5AV6 B;  5FUG A;  5B0Z D;  4KGC A;  3REH C;  1BH8 A;  1ID3 D;  3MGP C;  2ARO D;  5BS7 A;  5AV5 D;  3MNN D;  1M19 B;  5JA4 A;  3NQJ A;  3AN2 C;  3WTP E;  4WNN A;  5B24 C;  5CPI C;  3LEL A;  5CPK D;  1P3G B;  3MGR A;  1TZY A;  3WKJ A;  4R8P D;  3AZG C;  2F8N A;  5B1L C;  3W97 B;  1S32 C;  5DNM D;  3REH B;  2F8N H;  3X1T A;  3C1B D;  3UTB A;  3W96 A;  3AN2 B;  5GT0 D;  3R45 A;  1P34 C;  5B24 B;  5AV6 D;  3AZH C;  5CPI B;  5AY8 C;  3X1S A;  3X1U B;  1KX4 A;  4XUJ A;  4QLC C;  5CP6 C;  1P3I A;  1ZLA C;  5AVC C;  4H9S A;  3AZG B;  3REJ C;  5B1L B;  1M19 D;  4H9R A;  1S32 B;  3KSY A;  3TU4 C;  1P3G D;  1N1J A;  3AZK C;  1P34 B;  3W97 D;  4JJN A;  3AZH B;  4EO5 C;  5G49 A;  4WV4 B;  2JSS A;  5BT1 D;  5AY8 B;  5JRG C;  5CP6 B;  5E5A B;  4WZS B;  4QLC B;  3REH D;  1M1A A;  1ZLA B;  5AVC B;  3REL C;  5C3I C;  2RVQ C;  3REJ B;  3X1V B;  3AN2 D;  1P3B C;  5B24 D;  2NQB C;  5CPI D;  3TU4 B;  4WU8 A;  3LZ0 C;  3X1U D;  4J8V A;  3MGS A;  3WAA C;  3AZG D;  3AZK B;  5B1L D;  1P3L B;  3MGQ C;  1P3A A;  4EO5 B;  3AYW A;  5JRG B;  1F66 C;  5CHL B;  4J8U C;  4LD9 B;  5B32 C;  3REL B;  1AOI C;  5C3I B;  1P3P A;  3REI C;  1P3B B;  1P34 D;  1HQ3 A;  3KXB C;  3AZH D;  2NQB B;  3KWQ C;  3LZ0 B;  5AY8 D;  1ZLA D;  4QLC D;  5E5A D;  3AZN A;  1M18 A;  5AVC D;  3WAA B;  4NFT A;  3REJ D;  3X1V D;  3MGQ B;  1BH9 B;  4H9N B;  1P3P C;  3WA9 A;  3TU4 D;  1F66 B;  4J8U B;  3KUY A;  5B32 B;  5GSU A;  1AOI B;  3B6G C;  1KX5 D;  4KHA A;  3AZK D;  5AV8 C;  2ARO A;  1P3L D;  3KXB B;  5AV5 A;  3KWQ B;  3UT9 A;  5GT3 C;  4X23 C;  5JRG D;  5B2I A;  4J8X C;  4LD9 D;  1P3K C;  4ZUX D;  3REL D;  3AV2 C;  3UTA C;  2RVQ D;  3C1C C;  1P3B D;  3A6N A;  5AVB A;  2NQB D;  1P3F C;  1H3O A;  1TAF B;  3LZ0 D;  2YFW A;  5DNN A;  3AZE A;  5F99 C;  3B6G B;  5B2J C;  4G91 C;  3WTP C;  5B33 C;  3WAA D;  2HUE C;  5AV8 B;  3MGQ D;  3AV1 A;  5GT3 B;  3VH5 W;  3REK B;  4CAY B;  5GXQ C;  1F66 D;  4J8U D;  4H9P A;  5B40 B;  5B32 D;  1P3K B;  1AOI D;  5BNV B;  3UTA B;  3W99 C;  5AV9 C;  1P3M C;  3C1C B;  3W98 A;  2CWE A;  2HIO B;  1KX3 A;  3KXB D;  3KWQ D;  1P3F B;  3NQU A;  3VH6 A;  4Z5T C;  5F99 B;  3O62 A;  3LZ1 A;  4G91 B;  4J8W A;  2HUE B;  5CPJ C;  5GXQ B;  5B31 B;  4KUD A;  2FJ7 A;  3AZI C;  3B6G D;  1EQZ C;  1P3M B;  1U35 B;  3W99 B;  5AV9 B;  4G92 C;  4WU9 A;  3LZ1 C;  5AV8 D;  4KGC C;  5GT3 D;  4Z5T B;  5BS7 C;  4YM6 A;  3REK D;  4YS3 A;  4CSR A;  2NZD A;  5B40 D;  4H9Q B;  1P3K D;  3AFA A;  3UTA D;  3C1C D;  3MGP B;  3X1U A;  3V9R B;  2HIO D;  3LEL C;  5CPJ B;  3MGR