3LZ0C

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 1)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
total genus 30
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz0C00
3B0CW 3X1TC 5B2IB 1U35B 3W99C 3C1BB 3LZ0D 3MGSC 5JA4A 5AY8C 1P3KA 1M1AC 4NE6A 3C1CD 3AZID 1ID3A 4WNNB 3LJAC 4UUZA 2NZDA 3MNNA 5JRGA 3W98D 4E44A 5AV8A 5CPIA 3WA9C 1ID3C 3AN2C 2F8NA 5CPKB 3KUYA 1B6WA 5BNVA 5AVBD 3AFAA 1HQ3A 3UT9A 3WTPD 1BH9B 5CPIC 5AV8C 2BYKB 5AVCD 4X23A 3MGPA 1HTAA 1P3ID 1ZLAB 3UTBB 3WAAA 3X1VB 5B2IC 1U35C 4HGAC 1HQ3C 4J8UD 3UT9C 3AYWB 3KSYA 3REJD 5GT0B 3B6FD 3UTAA 3AZGD 3R45B 1P3GD 3MGPC 1S32B 3KWQB 5GXQA 4YS3D 3AV1D 4EO5C 1KX5B 5BO0A 5B40A 1P3LD 1P3PB 3MVDD 3LZ1D 3W97B 4G91C 3AZKB 5DNMD 1KX3D 3AV2B 5GXQC 2NQBB 4LD9B 4Z5TA 3UTBA 5DNNB 2YFVA 4Z66A 3KXBA 1A7WA 5AV6A 4J8VB 5B1LA 5AV9D 3MGQD 4ZUXB 3AZND 1ZLAC 4WU8A 3UTBC 3X1VC 3AZHD 3A6NA 5CP6B 1BFMA 5BNXB 3KXBC 1M19A 5GT0C 5AV6C 5B1LC 1P3BB 1P3AD 2HIOD 4QLCD 4R8PB 1EQZD 4WU8C 5B31D 3AZED 4H9NA 3AZFB 3NQJB 4H9SA 4XUJB 3A6NC 3X1SD 1KX5C 1N1JB 5B33A 3REIA 5F99B 4KGCB 2CV5A 4H9QA 3W97C 4M6BA 2BYMB 5C3IB 2NQBC 5DNNC 3AZMB 3REIC 5B33C 1H3OA 4KUDA 5B0YA 2CV5C 5BT1D 5BNXA 5B24A 4J8WA 3AZJD 3LJAD 4J8VC 5B2JD 4ZUXC 3LELA 3REKA 3WA9D 5GSUA 4KUDC 3AN2D 3AZLA 2PYOD 5B24C 2FJ7D 3REHD 1P3BC 3W99B 4YM6B 2AROA 3LELC 3MGSB 3REKC 1M1AB 3AZLC 5E5AB 4H9RB 5B2ID 1U35D 1AOIA 3C1BD 4CSRA 2AROC 5JA4B 3B6GB 5B0ZA 4NE5A 3WTPE 1P3KB 1P3MA 4CAYA 5DNMA 2LY8A 3WKJB 1ID3B 4UUZB 2NZDB 3MNNB 5B1MA 5JRGB 1P3MC 4XZQA 5AV8B 5CPIB 3VH5W 3RELA 5CPKD 2F8NB 3VH5A 3KUYB 5BNVB 4HGAB 4YM6C 3AFAB 5B1MC 3B6GA 1HQ3B 3UT9B 1KX4A 5G49A 3WKJA 4X23B 3MGPB 1ZLAD 5E5AC 3X1VD 3WAAB 4EO5B 2L5AA 3AYWD 3B6GC 1P3KC 1KX4C 1ULYA 3WKJC 3UTAB 2RVQC 5AV5A 4G91B 1S32D 3VH5T 3KWQD 3O62A 5GXQB 2F8NG 1KX5D 3NQUA 5CHLB 2NZDC 5BO0B 5B40B 3MNNC 4WU9A 1P3PD 5JRGC 3W97D 4AWLB 3AZKD 5AV5C 3W96A 3AV2D 3X1UB 2NQBD 4LD9D 3O62C 2YFWA 5DNND 4Z5TB 3KUYC 2YFVB 4Z66B 3AFAC 1BH8A 4J8VD 5GT3A 3KXBB 5AV6B 2F8NH 5B1LB 4X23C 1P3FA 3WAAC 4WU8B 5CP6D 3A6NB 5CPJA 1M19B 1P3BD 3UTAC 2CWEA 3B0BA 4R8PD 3X1UA 4JJNA 3AZFD 4H9NB 4XUJD 1WWSA 3TU4A 1M18A 5F99D 4KGCD 5B33B 3REIB 5B40C 4NFTA 1WWIA 2CV5B 4H9QB 4AWLC 3X1UC 4JJNC 3B0DC 4J8XA 1F66A 3AZMD 5B32A 4H9PA 4Z5TC 3TU4C 1P3OA 1M18C 2HUEC 1P34A 3MGRA 1H3OB 4Z66C 4KUDB 5B0YB 5B24B 4J8WB 1TAFB 1TZYD 3LZ0A 4J8XC 3LELB 5B32C 3REKB 3C1CA 1P3OC 5GSUB 1P34C 3AZIA 3AZLB 1M19C 3X1TD 3LZ0C 3W99D 4YM6D 3MGSD 5AY8D 2AROB 1M1AD 3W98A 4ZBJB 4H9SC 4DRBA 5E5AD 1R4VA 1AOIB 1TAFA 4CSRB 5AVBA 1P3KD 1JFIA 3W98C 5B0ZB 3WTPA 1P3MB 4CAYB 5DNMB 5AVCA 1ID3D 5B0YC 1P3IA 4H9OA 4J8WC 5AVBC 3MNND 4J8UA 3WTPC 3REJA 5B1MB 4XZQB 5AV8D 5AVCC 1B67A 5GSUC 3AZGA 5CPID 1P3GA 3B6FA 2F8ND 3RELB 3KUYD 3AV1A 4YS3A 3AFAD 4J8UC 1P3LA 1HQ3D 3UT9D 4E45A 4ZBJC 3LZ1A 3MVDA 3AZGC 1P3GC 1KX4B 5G49B 1KX3A 4X23D 3MGPD 4YS3C 3AV1C 4KHAA 1AOIC 5KDMA 1P3LC 2IO5B 5B0ZC 3MVDC 3LZ1C 3UTAD 5DNMC 1KX3C 5AV9A 3MGQA 5AV5B 3AZNA 5GXQD 3O62B 3AZHA 3NQUB 5B40D 4WU9B 1TZYA 4XZQC 5AV9C 4NE3A 1P3AA 2HIOA 3W96B 4QLCA 3RELC 1EQZA 3V9RA 5B31A 3AZEA 2YFWB 3UTBD 3AZHC 3X1SA 4Z66D 3X1TA 3KXBD 1BH8B 5GT0D 5AV6D 5GT3B 5B1LD 5AY8A 1EQZC 5B31C 3AZEC 4WU8D 1P3FB 3X1SC 3A6ND 2JSSA 2IO5C 3AZJA 1M19D 5CPJB 3LJAA 5B2JA 4JJNB 3B0DB 3WA9A 4WZSB 3TU4B 3AN2A 5B33D 3REID 1M18B 2PYOA 5BT1C 2HUEB 3AZJC 4WU9C 2CV5D 5B2JC 2FJ7A 3REHA 3W96C 4ZUXD 1F66B 4J8XB 3VH6W 5B32B 4H9PB 3VH6A 1P3OB 4KUDD 2PYOC 5B0YD 1P34B 3MGRB 3B0CT 5B24D 4J8WD 5B2IA 1U35A 3C1BA 2FJ7C 5GT3C 3REHC 3LZ0B 2F8NK 3LELD 3REKD 1P3FC 5GSUD 3C1CB 4WNNA 3AZLD 3AZIB 4WV4B 3C1BC 5CPJC 2AROD 3W98B 3VH6T 5CPKA 5B32G 1AOID 5AVBB 5B0ZD 1JFIB 1F66C 1BH9A 3WTPB 1P3MD 2BYKA 5CPKC 5AVCB 1KU5A 1ZLAA 3MGRC 3X1VA 1P3IB 4H9OB 3AYWA 4J8UB 5B1MD 5GT0A 4XZQD 3REJB 3R45A 3C1CC 3B6FB 3AZGB 1P3GB 3RELD 3AZIC 1S32A 3KWQA 4YS3B 3AV1B 1KX5A 3AYWC 3B6GD 1P3LB 1P3PA 3W97A 4DRAA 3MVDB 3LZ1B 3AZKA 1KX4D 3WKJD 2RVQD 1S32C 3AV2A 3KWQC 1KX3B 2NQBA 4LD9A 5DNNA 4KHAB 5KDMB 1F1EA 4G92B 2NZDD 1P3PC 5JRGD 4J8VA 3AZKC 4ZUXA 5AV5D 5AV9B 3MGQB 3AV2C 4LD9C 5FUGB 1Q9CA 4Z2MG 3AZNB 3O62D 1P3IC 5CP6A 3AZHB 4WU9D 1TZYB 3REJC 1P3BA 3B6FC 3W96D 4R8PA 1P3AB 2HIOB 4QLCB 3AZFA 1EQZB 3NQJA 3V9RB 5B31B 3AZEB 3WAAD 4XUJA 5CP6C 1N1JA 3X1SB 5F99A 4KGCA 4Z2MH 3X1TB 5GT3D 2BYMA 4R8PC 5AY8B 3AZFC 5FUGA 1P3FD 4XUJC 3AZMA 5F99C 4KGCC 4G92C 5CPJD 3AZJB 3LJAB 5C3IC 3MGQC 5B2JB 3X1UD 4JJND 3AZMC 3AZNC 3WA9B 4Z5TD 3TU4D 5B31G 1M18D 3AN2B 5BS7A 2PYOB 1TZYC 3W99A 2FJ7B 4YM6A 3MGSA 3REHB 1P3AC 2HIOC 4J8XD 4QLCC 1M1AA 1F66D 5B32D 1P3OD 1P34D 5BS7C 3MGRD 5E5AA 4H9RA
