4ZUXD

Saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
95
structure length
95
Chain Sequence
b'KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
molecule tags Hydrolase/dna
source organism Xenopus laevis
publication title Structural basis for histone H2B deubiquitination by the SAGA DUB module.
pubmed doi rcsb
total genus 37
structure length 95
sequence length 95
chains with identical sequence H, N, R
ec nomenclature
pdb deposition date 2015-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4zuxD00
3AZGA 5AV8C 3O62C 3NQJA 3AZMB 1KX5B 1ID3D 4ZBJB 1EQZC 5AV9B 5B0ZA 3REJD 1BH9B 4WU8C 1P3AA 3B6FA 3W98C 3B0CT 4CSRA 5CPIC 1HTAA 5FUGA 3WTPA 4E44A 3LJAC 3LZ1D 3WAAB 1H3OA 3A6ND 2F8ND 1BH8A 2YFWA 1ZLAC 5B1LB 1A7WA 3LZ0D 5B2ID 3AFAA 1M1AC 3REJA 5F99C 3W97D 2HIOB 1U35B 4M6BA 2FJ7B 5B2IB 1M1AB 3MGPD 3LZ0B 3R45A 1P3BA 3KWQA 5DNNB 3A6NB 2F8NB 3W98A 1P3AC 2PYOB 4XUJA 3AV1A 4DRBA 1P3GB 4H9SC 5AV8A 3AZID 1M19C 5CP6B 3B6GB 1B6WA 5DNNC 4J8VA 3UTAD 5JA4B 2NQBD 3LJAB 5AY8C 4JJNB 3RELC 3KUYD 3O62B 3MVDB 3X1VB 5B40D 4X23C 5BNXB 3WKJB 4YM6C 3AZLA 3LJAD 3UTBD 1AOIB 5GSUA 2RVQC 4Z2MG 4YS3C 3REJC 4WU8D 4Z5TB 3AZKA 2LY8A 1P3MA 3REKA 3AV2A 3AZNC 5E5AB 3X1UB 3C1BB 3REHA 4WU9A 3W99A 4QLCC 1P3ID 4R8PC 5CPKB 3W99B 5KDMB 3REHB 1HQ3D 5B1LC 2CV5C 5E5AA 4YS3D 3X1TB 4R8PA 3AZFD 3B6FC 1U35D 3REHC 5AV9D 1P3PB 5CPIA 3MGSD 4YM6D 4R8PB 5BNVB 4KGCA 5BS7A 3WA9D 3O62A 1M18B 3MGQC 1WWSA 4WU9D 3AZIC 1M19D 3WAAC 1TZYB 3AZHD 1P3MC 2AROD 4X23B 3AZEC 4KHAA 1P3AD 1JFIA 3AYWA 1S32A 5AV5C 5B1MA 1HQ3A 1P3MB 4J8VC 2PYOD 1JFIB 2AROB 3AZLC 3A6NA 5JRGD 2F8NA 1KX5C 3W98B 5GT3C 3MNNC 1P3BB 5AVCC 3C1CA 1M1AD 5AV6C 3LZ0A 3AZGD 5B31B 3VH6T 5JA4A 3X1VC 3UTBC 3W96C 1M19A 5CPIB 5AV8B 3AZFB 3AZHC 3AFAB 3B0DB 3X1TA 5BO0A 3KWQC 5BT1C 4J8WB 3AYWB 1S32B 2YFWB 1P3LD 3LZ1B 3AZEA 4H9RA 3VH6W 3WAAA 4KUDC 1TZYA 3AN2D 3X1UD 3KWQB 3C1BD 4J8WD 1M18A 4WU9B 5BS7C 3AFAC 4H9PB 5B2JD 3C1CD 2CV5B 3REKB 5BNVA 3AV2B 1M1AA 4KGCB 5AV8D 3REJB 2HIOD 5GSUB 3UTAA 1P3OC 1B67A 5BNXA 3WKJA 5B1LA 3X1VA 3WTPC 2NQBB 3UT9D 4Z66D 5JRGB 2RVQD 5B31G 1H3OB 3LJAA 4G91B 3UTBA 3AZED 3TU4C 3KWQD 4H9QA 5CPKA 3RELD 3WAAD 5CP6A 1P34D 3X1UA 3C1BA 1P3GD 4KUDD 5GT3A 5AV5B 4HGAC 4G92B 3A6NC 4ZUXB 4LD9D 4H9NB 2YFVB 4J8XC 1P3KD 1P3FC 1P3IA 5CHLB 4EO5B 3LELC 3UT9C 3MGRD 5B24C 5AVBA 1KX5D 3MVDA 3R45B 3AZGC 3WA9B 1P3FA 3X1VD 5B33A 4R8PD 3UT9A 3KXBA 1ULYA 2CWEA 3MGRB 3AZLD 3V9RB 4KGCD 3VH5A 1P34A 1P3GA 1P3KB 5B2JC 4ZUXD 1P3MD 5B2IC 3AN2C 5B40C 1N1JB 5F99D 4X23D 3AZNB 3AYWD 5E5AC 1S32D 1P3LB 4J8UD 4Z5TC 1ZLAB 1EQZB 5GT0B 2IO5B 1P3LC 2FJ7D 4WNNB 3AZKC 4CAYB 1KX4C 1BFMA 5GXQA 5GT0A 1ZLAA 1EQZD 1KX4B 3WA9A 4XZQA 5AY8A 3X1SC 1F66A 5AVCD 3AZHA 4H9OB 3LELA 1P3IC 5DNMA 5DNMB 2F8NK 3LELB 5B0YA 1TZYD 3AZHB 3MNNA 4EO5C 5CPJD 3KXBB 5DNMC 3AZJA 3LZ0C 4XUJC 3AV1C 1KX4D 5JRGA 5B32C 3AZGB 1ID3A 3AZJB 3MNNB 1P3BC 5B1MC 3AYWC 4CAYA 4DRAA 1S32C 4WNNA 3UTAC 3VH6A 4YS3B 1HQ3C 4H9NA 5B1LD 3REID 5G49B 5AV5A 5DNMD 4Z66A 3AZFC 4AWLB 3AN2B 5CPKD 1P3LA 5AV6D 1F66B 3MGPC 5AY8B 3RELB 1F1EA 5GXQC 4KUDA 3LZ1A 3AZEB 1KX4A 2NZDC 4J8WA 2BYKA 2IO5C 1P3KA 5B2JA 5GXQB 3X1SD 3W97B 3MGRA 1R4VA 3B0BA 3MGPA 1KX3A 2CV5A 4H9PA 1P3FD 5B33B 4J8UC 3C1CB 4WU9C 3KXBD 3AZNA 3REKC 1N1JA 3AV2C 3AZIB 3W99C 3W96B 1P3IB 4XUJD 3AV1D 4UUZA 4LD9B 2YFVA 4ZUXA 2HUEC 1ID3C 2NZDD 3V9RA 3W96D 3B0CW 4J8XA 5JRGC 4X23A 5B32G 4ZUXC 5B31A 3KUYA 1AOIC 2NQBA 1P3FB 3VH5T 3TU4A 4HGAB 4G92C 5CPKC 1TAFA 1KX3C 3UTAB 3X1UC 3C1BC 5CP6C 4WV4B 3MGQD 1HQ3B 3AZKD 3REIC 1P3OB 5B32D 2AROC 3MGSC 5AY8D 2NZDA 1F66C 3LZ1C 4H9QB 3WKJC 4J8XD 1P3KC 5F99A 4H9RB 5B32B 1M18C 5DNND 5BO0B 4Z66C 1TZYC 4NE3A 4Z5TA 3TU4D 2HUEB 3MGSA 3MNND 3AZFA 3MGSB 2HIOC 3AZMD 2JSSA 1TAFB 4QLCD 3NQUB 3O62D 5GXQD 4YM6A 3X1SB 5GT0D 5B32A 3B6GD 3X1TC 4XZQD 4J8VB 2NZDB 2AROA 5B24D 5AV6B 5AVCA 3REIA 5B0ZC 3KUYC 5B1MD 4XUJB 3AV1B 3REIB 4UUZB 5AVCB 5AV6A 4Z5TD 4KHAB 1AOIA 2PYOA 1M19B 1KU5A 5AV9C 2NQBC 4XZQC 3MVDC 3AZJD 3KUYB 4YM6B 3NQUA 3X1SA 4E45A 5B0ZD 3WTPE 3B6GA 4Z2MH 1P3PA 3X1TD 5B2JB 4KGCC 1Q9CA 5B1MB 2BYKB 5AV5D 3AZND 3W97C 5KDMA 5F99B 1WWIA 3AZMC 4WZSB 3AN2A 4Z66B 1M18D 5B2IA 1P3OA 1KX3B 3MGPB 2FJ7C 2HIOA 3MGRC 3W97A 4AWLC 3WKJD 1P3PD 5B31D 3TU4B 4JJND 1KX3D 2CV5D 3B6GC 3W98D 3RELA 5CP6D 5CPJC 4J8XB 3WTPB 5GT3D 5GSUC 2BYMA 4H9SA 5G49A 4CSRB 3B6FB 3AZKB 1P3AB 5B24B 1P3OD 2PYOC 4LD9A 4J8VD 3AFAD 3C1CC 5C3IB 1BH9A 3W96A 3AZLB 5AVBD 1KX5A 2L5AA 5DNNA 1ID3B 5B33D 5BT1D 5B31C 4JJNA 3MVDD 4QLCB 3AZJC 4ZBJC 1P3BD 5B0YC 3WA9C 3REKD 3AV2D 1U35C 3REHD 3MGQA 1BH8B 4KUDB 3VH5W 3AZIA 5GT0C 4G91C 4XZQB 4J8UA 3MGQB 2FJ7A 5B40A 1U35A 4WU8B 5B0ZB 5GSUD 4WU8A 5B40B 3AZMA 1EQZA 4J8WC 3NQJB 4NFTA 4QLCA 1ZLAD 2F8NH 4JJNC 2F8NG 4J8UB 5AVBB 5CPJB 3W99D 3KXBC 3LELD 1P34C 5B0YB 1F66D 5FUGB 1P3PC 3B6FD 5B24A 4LD9C 1P3GC 5E5AD 4YS3A 1P34B 5GT3B 3KSYA 4NE5A 3WTPD 5B0YD 2BYMB 4H9OA 4NE6A 5AVBC 5AV9A 5C3IC 3B0DC 5CPID 3UTBB 3UT9B 5B33C 5CPJA 1AOID