C;  1TZY C;  5B0Y A;  1KU5 A;  1P3F D;  3AZL A;  3WKJ C;  4H9O A;  5F99 D;  3AZI B;  3B6F A;  4G92 B;  3AZJ A;  5FUG B;  4KGC B;  1BH8 B;  5GXQ D;  5B31 D;  4XZQ A;  3X1T C;  3UTB C;  3W96 C;  5JA4 B;  3NQJ B;  1P3M D;  1U35 D;  3W99 D;  4WNN B;  5AV9 D;  5BNX A;  3B6F C;  5E5A A;  3LEL B;  4E44 A;  1TZY B;  3MGR B;  4XUJ C;  3X1S C;  1P3I C;  1KX4 C;  3WKJ B;  4Z5T D;  3X1V A;  4ZBJ C;  4H9S C;  2F8N B;  3MGP D;  5CPJ D;  1KX5 A;  3X1T B;  4Z66 A;  3UTB B;  3AZM A;  2PYO A;  1P3L A;  3W96 B;  3AZI D;  2CV5 A;  4NE6 A;  4JJN C;  2BYM B;  4KGC D;  4LD9 A;  3X1S B;  1KX4 B;  4XUJ B;  4ZUX A;  1P3I B;  1M1A C;  1S32 D;  1ULY A;  4H9R B;  3LEL D;  4WU8 C;  2BYK A;  3MGR D;  1TZY D;  4J8V C;  3MGS C;  1P3O A;  1N1J B;  2F8N D;  1P3A C;  4JJN B;  5CP6 D;  5G49 B;  3AYW C;  5KDM B;  3MVD A;  1M1A B;  3X1T D;  3UTB D;  3W96 D;  3LJA A;  4Z2M H;  4Z2M G;  5B32 G;  5B1M A;  1HQ3 C;  3AZF A;  4WU8 B;  3X1S D;  4XUJ D;  3AZN C;  3REI B;  5B0Z A;  4J8V B;  3MGS B;  1P3I D;  1M18 C;  1ID3 A;  4UUZ B;  2YFV A;  1P3A B;  3WA9 C;  3MNN A;  3AYW B;  3KUY C;  5CPK A;  5GSU C;  1WWI A;  1P3P B;  2ARO C;  1HQ3 B;  4JJN D;  4R8P A;  4CAY A;  3REK A;  5AV5 C;  3UT9 C;  5B40 A;  5B2I C;  3AZN B;  5DNM A;  5BNV A;  1M18 B;  2HIO A;  5CPK C;  2F8N K;  3C1B A;  4X23 B;  3WA9 B;  3A6N C;  5AVB C;  5GT0 A;  4J8X B;  5AV6 A;  5DNN C;  3KUY B;  3AV2 B;  3REI D;  4J8V D;  3AZE C;  3MGS D;  2ARO B;  1P3A D;  3AV1 C;  1JFI B;  5B31 A;  1M19 A;  3UT9 B;  3AYW D;  5B2J B;  5B2I B;  3WTP B;  5B33 B;  1U35 A;  5B31 G;  1P3G A;  4NE3 A;  1P3P D;  3W98 C;  3A6N B;  1KX3 C;  1HQ3 D;  4AWL C;  5AVB B;  3VH6 W;  3W97 A;  1H3O B;  4NE5 A;  5BO0 B;  5DNN B;  4H9Q A;  3AZN D;  3AZE B;  3O62 C;  3REH A;  1M18 D;  3MGP A;  4J8W C;  3AV1 B;  4X23 D;  3WA9 D;  3AN2 A;  1A7W A;  1HTA A;  3B0C W;  4J8X D;  4KUD C;  5B24 A;  3KUY D;  3AV2 D;  5CPI A;  4H9P B;  2FJ7 C;  3W98 B;  4WU9 C;  5BT1 C;  1KX3 B;  4AWL B;  3AZG A;  5B1L A;  3UT9 D;  3NQU B;  4YS3 C;  5B2J D;  4YM6 C;  1EQZ B;  5B2I D;  1S32 A;  5B33 D;  3WTP D;  3O62 B;  3LZ1 B;  2NZD C;  4J8W B;  3AFA C;  3X1U C;  3A6N D;  5AVB D;  5B0Y C;  1P34 A;  4KUD B;  3AZL C;  3AZH A;  5DNN D;  3AZE D;  2FJ7 B;  5AY8 A;  1ZLA A;  4QLC A;  5CP6 A;  4WU9 B;  3AZJ C;  5AVC A;  3AV1 D;  2F8N G;  3REJ A;  4YS3 B;  4XZQ C;  4YM6 B;  3B0B A;  4CSR B;  2NZD B;  3TU4 A;  2BYM A;  3AFA B;  3W98 D;  4DRB A;  5E5A C;  1KX3 D;  3AZK A;  5B0Y B;  3AZL B;  3X1V C;  1EQZ D;  1B67 A;  4H9O B;  3R45 B;  3O62 D;  3LZ1 D;  5JRG A;  