chains in the Genus database with same CATH superfamily
3B0CW 3X1TC 5B2IB 1U35B 3W99C 3C1BB 3LZ0D 3MGSC 5JA4A 5AY8C 1P3KA 1M1AC 4NE6A 3C1CD 3AZID 1ID3A 4WNNB 3LJAC 4UUZA 2NZDA 3MNNA 2Y2GA 5JRGA 3W98D 4E44A 3F6TA 5AV8A 5CPIA 1ID3C 3WA9C 3AN2C 2F8NA 2W8SA 5CPKB 3KUYA 1B6WA 5BNVA 5AVBD 3AFAA 1HQ3A 3UT9A 3WTPD 1BH9B 5CPIC 5AV8C 2BYKB 5AVCD 4X23A 2XD5A 3MGPA 1HTAA 1P3ID 1ZLAB 3UTBB 3WAAA 3X1VB 5B2IC 1U35C 4HGAC 1HQ3C 4J8UD 3UT9C 3AYWB 3KSYA 3REJD 5GT0B 3B6FD 3UTAA 3AZGD 3R45B 1P3GD 3MGPC 1S32B 3KWQB 5GXQA 4YS3D 3AV1D 4EO5C 1KX5B 5BO0A 5B40A 1P3LD 1P3PB 3MVDD 3LZ1D 3W97B 3EG5B 4G91C 3AZKB 5DNMD 1KX3D 3AV2B 5GXQC 2NQBB 2J8PA 4LD9B 4Z5TA 3UTBA 5DNNB 3FDDA 2YFVA 4Z66A 3KXBA 1A7WA 5AV6A 4J8VB 5B1LA 5AV9D 3MGQD 4ZUXB 3AZND 1ZLAC 4WU8A 3UTBC 3X1VC 3AZHD 3A6NA 5CP6B 1BFMA 5BNXB 3KXBC 1M19A 5AV6C 5GT0C 5B1LC 1P3BB 1P3AD 2HIOD 4QLCD 4R8PB 1EQZD 4WU8C 5B31D 3AZED 4H9NA 3AZFB 3NQJB 4H9SA 4XUJB 3A6NC 3X1SD 2Y2JA 1KX5C 1N1JB 5B33A 3REIA 5F99B 4KGCB 2CV5A 4H9QA 3W97C 4M6BA 2BYMB 5C3IB 2NQBC 5DNNC 3AZMB 3REIC 5B33C 1H3OA 4KUDA 5B0YA 2CV5C 5BT1D 5BNXA 5B24A 4J8WA 3AZJD 3LJAD 4J8VC 5B2JD 4ZUXC 3EPKA 3LELA 3REKA 3WA9D 5GSUA 4KUDC 3AN2D 3AZLA 2PYOD 5B24C 2FJ7D 3REHD 1P3BC 3W99B 4YM6B 2AROA 3LELC 3MGSB 3REKC 1M1AB 3AZLC 5E5AB 4H9RB 5B2ID 1U35D 1AOIA 3C1BD 2ZY2A 4CSRA 2AROC 5JA4B 3B6GB 5B0ZA 4NE5A 3WTPE 1P3KB 1P3MA 4CAYA 5DNMA 2LY8A 3WKJB 3H0RC 1ID3B 4UUZB 2NZDB 3MNNB 5B1MA 5JRGB 1P3MC 4XZQA 5AV8B 5CPIB 3VH5W 3RELA 5CPKD 2F8NB 3VH5A 3KUYB 5BNVB 4HGAB 4YM6C 3AFAB 5B1MC 3B6GA 1HQ3B 3UT9B 1KX4A 5G49A 3WKJA 4X23B 3MGPB 1ZLAD 5E5AC 3X1VD 3WAAB 4EO5B 2L5AA 3AYWD 2G5IC 3B6GC 2ZM5A 1P3KC 1KX4C 1ULYA 3WKJC 3UTAB 2RVQC 5AV5A 4G91B 1S32D 3VH5T 3KWQD 1W2EA 3O62A 5GXQB 2F8NG 1KX5D 3NQUA 5CHLB 2NZDC 5BO0B 5B40B 3MNNC 4WU9A 1P3PD 5JRGC 3W97D 4AWLB 3AZKD 2ZY3A 5AV5C 3W96A 3AV2D 3X1UB 2NQBD 4LD9D 3O62C 2YFWA 5DNND 4Z5TB 3KUYC 2YFVB 4Z66B 3AFAC 1BH8A 4J8VD 5GT3A 3KXBB 5AV6B 2F8NH 5B1LB 4X23C 1P3FA 3WAAC 4WU8B 2G5HC 5CP6D 3A6NB 5CPJA 3A1KA 1M19B 1P3BD 3UTAC 2CWEA 3B0BA 4R8PD 3X1UA 4JJNA 3AZFD 4H9NB 4XUJD 1WWSA 3TU4A 1M18A 5F99D 4KGCD 5B33B 3REIB 5B40C 2Y2IA 4NFTA 1WWIA 2CV5B 4H9QB 4AWLC 3X1UC 4JJNC 3B0DC 4J8XA 2Y2LA 1F66A 3AZMD 5B32A 4H9PA 4Z5TC 3TU4C 1P3OA 1M18C 2HUEC 1P34A 3MGRA 1H3OB 4Z66C 4KUDB 5B0YB 5B24B 4J8WB 1TAFB 1TZYD 3LZ0A 4J8XC 4WJ3C 3LELB 5B32C 3REKB 3C1CA 1P3OC 5GSUB 1P34C 3AZIA 3AZLB 1M19C 3X1TD 3LZ0C 3W99D 4YM6D 3MGSD 5AY8D 2AROB 2Y2OA 1M1AD 3W98A 2DF4C 4ZBJB 2ZY5A 4H9SC 4DRBA 5E5AD 1R4VA 1AOIB 1TAFA 4CSRB 5AVBA 1P3KD 1JFIA 3W98C 5B0ZB 3WTPA 3P5JB 1P3MB 4CAYB 5DNMB 5AVCA 1ID3D 5B0YC 1P3IA 4H9OA 4J8WC 2XD1A 5AVBC 3MNND 4J8UA 3WTPC 2DQNC 3REJA 5B1MB 4XZQB 1Z2CB 5AV8D 1B67A 5GSUC 5AVCC 3AZGA 5CPID 1P3GA 3B6FA 1PZRA 2F8ND 3RELB 3KUYD 3AV1A 4YS3A 3AFAD 4J8UC 1P3LA 1HQ3D 3UT9D 4E45A 4ZBJC 3LZ1A 3MVDA 3AZGC 1P3GC 1KX4B 5G49B 1KX3A 4X23D 3MGPD 4YS3C 3AV1C 2FFFB 4KHAA 1AOIC 5KDMA 1P3LC 2IO5B 5B0ZC 3MVDC 2Y2KA 3LZ1C 3UTAD 5DNMC 1KX3C 5AV9A 3MGQA 5AV5B 3AZNA 3H0LC 5GXQD 3O62B 3AZHA 3NQUB 5B40D 4WU9B 1TZYA 2JE5A 4XZQC 5AV9C 4NE3A 1P3AA 2HIOA 3W96B 4QLCA 3RELC 1EQZA 3V9RA 5B31A 3AZEA 2YFWB 3UTBD 4UPKA 3AZHC 3X1SA 4Z66D 2Y2PA 2JCHA 3EPJA 3X1TA 3KXBD 1BH8B 5AV6D 5GT0D 5GT3B 5B1LD 5AY8A 1EQZC 2Y2NA 5B31C 3AZEC 4WU8D 1P3FB 3X1SC 3A6ND 2IO5C 2JSSA 3AZJA 1M19D 5CPJB 3LJAA 5B2JA 4JJNB 3B0DB 3WA9A 4WZSB 3TU4B 3AN2A 5B33D 3REID 1M18B 2PYOA 2VQRA 2HUEB 5BT1C 3AZJC 4WU9C 2CV5D 5B2JC 2FJ7A 3REHA 3W96C 4ZUXD 3AL0C 1F66B 4J8XB 3VH6W 3EPLA 5B32B 4H9PB 3VH6A 1P3OB 4KUDD 2PYOC 5B0YD 1P34B 3MGRB 2UWXA 3B0CT 5B24D 5B2IA 4J8WD 1U35A 3C1BA 2FJ7C 3EPHA 5GT3C 3REHC 3LZ0B 2F8NK 3LELD 3REKD 1P3FC 5GSUD 3C1CB 4WNNA 3AZLD 3AZIB 4WV4B 3C1BC 5CPJC 2AROD 2BG1A 3W98B 3IP4C 3VH6T 5CPKA 5B32G 1AOID 4DQYB 5AVBB 5B0ZD 1JFIB 1F66C 1BH9A 3WTPB 1P3MD 2BYKA 5CPKC 5AVCB 1KU5A 1ZLAA 3MGRC 3X1VA 1P3IB 4H9OB 3AYWA 4J8UB 5B1MD 5GT0A 2Y2HA 4XZQD 3REJB 3R45A 3C1CC 3B6FB 3AZGB 1P3GB 1T3UA 3RELD 3AZIC 1S32A 3KWQA 2RIQA 4YS3B 3AV1B 1KX5A 3AYWC 3B6GD 1P3LB 1P3PA 3W97A 4DRAA 3MVDB 3LZ1B 3AZKA 1KX4D 3WKJD 2RVQD 1S32C 3AV2A 3KWQC 1KX3B 2NQBA 4LD9A 5DNNA 4KHAB 5KDMB 1F1EA 4G92B 2NZDD 1P3PC 5JRGD 4J8VA 3AZKC 4ZUXA 5AV5D 5AV9B 3MGQB 3AV2C 4LD9C 5FUGB 1Q9CA 4Z2MG 3AZNB 3A1IA 3O62D 1P3IC 5CP6A 3AZHB 4WU9D 3KFUG 1TZYB 3REJC 1P3BA 3B6FC 3W96D 4R8PA 1P3AB 2HIOB 4QLCB 3AZFA 1EQZB 3NQJA 3V9RB 5B31B 3AZEB 3WAAD 4XUJA 5CP6C 1N1JA 3X1SB 5F99A 4KGCA 3H0MC 4Z2MH 3X1TB 5GT3D 2BYMA 4R8PC 5AY8B 3AZFC 5FUGA 1P3FD 4XUJC 3AZMA 5F99C 2F2AC 4KGCC 4G92C 5CPJD 3AZJB 3LJAB 5C3IC 3MGQC 5B2JB 3X1UD 4JJND 3AZMC 3AZNC 3WA9B 4Z5TD 3TU4D 2ZY4A 5B31G 1M18D 3AN2B 5BS7A 2PYOB 1TZYC 3W99A 2Y2QA 2FJ7B 4YM6A 3MGSA 3REHB 1P3AC 2HIOC 4J8XD 4QLCC 1M1AA 1F66D 5B32D 1P3OD 1P34D 5BS7C 2Y2MA 3MGRD 5E5AA 4H9RA