chains in the Genus database with same CATH superfamily
3AZGA 2J8PA 5AV8C 2JE5A 2XD1A 3O62C 3NQJA 3AZMB 1KX5B 3P5JB 4ZBJB 1ID3D 1EQZC 5AV9B 5B0ZA 3REJD 1BH9B 4WU8C 1P3AA 3B6FA 3W98C 3B0CT 4CSRA 5CPIC 1HTAA 5FUGA 3WTPA 4E44A 3LJAC 3LZ1D 3WAAB 1H3OA 3A6ND 2F8ND 1BH8A 2YFWA 1ZLAC 5B1LB 1A7WA 3LZ0D 5B2ID 3AFAA 1M1AC 3REJA 5F99C 3W97D 2HIOB 1U35B 4M6BA 2FJ7B 5B2IB 1M1AB 3MGPD 1PZRA 3LZ0B 3R45A 1P3BA 3KWQA 5DNNB 3A6NB 2F8NB 3W98A 1P3AC 2PYOB 2ZY4A 4XUJA 3AV1A 4DRBA 2Y2GA 1P3GB 4H9SC 5AV8A 3AZID 1M19C 5CP6B 3B6GB 1B6WA 5DNNC 4J8VA 3UTAD 5JA4B 2NQBD 3LJAB 5AY8C 4JJNB 3RELC 2Y2PA 3KUYD 3O62B 3MVDB 3X1VB 5B40D 4X23C 5BNXB 3WKJB 4YM6C 3AZLA 3LJAD 3UTBD 1AOIB 5GSUA 2RVQC 4Z2MG 4YS3C 3REJC 4WU8D 4Z5TB 3AZKA 2LY8A 1P3MA 3REKA 3AV2A 3AZNC 5E5AB 2F2AC 3X1UB 3C1BB 3REHA 4WU9A 3W99A 4QLCC 1P3ID 4R8PC 5CPKB 3W99B 5KDMB 3REHB 1HQ3D 5B1LC 2CV5C 5E5AA 4YS3D 3X1TB 4R8PA 3AZFD 3A1KA 3B6FC 1U35D 3REHC 5AV9D 1P3PB 5CPIA 3MGSD 4YM6D 2Y2QA 4R8PB 5BNVB 4KGCA 5BS7A 3WA9D 3O62A 1M18B 3MGQC 1WWSA 4WU9D 3AZIC 1M19D 3WAAC 1TZYB 3AZHD 1P3MC 2AROD 4X23B 3AZEC 4KHAA 1P3AD 1JFIA 3AYWA 1S32A 5AV5C 2DF4C 5B1MA 1HQ3A 1P3MB 4J8VC 2JCHA 2PYOD 1JFIB 2AROB 3AZLC 3A6NA 5JRGD 2F8NA 1KX5C 3W98B 5GT3C 3MNNC 1P3BB 5AVCC 3C1CA 1M1AD 5AV6C 3LZ0A 3AZGD 5B31B 3VH6T 5JA4A 3X1VC 3UTBC 3W96C 1M19A 5CPIB 5AV8B 3AZFB 3AZHC 3AFAB 4DQYB 3B0DB 3X1TA 5BO0A 2RIQA 3KWQC 5BT1C 4J8WB 3AYWB 1S32B 2YFWB 1P3LD 3LZ1B 3AZEA 4H9RA 3VH6W 3WAAA 4KUDC 1TZYA 3AN2D 3X1UD 3KWQB 3C1BD 4J8WD 1M18A 4WU9B 5BS7C 3AFAC 4H9PB 5B2JD 2ZM5A 3C1CD 3REKB 5BNVA 3AV2B 2CV5B 1M1AA 4KGCB 2Y2JA 5AV8D 3REJB 2HIOD 5GSUB 3UTAA 1P3OC 1B67A 5BNXA 3WKJA 5B1LA 3X1VA 3WTPC 2G5IC 2NQBB 3UT9D 4Z66D 5JRGB 2RVQD 5B31G 1H3OB 3LJAA 3IP4C 4G91B 3UTBA 3AZED 3TU4C 3KWQD 4H9QA 5CPKA 3RELD 3WAAD 5CP6A 1P34D 3X1UA 3C1BA 1P3GD 4KUDD 5GT3A 5AV5B 4HGAC 4G92B 3A6NC 4ZUXB 4LD9D 4H9NB 2YFVB 4J8XC 1P3KD 1P3FC 1P3IA 5CHLB 4EO5B 3LELC 3UT9C 3MGRD 5B24C 5AVBA 1KX5D 3MVDA 3R45B 3AZGC 3WA9B 1P3FA 3X1VD 5B33A 4R8PD 3UT9A 3KXBA 1ULYA 2BG1A 2CWEA 3MGRB 3AZLD 3H0MC 3V9RB 4KGCD 3VH5A 1P34A 3EG5B 1P3GA 1P3KB 5B2JC 3EPKA 4ZUXD 1P3MD 5B2IC 3AN2C 5B40C 1N1JB 5F99D 4X23D 3AZNB 3AYWD 5E5AC 1S32D 1P3LB 4J8UD 4Z5TC 1ZLAB 1EQZB 5GT0B 2IO5B 1P3LC 2FJ7D 4WNNB 3AZKC 2UWXA 4CAYB 1KX4C 1BFMA 5GXQA 2Y2OA 5GT0A 2Y2LA 1ZLAA 2Y2KA 2VQRA 1EQZD 1KX4B 3WA9A 4XZQA 5AY8A 3X1SC 1F66A 5AVCD 3AZHA 4H9OB 3LELA 1P3IC 3KFUG 5DNMA 5DNMB 2F8NK 3LELB 5B0YA 1TZYD 3AZHB 3MNNA 4EO5C 5CPJD 3KXBB 5DNMC 2Y2IA 3AZJA 3LZ0C 4XUJC 3AV1C 1KX4D 5JRGA 5B32C 3H0LC 3AZGB 1ID3A 3AZJB 3MNNB 1P3BC 5B1MC 3AYWC 4CAYA 4DRAA 1S32C 4WNNA 3UTAC 3VH6A 3EPLA 4YS3B 1HQ3C 4H9NA 5B1LD 3REID 5G49B 5AV5A 5DNMD 4Z66A 3AZFC 4AWLB 3AN2B 5CPKD 1P3LA 5AV6D 4UPKA 3FDDA 1F66B 3MGPC 5AY8B 3RELB 1F1EA 5GXQC 4KUDA 3LZ1A 3AZEB 1KX4A 2NZDC 4J8WA 2BYKA 4WJ3C 2IO5C 1P3KA 5B2JA 5GXQB 3X1SD 3W97B 3MGRA 2Y2HA 2Y2MA 1R4VA 3B0BA 3MGPA 1KX3A 2CV5A 4H9PA 1P3FD 5B33B 4J8UC 3C1CB 1Z2CB 4WU9C 3KXBD 3AZNA 3REKC 1N1JA 3AV2C 3AZIB 3W99C 2XD5A 3W96B 1P3IB 4XUJD 3AV1D 4UUZA 4LD9B 2YFVA 4ZUXA 2Y2NA 2HUEC 1ID3C 2NZDD 3V9RA 3W96D 2DQNC 3B0CW 4J8XA 5JRGC 4X23A 5B32G 4ZUXC 5B31A 3KUYA 1AOIC 2NQBA 1P3FB 2ZY2A 3VH5T 3TU4A 4HGAB 4G92C 5CPKC 1TAFA 1KX3C 3UTAB 3X1UC 3C1BC 5CP6C 4WV4B 3MGQD 1HQ3B 3AZKD 3REIC 1P3OB 5B32D 2AROC 3MGSC 5AY8D 2NZDA 1F66C 3LZ1C 4H9QB 3WKJC 4J8XD 1P3KC 5F99A 4H9RB 5B32B 1M18C 5DNND 3A1IA 5BO0B 4Z66C 1TZYC 4NE3A 4Z5TA 3TU4D 2HUEB 3MGSA 3MNND 3AZFA 3MGSB 2HIOC 3AZMD 2JSSA 1TAFB 4QLCD 3X1SB 3NQUB 5GXQD 4YM6A 3O62D 5GT0D 5B32A 3EPHA 3B6GD 3X1TC 2ZY3A 4XZQD 4J8VB 2NZDB 2AROA 5B24D 5AV6B 5AVCA 3REIA 5B0ZC 3KUYC 3F6TA 5B1MD 4XUJB 3AV1B 3REIB 4UUZB 2G5HC 5AVCB 4Z5TD 4KHAB 5AV6A 1AOIA 2PYOA 1M19B 1KU5A 5AV9C 2NQBC 4XZQC 3MVDC 3EPJA 3AZJD 3KUYB 4YM6B 3NQUA 3X1SA 4E45A 5B0ZD 3WTPE 3B6GA 4Z2MH 1P3PA 3X1TD 5B2JB 4KGCC 1Q9CA 5B1MB 2BYKB 5AV5D 2FFFB 3AZND 3W97C 5KDMA 5F99B 3H0RC 1WWIA 3AZMC 4WZSB 3AN2A 