3B6F B;  4J8W D;  3AZJ B;  3REL A;  1R4V A;  1P3B A;  1KX5 C;  4ZBJ B;  4XZQ B;  4KUD D;  4Z66 C;  3AZM C;  2PYO C;  1P3L C;  2NQB A;  2FJ7 D;  3LZ0 A;  2CV5 C;  4WU9 D;  5KDM A;  5BNX B;  3WKJ D;  3WAA A;  4LD9 C;  3MGQ A;  1BH9 A;  4ZUX C;  4H9N A;  4YS3 D;  4YM6 D;  1B6W A;  2NZD D;  1F66 A;  4J8U A;  3AFA D;  5B32 A;  1AOI A;  3REI A;  1KX5 B;  5B0Y D;  4UUZ A;  3AZL D;  4Z66 B;  3KXB A;  3AZM B;  2PYO B;  3KWQ A;  1P3O C;  3B6F D;  2CV5 B;  1F1E A;  3AZJ D;  1KX4 D;  4DRA A;  1WWS A;  4ZUX B;  3MVD C;  4XZQ D;  3LJA C;  1TAF A;  5B1M C;  3B6G A;  3AZF C;  2BYK B;  5AV8 A;  5B0Z C;  2IO5 C;  1P3O B;  1ID3 C;  5GT3 A;  4X23 A;  3B0D C;  2L5A A;  3MNN C;  4J8X A;  1P3K A;  3AV2 A;  3UTA A;  1M1A D;  3C1C A;  1Q9C A;  4HGA C;  3MVD B;  4Z66 D;  3AZM D;  2PYO D;  3LJA B;  1P3F A;  1JFI A;  4E45 A;  3VH5 T;  5B1M B;  2CV5 D;  5F99 A;  4WU8 D;  4R8P C;  5B2J A;  3REK C;  3AZF B;  1BFM A;  5B33 A;  3WTP A;  5GSU B;  5B40 C;  4KHA B;  2IO5 B;  5DNM C;  5B0Z B;  1ID3 B;  2HIO C;  5GXQ A;  2YFV B;  4M6B A;  5AV5 B;  3C1B C;  3VH5 A;  3B0D B;  5BO0 A; 
#chains in the Genus database with same CATH topology
 1P3M A;  3W99 A;  5GT0 C;  5AV9 A;  4HGA B;  5AV6 C;  5CPK B;  3MNN B;  1P3O D;  4Z5T A;  3VH6 T;  4R8P B;  5B31 C;  1M19 C;  2YFW B;  2ZY4 A;  2LY8 A;  3V9R A;  3MVD D;  5DNM B;  1U35 C;  5CPJ A;  1P3G C;  3LJA D;  3C1B B;  2JE5 A;  4UPK A;  5B1M D;  3AZI A;  1EQZ A;  3AZF D;  3B0C T;  5GT0 B;  3W97 C;  5GSU D;  5AV6 B;  5FUG A;  5B0Z D;  4KGC A;  3REH C;  1BH8 A;  1ID3 D;  3MGP C;  2ARO D;  5BS7 A;  5AV5 D;  3MNN D;  1M19 B;  5JA4 A;  3NQJ A;  3AN2 C;  3WTP E;  3P5J B;  4WNN A;  5B24 C;  5CPI C;  3LEL A;  5CPK D;  1P3G B;  3MGR A;  1TZY A;  3WKJ A;  3EG5 B;  4R8P D;  3AZG C;  2F8N A;  5B1L C;  2F2A C;  3W97 B;  1S32 C;  5DNM D;  3REH B;  2F8N H;  3X1T A;  3C1B D;  3UTB A;  3W96 A;  3AN2 B;  5GT0 D;  3R45 A;  1P34 C;  5B24 B;  5AV6 D;  3AZH C;  5CPI B;  5AY8 C;  3X1S A;  3X1U B;  1KX4 A;  4XUJ A;  4QLC C;  5CP6 C;  1P3I A;  1ZLA C;  5AVC C;  4H9S A;  3AZG B;  3REJ C;  5B1L B;  1M19 D;  4H9R A;  2XD5 A;  3KSY A;  1S32 B;  3TU4 C;  1P3G D;  1N1J A;  3AZK C;  2DQN C;  3IP4 C;  1P34 B;  3W97 D;  4JJN A;  3AZH B;  4EO5 C;  5G49 A;  4WV4 B;  5AY8 B;  2JSS A;  5BT1 D;  5JRG C;  5CP6 B;  5E5A B;  4WZS B;  4QLC B;  3REH D;  1M1A A;  1ZLA B;  5AVC B;  3REL C;  5C3I C;  2RVQ C;  3REJ B;  3X1V B;  3AN2 D;  1P3B C;  2Y2O A;  5B24 D;  2NQB C;  5CPI D;  3TU4 B;  4WU8 A;  3LZ0 C;  2Y2L A;  3X1U D;  4J8V A;  3MGS A;  3WAA C;  3AZG