chains in the Genus database with same CATH topology
3B0CW 3X1TC 5B2IB 1U35B 3W99C 3C1BB 3LZ0D 3MGSC 5JA4A 5AY8C 1P3KA 1M1AC 4NE6A 3C1CD 3AZID 1ID3A 4WNNB 3LJAC 4UUZA 2NZDA 3MNNA 2Y2GA 5JRGA 3W98D 4E44A 3F6TA 5AV8A 5CPIA 1ID3C 3WA9C 3AN2C 2F8NA 2W8SA 5CPKB 3KUYA 1B6WA 5BNVA 5AVBD 3AFAA 1HQ3A 3UT9A 3WTPD 1BH9B 5CPIC 5AV8C 2BYKB 5AVCD 4X23A 2XD5A 3MGPA 1HTAA 1P3ID 1ZLAB 3UTBB 3WAAA 3X1VB 5B2IC 1U35C 4HGAC 1HQ3C 4J8UD 3UT9C 3AYWB 3KSYA 3REJD 5GT0B 3B6FD 3UTAA 3AZGD 3R45B 1P3GD 3MGPC 1S32B 3KWQB 5GXQA 4YS3D 3AV1D 4EO5C 1KX5B 5BO0A 5B40A 1P3LD 1P3PB 3MVDD 3LZ1D 3W97B 3EG5B 4G91C 3AZKB 5DNMD 1KX3D 3AV2B 5GXQC 2NQBB 2J8PA 4LD9B 4Z5TA 3UTBA 5DNNB 3FDDA 2YFVA 4Z66A 3KXBA 1A7WA 5AV6A 4J8VB 5B1LA 5AV9D 3MGQD 4ZUXB 3AZND 1ZLAC 4WU8A 3UTBC 3X1VC 3AZHD 3A6NA 5CP6B 1BFMA 5BNXB 3KXBC 1M19A 5AV6C 5GT0C 5B1LC 1P3BB 1P3AD 2HIOD 4QLCD 4R8PB 1EQZD 4WU8C 5B31D 3AZED 4H9NA 3AZFB 3NQJB 4H9SA 4XUJB 3A6NC 3X1SD 2Y2JA 1KX5C 1N1JB 5B33A 3REIA 5F99B 4KGCB 2CV5A 4H9QA 3W97C 4M6BA 2BYMB 5C3IB 2NQBC 5DNNC 3AZMB 3REIC 5B33C 1H3OA 4KUDA 5B0YA 2CV5C 5BT1D 5BNXA 5B24A 4J8WA 3AZJD 3LJAD 4J8VC 5B2JD 4ZUXC 3EPKA 3LELA 3REKA 3WA9D 5GSUA 4KUDC 3AN2D 3AZLA 2PYOD 5B24C 2FJ7D 3REHD 1P3BC 3W99B 4YM6B 2AROA 3LELC 3MGSB 3REKC 1M1AB 3AZLC 5E5AB 4H9RB 5B2ID 1U35D 1AOIA 3C1BD 2ZY2A 4CSRA 2AROC 5JA4B 3B6GB 5B0ZA 4NE5A 3WTPE 1P3KB 1P3MA 4CAYA 5DNMA 2LY8A 3WKJB 3H0RC 1ID3B 4UUZB 2NZDB 3MNNB 5B1MA 5JRGB 1P3MC 4XZQA 5AV8B 5CPIB 3VH5W 3RELA 5CPKD 2F8NB 3VH5A 3KUYB 5BNVB 4HGAB 4YM6C 3AFAB 5B1MC 3B6GA 1HQ3B 3UT9B 1KX4A 5G49A 3WKJA 4X23B 3MGPB 1ZLAD 5E5AC 3X1VD 3WAAB 4EO5B 2L5AA 3AYWD 2G5IC 3B6GC 2ZM5A 1P3KC 1KX4C 1ULYA 3WKJC 3UTAB 2RVQC 5AV5A 4G91B 1S32D 3VH5T 3KWQD 1W2EA 3O62A 5GXQB 2F8NG 1KX5D 3NQUA 5CHLB 2NZDC 5BO0B 5B40B 3MNNC 4WU9A 1P3PD 5JRGC 3W97D 4AWLB 3AZKD 2ZY3A 5AV5C 3W96A 3AV2D 3X1UB 2NQBD 4LD9D 3O62C 2YFWA 5DNND 4Z5TB 3KUYC 2YFVB 4Z66B 3AFAC 1BH8A 4J8VD 5GT3A 3KXBB 5AV6B 2F8NH 5B1LB 4X23C 1P3FA 3WAAC 4WU8B 2G5HC 5CP6D 3A6NB 5CPJA 3A1KA 1M19B 1P3BD 3UTAC 2CWEA 3B0BA 4R8PD 3X1UA 4JJNA 3AZFD 4H9NB 4XUJD 1WWSA 3TU4A 1M18A 5F99D 4KGCD 5B33B 3REIB 5B40C 2Y2IA 4NFTA 1WWIA 2CV5B 4H9QB 4AWLC 3X1UC 4JJNC 3B0DC 4J8XA 2Y2LA 1F66A 3AZMD 5B32A 4H9PA 4Z5TC 3TU4C 1P3OA 1M18C 2HUEC 1P34A 3MGRA 1H3OB 4Z66C 4KUDB 5B0YB 5B24B 4J8WB 1TAFB 1TZYD 3LZ0A 4J8XC 4WJ3C 3LELB 5B32C 3REKB 3C1CA 1P3OC 5GSUB 1P34C 3AZIA 3AZLB 1M19C 3X1TD 3LZ0C 3W99D 4YM6D 3MGSD 5AY8D 2AROB 2Y2OA 1M1AD 3W98A 2DF4C 4ZBJB 2ZY5A 4H9SC 4DRBA 5E5AD 1R4VA 1AOIB 1TAFA 4CSRB 5AVBA 1P3KD 1JFIA 3W98C 5B0ZB 3WTPA 3P5JB 1P3MB 4CAYB 5DNMB 5AVCA 1ID3D 5B0YC 1P3IA 4H9OA 4J8WC 2XD1A 5AVBC 3MNND 4J8UA 3WTPC 2DQNC 3REJA 5B1MB 4XZQB 1Z2CB 5AV8D 1B67A 5GSUC 5AVCC 3AZGA 5CPID 1P3GA 3B6FA 1PZRA 2F8ND 3RELB 3KUYD 3AV1A 4YS3A 3AFAD 4J8UC 1P3LA 1HQ3D 3UT9D 4E45A 4ZBJC 3LZ1A 3MVDA 3AZGC 1P3GC 1KX4B 5G49B 1KX3A 4X23D 3MGPD 4YS3C 3AV1C 2FFFB 4KHAA 1AOIC 5KDMA 1P3LC 2IO5B 5B0ZC 3MVDC 2Y2KA 3LZ1C 3UTAD 5DNMC 1KX3C 5AV9A 3MGQA 5AV5B 3AZNA 3H0LC 5GXQD 3O62B 3AZHA 3NQUB 5B40D 4WU9B 1TZYA 2JE5A 4XZQC 5AV9C 4NE3A 1P3AA 2HIOA 3W96B 4QLCA 3RELC 1EQZA 3V9RA 5B31A 3AZEA 2YFWB 3UTBD 4UPKA 3AZHC 3X1SA 4Z66D 2Y2PA 2JCHA 3EPJA 3X1TA 3KXBD 1BH8B 5AV6D 5GT0D 5GT3B 5B1LD 5AY8A 1EQZC 2Y2NA 5B31C 3AZEC 4WU8D 1P3FB 3X1SC 3A6ND 2IO5C 2JSSA 3AZJA 1M19D 5CPJB 3LJAA 5B2JA 4JJNB 3B0DB 3WA9A 4WZSB 3TU4B 3AN2A 5B33D 3REID 1M18B 2PYOA 2VQRA 2HUEB 5BT1C 3AZJC 4WU9C 2CV5D 5B2JC 2FJ7A 3REHA 3W96C 4ZUXD 3AL0C 1F66B 4J8XB 3VH6W 3EPLA 5B32B 4H9PB 3VH6A 1P3OB 4KUDD 2PYOC 5B0YD 1P34B 3MGRB 2UWXA 3B0CT 5B24D 5B2IA 4J8WD 1U35A 3C1BA 2FJ7C 3EPHA 5GT3C 3REHC 3LZ0B 2F8NK 3LELD 3REKD 1P3FC 5GSUD 3C1CB 4WNNA 3AZLD 3AZIB 4WV4B 3C1BC 5CPJC 2AROD 2BG1A 3W98B 3IP4C 3VH6T 5CPKA 5B32G 1AOID 4DQYB 5AVBB 5B0ZD 1JFIB 1F66C 1BH9A 