4Z66B 1M18D 5B2IA 1P3OA 1KX3B 3MGPB 2FJ7C 2HIOA 3MGRC 3W97A 4AWLC 3WKJD 1P3PD 5B31D 3TU4B 1T3UA 4JJND 1KX3D 2CV5D 3B6GC 3W98D 3RELA 2W8SA 5CP6D 5CPJC 4J8XB 3WTPB 5GT3D 5GSUC 2BYMA 4H9SA 5G49A 4CSRB 3B6FB 3AZKB 1P3AB 5B24B 1P3OD 2PYOC 4LD9A 4J8VD 3AFAD 3C1CC 1W2EA 1BH9A 3W96A 5C3IB 3AZLB 5AVBD 1KX5A 2L5AA 5DNNA 1ID3B 5B33D 5BT1D 5B31C 4JJNA 3MVDD 4QLCB 3AZJC 4ZBJC 1P3BD 5B0YC 3WA9C 3REKD 3AV2D 1U35C 3REHD 3MGQA 1BH8B 4KUDB 3VH5W 3AZIA 5GT0C 4G91C 4XZQB 4J8UA 2ZY5A 3MGQB 2FJ7A 5B40A 1U35A 4WU8B 5B0ZB 5GSUD 4WU8A 5B40B 3AZMA 1EQZA 4J8WC 3NQJB 4NFTA 4QLCA 1ZLAD 2F8NH 4JJNC 2F8NG 4J8UB 5AVBB 5CPJB 3W99D 3KXBC 3LELD 1P34C 5B0YB 1F66D 5FUGB 1P3PC 3B6FD 5B24A 4LD9C 1P3GC 5E5AD 4YS3A 1P34B 5GT3B 3KSYA 4NE5A 3WTPD 5B0YD 2BYMB 4H9OA 4NE6A 5AVBC 5AV9A 5C3IC 3AL0C 3B0DC 5CPID 3UTBB 3UT9B 5B33C 5CPJA 1AOID
chains in the Genus database with same CATH topology
3AZGA 2J8PA 5AV8C 2JE5A 2XD1A 3O62C 3NQJA 3AZMB 1KX5B 3P5JB 4ZBJB 1ID3D 1EQZC 5AV9B 5B0ZA 3REJD 1BH9B 4WU8C 1P3AA 3B6FA 3W98C 3B0CT 4CSRA 5CPIC 1HTAA 5FUGA 3WTPA 4E44A 3LJAC 3LZ1D 3WAAB 1H3OA 3A6ND 2F8ND 1BH8A 2YFWA 1ZLAC 5B1LB 1A7WA 3LZ0D 5B2ID 3AFAA 1M1AC 3REJA 5F99C 3W97D 2HIOB 1U35B 4M6BA 2FJ7B 5B2IB 1M1AB 3MGPD 1PZRA 3LZ0B 3R45A 1P3BA 3KWQA 5DNNB 3A6NB 2F8NB 3W98A 1P3AC 2PYOB 2ZY4A 4XUJA 3AV1A 4DRBA 2Y2GA 1P3GB 4H9SC 5AV8A 3AZID 1M19C 5CP6B 3B6GB 1B6WA 5DNNC 4J8VA 3UTAD 5JA4B 2NQBD 3LJAB 5AY8C 4JJNB 3RELC 2Y2PA 3KUYD 3O62B 3MVDB 3X1VB 5B40D 4X23C 5BNXB 3WKJB 4YM6C 3AZLA 3LJAD 3UTBD 1AOIB 5GSUA 2RVQC 4Z2MG 4YS3C 3REJC 4WU8D 4Z5TB 3AZKA 2LY8A 1P3MA 3REKA 3AV2A 3AZNC 5E5AB 2F2AC 3X1UB 3C1BB 3REHA 4WU9A 3W99A 4QLCC 1P3ID 4R8PC 5CPKB 3W99B 5KDMB 3REHB 1HQ3D 5B1LC 2CV5C 5E5AA 4YS3D 3X1TB 4R8PA 3AZFD 3A1KA 3B6FC 1U35D 3REHC 5AV9D 1P3PB 5CPIA 3MGSD 4YM6D 2Y2QA 4R8PB 5BNVB 4KGCA 5BS7A 3WA9D 3O62A 1M18B 3MGQC 1WWSA 4WU9D 3AZIC 1M19D 3WAAC 1TZYB 3AZHD 1P3MC 2AROD 4X23B 3AZEC 4KHAA 1P3AD 1JFIA 3AYWA 1S32A 5AV5C 2DF4C 5B1MA 1HQ3A 1P3MB 4J8VC 2JCHA 2PYOD 1JFIB 2AROB 3AZLC 3A6NA 5JRGD 2F8NA 1KX5C 3W98B 5GT3C 3MNNC 1P3BB 5AVCC 3C1CA 1M1AD 5AV6C 3LZ0A 3AZGD 5B31B 3VH6T 5JA4A 3X1VC 3UTBC 3W96C 1M19A 5CPIB 5AV8B 3AZFB 3AZHC 3AFAB 4DQYB 3B0DB 3X1TA 5BO0A 2RIQA 3KWQC 5BT1C 4J8WB 3AYWB 1S32B 2YFWB 1P3LD 3LZ1B 3AZEA 4H9RA 3VH6W 3WAAA 4KUDC 1TZYA 3AN2D 3X1UD 3KWQB 3C1BD 4J8WD 1M18A 4WU9B 5BS7C 3AFAC 4H9PB 5B2JD 2ZM5A 3C1CD 3REKB 5BNVA 3AV2B 2CV5B 1M1AA 4KGCB 2Y2JA 5AV8D 3REJB 2HIOD 5GSUB 3UTAA 1P3OC 1B67A 5BNXA 3WKJA 5B1LA 3X1VA 3WTPC 2G5IC 2NQBB 3UT9D 4Z66D 5JRGB 2RVQD 5B31G 1H3OB 3LJAA 3IP4C 4G91B 3UTBA 3AZED 3TU4C 3KWQD 4H9QA 5CPKA 3RELD 3WAAD 5CP6A 1P34D 3X1UA 3C1BA 1P3GD 4KUDD 5GT3A 5AV5B 4HGAC 4G92B 3A6NC 4ZUXB 4LD9D 4H9NB 2YFVB 4J8XC 1P3KD 1P3FC 1P3IA 5CHLB 4EO5B 3LELC 3UT9C 3MGRD 5B24C 5AVBA 1KX5D 3MVDA 3R45B 3AZGC 3WA9B 1P3FA 3X1VD 5B33A 4R8PD 3UT9A 3KXBA 1ULYA 2BG1A 2CWEA 3MGRB 3AZLD 3H0MC 3V9RB 4KGCD 3VH5A 1P34A 3EG5B 1P3GA 1P3KB 5B2JC 3EPKA 4ZUXD 1P3MD 5B2IC 3AN2C 5B40C 1N1JB 5F99D 4X23D 3AZNB 3AYWD 5E5AC 1S32D 1P3LB 4J8UD 4Z5TC 1ZLAB 1EQZB 5GT0B 2IO5B 1P3LC 2FJ7D 4WNNB 3AZKC 2UWXA 4CAYB 1KX4C 1BFMA 5GXQA 2Y2OA 5GT0A 2Y2LA 1ZLAA 2Y2KA 2VQRA 1EQZD 1KX4B 3WA9A 4XZQA 5AY8A 3X1SC 1F66A 5AVCD 3AZHA 4H9OB 3LELA 1P3IC 3KFUG 5DNMA 5DNMB 2F8NK 3LELB 5B0YA 1TZYD 3AZHB 3MNNA 4EO5C 5CPJD 3KXBB 5DNMC 2Y2IA 3AZJA 3LZ0C 4XUJC 3AV1C 1KX4D 5JRGA 5B32C 3H0LC 3AZGB 1ID3A 3AZJB 3MNNB 1P3BC 5B1MC 3AYWC 4CAYA 4DRAA 1S32C 4WNNA 3UTAC 3VH6A 3EPLA 4YS3B 1HQ3C 4H9NA 5B1LD 3REID 5G49B 5AV5A 5DNMD 4Z66A 3AZFC 4AWLB 3AN2B 5CPKD 1P3LA 5AV6D 4UPKA 3FDDA 1F66B 3MGPC 5AY8B 3RELB 1F1EA 5GXQC 4KUDA 3LZ1A 3AZEB 1KX4A 2NZDC 4J8WA 2BYKA 4WJ3C 2IO5C 1P3KA 5B2JA 5GXQB 3X1SD 3W97B 3MGRA 2Y2HA 2Y2MA 1R4VA 3B0BA 3MGPA 1KX3A 2CV5A 4H9PA 1P3FD 5B33B 4J8UC 3C1CB 1Z2CB 4WU9C 3KXBD 3AZNA 3REKC 1N1JA 3AV2C 3AZIB 3W99C 2XD5A 3W96B 1P3IB 4XUJD 3AV1D 4UUZA 4LD9B 2YFVA 4ZUXA 2Y2NA 2HUEC 1ID3C 2NZDD 3V9RA 3W96D 2DQNC 3B0CW 4J8XA 5JRGC 4X23A 5B32G 4ZUXC 5B31A 3KUYA 1AOIC 2NQBA 1P3FB 2ZY2A 3VH5T 3TU4A 4HGAB 4G92C 5CPKC 1TAFA 1KX3C 3UTAB 3X1UC 3C1BC 5CP6C 4WV4B 3MGQD 1HQ3B 3AZKD 3REIC 1P3OB 5B32D 2AROC 3MGSC 5AY8D 2NZDA 1F66C 3LZ1C 4H9QB 3WKJC 4J8XD 1P3KC 5F99A 4H9RB 5B32B 1M18C 5DNND 3A1IA 5BO0B 4Z66C 1TZYC 4NE3A 4Z5TA 3TU4D 2HUEB 3MGSA 3MNND 3AZFA 3MGSB 2HIOC 3AZMD 2JSSA 1TAFB 4QLCD 3X1SB 3NQUB 5GXQD 4YM6A 3O62D 5GT0D 5B32A 3EPHA 3B6GD 3X1TC 2ZY3A 4XZQD 4J8VB 2NZDB 