D;  3AZK B;  5B1L D;  1P3L B;  3MGQ C;  1P3A A;  2BG1 A;  4EO5 B;  3AYW A;  5JRG B;  1F66 C;  5CHL B;  4J8U C;  4LD9 B;  5B32 C;  3REL B;  1AOI C;  5C3I B;  2VQR A;  3REI C;  1Z2C B;  1P3P A;  1P3B B;  2JCH A;  1P34 D;  1HQ3 A;  3KXB C;  3AZH D;  2NQB B;  3KWQ C;  3LZ0 B;  5AY8 D;  1ZLA D;  4QLC D;  5E5A D;  3AZN A;  1M18 A;  5AVC D;  3WAA B;  4NFT A;  3REJ D;  3X1V D;  3MGQ B;  1BH9 B;  4H9N B;  1P3P C;  3WA9 A;  3TU4 D;  1F66 B;  4J8U B;  3KUY A;  5B32 B;  5GSU A;  1AOI B;  3B6G C;  1KX5 D;  4KHA A;  3FDD A;  3AZK D;  5AV8 C;  2ARO A;  1P3L D;  3KXB B;  5AV5 A;  3KWQ B;  3UT9 A;  5GT3 C;  4X23 C;  5JRG D;  5B2I A;  4J8X C;  4LD9 D;  1P3K C;  2Y2G A;  4ZUX D;  3REL D;  3AV2 C;  3UTA C;  2RVQ D;  3C1C C;  1P3B D;  3A6N A;  2FFF B;  5AVB A;  2NQB D;  1P3F C;  1H3O A;  1TAF B;  3LZ0 D;  2YFW A;  5DNN A;  3AZE A;  5F99 C;  3B6G B;  5B2J C;  4G91 C;  3WTP C;  5B33 C;  3WAA D;  2HUE C;  5AV8 B;  3A1I A;  3MGQ D;  3AV1 A;  5GT3 B;  3VH5 W;  2RIQ A;  4CAY B;  5GXQ C;  3REK B;  1F66 D;  4J8U D;  4H9P A;  5B40 B;  4WJ3 C;  5B32 D;  1P3K B;  1AOI D;  5BNV B;  3UTA B;  3W99 C;  5AV9 C;  1P3M C;  3C1C B;  3W98 A;  2CWE A;  2HIO B;  1KX3 A;  3KXB D;  3KWQ D;  1P3F B;  3NQU A;  3VH6 A;  4Z5T C;  5F99 B;  3O62 A;  3LZ1 A;  4G91 B;  4J8W A;  2HUE B;  5CPJ C;  5GXQ B;  5B31 B;  4KUD A;  2FJ7 A;  3AZI C;  3B6G D;  1EQZ C;  1P3M B;  1U35 B;  3W99 B;  5AV9 B;  4G92 C;  4WU9 A;  3LZ1 C;  5AV8 D;  4KGC C;  5GT3 D;  4Z5T B;  5BS7 C;  4YM6 A;  2Y2P A;  3REK D;  4YS3 A;  4CSR A;  2NZD A;  5B40 D;  4H9Q B;  3H0L C;  1P3K D;  3AFA A;  3UTA D;  3C1C D;  3MGP B;  3V9R B;  2HIO D;  2Y2J A;  3X1U A;  3LEL C;  5CPJ B;  3MGR C;  1TZY C;  5B0Y A;  1KU5 A;  1P3F D;  3AZL A;  3WKJ C;  4H9O A;  5F99 D;  2ZM5 A;  3AZI B;  3B6F A;  4G92 B;  2J8P A;  3AZJ A;  5FUG B;  4KGC B;  1BH8 B;  3KFU G;  5GXQ D;  5B31 D;  4XZQ A;  3X1T C;  3UTB C;  3W96 C;  5JA4 B;  3NQJ B;  1P3M D;  1U35 D;  3W99 D;  4WNN B;  5AV9 D;  5BNX A;  3B6F C;  5E5A A;  3LEL B;  4E44 A;  1TZY B;  3MGR B;  4XUJ C;  3X1S C;  1P3I C;  1KX4 C;  3WKJ B;  4Z5T D;  3X1V A;  4ZBJ C;  4H9S C;  2F8N B;  3MGP D;  5CPJ D;  1KX5 A;  3X1T B;  4Z66 A;  3UTB B;  3AZM A;  2PYO A;  1P3L A;  3W96 B;  3AZI D;  2CV5 A;  4NE6 A;  4JJN C;  2BYM B;  4KGC D;  4LD9 A;  3X1S B;  1KX4 B;  4XUJ B;  4ZUX A;  1P3I B;  1M1A C;  1S32 D;  1PZR A;  1ULY A;  4H9R B;  3LEL D;  4WU8 C;  2BYK A;  3MGR D;  1TZY D;  4J8V C;  3MGS C;  1P3O A;  1N1J B;  2F8N D;  1P3A C;  2G5I C;  4JJN B;  5CP6 D;  5G49 B;  3AYW C;  5KDM B;  