3WTPB 1P3MD 2BYKA 5CPKC 5AVCB 1KU5A 1ZLAA 3MGRC 3X1VA 1P3IB 4H9OB 3AYWA 4J8UB 5B1MD 5GT0A 2Y2HA 4XZQD 3REJB 3R45A 3C1CC 3B6FB 3AZGB 1P3GB 1T3UA 3RELD 3AZIC 1S32A 3KWQA 2RIQA 4YS3B 3AV1B 1KX5A 3AYWC 3B6GD 1P3LB 1P3PA 3W97A 4DRAA 3MVDB 3LZ1B 3AZKA 1KX4D 3WKJD 2RVQD 1S32C 3AV2A 3KWQC 1KX3B 2NQBA 4LD9A 5DNNA 4KHAB 5KDMB 1F1EA 4G92B 2NZDD 1P3PC 5JRGD 4J8VA 3AZKC 4ZUXA 5AV5D 5AV9B 3MGQB 3AV2C 4LD9C 5FUGB 1Q9CA 4Z2MG 3AZNB 3A1IA 3O62D 1P3IC 5CP6A 3AZHB 4WU9D 3KFUG 1TZYB 3REJC 1P3BA 3B6FC 3W96D 4R8PA 1P3AB 2HIOB 4QLCB 3AZFA 1EQZB 3NQJA 3V9RB 5B31B 3AZEB 3WAAD 4XUJA 5CP6C 1N1JA 3X1SB 5F99A 4KGCA 3H0MC 4Z2MH 3X1TB 5GT3D 2BYMA 4R8PC 5AY8B 3AZFC 5FUGA 1P3FD 4XUJC 3AZMA 5F99C 2F2AC 4KGCC 4G92C 5CPJD 3AZJB 3LJAB 5C3IC 3MGQC 5B2JB 3X1UD 4JJND 3AZMC 3AZNC 3WA9B 4Z5TD 3TU4D 2ZY4A 5B31G 1M18D 3AN2B 5BS7A 2PYOB 1TZYC 3W99A 2Y2QA 2FJ7B 4YM6A 3MGSA 3REHB 1P3AC 2HIOC 4J8XD 4QLCC 1M1AA 1F66D 5B32D 1P3OD 1P34D 5BS7C 2Y2MA 3MGRD 5E5AA 4H9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0C W;  3X1T C;  5B2I B;  1U35 B;  3W99 C;  3C1B B;  3LZ0 D;  3MGS C;  5JA4 A;  5AY8 C;  1P3K A;  1M1A C;  4NE6 A;  3C1C D;  3AZI D;  1ID3 A;  4WNN B;  3LJA C;  4UUZ A;  2NZD A;  3MNN A;  5JRG A;  3W98 D;  4E44 A;  5AV8 A;  5CPI A;  3WA9 C;  1ID3 C;  3AN2 C;  2F8N A;  5CPK B;  3KUY A;  1B6W A;  5BNV A;  5AVB D;  3AFA A;  1HQ3 A;  3UT9 A;  3WTP D;  1BH9 B;  5CPI C;  5AV8 C;  2BYK B;  5AVC D;  4X23 A;  3MGP A;  1HTA A;  1P3I D;  1ZLA B;  3UTB B;  3WAA A;  3X1V B;  5B2I C;  1U35 C;  4HGA C;  1HQ3 C;  4J8U D;  3UT9 C;  3AYW B;  3KSY A;  3REJ D;  5GT0 B;  3B6F D;  3UTA A;  3AZG D;  3R45 B;  1P3G D;  3MGP C;  1S32 B;  3KWQ B;  5GXQ A;  4YS3 D;  3AV1 D;  4EO5 C;  1KX5 B;  5BO0 A;  5B40 A;  1P3L D;  1P3P B;  3MVD D;  3LZ1 D;  3W97 B;  4G91 C;  3AZK B;  5DNM D;  1KX3 D;  3AV2 B;  5GXQ C;  2NQB B;  4LD9 B;  4Z5T A;  3UTB A;  5DNN B;  2YFV A;  4Z66 A;  3KXB A;  1A7W A;  5AV6 A;  4J8V B;  5B1L A;  5AV9 D;  3MGQ D;  4ZUX B;  3AZN D;  1ZLA C;  4WU8 A;  3UTB C;  3X1V C;  3AZH D;  3A6N A;  5CP6 B;  1BFM A;  5BNX B;  3KXB C;  1M19 A;  5GT0 C;  5AV6 C;  5B1L C;  1P3B B;  1P3A D;  2HIO D;  4QLC D;  4R8P B;  1EQZ D;  4WU8 C;  5B31 D;  3AZE D;  4H9N A;  3AZF B;  3NQJ B;  4H9S A;  4XUJ B;  3A6N C;  3X1S D;  1KX5 C;  1N1J B;  5B33 A;  3REI A;  5F99 B;  4KGC B;  2CV5 A;  4H9Q A;  3W97 C;  4M6B A;  2BYM B;  5C3I B;  2NQB C;  5DNN C;  3AZM B;  3REI C;  5B33 C;  1H3O A;  4KUD A;  5B0Y A;  2CV5 C;  5BT1 D;  5BNX A;  5B24 A;  4J8W A;  3AZJ D;  3LJA D;  4J8V C;  5B2J D;  4ZUX C;  3LEL A;  3REK A;  3WA9 D;  5GSU A;  4KUD C;  3AN2 D;  3AZL A;  2PYO D;  5B24 C;  2FJ7 D;  3REH D;  1P3B C;  3W99 B;  4YM6 B;  2ARO A;  3LEL C;  3MGS B;  3REK C;  1M1A B;  3AZL C;  5E5A B;  4H9R B;  5B2I D;  1U35 D;  1AOI A;  3C1B D;  4CSR A;  2ARO C;  5JA4 B;  3B6G B;  5B0Z A;  4NE5 A;  3WTP E;  1P3K B;  1P3M A;  4CAY A;  5DNM A;  2LY8 A;  3WKJ B;  1ID3 B;  4UUZ B;  2NZD B;  3MNN B;  5B1M A;  5JRG B;  1P3M C;  4XZQ A;  5AV8 B;  5CPI B;  3VH5 W;  3REL A;  5CPK D;  2F8N B;  3VH5 A;  3KUY B;  5BNV B;  4HGA B;  4YM6 C;  3AFA B;  5B1M C;  3B6G A;  1HQ3 B;  3UT9 B;  1KX4 A;  5G49 A;  3WKJ A;  4X23 B;  3MGP B;  1ZLA D;  5E5A C;  3X1V D;  3WAA B;  4EO5 B;  2L5A A;  3AYW D;  3B6G C;  1P3K C;  1KX4 C;  1ULY A;  3WKJ C;  3UTA B;  2RVQ C;  5AV5 A;  4G91 B;  1S32 D;  3VH5 T;  3KWQ D;  3O62 A;  5GXQ B;  2F8N G;  1KX5 D;  3NQU A;  5CHL B;  2NZD C;  5BO0 B;  5B40 B;  3MNN C;  4WU9 A;  1P3P D;  5JRG C;  3W97 D;  4AWL B;  3AZK D;  5AV5 C;  3W96 A;  3AV2 D;  3X1U B;  2NQB D;  4LD9 D;  3O62 C;  2YFW A;  5DNN D;  4Z5T B;  3KUY C;  2YFV B;  4Z66 B;  3AFA C;  1BH8 A;  4J8V D;  5GT3 A;  3KXB B;  5AV6 B;  2F8N H;  5B1L B;  4X23 C;  1P3F A;  3WAA C;  4WU8 B;  5CP6 D;  3A6N B;  5CPJ A;  1M19 B;  1P3B D;  3UTA C;  2CWE A;  3B0B A;  4R8P D;  3X1U A;  4JJN A;  3AZF D;  4H9N B;  4XUJ D;  1WWS A;  3TU4 A;  1M18 A;  5F99 D;  4KGC D;  5B33 B;  3REI B;  5B40 C;  4NFT A;  1WWI A;  2CV5 B;  4H9Q B;  4AWL C;  3X1U C;  4JJN C;  3B0D C;  4J8X A;  1F66 A;  3AZM D;  5B32 A;  4H9P A;  4Z5T C;  3TU4 C;  1P3O A;  1M18 C;  2HUE C;  1P34 A;  3MGR A;  1H3O B;  4Z66 C;  4KUD B;  5B0Y B;  5B24 B;  4J8W B;  1TAF B;  1TZY D;  3LZ0 A;  4J8X C;  3LEL B;  5B32 C;  3REK B;  3C1C A;  1P3O C;  5GSU B;  1P34 C;  3AZI A;  3AZL B;  1M19 C;  3X1T D;  3LZ0 