2AROA 5B24D 5AV6B 5AVCA 3REIA 5B0ZC 3KUYC 3F6TA 5B1MD 4XUJB 3AV1B 3REIB 4UUZB 2G5HC 5AVCB 4Z5TD 4KHAB 5AV6A 1AOIA 2PYOA 1M19B 1KU5A 5AV9C 2NQBC 4XZQC 3MVDC 3EPJA 3AZJD 3KUYB 4YM6B 3NQUA 3X1SA 4E45A 5B0ZD 3WTPE 3B6GA 4Z2MH 1P3PA 3X1TD 5B2JB 4KGCC 1Q9CA 5B1MB 2BYKB 5AV5D 2FFFB 3AZND 3W97C 5KDMA 5F99B 3H0RC 1WWIA 3AZMC 4WZSB 3AN2A 4Z66B 1M18D 5B2IA 1P3OA 1KX3B 3MGPB 2FJ7C 2HIOA 3MGRC 3W97A 4AWLC 3WKJD 1P3PD 5B31D 3TU4B 1T3UA 4JJND 1KX3D 2CV5D 3B6GC 3W98D 3RELA 2W8SA 5CP6D 5CPJC 4J8XB 3WTPB 5GT3D 5GSUC 2BYMA 4H9SA 5G49A 4CSRB 3B6FB 3AZKB 1P3AB 5B24B 1P3OD 2PYOC 4LD9A 4J8VD 3AFAD 3C1CC 1W2EA 1BH9A 3W96A 5C3IB 3AZLB 5AVBD 1KX5A 2L5AA 5DNNA 1ID3B 5B33D 5BT1D 5B31C 4JJNA 3MVDD 4QLCB 3AZJC 4ZBJC 1P3BD 5B0YC 3WA9C 3REKD 3AV2D 1U35C 3REHD 3MGQA 1BH8B 4KUDB 3VH5W 3AZIA 5GT0C 4G91C 4XZQB 4J8UA 2ZY5A 3MGQB 2FJ7A 5B40A 1U35A 4WU8B 5B0ZB 5GSUD 4WU8A 5B40B 3AZMA 1EQZA 4J8WC 3NQJB 4NFTA 4QLCA 1ZLAD 2F8NH 4JJNC 2F8NG 4J8UB 5AVBB 5CPJB 3W99D 3KXBC 3LELD 1P34C 5B0YB 1F66D 5FUGB 1P3PC 3B6FD 5B24A 4LD9C 1P3GC 5E5AD 4YS3A 1P34B 5GT3B 3KSYA 4NE5A 3WTPD 5B0YD 2BYMB 4H9OA 4NE6A 5AVBC 5AV9A 5C3IC 3AL0C 3B0DC 5CPID 3UTBB 3UT9B 5B33C 5CPJA 1AOID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZG A;  5AV8 C;  3O62 C;  3NQJ A;  3AZM B;  1KX5 B;  1ID3 D;  4ZBJ B;  1EQZ C;  5AV9 B;  5B0Z A;  3REJ D;  1BH9 B;  4WU8 C;  1P3A A;  3B6F A;  3W98 C;  3B0C T;  4CSR A;  5CPI C;  1HTA A;  5FUG A;  3WTP A;  4E44 A;  3LJA C;  3LZ1 D;  3WAA B;  1H3O A;  3A6N D;  2F8N D;  1BH8 A;  2YFW A;  1ZLA C;  5B1L B;  1A7W A;  3LZ0 D;  5B2I D;  3AFA A;  1M1A C;  3REJ A;  5F99 C;  3W97 D;  2HIO B;  1U35 B;  4M6B A;  2FJ7 B;  5B2I B;  1M1A B;  3MGP D;  3LZ0 B;  3R45 A;  1P3B A;  3KWQ A;  5DNN B;  3A6N B;  2F8N B;  3W98 A;  1P3A C;  2PYO B;  4XUJ A;  3AV1 A;  4DRB A;  1P3G B;  4H9S C;  5AV8 A;  3AZI D;  1M19 C;  5CP6 B;  3B6G B;  1B6W A;  5DNN C;  4J8V A;  3UTA D;  5JA4 B;  2NQB D;  3LJA B;  5AY8 C;  4JJN B;  3REL C;  3KUY D;  3O62 B;  3MVD B;  3X1V B;  5B40 D;  4X23 C;  5BNX B;  3WKJ B;  4YM6 C;  3AZL A;  3LJA D;  3UTB D;  1AOI B;  5GSU A;  2RVQ C;  4Z2M G;  4YS3 C;  3REJ C;  4WU8 D;  4Z5T B;  3AZK A;  2LY8 A;  1P3M A;  3REK A;  3AV2 A;  3AZN C;  5E5A B;  3X1U B;  3C1B B;  3REH A;  4WU9 A;  3W99 A;  4QLC C;  1P3I D;  4R8P C;  5CPK B;  3W99 B;  5KDM B;  3REH B;  1HQ3 D;  5B1L C;  2CV5 C;  5E5A A;  4YS3 D;  3X1T B;  4R8P A;  3AZF D;  3B6F C;  1U35 D;  3REH C;  5AV9 D;  1P3P B;  5CPI A;  3MGS D;  4YM6 D;  4R8P B;  5BNV B;  4KGC A;  5BS7 A;  3WA9 D;  3O62 A;  1M18 B;  3MGQ C;  1WWS A;  4WU9 D;  3AZI C;  1M19 D;  3WAA C;  1TZY B;  3AZH D;  1P3M C;  2ARO D;  4X23 B;  3AZE C;  4KHA A;  1P3A D;  1JFI A;  3AYW A;  1S32 A;  5AV5 C;  5B1M A;  1HQ3 A;  1P3M B;  4J8V C;  2PYO D;  1JFI B;  2ARO B;  3AZL C;  3A6N A;  5JRG D;  2F8N A;  1KX5 C;  3W98 B;  5GT3 C;  3MNN C;  1P3B B;  5AVC C;  3C1C A;  1M1A D;  5AV6 C;  3LZ0 A;  3AZG D;  5B31 B;  3VH6 T;  5JA4 A;  3X1V C;  3UTB C;  3W96 C;  1M19 A;  5CPI B;  5AV8 B;  3AZF B;  3AZH C;  3AFA B;  3B0D B;  3X1T A;  5BO0 A;  3KWQ C;  5BT1 C;  4J8W B;  3AYW B;  1S32 B;  2YFW B;  1P3L D;  3LZ1 B;  3AZE A;  4H9R A;  3VH6 W;  3WAA A;  4KUD C;  1TZY A;  3AN2 D;  3X1U D;  3KWQ B;  3C1B D;  4J8W D;  1M18 A;  4WU9 B;  5BS7 C;  3AFA C;  4H9P B;  5B2J D;  3C1C D;  2CV5 B;  3REK B;  5BNV A;  3AV2 B;  1M1A A;  4KGC B;  5AV8 D;  3REJ B;  2HIO D;  5GSU B;  3UTA A;  1P3O C;  1B67 A;  5BNX A;  3WKJ A;  5B1L A;  3X1V A;  3WTP C;  2NQB B;  3UT9 D;  4Z66 D;  5JRG B;  2RVQ D;  5B31 G;  1H3O B;  3LJA A;  4G91 B;  3UTB A;  3AZE D;  3TU4 C;  3KWQ D;  4H9Q A;  5CPK A;  3REL D;  3WAA D;  5CP6 A;  1P34 D;  3X1U A;  3C1B A;  1P3G D;  4KUD D;  5GT3 A;  5AV5 B;  4HGA C;  4G92 B;  3A6N C;  4ZUX B;  4LD9 D;  4H9N B;  2YFV B;  4J8X C;  1P3K D;  1P3F C;  1P3I A;  5CHL B;  4EO5 B;  3LEL C;  3UT9 C;  3MGR D;  5B24 C;  5AVB A;  1KX5 D;  3MVD A;  3R45 B;  3AZG C;  3WA9 B;  1P3F A;  3X1V D;  5B33 A;  4R8P D;  3UT9 A;  3KXB A;  1ULY A;  2CWE A;  3MGR B;  3AZL D;  3V9R B;  4KGC D;  3VH5 A;  1P34 A;  1P3G A;  1P3K B;  5B2J C;  4ZUX D;  1P3M D;  5B2I C;  3AN2 C;  5B40 C;  1N1J B;  5F99 D;  4X23 D;  3AZN B;  3AYW D;  5E5A C;  1S32 D;  1P3L B;  4J8U D;  4Z5T C;  1ZLA B;  1EQZ B;  5GT0 B;  2IO5 B;  1P3L C;  2FJ7 D;  4WNN B;  3AZK C;  4CAY B;  1KX4 C;  1BFM A;  5GXQ A;  5GT0 A;  1ZLA A;  1EQZ D;  1KX4 B;  3WA9 A;  