3MVD A;  2G5H C;  1M1A B;  3X1T D;  3UTB D;  3W96 D;  3LJA A;  4Z2M H;  4Z2M G;  5B32 G;  5B1M A;  1HQ3 C;  3AZF A;  4WU8 B;  3AL0 C;  3X1S D;  2Y2H A;  4XUJ D;  3AZN C;  3REI B;  5B0Z A;  4J8V B;  3MGS B;  1P3I D;  1M18 C;  1ID3 A;  4UUZ B;  2ZY2 A;  2YFV A;  1P3A B;  3WA9 C;  3MNN A;  3AYW B;  3KUY C;  1T3U A;  5CPK A;  5GSU C;  1WWI A;  1P3P B;  2ARO C;  1HQ3 B;  4JJN D;  4R8P A;  4CAY A;  3REK A;  5AV5 C;  3UT9 C;  5B40 A;  5B2I C;  3AZN B;  5DNM A;  5BNV A;  1M18 B;  2HIO A;  5CPK C;  2F8N K;  3C1B A;  4X23 B;  3EPK A;  3A6N C;  3WA9 B;  5AVB C;  5GT0 A;  4J8X B;  5AV6 A;  5DNN C;  3KUY B;  3AV2 B;  3REI D;  4J8V D;  3AZE C;  3MGS D;  2ARO B;  1P3A D;  3AV1 C;  1JFI B;  1W2E A;  5B31 A;  1M19 A;  3A1K A;  3UT9 B;  3AYW D;  5B2J B;  5B2I B;  3WTP B;  5B33 B;  1U35 A;  5B31 G;  1P3G A;  4NE3 A;  1P3P D;  3W98 C;  3A6N B;  1KX3 C;  1HQ3 D;  4AWL C;  5AVB B;  3VH6 W;  3W97 A;  1H3O B;  4NE5 A;  5BO0 B;  5DNN B;  4H9Q A;  3AZN D;  3AZE B;  3O62 C;  3REH A;  1M18 D;  3MGP A;  4J8W C;  3EPJ A;  3AV1 B;  4X23 D;  3WA9 D;  3AN2 A;  1A7W A;  1HTA A;  3B0C W;  4J8X D;  4KUD C;  5B24 A;  3KUY D;  3AV2 D;  5CPI A;  4H9P B;  2FJ7 C;  3W98 B;  4DQY B;  4WU9 C;  5BT1 C;  1KX3 B;  4AWL B;  3AZG A;  5B1L A;  2UWX A;  3UT9 D;  3NQU B;  2Y2I A;  4YS3 C;  5B2J D;  4YM6 C;  1EQZ B;  5B2I D;  1S32 A;  5B33 D;  3WTP D;  3O62 B;  3LZ1 B;  2NZD C;  2Y2Q A;  4J8W B;  3AFA C;  2Y2N A;  2W8S A;  3X1U C;  3A6N D;  5AVB D;  5B0Y C;  2ZY3 A;  1P34 A;  4KUD B;  3AZL C;  3H0R C;  3AZH A;  5DNN D;  3AZE D;  2FJ7 B;  5AY8 A;  1ZLA A;  4QLC A;  5CP6 A;  3F6T A;  4WU9 B;  3AZJ C;  5AVC A;  3AV1 D;  2F8N G;  3REJ A;  4YS3 B;  4XZQ C;  4YM6 B;  2XD1 A;  3B0B A;  4CSR B;  2DF4 C;  3TU4 A;  2NZD B;  2BYM A;  3AFA B;  3W98 D;  4DRB A;  5E5A C;  1KX3 D;  3AZK A;  5B0Y B;  3AZL B;  3X1V C;  1EQZ D;  1B67 A;  4H9O B;  3R45 B;  3O62 D;  3LZ1 D;  5JRG A;  3B6F B;  4J8W D;  3AZJ B;  3REL A;  1R4V A;  1P3B A;  1KX5 C;  4ZBJ B;  4XZQ B;  4KUD D;  4Z66 C;  3AZM C;  2PYO C;  3EPH A;  1P3L C;  2NQB A;  2FJ7 D;  3H0M C;  3LZ0 A;  2CV5 C;  3EPL A;  2Y2K A;  4WU9 D;  5KDM A;  5BNX B;  3WKJ D;  3WAA A;  4LD9 C;  3MGQ A;  1BH9 A;  4ZUX C;  4H9N A;  4YS3 D;  4YM6 D;  1B6W A;  2NZD D;  1F66 A;  4J8U A;  3AFA D;  5B32 A;  1AOI A;  3REI A;  1KX5 B;  5B0Y D;  4UUZ A;  3AZL D;  4Z66 B;  3KXB A;  3AZM B;  2PYO B;  3KWQ A;  1P3O C;  3B6F D;  2CV5 B;  1F1E A;  3AZJ D;  1KX4 D;  4DRA A;  1WWS A;  4ZUX B;  3MVD C;  2ZY5 A;  4XZQ D;  3LJA C;  1TAF A;  5B1M C;  3B6G A;  3AZF C;  