C;  3W99 D;  4YM6 D;  3MGS D;  5AY8 D;  2ARO B;  1M1A D;  3W98 A;  4ZBJ B;  4H9S C;  4DRB A;  5E5A D;  1R4V A;  1AOI B;  1TAF A;  4CSR B;  5AVB A;  1P3K D;  1JFI A;  3W98 C;  5B0Z B;  3WTP A;  1P3M B;  4CAY B;  5DNM B;  5AVC A;  1ID3 D;  5B0Y C;  1P3I A;  4H9O A;  4J8W C;  5AVB C;  3MNN D;  4J8U A;  3WTP C;  3REJ A;  5B1M B;  4XZQ B;  5AV8 D;  5AVC C;  1B67 A;  5GSU C;  3AZG A;  5CPI D;  1P3G A;  3B6F A;  2F8N D;  3REL B;  3KUY D;  3AV1 A;  4YS3 A;  3AFA D;  4J8U C;  1P3L A;  1HQ3 D;  3UT9 D;  4E45 A;  4ZBJ C;  3LZ1 A;  3MVD A;  3AZG C;  1P3G C;  1KX4 B;  5G49 B;  1KX3 A;  4X23 D;  3MGP D;  4YS3 C;  3AV1 C;  4KHA A;  1AOI C;  5KDM A;  1P3L C;  2IO5 B;  5B0Z C;  3MVD C;  3LZ1 C;  3UTA D;  5DNM C;  1KX3 C;  5AV9 A;  3MGQ A;  5AV5 B;  3AZN A;  5GXQ D;  3O62 B;  3AZH A;  3NQU B;  5B40 D;  4WU9 B;  1TZY A;  4XZQ C;  5AV9 C;  4NE3 A;  1P3A A;  2HIO A;  3W96 B;  4QLC A;  3REL C;  1EQZ A;  3V9R A;  5B31 A;  3AZE A;  2YFW B;  3UTB D;  3AZH C;  3X1S A;  4Z66 D;  3X1T A;  3KXB D;  1BH8 B;  5GT0 D;  5AV6 D;  5GT3 B;  5B1L D;  5AY8 A;  1EQZ C;  5B31 C;  3AZE C;  4WU8 D;  1P3F B;  3X1S C;  3A6N D;  2JSS A;  2IO5 C;  3AZJ A;  1M19 D;  5CPJ B;  3LJA A;  5B2J A;  4JJN B;  3B0D B;  3WA9 A;  4WZS B;  3TU4 B;  3AN2 A;  5B33 D;  3REI D;  1M18 B;  2PYO A;  5BT1 C;  2HUE B;  3AZJ C;  4WU9 C;  2CV5 D;  5B2J C;  2FJ7 A;  3REH A;  3W96 C;  4ZUX D;  1F66 B;  4J8X B;  3VH6 W;  5B32 B;  4H9P B;  3VH6 A;  1P3O B;  4KUD D;  2PYO C;  5B0Y D;  1P34 B;  3MGR B;  3B0C T;  5B24 D;  4J8W D;  5B2I A;  1U35 A;  3C1B A;  2FJ7 C;  5GT3 C;  3REH C;  3LZ0 B;  2F8N K;  3LEL D;  3REK D;  1P3F C;  5GSU D;  3C1C B;  4WNN A;  3AZL D;  3AZI B;  4WV4 B;  3C1B C;  5CPJ C;  2ARO D;  3W98 B;  3VH6 T;  5CPK A;  5B32 G;  1AOI D;  5AVB B;  5B0Z D;  1JFI B;  1F66 C;  1BH9 A;  3WTP B;  1P3M D;  2BYK A;  5CPK C;  5AVC B;  1KU5 A;  1ZLA A;  3MGR C;  3X1V A;  1P3I B;  4H9O B;  3AYW A;  4J8U B;  5B1M D;  5GT0 A;  4XZQ D;  3REJ B;  3R45 A;  3C1C C;  3B6F B;  3AZG B;  1P3G B;  3REL D;  3AZI C;  1S32 A;  3KWQ A;  4YS3 B;  3AV1 B;  1KX5 A;  3AYW C;  3B6G D;  1P3L B;  1P3P A;  3W97 A;  4DRA A;  3MVD B;  3LZ1 B;  3AZK A;  1KX4 D;  3WKJ D;  2RVQ D;  1S32 C;  3AV2 A;  3KWQ C;  1KX3 B;  2NQB A;  4LD9 A;  5DNN A;  4KHA B;  5KDM B;  1F1E A;  4G92 B;  2NZD D;  1P3P C;  5JRG D;  4J8V A;  3AZK C;  4ZUX A;  5AV5 D;  5AV9 B;  3MGQ B;  3AV2 C;  4LD9 C;  5FUG B;  1Q9C A;  4Z2M G;  3AZN B;  3O62 D;  1P3I C;  5CP6 A;  3AZH B;  4WU9 D;  1TZY B;  3REJ C;  1P3B A;  3B6F C;  3W96 D;  4R8P A;  1P3A B;  2HIO B;  4QLC B;  3AZF A;  1EQZ B;  3NQJ A;  3V9R B;  5B31 B;  3AZE B;  3WAA D;  4XUJ A;  5CP6 C;  1N1J A;  3X1S B;  5F99 A;  4KGC A;  4Z2M H;  3X1T B;  5GT3 D;  2BYM A;  4R8P C;  5AY8 B;  3AZF C;  5FUG A;  1P3F D;  4XUJ C;  3AZM A;  5F99 C;  4KGC C;  4G92 C;  5CPJ D;  3AZJ B;  3LJA B;  5C3I C;  3MGQ C;  5B2J B;  3X1U D;  4JJN D;  3AZM C;  3AZN C;  3WA9 B;  4Z5T D;  3TU4 D;  5B31 G;  1M18 D;  3AN2 B;  5BS7 A;  2PYO B;  1TZY C;  3W99 A;  2FJ7 B;  4YM6 A;  3MGS A;  3REH B;  1P3A C;  2HIO C;  4J8X D;  4QLC C;  1M1A A;  1F66 D;  5B32 D;  1P3O D;  1P34 D;  5BS7 C;  3MGR D;  5E5A A;  4H9R A; 
#chains in the Genus database with same CATH topology
 3B0C W;  3X1T C;  5B2I B;  1U35 B;  3W99 C;  3C1B B;  3LZ0 D;  3MGS C;  5JA4 A;  5AY8 C;  1P3K A;  1M1A C;  4NE6 A;  3C1C D;  3AZI D;  1ID3 A;  4WNN B;  3LJA C;  4UUZ A;  2NZD A;  3MNN A;  2Y2G A;  5JRG A;  3W98 D;  4E44 A;  3F6T A;  5AV8 A;  5CPI A;  1ID3 C;  3WA9 C;  3AN2 C;  2F8N A;  2W8S A;  5CPK B;  3KUY A;  1B6W A;  5BNV A;  5AVB D;  3AFA A;  1HQ3 A;  3UT9 A;  3WTP D;  1BH9 B;  5CPI C;  5AV8 C;  2BYK B;  5AVC D;  4X23 A;  2XD5 A;  3MGP A;  1HTA A;  1P3I D;  1ZLA B;  3UTB B;  3WAA A;  3X1V B;  5B2I C;  1U35 C;  4HGA C;  1HQ3 C;  4J8U D;  3UT9 C;  3AYW B;  3KSY A;  3REJ D;  5GT0 B;  3B6F D;  3UTA A;  3AZG D;  3R45 B;  1P3G D;  3MGP C;  1S32 B;  3KWQ B;  5GXQ A;  4YS3 D;  3AV1 D;  4EO5 C;  1KX5 B;  5BO0 A;  5B40 A;  1P3L D;  1P3P B;  3MVD D;  3LZ1 D;  3W97 B;  3EG5 B;  4G91 C;  3AZK B;  5DNM D;  1KX3 D;  3AV2 B;  5GXQ C;  2NQB B;  2J8P A;  4LD9 B;  4Z5T A;  3UTB A;  5DNN B;  3FDD A;  2YFV A;  4Z66 A;  3KXB A;  1A7W A;  5AV6 A;  4J8V B;  5B1L A;  5AV9 D;  3MGQ D;  4ZUX B;  3AZN D;  1ZLA C;  4WU8 A;  3UTB C;  3X1V C;  3AZH D;  3A6N A;  5CP6 B;  1BFM