4XZQ A;  5AY8 A;  3X1S C;  1F66 A;  5AVC D;  3AZH A;  4H9O B;  3LEL A;  1P3I C;  5DNM A;  5DNM B;  2F8N K;  3LEL B;  5B0Y A;  1TZY D;  3AZH B;  3MNN A;  4EO5 C;  5CPJ D;  3KXB B;  5DNM C;  3AZJ A;  3LZ0 C;  4XUJ C;  3AV1 C;  1KX4 D;  5JRG A;  5B32 C;  3AZG B;  1ID3 A;  3AZJ B;  3MNN B;  1P3B C;  5B1M C;  3AYW C;  4CAY A;  4DRA A;  1S32 C;  4WNN A;  3UTA C;  3VH6 A;  4YS3 B;  1HQ3 C;  4H9N A;  5B1L D;  3REI D;  5G49 B;  5AV5 A;  5DNM D;  4Z66 A;  3AZF C;  4AWL B;  3AN2 B;  5CPK D;  1P3L A;  5AV6 D;  1F66 B;  3MGP C;  5AY8 B;  3REL B;  1F1E A;  5GXQ C;  4KUD A;  3LZ1 A;  3AZE B;  1KX4 A;  2NZD C;  4J8W A;  2BYK A;  2IO5 C;  1P3K A;  5B2J A;  5GXQ B;  3X1S D;  3W97 B;  3MGR A;  1R4V A;  3B0B A;  3MGP A;  1KX3 A;  2CV5 A;  4H9P A;  1P3F D;  5B33 B;  4J8U C;  3C1C B;  4WU9 C;  3KXB D;  3AZN A;  3REK C;  1N1J A;  3AV2 C;  3AZI B;  3W99 C;  3W96 B;  1P3I B;  4XUJ D;  3AV1 D;  4UUZ A;  4LD9 B;  2YFV A;  4ZUX A;  2HUE C;  1ID3 C;  2NZD D;  3V9R A;  3W96 D;  3B0C W;  4J8X A;  5JRG C;  4X23 A;  5B32 G;  4ZUX C;  5B31 A;  3KUY A;  1AOI C;  2NQB A;  1P3F B;  3VH5 T;  3TU4 A;  4HGA B;  4G92 C;  5CPK C;  1TAF A;  1KX3 C;  3UTA B;  3X1U C;  3C1B C;  5CP6 C;  4WV4 B;  3MGQ D;  1HQ3 B;  3AZK D;  3REI C;  1P3O B;  5B32 D;  2ARO C;  3MGS C;  5AY8 D;  2NZD A;  1F66 C;  3LZ1 C;  4H9Q B;  3WKJ C;  4J8X D;  1P3K C;  5F99 A;  4H9R B;  5B32 B;  1M18 C;  5DNN D;  5BO0 B;  4Z66 C;  1TZY C;  4NE3 A;  4Z5T A;  3TU4 D;  2HUE B;  3MGS A;  3MNN D;  3AZF A;  3MGS B;  2HIO C;  3AZM D;  2JSS A;  1TAF B;  4QLC D;  3NQU B;  3O62 D;  5GXQ D;  4YM6 A;  3X1S B;  5GT0 D;  5B32 A;  3B6G D;  3X1T C;  4XZQ D;  4J8V B;  2NZD B;  2ARO A;  5B24 D;  5AV6 B;  5AVC A;  3REI A;  5B0Z C;  3KUY C;  5B1M D;  4XUJ B;  3AV1 B;  3REI B;  4UUZ B;  5AVC B;  5AV6 A;  4Z5T D;  4KHA B;  1AOI A;  2PYO A;  1M19 B;  1KU5 A;  5AV9 C;  2NQB C;  4XZQ C;  3MVD C;  3AZJ D;  3KUY B;  4YM6 B;  3NQU A;  3X1S A;  4E45 A;  5B0Z D;  3WTP E;  3B6G A;  4Z2M H;  1P3P A;  3X1T D;  5B2J B;  4KGC C;  1Q9C A;  5B1M B;  2BYK B;  5AV5 D;  3AZN D;  3W97 C;  5KDM A;  5F99 B;  1WWI A;  3AZM C;  4WZS B;  3AN2 A;  4Z66 B;  1M18 D;  5B2I A;  1P3O A;  1KX3 B;  3MGP B;  2FJ7 C;  2HIO A;  3MGR C;  3W97 A;  4AWL C;  3WKJ D;  1P3P D;  5B31 D;  3TU4 B;  4JJN D;  1KX3 D;  2CV5 D;  3B6G C;  3W98 D;  3REL A;  5CP6 D;  5CPJ C;  4J8X B;  3WTP B;  5GT3 D;  5GSU C;  2BYM A;  4H9S A;  5G49 A;  4CSR B;  3B6F B;  3AZK B;  1P3A B;  5B24 B;  1P3O D;  2PYO C;  4LD9 A;  4J8V D;  3AFA D;  3C1C C;  5C3I B;  1BH9 A;  3W96 A;  3AZL B;  5AVB D;  1KX5 A;  2L5A A;  5DNN A;  1ID3 B;  5B33 D;  5BT1 D;  5B31 C;  4JJN A;  3MVD D;  4QLC B;  3AZJ C;  4ZBJ C;  1P3B D;  5B0Y C;  3WA9 C;  3REK D;  3AV2 D;  1U35 C;  3REH D;  3MGQ A;  1BH8 B;  4KUD B;  3VH5 W;  3AZI A;  5GT0 C;  4G91 C;  4XZQ B;  4J8U A;  3MGQ B;  2FJ7 A;  5B40 A;  1U35 A;  4WU8 B;  5B0Z B;  5GSU D;  4WU8 A;  5B40 B;  3AZM A;  1EQZ A;  4J8W C;  3NQJ B;  4NFT A;  4QLC A;  1ZLA D;  2F8N H;  4JJN C;  2F8N G;  4J8U B;  5AVB B;  5CPJ B;  3W99 D;  3KXB C;  3LEL D;  1P34 C;  5B0Y B;  1F66 D;  5FUG B;  1P3P C;  3B6F D;  5B24 A;  4LD9 C;  1P3G C;  5E5A D;  4YS3 A;  1P34 B;  5GT3 B;  3KSY A;  4NE5 A;  3WTP D;  5B0Y D;  2BYM B;  4H9O A;  4NE6 A;  5AVB C;  5AV9 A;  5C3I C;  3B0D C;  5CPI D;  3UTB B;  3UT9 B;  5B33 C;  5CPJ A;  1AOI D; 
#chains in the Genus database with same CATH topology
 3AZG A;  2J8P A;  5AV8 C;  2JE5 A;  2XD1 A;  3O62 C;  3NQJ A;  3AZM B;  1KX5 B;  3P5J B;  4ZBJ B;  1ID3 D;  1EQZ C;  5AV9 B;  5B0Z A;  3REJ D;  1BH9 B;  4WU8 C;  1P3A A;  3B6F A;  3W98 C;  3B0C T;  4CSR A;  5CPI C;  1HTA A;  5FUG A;  3WTP A;  4E44 A;  3LJA C;  3LZ1 D;  3WAA B;  1H3O A;  3A6N D;  2F8N D;  1BH8 A;  2YFW A;  1ZLA C;  5B1L B;  1A7W A;  3LZ0 D;  5B2I D;  3AFA A;  1M1A C;  3REJ A;  5F99 C;  3W97 D;  2HIO B;  1U35 B;  4M6B A;  2FJ7 B;  5B2I B;  1M1A B;  3MGP D;  1PZR A;  3LZ0 B;  3R45 A;  1P3B A;  3KWQ A;  5DNN B;  3A6N B;  2F8N B;  3W98 A;  1P3A C;  2PYO B;  2ZY4 A;  4XUJ A;  3AV1 A;  4DRB A;  2Y2G A;  1P3G B;  4H9S C;  5AV8 A;  3AZI D;  1M19 C;  5CP6 B;  3B6G B;  1B6W A;  5DNN C;  4J8V A;  3UTA D;  5JA4 B;  2NQB D;  3LJA B;  5AY8 C;  4JJN B;  3REL C;  2Y2P A;  3KUY D;  3O62 B;  3MVD B;  3X1V B;  5B40 D;  4X23 C;  5BNX B;  3WKJ B;  4YM6 C;  3AZL A;  3LJA D;  3UTB D;  1AOI B;  5GSU A;  2RVQ C;  4Z2M G;  4YS3 C;  3REJ C;  