2BYK B;  5AV8 A;  5B0Z C;  2IO5 C;  1P3O B;  1ID3 C;  5GT3 A;  4X23 A;  3B0D C;  2L5A A;  3MNN C;  4J8X A;  1P3K A;  3AV2 A;  3UTA A;  1M1A D;  3C1C A;  1Q9C A;  4HGA C;  3MVD B;  4Z66 D;  3AZM D;  2PYO D;  3LJA B;  1P3F A;  1JFI A;  4E45 A;  3VH5 T;  5B1M B;  2CV5 D;  5F99 A;  4WU8 D;  2Y2M A;  4R8P C;  5B2J A;  3REK C;  3AZF B;  1BFM A;  5B33 A;  3WTP A;  5GSU B;  5B40 C;  4KHA B;  2IO5 B;  5DNM C;  5B0Z B;  1ID3 B;  2HIO C;  5GXQ A;  2YFV B;  4M6B A;  5AV5 B;  3C1B C;  3VH5 A;  3B0D B;  5BO0 A; 
#chains in the Genus database with same CATH homology
 1P3M A;  3W99 A;  5GT0 C;  5AV9 A;  4HGA B;  5AV6 C;  5CPK B;  3MNN B;  1P3O D;  4Z5T A;  3VH6 T;  4R8P B;  5B31 C;  1M19 C;  2YFW B;  2ZY4 A;  2LY8 A;  3V9R A;  3MVD D;  5DNM B;  1U35 C;  5CPJ A;  1P3G C;  3LJA D;  3C1B B;  2JE5 A;  4UPK A;  5B1M D;  3AZI A;  1EQZ A;  3AZF D;  3B0C T;  5GT0 B;  3W97 C;  5GSU D;  5AV6 B;  5FUG A;  5B0Z D;  4KGC A;  3REH C;  1BH8 A;  1ID3 D;  3MGP C;  2ARO D;  5BS7 A;  5AV5 D;  3MNN D;  1M19 B;  5JA4 A;  3NQJ A;  3AN2 C;  3WTP E;  3P5J B;  4WNN A;  5B24 C;  5CPI C;  3LEL A;  5CPK D;  1P3G B;  3MGR A;  1TZY A;  3WKJ A;  3EG5 B;  4R8P D;  3AZG C;  2F8N A;  5B1L C;  2F2A C;  3W97 B;  1S32 C;  5DNM D;  3REH B;  2F8N H;  3X1T A;  3C1B D;  3UTB A;  3W96 A;  3AN2 B;  5GT0 D;  3R45 A;  1P34 C;  5B24 B;  5AV6 D;  3AZH C;  5CPI B;  5AY8 C;  3X1S A;  3X1U B;  1KX4 A;  4XUJ A;  4QLC C;  5CP6 C;  1P3I A;  1ZLA C;  5AVC C;  4H9S A;  3AZG B;  3REJ C;  5B1L B;  1M19 D;  4H9R A;  2XD5 A;  3KSY A;  1S32 B;  3TU4 C;  1P3G D;  1N1J A;  3AZK C;  2DQN C;  3IP4 C;  1P34 B;  3W97 D;  4JJN A;  3AZH B;  4EO5 C;  5G49 A;  4WV4 B;  5AY8 B;  2JSS A;  5BT1 D;  5JRG C;  5CP6 B;  5E5A B;  4WZS B;  4QLC B;  3REH D;  1M1A A;  1ZLA B;  5AVC B;  3REL C;  5C3I C;  2RVQ C;  3REJ B;  3X1V B;  3AN2 D;  1P3B C;  2Y2O A;  5B24 D;  2NQB C;  5CPI D;  3TU4 B;  4WU8 A;  3LZ0 C;  2Y2L A;  3X1U D;  4J8V A;  3MGS A;  3WAA C;  3AZG D;  3AZK B;  5B1L D;  1P3L B;  3MGQ C;  1P3A A;  2BG1 A;  4EO5 B;  3AYW A;  5JRG B;  1F66 C;  5CHL B;  4J8U C;  4LD9 B;  5B32 C;  3REL B;  1AOI C;  5C3I B;  2VQR A;  3REI C;  1Z2C B;  1P3P A;  1P3B B;  2JCH A;  1P34 D;  1HQ3 A;  3KXB C;  3AZH D;  2NQB B;  3KWQ C;  3LZ0 B;  5AY8 D;  1ZLA D;  4QLC D;  5E5A D;  3AZN A;  1M18 A;  5AVC D;  3WAA B;  4NFT A;  3REJ D;  3X1V D;  3MGQ B;  1BH9 B;  4H9N B;  1P3P C;  3WA9 A;  3TU4 D;  1F66 B;  4J8U B;  3KUY A;  5B32 B;  5GSU A;  1AOI B;  3B6G C;  1KX5 D;  4KHA A;  3FDD A;  3AZK D;  5AV8 C;  2ARO A;  1P3L D;  3KXB