A;  5BNX B;  3KXB C;  1M19 A;  5AV6 C;  5GT0 C;  5B1L C;  1P3B B;  1P3A D;  2HIO D;  4QLC D;  4R8P B;  1EQZ D;  4WU8 C;  5B31 D;  3AZE D;  4H9N A;  3AZF B;  3NQJ B;  4H9S A;  4XUJ B;  3A6N C;  3X1S D;  2Y2J A;  1KX5 C;  1N1J B;  5B33 A;  3REI A;  5F99 B;  4KGC B;  2CV5 A;  4H9Q A;  3W97 C;  4M6B A;  2BYM B;  5C3I B;  2NQB C;  5DNN C;  3AZM B;  3REI C;  5B33 C;  1H3O A;  4KUD A;  5B0Y A;  2CV5 C;  5BT1 D;  5BNX A;  5B24 A;  4J8W A;  3AZJ D;  3LJA D;  4J8V C;  5B2J D;  4ZUX C;  3EPK A;  3LEL A;  3REK A;  3WA9 D;  5GSU A;  4KUD C;  3AN2 D;  3AZL A;  2PYO D;  5B24 C;  2FJ7 D;  3REH D;  1P3B C;  3W99 B;  4YM6 B;  2ARO A;  3LEL C;  3MGS B;  3REK C;  1M1A B;  3AZL C;  5E5A B;  4H9R B;  5B2I D;  1U35 D;  1AOI A;  3C1B D;  2ZY2 A;  4CSR A;  2ARO C;  5JA4 B;  3B6G B;  5B0Z A;  4NE5 A;  3WTP E;  1P3K B;  1P3M A;  4CAY A;  5DNM A;  2LY8 A;  3WKJ B;  3H0R C;  1ID3 B;  4UUZ B;  2NZD B;  3MNN B;  5B1M A;  5JRG B;  1P3M C;  4XZQ A;  5AV8 B;  5CPI B;  3VH5 W;  3REL A;  5CPK D;  2F8N B;  3VH5 A;  3KUY B;  5BNV B;  4HGA B;  4YM6 C;  3AFA B;  5B1M C;  3B6G A;  1HQ3 B;  3UT9 B;  1KX4 A;  5G49 A;  3WKJ A;  4X23 B;  3MGP B;  1ZLA D;  5E5A C;  3X1V D;  3WAA B;  4EO5 B;  2L5A A;  3AYW D;  2G5I C;  3B6G C;  2ZM5 A;  1P3K C;  1KX4 C;  1ULY A;  3WKJ C;  3UTA B;  2RVQ C;  5AV5 A;  4G91 B;  1S32 D;  3VH5 T;  3KWQ D;  1W2E A;  3O62 A;  5GXQ B;  2F8N G;  1KX5 D;  3NQU A;  5CHL B;  2NZD C;  5BO0 B;  5B40 B;  3MNN C;  4WU9 A;  1P3P D;  5JRG C;  3W97 D;  4AWL B;  3AZK D;  2ZY3 A;  5AV5 C;  3W96 A;  3AV2 D;  3X1U B;  2NQB D;  4LD9 D;  3O62 C;  2YFW A;  5DNN D;  4Z5T B;  3KUY C;  2YFV B;  4Z66 B;  3AFA C;  1BH8 A;  4J8V D;  5GT3 A;  3KXB B;  5AV6 B;  2F8N H;  5B1L B;  4X23 C;  1P3F A;  3WAA C;  4WU8 B;  2G5H C;  5CP6 D;  3A6N B;  5CPJ A;  3A1K A;  1M19 B;  1P3B D;  3UTA C;  2CWE A;  3B0B A;  4R8P D;  3X1U A;  4JJN A;  3AZF D;  4H9N B;  4XUJ D;  1WWS A;  3TU4 A;  1M18 A;  5F99 D;  4KGC D;  5B33 B;  3REI B;  5B40 C;  2Y2I A;  4NFT A;  1WWI A;  2CV5 B;  4H9Q B;  4AWL C;  3X1U C;  4JJN C;  3B0D C;  4J8X A;  2Y2L A;  1F66 A;  3AZM D;  5B32 A;  4H9P A;  4Z5T C;  3TU4 C;  1P3O A;  1M18 C;  2HUE C;  1P34 A;  3MGR A;  1H3O B;  4Z66 C;  4KUD B;  5B0Y B;  5B24 B;  4J8W B;  1TAF B;  1TZY D;  3LZ0 A;  4J8X C;  4WJ3 C;  3LEL B;  5B32 C;  3REK B;  3C1C A;  1P3O C;  5GSU B;  1P34 C;  3AZI A;  3AZL B;  1M19 C;  3X1T D;  3LZ0 C;  3W99 D;  4YM6 D;  3MGS D;  5AY8 D;  2ARO B;  2Y2O A;  1M1A D;  3W98 A;  2DF4 C;  4ZBJ B;  2ZY5 A;  4H9S C;  4DRB A;  5E5A D;  1R4V A;  1AOI B;  1TAF A;  4CSR B;  5AVB A;  1P3K D;  1JFI A;  3W98 C;  5B0Z B;  3WTP A;  3P5J B;  1P3M B;  4CAY B;  5DNM B;  5AVC A;  1ID3 D;  5B0Y C;  1P3I A;  4H9O A;  4J8W C;  2XD1 A;  5AVB C;  3MNN D;  4J8U A;  3WTP C;  2DQN C;  3REJ A;  5B1M B;  4XZQ B;  1Z2C B;  5AV8 D;  1B67 A;  5GSU C;  5AVC C;  3AZG A;  5CPI D;  1P3G A;  3B6F A;  1PZR A;  2F8N D;  3REL B;  3KUY D;  3AV1 A;  4YS3 A;  3AFA D;  4J8U C;  1P3L A;  1HQ3 D;  3UT9 D;  4E45 A;  4ZBJ C;  3LZ1 A;  3MVD A;  3AZG C;  1P3G C;  1KX4 B;  5G49 B;  1KX3 A;  4X23 D;  3MGP D;  4YS3 C;  3AV1 C;  2FFF B;  4KHA A;  1AOI C;  5KDM A;  1P3L C;  2IO5 B;  5B0Z C;  3MVD C;  2Y2K A;  3LZ1 C;  3UTA D;  5DNM C;  1KX3 C;  5AV9 A;  3MGQ A;  5AV5 B;  3AZN A;  3H0L C;  5GXQ D;  3O62 B;  3AZH A;  3NQU B;  5B40 D;  4WU9 B;  1TZY A;  2JE5 A;  4XZQ C;  5AV9 C;  4NE3 A;  1P3A A;  2HIO A;  3W96 B;  4QLC A;  3REL C;  1EQZ A;  3V9R A;  5B31 A;  3AZE A;  2YFW B;  3UTB D;  4UPK A;  3AZH C;  3X1S A;  4Z66 D;  2Y2P A;  2JCH A;  3EPJ A;  3X1T A;  3KXB D;  1BH8 B;  5AV6 D;  5GT0 D;  5GT3 B;  5B1L D;  5AY8 A;  1EQZ C;  2Y2N A;  5B31 C;  3AZE C;  4WU8 D;  1P3F B;  3X1S C;  3A6N D;  2IO5 C;  2JSS A;  3AZJ A;  1M19 D;  5CPJ B;  3LJA A;  5B2J A;  4JJN B;  3B0D B;  3WA9 A;  4WZS B;  3TU4 B;  3AN2 A;  5B33 D;  3REI D;  1M18 B;  2PYO A;  2VQR A;  2HUE B;  5BT1 C;  3AZJ C;  4WU9 C;  2CV5 D;  5B2J C;  2FJ7 A;  3REH A;  3W96 C;  4ZUX D;  3AL0 C;  1F66 B;  4J8X B;  3VH6 W;  3EPL A;  5B32 B;  4H9P B;  3VH6 A;  1P3O B;  4KUD D;  2PYO C;  5B0Y D;  1P34 B;  3MGR B;  2UWX A;  3B0C T;  5B24 D;  5B2I A;  4J8W D;  1U35 A;  3C1B A;  2FJ7 C;  3EPH A;  5GT3 C;  3REH C;  3LZ0 B;  2F8N K;  3LEL D;  3REK D;  1P3F C;  5GSU D;  3C1C B;  4WNN A;  3AZL D;  3AZI B;  4WV4 B;  3C1B C;  5CPJ C;  2ARO D;  2BG1 A;  