4WU8 D;  4Z5T B;  3AZK A;  2LY8 A;  1P3M A;  3REK A;  3AV2 A;  3AZN C;  5E5A B;  2F2A C;  3X1U B;  3C1B B;  3REH A;  4WU9 A;  3W99 A;  4QLC C;  1P3I D;  4R8P C;  5CPK B;  3W99 B;  5KDM B;  3REH B;  1HQ3 D;  5B1L C;  2CV5 C;  5E5A A;  4YS3 D;  3X1T B;  4R8P A;  3AZF D;  3A1K A;  3B6F C;  1U35 D;  3REH C;  5AV9 D;  1P3P B;  5CPI A;  3MGS D;  4YM6 D;  2Y2Q A;  4R8P B;  5BNV B;  4KGC A;  5BS7 A;  3WA9 D;  3O62 A;  1M18 B;  3MGQ C;  1WWS A;  4WU9 D;  3AZI C;  1M19 D;  3WAA C;  1TZY B;  3AZH D;  1P3M C;  2ARO D;  4X23 B;  3AZE C;  4KHA A;  1P3A D;  1JFI A;  3AYW A;  1S32 A;  5AV5 C;  2DF4 C;  5B1M A;  1HQ3 A;  1P3M B;  4J8V C;  2JCH A;  2PYO D;  1JFI B;  2ARO B;  3AZL C;  3A6N A;  5JRG D;  2F8N A;  1KX5 C;  3W98 B;  5GT3 C;  3MNN C;  1P3B B;  5AVC C;  3C1C A;  1M1A D;  5AV6 C;  3LZ0 A;  3AZG D;  5B31 B;  3VH6 T;  5JA4 A;  3X1V C;  3UTB C;  3W96 C;  1M19 A;  5CPI B;  5AV8 B;  3AZF B;  3AZH C;  3AFA B;  4DQY B;  3B0D B;  3X1T A;  5BO0 A;  2RIQ A;  3KWQ C;  5BT1 C;  4J8W B;  3AYW B;  1S32 B;  2YFW B;  1P3L D;  3LZ1 B;  3AZE A;  4H9R A;  3VH6 W;  3WAA A;  4KUD C;  1TZY A;  3AN2 D;  3X1U D;  3KWQ B;  3C1B D;  4J8W D;  1M18 A;  4WU9 B;  5BS7 C;  3AFA C;  4H9P B;  5B2J D;  2ZM5 A;  3C1C D;  3REK B;  5BNV A;  3AV2 B;  2CV5 B;  1M1A A;  4KGC B;  2Y2J A;  5AV8 D;  3REJ B;  2HIO D;  5GSU B;  3UTA A;  1P3O C;  1B67 A;  5BNX A;  3WKJ A;  5B1L A;  3X1V A;  3WTP C;  2G5I C;  2NQB B;  3UT9 D;  4Z66 D;  5JRG B;  2RVQ D;  5B31 G;  1H3O B;  3LJA A;  3IP4 C;  4G91 B;  3UTB A;  3AZE D;  3TU4 C;  3KWQ D;  4H9Q A;  5CPK A;  3REL D;  3WAA D;  5CP6 A;  1P34 D;  3X1U A;  3C1B A;  1P3G D;  4KUD D;  5GT3 A;  5AV5 B;  4HGA C;  4G92 B;  3A6N C;  4ZUX B;  4LD9 D;  4H9N B;  2YFV B;  4J8X C;  1P3K D;  1P3F C;  1P3I A;  5CHL B;  4EO5 B;  3LEL C;  3UT9 C;  3MGR D;  5B24 C;  5AVB A;  1KX5 D;  3MVD A;  3R45 B;  3AZG C;  3WA9 B;  1P3F A;  3X1V D;  5B33 A;  4R8P D;  3UT9 A;  3KXB A;  1ULY A;  2BG1 A;  2CWE A;  3MGR B;  3AZL D;  3H0M C;  3V9R B;  4KGC D;  3VH5 A;  1P34 A;  3EG5 B;  1P3G A;  1P3K B;  5B2J C;  3EPK A;  4ZUX D;  1P3M D;  5B2I C;  3AN2 C;  5B40 C;  1N1J B;  5F99 D;  4X23 D;  3AZN B;  3AYW D;  5E5A C;  1S32 D;  1P3L B;  4J8U D;  4Z5T C;  1ZLA B;  1EQZ B;  5GT0 B;  2IO5 B;  1P3L C;  2FJ7 D;  4WNN B;  3AZK C;  2UWX A;  4CAY B;  1KX4 C;  1BFM A;  5GXQ A;  2Y2O A;  5GT0 A;  2Y2L A;  1ZLA A;  2Y2K A;  2VQR A;  1EQZ D;  1KX4 B;  3WA9 A;  4XZQ A;  5AY8 A;  3X1S C;  1F66 A;  5AVC D;  3AZH A;  4H9O B;  3LEL A;  1P3I C;  3KFU G;  5DNM A;  5DNM B;  2F8N K;  3LEL B;  5B0Y A;  1TZY D;  3AZH B;  3MNN A;  4EO5 C;  5CPJ D;  3KXB B;  5DNM C;  2Y2I A;  3AZJ A;  3LZ0 C;  4XUJ C;  3AV1 C;  1KX4 D;  5JRG A;  5B32 C;  3H0L C;  3AZG B;  1ID3 A;  3AZJ B;  3MNN B;  1P3B C;  5B1M C;  3AYW C;  4CAY A;  4DRA A;  1S32 C;  4WNN A;  3UTA C;  3VH6 A;  3EPL A;  4YS3 B;  1HQ3 C;  4H9N A;  5B1L D;  3REI D;  5G49 B;  5AV5 A;  5DNM D;  4Z66 A;  3AZF C;  4AWL B;  3AN2 B;  5CPK D;  1P3L A;  5AV6 D;  4UPK A;  3FDD A;  1F66 B;  3MGP C;  5AY8 B;  3REL B;  1F1E A;  5GXQ C;  4KUD A;  3LZ1 A;  3AZE B;  1KX4 A;  2NZD C;  4J8W A;  2BYK A;  4WJ3 C;  2IO5 C;  1P3K A;  5B2J A;  5GXQ B;  3X1S D;  3W97 B;  3MGR A;  2Y2H A;  2Y2M A;  1R4V A;  3B0B A;  3MGP A;  1KX3 A;  2CV5 A;  4H9P A;  1P3F D;  5B33 B;  4J8U C;  3C1C B;  1Z2C B;  4WU9 C;  3KXB D;  3AZN A;  3REK C;  1N1J A;  3AV2 C;  3AZI B;  3W99 C;  2XD5 A;  3W96 B;  1P3I B;  4XUJ D;  3AV1 D;  4UUZ A;  4LD9 B;  2YFV A;  4ZUX A;  2Y2N A;  2HUE C;  1ID3 C;  2NZD D;  3V9R A;  3W96 D;  2DQN C;  3B0C W;  4J8X A;  5JRG C;  4X23 A;  5B32 G;  4ZUX C;  5B31 A;  3KUY A;  1AOI C;  2NQB A;  1P3F B;  2ZY2 A;  3VH5 T;  3TU4 A;  4HGA B;  4G92 C;  5CPK C;  1TAF A;  1KX3 C;  3UTA B;  3X1U C;  3C1B C;  5CP6 C;  4WV4 B;  3MGQ D;  1HQ3 B;  3AZK D;  3REI C;  1P3O B;  5B32 D;  2ARO C;  3MGS C;  5AY8 D;  2NZD A;  1F66 C;  3LZ1 C;  4H9Q B;  3WKJ C;  4J8X D;  1P3K C;  5F99 A;  4H9R B;  5B32 B;  1M18 C;  5DNN D;  3A1I A;  5BO0 B;  4Z66 C;  1TZY C;  4NE3 A;  4Z5T A;  3TU4 D;  2HUE B;  3MGS A;  3MNN D;  3AZF A;  3MGS B;  2HIO C;  3AZM D;  2JSS A;  1TAF B;  4QLC D;  3X1S B;  3NQU B;  5GXQ D;  4YM6 A;  3O62 D;  5GT0 D;  5B32 A;  3EPH A;  3B6G D;  3X1T C;  2ZY3 A;  4XZQ D;  4J8V B;  2NZD B;  2ARO A;  5B24 D;  5AV6 B;  5AVC A;  3REI A;  5B0Z C;  3KUY C;  3F6T A;  5B1M D;  4XUJ B;  3AV1 B;  3REI B;  4UUZ B;  