B;  5AV5 A;  3KWQ B;  3UT9 A;  5GT3 C;  4X23 C;  5JRG D;  5B2I A;  4J8X C;  4LD9 D;  1P3K C;  2Y2G A;  4ZUX D;  3REL D;  3AV2 C;  3UTA C;  2RVQ D;  3C1C C;  1P3B D;  3A6N A;  2FFF B;  5AVB A;  2NQB D;  1P3F C;  1H3O A;  1TAF B;  3LZ0 D;  2YFW A;  5DNN A;  3AZE A;  5F99 C;  3B6G B;  5B2J C;  4G91 C;  3WTP C;  5B33 C;  3WAA D;  2HUE C;  5AV8 B;  3A1I A;  3MGQ D;  3AV1 A;  5GT3 B;  3VH5 W;  2RIQ A;  4CAY B;  5GXQ C;  3REK B;  1F66 D;  4J8U D;  4H9P A;  5B40 B;  4WJ3 C;  5B32 D;  1P3K B;  1AOI D;  5BNV B;  3UTA B;  3W99 C;  5AV9 C;  1P3M C;  3C1C B;  3W98 A;  2CWE A;  2HIO B;  1KX3 A;  3KXB D;  3KWQ D;  1P3F B;  3NQU A;  3VH6 A;  4Z5T C;  5F99 B;  3O62 A;  3LZ1 A;  4G91 B;  4J8W A;  2HUE B;  5CPJ C;  5GXQ B;  5B31 B;  4KUD A;  2FJ7 A;  3AZI C;  3B6G D;  1EQZ C;  1P3M B;  1U35 B;  3W99 B;  5AV9 B;  4G92 C;  4WU9 A;  3LZ1 C;  5AV8 D;  4KGC C;  5GT3 D;  4Z5T B;  5BS7 C;  4YM6 A;  2Y2P A;  3REK D;  4YS3 A;  4CSR A;  2NZD A;  5B40 D;  4H9Q B;  3H0L C;  1P3K D;  3AFA A;  3UTA D;  3C1C D;  3MGP B;  3V9R B;  2HIO D;  2Y2J A;  3X1U A;  3LEL C;  5CPJ B;  3MGR C;  1TZY C;  5B0Y A;  1KU5 A;  1P3F D;  3AZL A;  3WKJ C;  4H9O A;  5F99 D;  2ZM5 A;  3AZI B;  3B6F A;  4G92 B;  2J8P A;  3AZJ A;  5FUG B;  4KGC B;  1BH8 B;  3KFU G;  5GXQ D;  5B31 D;  4XZQ A;  3X1T C;  3UTB C;  3W96 C;  5JA4 B;  3NQJ B;  1P3M D;  1U35 D;  3W99 D;  4WNN B;  5AV9 D;  5BNX A;  3B6F C;  5E5A A;  3LEL B;  4E44 A;  1TZY B;  3MGR B;  4XUJ C;  3X1S C;  1P3I C;  1KX4 C;  3WKJ B;  4Z5T D;  3X1V A;  4ZBJ C;  4H9S C;  2F8N B;  3MGP D;  5CPJ D;  1KX5 A;  3X1T B;  4Z66 A;  3UTB B;  3AZM A;  2PYO A;  1P3L A;  3W96 B;  3AZI D;  2CV5 A;  4NE6 A;  4JJN C;  2BYM B;  4KGC D;  4LD9 A;  3X1S B;  1KX4 B;  4XUJ B;  4ZUX A;  1P3I B;  1M1A C;  1S32 D;  1PZR A;  1ULY A;  4H9R B;  3LEL D;  4WU8 C;  2BYK A;  3MGR D;  1TZY D;  4J8V C;  3MGS C;  1P3O A;  1N1J B;  2F8N D;  1P3A C;  2G5I C;  4JJN B;  5CP6 D;  5G49 B;  3AYW C;  5KDM B;  3MVD A;  2G5H C;  1M1A B;  3X1T D;  3UTB D;  3W96 D;  3LJA A;  4Z2M H;  4Z2M G;  5B32 G;  5B1M A;  1HQ3 C;  3AZF A;  4WU8 B;  3AL0 C;  3X1S D;  2Y2H A;  4XUJ D;  3AZN C;  3REI B;  5B0Z A;  4J8V B;  3MGS B;  1P3I D;  1M18 C;  1ID3 A;  4UUZ B;  2ZY2 A;  2YFV A;  1P3A B;  3WA9 C;  3MNN A;  3AYW B;  3KUY C;  1T3U A;  5CPK A;  5GSU C;  1WWI A;  1P3P B;  2ARO C;  1HQ3 B;  4JJN D;  4R8P A;  4CAY A;  3REK A;  5AV5 C;  3UT9 C;  5B40 A;  5B2I C;  3AZN B;  5DNM A;  5BNV A;  1M18 B;  2HIO A;  5CPK C;  2F8N K;  3C1B A;  4X23 B;  3EPK A;  3A6N C;  3WA9 B;  5AVB C;  