3W98 B;  3IP4 C;  3VH6 T;  5CPK A;  5B32 G;  1AOI D;  4DQY B;  5AVB B;  5B0Z D;  1JFI B;  1F66 C;  1BH9 A;  3WTP B;  1P3M D;  2BYK A;  5CPK C;  5AVC B;  1KU5 A;  1ZLA A;  3MGR C;  3X1V A;  1P3I B;  4H9O B;  3AYW A;  4J8U B;  5B1M D;  5GT0 A;  2Y2H A;  4XZQ D;  3REJ B;  3R45 A;  3C1C C;  3B6F B;  3AZG B;  1P3G B;  1T3U A;  3REL D;  3AZI C;  1S32 A;  3KWQ A;  2RIQ A;  4YS3 B;  3AV1 B;  1KX5 A;  3AYW C;  3B6G D;  1P3L B;  1P3P A;  3W97 A;  4DRA A;  3MVD B;  3LZ1 B;  3AZK A;  1KX4 D;  3WKJ D;  2RVQ D;  1S32 C;  3AV2 A;  3KWQ C;  1KX3 B;  2NQB A;  4LD9 A;  5DNN A;  4KHA B;  5KDM B;  1F1E A;  4G92 B;  2NZD D;  1P3P C;  5JRG D;  4J8V A;  3AZK C;  4ZUX A;  5AV5 D;  5AV9 B;  3MGQ B;  3AV2 C;  4LD9 C;  5FUG B;  1Q9C A;  4Z2M G;  3AZN B;  3A1I A;  3O62 D;  1P3I C;  5CP6 A;  3AZH B;  4WU9 D;  3KFU G;  1TZY B;  3REJ C;  1P3B A;  3B6F C;  3W96 D;  4R8P A;  1P3A B;  2HIO B;  4QLC B;  3AZF A;  1EQZ B;  3NQJ A;  3V9R B;  5B31 B;  3AZE B;  3WAA D;  4XUJ A;  5CP6 C;  1N1J A;  3X1S B;  5F99 A;  4KGC A;  3H0M C;  4Z2M H;  3X1T B;  5GT3 D;  2BYM A;  4R8P C;  5AY8 B;  3AZF C;  5FUG A;  1P3F D;  4XUJ C;  3AZM A;  5F99 C;  2F2A C;  4KGC C;  4G92 C;  5CPJ D;  3AZJ B;  3LJA B;  5C3I C;  3MGQ C;  5B2J B;  3X1U D;  4JJN D;  3AZM C;  3AZN C;  3WA9 B;  4Z5T D;  3TU4 D;  2ZY4 A;  5B31 G;  1M18 D;  3AN2 B;  5BS7 A;  2PYO B;  1TZY C;  3W99 A;  2Y2Q A;  2FJ7 B;  4YM6 A;  3MGS A;  3REH B;  1P3A C;  2HIO C;  4J8X D;  4QLC C;  1M1A A;  1F66 D;  5B32 D;  1P3O D;  1P34 D;  5BS7 C;  2Y2M A;  3MGR D;  5E5A A;  4H9R A; 
#chains in the Genus database with same CATH homology
 3B0C W;  3X1T C;  5B2I B;  1U35 B;  3W99 C;  3C1B B;  3LZ0 D;  3MGS C;  5JA4 A;  5AY8 C;  1P3K A;  1M1A C;  4NE6 A;  3C1C D;  3AZI D;  1ID3 A;  4WNN B;  3LJA C;  4UUZ A;  2NZD A;  3MNN A;  2Y2G A;  5JRG A;  3W98 D;  4E44 A;  3F6T A;  5AV8 A;  5CPI A;  1ID3 C;  3WA9 C;  3AN2 C;  2F8N A;  2W8S A;  5CPK B;  3KUY A;  1B6W A;  5BNV A;  5AVB D;  3AFA A;  1HQ3 A;  3UT9 A;  3WTP D;  1BH9 B;  5CPI C;  5AV8 C;  2BYK B;  5AVC D;  4X23 A;  2XD5 A;  3MGP A;  1HTA A;  1P3I D;  1ZLA B;  3UTB B;  3WAA A;  3X1V B;  5B2I C;  1U35 C;  4HGA C;  1HQ3 C;  4J8U D;  3UT9 C;  3AYW B;  3KSY A;  3REJ D;  5GT0 B;  3B6F D;  3UTA A;  3AZG D;  3R45 B;  1P3G D;  3MGP C;  1S32 B;  3KWQ B;  5GXQ A;  4YS3 D;  3AV1 D;  4EO5 C;  1KX5 B;  5BO0 A;  5B40 A;  1P3L D;  1P3P B;  3MVD D;  3LZ1 D;  3W97 B;  3EG5 B;  4G91 C;  3AZK B;  5DNM D;  1KX3 D;  3AV2 B;  5GXQ C;  2NQB B;  2J8P A;  4LD9 B;  4Z5T A;  3UTB A;  5DNN B;  3FDD A;  2YFV A;  4Z66 A;  3KXB A;  1A7W A;  5AV6 A;  4J8V B;  5B1L A;  5AV9 D;  3MGQ D;  4ZUX B;  3AZN D;  1ZLA C;  4WU8 A;  3UTB C;  3X1V C;  3AZH D;  3A6N A;  5CP6 B;  1BFM A;  5BNX B;  3KXB C;  1M19 A;  5AV6 C;  5GT0 C;  5B1L C;  1P3B B;  1P3A D;  2HIO D;  4QLC D;  4R8P B;  1EQZ D;  4WU8 C;  5B31 D;  3AZE D;  4H9N A;  3AZF B;  3NQJ B;  4H9S A;  4XUJ B;  3A6N C;  3X1S D;  2Y2J A;  1KX5 C;  1N1J B;  5B33 A;  3REI A;  5F99 B;  4KGC B;  2CV5 A;  4H9Q A;  3W97 C;  4M6B A;  2BYM B;  5C3I B;  2NQB C;  5DNN C;  3AZM B;  3REI C;  5B33 C;  1H3O A;  4KUD A;  5B0Y A;  2CV5 C;  5BT1 D;  5BNX A;  5B24 A;  4J8W A;  3AZJ D;  3LJA D;  4J8V C;  5B2J D;  4ZUX C;  3EPK A;  3LEL A;  3REK A;  3WA9 D;  5GSU A;  4KUD C;  3AN2 D;  3AZL A;  2PYO D;  5B24 C;  2FJ7 D;  3REH D;  1P3B C;  3W99 B;  4YM6 B;  2ARO A;  3LEL C;  3MGS B;  3REK C;  1M1A B;  3AZL C;  5E5A B;  4H9R B;  5B2I D;  1U35 D;  1AOI A;  3C1B D;  2ZY2 A;  4CSR A;  2ARO C;  5JA4 B;  3B6G B;  5B0Z A;  4NE5 A;  3WTP E;  1P3K B;  1P3M A;  4CAY A;  5DNM A;  2LY8 A;  3WKJ B;  3H0R C;  1ID3 B;  4UUZ B;  2NZD B;  3MNN B;  5B1M A;  5JRG B;  1P3M C;  4XZQ A;  5AV8 B;  5CPI B;  3VH5 W;  3REL A;  5CPK D;  2F8N B;  3VH5 A;  3KUY B;  5BNV B;  4HGA B;  4YM6 C;  3AFA B;  5B1M C;  3B6G A;  1HQ3 B;  3UT9 B;  1KX4 A;  5G49 A;  3WKJ A;  4X23 B;  3MGP B;  1ZLA D;  5E5A C;  3X1V D;  3WAA B;  4EO5 B;  2L5A A;  3AYW D;  2G5I C;  3B6G C;  2ZM5 A;  1P3K C;  1KX4 C;  1ULY A;  3WKJ C;  3UTA B;  2RVQ C;  5AV5 A;  4G91 B;  1S32 D;  3VH5 T;  3KWQ D;  1W2E A;  3O62 A;  5GXQ B;  2F8N G;  1KX5 D;  3NQU A;  5CHL B;  2NZD C;  5BO0 B;  5B40 B;  3MNN C;  4WU9 A;  1P3P D;  5JRG C;  3W97 D;  4AWL B;  3AZK D;  2ZY3 A;  5AV5 C;  3W96 A;  3AV2 D;  3X1U B;  2NQB D;  4LD9 D;  3O62 C;  2YFW A;  5DNN D;  