2G5H C;  5AVC B;  4Z5T D;  4KHA B;  5AV6 A;  1AOI A;  2PYO A;  1M19 B;  1KU5 A;  5AV9 C;  2NQB C;  4XZQ C;  3MVD C;  3EPJ A;  3AZJ D;  3KUY B;  4YM6 B;  3NQU A;  3X1S A;  4E45 A;  5B0Z D;  3WTP E;  3B6G A;  4Z2M H;  1P3P A;  3X1T D;  5B2J B;  4KGC C;  1Q9C A;  5B1M B;  2BYK B;  5AV5 D;  2FFF B;  3AZN D;  3W97 C;  5KDM A;  5F99 B;  3H0R C;  1WWI A;  3AZM C;  4WZS B;  3AN2 A;  4Z66 B;  1M18 D;  5B2I A;  1P3O A;  1KX3 B;  3MGP B;  2FJ7 C;  2HIO A;  3MGR C;  3W97 A;  4AWL C;  3WKJ D;  1P3P D;  5B31 D;  3TU4 B;  1T3U A;  4JJN D;  1KX3 D;  2CV5 D;  3B6G C;  3W98 D;  3REL A;  2W8S A;  5CP6 D;  5CPJ C;  4J8X B;  3WTP B;  5GT3 D;  5GSU C;  2BYM A;  4H9S A;  5G49 A;  4CSR B;  3B6F B;  3AZK B;  1P3A B;  5B24 B;  1P3O D;  2PYO C;  4LD9 A;  4J8V D;  3AFA D;  3C1C C;  1W2E A;  1BH9 A;  3W96 A;  5C3I B;  3AZL B;  5AVB D;  1KX5 A;  2L5A A;  5DNN A;  1ID3 B;  5B33 D;  5BT1 D;  5B31 C;  4JJN A;  3MVD D;  4QLC B;  3AZJ C;  4ZBJ C;  1P3B D;  5B0Y C;  3WA9 C;  3REK D;  3AV2 D;  1U35 C;  3REH D;  3MGQ A;  1BH8 B;  4KUD B;  3VH5 W;  3AZI A;  5GT0 C;  4G91 C;  4XZQ B;  4J8U A;  2ZY5 A;  3MGQ B;  2FJ7 A;  5B40 A;  1U35 A;  4WU8 B;  5B0Z B;  5GSU D;  4WU8 A;  5B40 B;  3AZM A;  1EQZ A;  4J8W C;  3NQJ B;  4NFT A;  4QLC A;  1ZLA D;  2F8N H;  4JJN C;  2F8N G;  4J8U B;  5AVB B;  5CPJ B;  3W99 D;  3KXB C;  3LEL D;  1P34 C;  5B0Y B;  1F66 D;  5FUG B;  1P3P C;  3B6F D;  5B24 A;  4LD9 C;  1P3G C;  5E5A D;  4YS3 A;  1P34 B;  5GT3 B;  3KSY A;  4NE5 A;  3WTP D;  5B0Y D;  2BYM B;  4H9O A;  4NE6 A;  5AVB C;  5AV9 A;  5C3I C;  3AL0 C;  3B0D C;  5CPI D;  3UTB B;  3UT9 B;  5B33 C;  5CPJ A;  1AOI D; 
#chains in the Genus database with same CATH homology
 3AZG A;  2J8P A;  5AV8 C;  2JE5 A;  2XD1 A;  3O62 C;  3NQJ A;  3AZM B;  1KX5 B;  3P5J B;  4ZBJ B;  1ID3 D;  1EQZ C;  5AV9 B;  5B0Z A;  3REJ D;  1BH9 B;  4WU8 C;  1P3A A;  3B6F A;  3W98 C;  3B0C T;  4CSR A;  5CPI C;  1HTA A;  5FUG A;  3WTP A;  4E44 A;  3LJA C;  3LZ1 D;  3WAA B;  1H3O A;  3A6N D;  2F8N D;  1BH8 A;  2YFW A;  1ZLA C;  5B1L B;  1A7W A;  3LZ0 D;  5B2I D;  3AFA A;  1M1A C;  3REJ A;  5F99 C;  3W97 D;  2HIO B;  1U35 B;  4M6B A;  2FJ7 B;  5B2I B;  1M1A B;  3MGP D;  1PZR A;  3LZ0 B;  3R45 A;  1P3B A;  3KWQ A;  5DNN B;  3A6N B;  2F8N B;  3W98 A;  1P3A C;  2PYO B;  2ZY4 A;  4XUJ A;  3AV1 A;  4DRB A;  2Y2G A;  1P3G B;  4H9S C;  5AV8 A;  3AZI D;  1M19 C;  5CP6 B;  3B6G B;  1B6W A;  5DNN C;  4J8V A;  3UTA D;  5JA4 B;  2NQB D;  3LJA B;  5AY8 C;  4JJN B;  3REL C;  2Y2P A;  3KUY D;  3O62 B;  3MVD B;  3X1V B;  5B40 D;  4X23 C;  5BNX B;  3WKJ B;  4YM6 C;  3AZL A;  3LJA D;  3UTB D;  1AOI B;  5GSU A;  2RVQ C;  4Z2M G;  4YS3 C;  3REJ C;  4WU8 D;  4Z5T B;  3AZK A;  2LY8 A;  1P3M A;  3REK A;  3AV2 A;  3AZN C;  5E5A B;  2F2A C;  3X1U B;  3C1B B;  3REH A;  4WU9 A;  3W99 A;  4QLC C;  1P3I D;  4R8P C;  5CPK B;  3W99 B;  5KDM B;  3REH B;  1HQ3 D;  5B1L C;  2CV5 C;  5E5A A;  4YS3 D;  3X1T B;  4R8P A;  3AZF D;  3A1K A;  3B6F C;  1U35 D;  3REH C;  5AV9 D;  1P3P B;  5CPI A;  3MGS D;  4YM6 D;  2Y2Q A;  4R8P B;  5BNV B;  4KGC A;  5BS7 A;  3WA9 D;  3O62 A;  1M18 B;  3MGQ C;  1WWS A;  4WU9 D;  3AZI C;  1M19 D;  3WAA C;  1TZY B;  3AZH D;  1P3M C;  2ARO D;  4X23 B;  3AZE C;  4KHA A;  1P3A D;  1JFI A;  3AYW A;  1S32 A;  5AV5 C;  2DF4 C;  5B1M A;  1HQ3 A;  1P3M B;  4J8V C;  2JCH A;  2PYO D;  1JFI B;  2ARO B;  3AZL C;  3A6N A;  5JRG D;  2F8N A;  1KX5 C;  3W98 B;  5GT3 C;  3MNN C;  1P3B B;  5AVC C;  3C1C A;  1M1A D;  5AV6 C;  3LZ0 A;  3AZG D;  5B31 B;  3VH6 T;  5JA4 A;  3X1V C;  3UTB C;  3W96 C;  1M19 A;  5CPI B;  5AV8 B;  3AZF B;  3AZH C;  3AFA B;  4DQY B;  3B0D B;  3X1T A;  5BO0 A;  2RIQ A;  3KWQ C;  5BT1 C;  4J8W B;  3AYW B;  1S32 B;  2YFW B;  1P3L D;  3LZ1 B;  3AZE A;  4H9R A;  3VH6 W;  3WAA A;  4KUD C;  1TZY A;  3AN2 D;  3X1U D;  3KWQ B;  3C1B D;  4J8W D;  1M18 A;  4WU9 B;  5BS7 C;  3AFA C;  4H9P B;  5B2J D;  2ZM5 A;  3C1C D;  3REK B;  5BNV A;  3AV2 B;  2CV5 B;  1M1A A;  4KGC B;  2Y2J A;  5AV8 D;  3REJ B;  2HIO D;  5GSU B;  3UTA A;  1P3O C;  1B67 A;  5BNX A;  3WKJ A;  5B1L A;  3X1V A;  3WTP C;  2G5I C;  2NQB B;  3UT9 D;  4Z66 D;  5JRG B;  2RVQ D;  5B31 G;  1H3O B;  3LJA A;  3IP4 C;  4G91 B;  3UTB A;  3AZE D;  3TU4 C;  3KWQ D;  4H9Q A;  5CPK A;  3REL D;  3WAA D;  5CP6 A;  1P34 D;  3X1U A;  3C1B A;  1P3G D;  4KUD D;  5GT3 A;  5AV5 B;  4HGA C;  4G92 B;  3A6N C;  