3LZ0C

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 1)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz0C00
5GSUD 1KU5A 2F8ND 3UT9C 3REID 1BH9A 1AOID 3MGSC 1P3IC 1P3PC 2NQBB 3UTAD 4E45A 4KUDA 5B32G 4Z66A 3V9RA 4R8PB 3MGQC 1A7WA 5KDMB 2JSSA 4H9SA 5CPKC 4DRAA 3REIC 4J8UD 3AZJB 3AZED 4ZUXA 5B31C 1M18B 5B0ZA 3VH5T 5B2IC 1KX3C 4XUJD 2YFWA 5B1LA 4J8UC 3KWQA 1EQZA 2NZDD 5GT3C 4G91B 5B40C 3WTPA 4YS3D 4HGAC 3C1CA 5B33C 3VH6W 5AV5C 1HTAA 4XUJC 3O62A 3AZKB 3KXBA 2NZDC 5AY8B 5CPIB 3RELC 1B6WA 1HQ3B 3AZMA 5B32C 3TU4B 4H9QB 4KUDD 4Z66D 4YM6B 3LZ0A 5AVCB 1P34A 5AVBA 5B24C 4H9OA 3B6GA 1TZYB 4ZUXD 5B0ZD 4KUDC 4Z66C 1P3KC 3A6NB 4H9SC 5G49A 3NQJB 5BO0A 4EO5B 4WU8A 5B1LD 5DNNA 3KWQD 1EQZD 1ZLAB 3AN2B 1KX5C 3WTPD 4J8VB 4ZUXC 3AZHB 1F66B 4KGCA 1WWIA 3AZGA 3C1CD 5B0ZC 5B0YA 4Z2MH 3O62D 1U35B 3KXBD 2PYOB 3W97B 4J8XB 3KUYB 3C1CC 3WTPE 3MGPA 3X1TB 5JA4B 5C3IC 4JJNB 3UT9A 3WKJA 3MGSA 3AZMD 3O62C 3W98B 1P3PA 5JRGB 3VH5A 5AV8B 5BNXB 2FJ7B 3WA9C 4CAYA 4QLCB 5CPKA 3REJC 3LZ0D 2CV5C 1P34D 5AVBD 3X1SA 3AZMC 3B6GD 5FUGA 5AVCC 4ZBJC 5B31A 1TZYC 4Z5TB 1KX3A 5B2IA 2YFVB 4WU8D 4UUZB 5DNND 3LZ0C 1P34C 5AVBC 3LZ1B 1F1EA 3MGRB 5GT3A 4KHAB 4EO5C 3MVDB 4KGCD 3AV2B 5B40A 3LELB 3AZGD 3AN2C 5B0YD 2HUEC 5B33A 4WNNA 4J8VC 5AV5A 3NQUA 3C1BC 2BYKA 3AZHC 1F66C 5DNNC 5GXQB 4LD9C 1N1JB 1M19B 2BYMB 1U35C 4KGCC 3RELA 4WV4B 3MGPD 1AOIB 3UT9D 1R4VA 3MGSD 3AYWB 3WKJD 2LY8A 5F99B 3KUYC 1P3PD 1JFIB 5B32A 5B1MB 3UTBB 4WU9B 1P3GB 3B6FC 3X1VC 3MGPC 3AV1C 5CPKD 3X1SD 3WKJC 2FJ7C 4AWLC 1P3LC 4R8PA 5B24A 3AZEB 2HIOC 5B31D 5DNMC 1P3KA 3AZJA 5B2ID 1KX3D 3WAAC 3X1SC 4X23C 1M18A 5AV6B 3VH5W 5GT3D 1KX5A 5B40D 4Z2MG 2AROB 3W99B 5B33D 2L5AA 3W96B 5AV5D 4G92C 1P3FC 1ID3B 4H9RB 3REHB 3RELD 3AZKA 1BH8B 1P3BB 1P3OC 5AY8A 5CPIA 3REKB 5B32D 1H3OB 1P3AB 1KX4B 1HQ3A 3AYWC 3AZNC 5F99C 5E5AC 3R45B 5CP6B 5B1MC 3WA9A 4H9QA 3UTBC 3B0CT 4WU9C 3REJA 2CV5A 5B24D 5AVCA 1P3KD 2NQBC 2CWEA 3AZJD 1TZYA 5B1LB 1EQZB 4NE6A 1M18D 2IO5B 4R8PC 4J8WB 3A6NA 1KX5D 3NQJA 1P3MB 5AV9B 4DRBA 1ZLAA 5AV6C 3AN2A 3AZJC 4J8VA 3AZHA 1F66A 3C1BA 4LD9A 1M18C 4H9NB 5CHLB 1S32B 4WZSB 3AZKD 1U35A 3AZLB 3AFAB 1M1AB 5BS7C 