5GT0 A;  4J8X B;  5AV6 A;  5DNN C;  3KUY B;  3AV2 B;  3REI D;  4J8V D;  3AZE C;  3MGS D;  2ARO B;  1P3A D;  3AV1 C;  1JFI B;  1W2E A;  5B31 A;  1M19 A;  3A1K A;  3UT9 B;  3AYW D;  5B2J B;  5B2I B;  3WTP B;  5B33 B;  1U35 A;  5B31 G;  1P3G A;  4NE3 A;  1P3P D;  3W98 C;  3A6N B;  1KX3 C;  1HQ3 D;  4AWL C;  5AVB B;  3VH6 W;  3W97 A;  1H3O B;  4NE5 A;  5BO0 B;  5DNN B;  4H9Q A;  3AZN D;  3AZE B;  3O62 C;  3REH A;  1M18 D;  3MGP A;  4J8W C;  3EPJ A;  3AV1 B;  4X23 D;  3WA9 D;  3AN2 A;  1A7W A;  1HTA A;  3B0C W;  4J8X D;  4KUD C;  5B24 A;  3KUY D;  3AV2 D;  5CPI A;  4H9P B;  2FJ7 C;  3W98 B;  4DQY B;  4WU9 C;  5BT1 C;  1KX3 B;  4AWL B;  3AZG A;  5B1L A;  2UWX A;  3UT9 D;  3NQU B;  2Y2I A;  4YS3 C;  5B2J D;  4YM6 C;  1EQZ B;  5B2I D;  1S32 A;  5B33 D;  3WTP D;  3O62 B;  3LZ1 B;  2NZD C;  2Y2Q A;  4J8W B;  3AFA C;  2Y2N A;  2W8S A;  3X1U C;  3A6N D;  5AVB D;  5B0Y C;  2ZY3 A;  1P34 A;  4KUD B;  3AZL C;  3H0R C;  3AZH A;  5DNN D;  3AZE D;  2FJ7 B;  5AY8 A;  1ZLA A;  4QLC A;  5CP6 A;  3F6T A;  4WU9 B;  3AZJ C;  5AVC A;  3AV1 D;  2F8N G;  3REJ A;  4YS3 B;  4XZQ C;  4YM6 B;  2XD1 A;  3B0B A;  4CSR B;  2DF4 C;  3TU4 A;  2NZD B;  2BYM A;  3AFA B;  3W98 D;  4DRB A;  5E5A C;  1KX3 D;  3AZK A;  5B0Y B;  3AZL B;  3X1V C;  1EQZ D;  1B67 A;  4H9O B;  3R45 B;  3O62 D;  3LZ1 D;  5JRG A;  3B6F B;  4J8W D;  3AZJ B;  3REL A;  1R4V A;  1P3B A;  1KX5 C;  4ZBJ B;  4XZQ B;  4KUD D;  4Z66 C;  3AZM C;  2PYO C;  3EPH A;  1P3L C;  2NQB A;  2FJ7 D;  3H0M C;  3LZ0 A;  2CV5 C;  3EPL A;  2Y2K A;  4WU9 D;  5KDM A;  5BNX B;  3WKJ D;  3WAA A;  4LD9 C;  3MGQ A;  1BH9 A;  4ZUX C;  4H9N A;  4YS3 D;  4YM6 D;  1B6W A;  2NZD D;  1F66 A;  4J8U A;  3AFA D;  5B32 A;  1AOI A;  3REI A;  1KX5 B;  5B0Y D;  4UUZ A;  3AZL D;  4Z66 B;  3KXB A;  3AZM B;  2PYO B;  3KWQ A;  1P3O C;  3B6F D;  2CV5 B;  1F1E A;  3AZJ D;  1KX4 D;  4DRA A;  1WWS A;  4ZUX B;  3MVD C;  2ZY5 A;  4XZQ D;  3LJA C;  1TAF A;  5B1M C;  3B6G A;  3AZF C;  2BYK B;  5AV8 A;  5B0Z C;  2IO5 C;  1P3O B;  1ID3 C;  5GT3 A;  4X23 A;  3B0D C;  2L5A A;  3MNN C;  4J8X A;  1P3K A;  3AV2 A;  3UTA A;  1M1A D;  3C1C A;  1Q9C A;  4HGA C;  3MVD B;  4Z66 D;  3AZM D;  2PYO D;  3LJA B;  1P3F A;  1JFI A;  4E45 A;  3VH5 T;  5B1M B;  2CV5 D;  5F99 A;  4WU8 D;  2Y2M A;  4R8P C;  5B2J A;  3REK C;  3AZF B;  1BFM A;  5B33 A;  3WTP A;  5GSU B;  5B40 C;  4KHA B;  2IO5 B;  5DNM C;  5B0Z B;  1ID3 B;  2HIO C;  5GXQ A;  2YFV B;  4M6B A;  5AV5 B;  3C1B C;  3VH5 A;  3B0D B;  5BO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...