4ZUX B;  4LD9 D;  4H9N B;  2YFV B;  4J8X C;  1P3K D;  1P3F C;  1P3I A;  5CHL B;  4EO5 B;  3LEL C;  3UT9 C;  3MGR D;  5B24 C;  5AVB A;  1KX5 D;  3MVD A;  3R45 B;  3AZG C;  3WA9 B;  1P3F A;  3X1V D;  5B33 A;  4R8P D;  3UT9 A;  3KXB A;  1ULY A;  2BG1 A;  2CWE A;  3MGR B;  3AZL D;  3H0M C;  3V9R B;  4KGC D;  3VH5 A;  1P34 A;  3EG5 B;  1P3G A;  1P3K B;  5B2J C;  3EPK A;  4ZUX D;  1P3M D;  5B2I C;  3AN2 C;  5B40 C;  1N1J B;  5F99 D;  4X23 D;  3AZN B;  3AYW D;  5E5A C;  1S32 D;  1P3L B;  4J8U D;  4Z5T C;  1ZLA B;  1EQZ B;  5GT0 B;  2IO5 B;  1P3L C;  2FJ7 D;  4WNN B;  3AZK C;  2UWX A;  4CAY B;  1KX4 C;  1BFM A;  5GXQ A;  2Y2O A;  5GT0 A;  2Y2L A;  1ZLA A;  2Y2K A;  2VQR A;  1EQZ D;  1KX4 B;  3WA9 A;  4XZQ A;  5AY8 A;  3X1S C;  1F66 A;  5AVC D;  3AZH A;  4H9O B;  3LEL A;  1P3I C;  3KFU G;  5DNM A;  5DNM B;  2F8N K;  3LEL B;  5B0Y A;  1TZY D;  3AZH B;  3MNN A;  4EO5 C;  5CPJ D;  3KXB B;  5DNM C;  2Y2I A;  3AZJ A;  3LZ0 C;  4XUJ C;  3AV1 C;  1KX4 D;  5JRG A;  5B32 C;  3H0L C;  3AZG B;  1ID3 A;  3AZJ B;  3MNN B;  1P3B C;  5B1M C;  3AYW C;  4CAY A;  4DRA A;  1S32 C;  4WNN A;  3UTA C;  3VH6 A;  3EPL A;  4YS3 B;  1HQ3 C;  4H9N A;  5B1L D;  3REI D;  5G49 B;  5AV5 A;  5DNM D;  4Z66 A;  3AZF C;  4AWL B;  3AN2 B;  5CPK D;  1P3L A;  5AV6 D;  4UPK A;  3FDD A;  1F66 B;  3MGP C;  5AY8 B;  3REL B;  1F1E A;  5GXQ C;  4KUD A;  3LZ1 A;  3AZE B;  1KX4 A;  2NZD C;  4J8W A;  2BYK A;  4WJ3 C;  2IO5 C;  1P3K A;  5B2J A;  5GXQ B;  3X1S D;  3W97 B;  3MGR A;  2Y2H A;  2Y2M A;  1R4V A;  3B0B A;  3MGP A;  1KX3 A;  2CV5 A;  4H9P A;  1P3F D;  5B33 B;  4J8U C;  3C1C B;  1Z2C B;  4WU9 C;  3KXB D;  3AZN A;  3REK C;  1N1J A;  3AV2 C;  3AZI B;  3W99 C;  2XD5 A;  3W96 B;  1P3I B;  4XUJ D;  3AV1 D;  4UUZ A;  4LD9 B;  2YFV A;  4ZUX A;  2Y2N A;  2HUE C;  1ID3 C;  2NZD D;  3V9R A;  3W96 D;  2DQN C;  3B0C W;  4J8X A;  5JRG C;  4X23 A;  5B32 G;  4ZUX C;  5B31 A;  3KUY A;  1AOI C;  2NQB A;  1P3F B;  2ZY2 A;  3VH5 T;  3TU4 A;  4HGA B;  4G92 C;  5CPK C;  1TAF A;  1KX3 C;  3UTA B;  3X1U C;  3C1B C;  5CP6 C;  4WV4 B;  3MGQ D;  1HQ3 B;  3AZK D;  3REI C;  1P3O B;  5B32 D;  2ARO C;  3MGS C;  5AY8 D;  2NZD A;  1F66 C;  3LZ1 C;  4H9Q B;  3WKJ C;  4J8X D;  1P3K C;  5F99 A;  4H9R B;  5B32 B;  1M18 C;  5DNN D;  3A1I A;  5BO0 B;  4Z66 C;  1TZY C;  4NE3 A;  4Z5T A;  3TU4 D;  2HUE B;  3MGS A;  3MNN D;  3AZF A;  3MGS B;  2HIO C;  3AZM D;  2JSS A;  1TAF B;  4QLC D;  3X1S B;  3NQU B;  5GXQ D;  4YM6 A;  3O62 D;  5GT0 D;  5B32 A;  3EPH A;  3B6G D;  3X1T C;  2ZY3 A;  4XZQ D;  4J8V B;  2NZD B;  2ARO A;  5B24 D;  5AV6 B;  5AVC A;  3REI A;  5B0Z C;  3KUY C;  3F6T A;  5B1M D;  4XUJ B;  3AV1 B;  3REI B;  4UUZ B;  2G5H C;  5AVC B;  4Z5T D;  4KHA B;  5AV6 A;  1AOI A;  2PYO A;  1M19 B;  1KU5 A;  5AV9 C;  2NQB C;  4XZQ C;  3MVD C;  3EPJ A;  3AZJ D;  3KUY B;  4YM6 B;  3NQU A;  3X1S A;  4E45 A;  5B0Z D;  3WTP E;  3B6G A;  4Z2M H;  1P3P A;  3X1T D;  5B2J B;  4KGC C;  1Q9C A;  5B1M B;  2BYK B;  5AV5 D;  2FFF B;  3AZN D;  3W97 C;  5KDM A;  5F99 B;  3H0R C;  1WWI A;  3AZM C;  4WZS B;  3AN2 A;  4Z66 B;  1M18 D;  5B2I A;  1P3O A;  1KX3 B;  3MGP B;  2FJ7 C;  2HIO A;  3MGR C;  3W97 A;  4AWL C;  3WKJ D;  1P3P D;  5B31 D;  3TU4 B;  1T3U A;  4JJN D;  1KX3 D;  2CV5 D;  3B6G C;  3W98 D;  3REL A;  2W8S A;  5CP6 D;  5CPJ C;  4J8X B;  3WTP B;  5GT3 D;  5GSU C;  2BYM A;  4H9S A;  5G49 A;  4CSR B;  3B6F B;  3AZK B;  1P3A B;  5B24 B;  1P3O D;  2PYO C;  4LD9 A;  4J8V D;  3AFA D;  3C1C C;  1W2E A;  1BH9 A;  3W96 A;  5C3I B;  3AZL B;  5AVB D;  1KX5 A;  2L5A A;  5DNN A;  1ID3 B;  5B33 D;  5BT1 D;  5B31 C;  4JJN A;  3MVD D;  4QLC B;  3AZJ C;  4ZBJ C;  1P3B D;  5B0Y C;  3WA9 C;  3REK D;  3AV2 D;  1U35 C;  3REH D;  3MGQ A;  1BH8 B;  4KUD B;  3VH5 W;  3AZI A;  5GT0 C;  4G91 C;  4XZQ B;  4J8U A;  2ZY5 A;  3MGQ B;  2FJ7 A;  5B40 A;  1U35 A;  4WU8 B;  5B0Z B;  5GSU D;  4WU8 A;  5B40 B;  3AZM A;  1EQZ A;  4J8W C;  3NQJ B;  4NFT A;  4QLC A;  1ZLA D;  2F8N H;  4JJN C;  2F8N G;  4J8U B;  5AVB B;  5CPJ B;  3W99 D;  3KXB C;  3LEL D;  1P34 C;  5B0Y B;  1F66 D;  5FUG B;  1P3P C;  3B6F D;  5B24 A;  4LD9 C;  1P3G C;  5E5A D;  4YS3 A;  1P34 B;  5GT3 B;  3KSY A;  4NE5 A;  3WTP D;  5B0Y D;  2BYM B;  4H9O A;  4NE6 A;  5AVB C;  5AV9 A;  5C3I C;  3AL0 C;  3B0D C;  5CPI D;  3UTB B;  3UT9 B;  5B33 C;  5CPJ A;  1AOI D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...