3X1UB 1ID3C 4G91C 5AY8D 3REHC 5CPID 3B0DB 2PYOA 4J8XA 3KUYA 3X1TA 1HQ3D 3LJAB 5JA4A 1P3BC 4NE3A 3AZKC 3MNNB 1P3AC 3W98A 3WA9D 5JRGA 3B6FA 3X1VA 3AV1A 2CV5D 3REJD 5AV8A 5AY8C 5CPIC 5CP6C 2FJ7A 3B6GB 1P3LA 3AZIB 4QLCA 5GT0B 1HQ3C 2HIOA 5AVCD 5DNMA 1TZYD 5BO0B 3TU4C 3WAAA 4X23A 4XZQB 4Z5TA 4YM6C 3AZGB 2YFVA 4UUZA 1ZLAD 3AN2D 5B2JB 3LZ1A 4CSRB 3MGRA 4J8VD 3MVDA 3AZHD 3C1BD 1F66D 3LELA 4LD9D 3A6NC 1P3FA 5CPJB 1U35D 1ZLAC 5GXQA 1N1JA 3UT9B 4H9PB 1M19A 2PYOD 3AZFB 1S32C 2BYMA 1P3IB 4J8XD 1P3PB 3KUYD 3AFAC 1P3OA 1M1AC 3X1TD 3AYWA 3B0DC 3AZNA 3MGQB 5F99A 5E5AA 5GSUB 3W98D 5JRGD 2F8NB 3LJAC 3X1VD 1JFIA 3REIB 3AV1D 5B1MA 3B6FD 5AV8D 3UTBA 2PYOC 4WU9A 1P3GA 2FJ7D 3MNNC 4J8XC 1P3LD 3W97C 3UTAB 4QLCD 3X1TC 2HIOD 5B31B 4JJNC 5DNMD 5BNVB 5B2IB 3AZIC 1KX3B 3W98C 2NQBA 5JRGC 4J8UB 5AV8C 3WAAD 4X23D 4Z5TD 5KDMA 4QLCC 4HGAB 5B33B 3LZ1D 5AV6A 5AV5B 4XUJB 3MVDD 5BT1D 3LELD 2AROA 1TAFB 2NZDB 3W99A 1P3FD 4Z5TC 3W96A 1BFMA 4YS3B 5GXQD 5BS7A 3LZ1C 3MGRC 1M19D 5CPJC 3MVDC 1ID3A 4H9RA 5BT1C 3LELC 3REHA 5B32B 3AV2C 1P3OD 3AYWD 3AZFC 1BH8A 1P3BA 3AZND 5F99D 5E5AD 3REKA 5GXQC 1P3AA 1BH9B 1H3OA 5B1MD 1KX4A 3UTBD 1M19C 4WU9D 1P3GD 5B24B 5GSUC 3R45A 5CP6A 1AOIC 3B0CW 4KUDB 4Z66B 1P3KB 3V9RB 3UTAC 2NQBD 3TU4A 4NE5A 1P3GC 1KX5B 4R8PD 4ZUXB 1ULYA 4YM6A 5B0ZB 5AV6D 4J8WA 3AZEC 2YFWB 4NFTA 1P3MA 2AROD 3KWQB 5AV9A 3W99D 2F8NH 3W96D 3WTPB 3C1CB 4H9NA 3VH6T 5C3IB 4YS3C 3O62B 3REHD 1ID3D 1S32A 2AROC 3KXBB 3W99C 3AFAA 3AZLA 1M1AA 1B67A 3X1UA 3W96C 1P3BD 3REKD 3WA9B 1P3AD 1KX4D 2CV5B 3REJB 3LJAA 3AZMB 4E44A 5CP6D 3W97A 3MNNA 2RVQD 4ZBJB 4JJNA 3REKC 3AZIA 3TU4D 1KX4C 3LZ0B 5GT0A 1P34B 5AVBB 4H9OB 5BNXA 2RVQC 4YM6D 1WWSA 4J8WD 2HUEB 3KSYA 5G49B 4XZQA 1P3MD 3C1BB 4LD9B 4WU8B 5DNNB 5AV9D 5B2JA 3A6ND 3B0BA 4CSRA 5B1LC 1EQZC 3KWQC 4KGCB 2IO5C 5B0YB 4J8WC 1Q9CA 3WTPC 1P3MC 4KHAA 5CPJA 1S32D 5AV9C 3AZLD 3AFAD 3AV2A 1M1AD 3X1UD 4H9PA 3AZFA 1P3IA 3KXBC 3B6FB 3X1VB 3MGPB 3AV1B 3LJAD 3WKJB 3MGSB 4AWLB 1P3LB 3MGQA 3MNND 5GSUA 3W97D 3AZLC 2HIOB 2F8NA 3REIA 3X1UC 1AOIA 5DNMB 4JJND 3AZID 4CAYB 3UTAA 5CPKB 5GT0D 3WAAB 3X1SB 4X23B 2F8NK 5BNVA 3VH6A 5FUGB 4J8UA 3B6GC 2F8NG 4XZQD 3AZEA 5GT0C 4G92B 1P3FB 5B2JD 5GT3B 4XUJA 5B31G 4WU8C 5B40B 1TAFA 2NZDA 4WNNB 4XZQC 3MGRD 3NQUB 2BYKB 5CPJD 3AZGC 1P3OB 4YS3A 3AV2D 5B0YC 5B2JC 3AZNB 5E5AB 3AZFD 1P3ID 3RELB 4M6BA 3MGQD