4Z5T B;  3KUY C;  2YFV B;  4Z66 B;  3AFA C;  1BH8 A;  4J8V D;  5GT3 A;  3KXB B;  5AV6 B;  2F8N H;  5B1L B;  4X23 C;  1P3F A;  3WAA C;  4WU8 B;  2G5H C;  5CP6 D;  3A6N B;  5CPJ A;  3A1K A;  1M19 B;  1P3B D;  3UTA C;  2CWE A;  3B0B A;  4R8P D;  3X1U A;  4JJN A;  3AZF D;  4H9N B;  4XUJ D;  1WWS A;  3TU4 A;  1M18 A;  5F99 D;  4KGC D;  5B33 B;  3REI B;  5B40 C;  2Y2I A;  4NFT A;  1WWI A;  2CV5 B;  4H9Q B;  4AWL C;  3X1U C;  4JJN C;  3B0D C;  4J8X A;  2Y2L A;  1F66 A;  3AZM D;  5B32 A;  4H9P A;  4Z5T C;  3TU4 C;  1P3O A;  1M18 C;  2HUE C;  1P34 A;  3MGR A;  1H3O B;  4Z66 C;  4KUD B;  5B0Y B;  5B24 B;  4J8W B;  1TAF B;  1TZY D;  3LZ0 A;  4J8X C;  4WJ3 C;  3LEL B;  5B32 C;  3REK B;  3C1C A;  1P3O C;  5GSU B;  1P34 C;  3AZI A;  3AZL B;  1M19 C;  3X1T D;  3LZ0 C;  3W99 D;  4YM6 D;  3MGS D;  5AY8 D;  2ARO B;  2Y2O A;  1M1A D;  3W98 A;  2DF4 C;  4ZBJ B;  2ZY5 A;  4H9S C;  4DRB A;  5E5A D;  1R4V A;  1AOI B;  1TAF A;  4CSR B;  5AVB A;  1P3K D;  1JFI A;  3W98 C;  5B0Z B;  3WTP A;  3P5J B;  1P3M B;  4CAY B;  5DNM B;  5AVC A;  1ID3 D;  5B0Y C;  1P3I A;  4H9O A;  4J8W C;  2XD1 A;  5AVB C;  3MNN D;  4J8U A;  3WTP C;  2DQN C;  3REJ A;  5B1M B;  4XZQ B;  1Z2C B;  5AV8 D;  1B67 A;  5GSU C;  5AVC C;  3AZG A;  5CPI D;  1P3G A;  3B6F A;  1PZR A;  2F8N D;  3REL B;  3KUY D;  3AV1 A;  4YS3 A;  3AFA D;  4J8U C;  1P3L A;  1HQ3 D;  3UT9 D;  4E45 A;  4ZBJ C;  3LZ1 A;  3MVD A;  3AZG C;  1P3G C;  1KX4 B;  5G49 B;  1KX3 A;  4X23 D;  3MGP D;  4YS3 C;  3AV1 C;  2FFF B;  4KHA A;  1AOI C;  5KDM A;  1P3L C;  2IO5 B;  5B0Z C;  3MVD C;  2Y2K A;  3LZ1 C;  3UTA D;  5DNM C;  1KX3 C;  5AV9 A;  3MGQ A;  5AV5 B;  3AZN A;  3H0L C;  5GXQ D;  3O62 B;  3AZH A;  3NQU B;  5B40 D;  4WU9 B;  1TZY A;  2JE5 A;  4XZQ C;  5AV9 C;  4NE3 A;  1P3A A;  2HIO A;  3W96 B;  4QLC A;  3REL C;  1EQZ A;  3V9R A;  5B31 A;  3AZE A;  2YFW B;  3UTB D;  4UPK A;  3AZH C;  3X1S A;  4Z66 D;  2Y2P A;  2JCH A;  3EPJ A;  3X1T A;  3KXB D;  1BH8 B;  5AV6 D;  5GT0 D;  5GT3 B;  5B1L D;  5AY8 A;  1EQZ C;  2Y2N A;  5B31 C;  3AZE C;  4WU8 D;  1P3F B;  3X1S C;  3A6N D;  2IO5 C;  2JSS A;  3AZJ A;  1M19 D;  5CPJ B;  3LJA A;  5B2J A;  4JJN B;  3B0D B;  3WA9 A;  4WZS B;  3TU4 B;  3AN2 A;  5B33 D;  3REI D;  1M18 B;  2PYO A;  2VQR A;  2HUE B;  5BT1 C;  3AZJ C;  4WU9 C;  2CV5 D;  5B2J C;  2FJ7 A;  3REH A;  3W96 C;  4ZUX D;  3AL0 C;  1F66 B;  4J8X B;  3VH6 W;  3EPL A;  5B32 B;  4H9P B;  3VH6 A;  1P3O B;  4KUD D;  2PYO C;  5B0Y D;  1P34 B;  3MGR B;  2UWX A;  3B0C T;  5B24 D;  5B2I A;  4J8W D;  1U35 A;  3C1B A;  2FJ7 C;  3EPH A;  5GT3 C;  3REH C;  3LZ0 B;  2F8N K;  3LEL D;  3REK D;  1P3F C;  5GSU D;  3C1C B;  4WNN A;  3AZL D;  3AZI B;  4WV4 B;  3C1B C;  5CPJ C;  2ARO D;  2BG1 A;  3W98 B;  3IP4 C;  3VH6 T;  5CPK A;  5B32 G;  1AOI D;  4DQY B;  5AVB B;  5B0Z D;  1JFI B;  1F66 C;  1BH9 A;  3WTP B;  1P3M D;  2BYK A;  5CPK C;  5AVC B;  1KU5 A;  1ZLA A;  3MGR C;  3X1V A;  1P3I B;  4H9O B;  3AYW A;  4J8U B;  5B1M D;  5GT0 A;  2Y2H A;  4XZQ D;  3REJ B;  3R45 A;  3C1C C;  3B6F B;  3AZG B;  1P3G B;  1T3U A;  3REL D;  3AZI C;  1S32 A;  3KWQ A;  2RIQ A;  4YS3 B;  3AV1 B;  1KX5 A;  3AYW C;  3B6G D;  1P3L B;  1P3P A;  3W97 A;  4DRA A;  3MVD B;  3LZ1 B;  3AZK A;  1KX4 D;  3WKJ D;  2RVQ D;  1S32 C;  3AV2 A;  3KWQ C;  1KX3 B;  2NQB A;  4LD9 A;  5DNN A;  4KHA B;  5KDM B;  1F1E A;  4G92 B;  2NZD D;  1P3P C;  5JRG D;  4J8V A;  3AZK C;  4ZUX A;  5AV5 D;  5AV9 B;  3MGQ B;  3AV2 C;  4LD9 C;  5FUG B;  1Q9C A;  4Z2M G;  3AZN B;  3A1I A;  3O62 D;  1P3I C;  5CP6 A;  3AZH B;  4WU9 D;  3KFU G;  1TZY B;  3REJ C;  1P3B A;  3B6F C;  3W96 D;  4R8P A;  1P3A B;  2HIO B;  4QLC B;  3AZF A;  1EQZ B;  3NQJ A;  3V9R B;  5B31 B;  3AZE B;  3WAA D;  4XUJ A;  5CP6 C;  1N1J A;  3X1S B;  5F99 A;  4KGC A;  3H0M C;  4Z2M H;  3X1T B;  5GT3 D;  2BYM A;  4R8P C;  5AY8 B;  3AZF C;  5FUG A;  1P3F D;  4XUJ C;  3AZM A;  5F99 C;  2F2A C;  4KGC C;  4G92 C;  5CPJ D;  3AZJ B;  3LJA B;  5C3I C;  3MGQ C;  5B2J B;  3X1U D;  4JJN D;  3AZM C;  3AZN C;  3WA9 B;  4Z5T D;  3TU4 D;  2ZY4 A;  5B31 G;  1M18 D;  3AN2 B;  5BS7 A;  2PYO B;  1TZY C;  3W99 A;  2Y2Q A;  2FJ7 B;  4YM6 A;  3MGS A;  3REH B;  1P3A C;  2HIO C;  4J8X D;  4QLC C;  1M1A A;  1F66 D;  5B32 D;  1P3O D;  1P34 D;  5BS7 C;  2Y2M A;  3MGR D;  5E5A A;  4H9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...