chains in the Genus database with same CATH superfamily
5GSUD 1KU5A 2F8ND 3UT9C 3REID 1BH9A 1AOID 3MGSC 1P3IC 1P3PC 2NQBB 3UTAD 4E45A 4KUDA 5B32G 4Z66A 3V9RA 4R8PB 3MGQC 1A7WA 5KDMB 2JSSA 2Y2QA 4H9SA 5CPKC 4DRAA 3REIC 4J8UD 3AZJB 3AZED 4ZUXA 5B31C 1M18B 5B0ZA 3EPJA 3VH5T 5B2IC 1KX3C 4XUJD 2YFWA 5B1LA 4J8UC 3KWQA 1EQZA 2NZDD 5GT3C 2Y2PA 4G91B 5B40C 3WTPA 4YS3D 4HGAC 3C1CA 5B33C 3VH6W 5AV5C 1HTAA 4XUJC 3O62A 3AZKB 3KXBA 2NZDC 5AY8B 5CPIB 3RELC 1B6WA 1HQ3B 2ZY3A 3AZMA 5B32C 3TU4B 4H9QB 4KUDD 4Z66D 4YM6B 3LZ0A 5AVCB 1P34A 5AVBA 5B24C 4H9OA 3B6GA 1TZYB 4ZUXD 5B0ZD 4KUDC 4Z66C 1P3KC 3A6NB 4H9SC 5G49A 3NQJB 5BO0A 4EO5B 5B1LD 4WU8A 5DNNA 3KWQD 1EQZD 1ZLAB 3AN2B 1KX5C 3WTPD 4J8VB 4ZUXC 3AZHB 2Y2NA 1F66B 1WWIA 3AZGA 3C1CD 5B0ZC 4KGCA 5B0YA 4Z2MH 3O62D 1U35B 2VQRA 3KXBD 2PYOB 3W97B 4J8XB 3KUYB 3C1CC 3WTPE 3MGPA 3X1TB 5JA4B 5C3IC 4JJNB 3UT9A 3WKJA 3MGSA 3AZMD 3O62C 2ZM5A 3W98B 1P3PA 5JRGB 3VH5A 2Y2MA 5AV8B 5BNXB 2FJ7B 2RIQA 3WA9C 4CAYA 4QLCB 5CPKA 3REJC 3LZ0D 2CV5C 1P34D 5AVBD 3X1SA 3AZMC 4UPKA 3B6GD 5FUGA 5AVCC 1PZRA 4ZBJC 5B31A 1TZYC 4Z5TB 1KX3A 5B2IA 2YFVB 4WU8D 4UUZB 5DNND 3LZ0C 2UWXA 1P34C 5AVBC 3LZ1B 1F1EA 3MGRB 5GT3A 4KHAB 4EO5C 3MVDB 4KGCD 3AV2B 5B40A 3LELB 3AZGD 3AN2C 5B0YD 2HUEC 5B33A 4WNNA 2DQNC 4J8VC 5AV5A 3F6TA 3NQUA 2BYKA 3C1BC 3AZHC 5DNNC 5GXQB 1F66C 4LD9C 1N1JB 1M19B 2BYMB 1U35C 4KGCC 2Y2IA 3RELA 4WV4B 3MGPD 1AOIB 3UT9D 1R4VA 3MGSD 3AYWB 3WKJD 2LY8A 5F99B 3KUYC 1P3PD 1JFIB 2Y2HA 1W2EA 5B1MB 5B32A 3UTBB 4WU9B 1P3GB 3B6FC 3X1VC 3MGPC 3AV1C 5CPKD 2XD1A 3X1SD 3WKJC 2FJ7C 4AWLC 1P3LC 4R8PA 5B24A 3AZEB 2HIOC 5B31D 5DNMC 1P3KA 3AZJA 5B2ID 1KX3D 3WAAC 3X1SC 4X23C 1M18A 5AV6B 3VH5W 5GT3D 1KX5A 5B40D 4Z2MG 2AROB 3FDDA 3W99B 2ZY5A 5B33D 2L5AA 3W96B 5AV5D 4G92C 1P3FC 1ID3B 4H9RB 3REHB 3RELD 3AZKA 1BH8B 1P3BB 1P3OC 5AY8A 5CPIA 3REKB 5B32D 1H3OB 1P3AB 1KX4B 1HQ3A 3AYWC 3AZNC 3AL0C 5F99C 5E5AC 3R45B 5CP6B 3EPKA 5B1MC 3WA9A 4H9QA 3UTBC 3B0CT 4WU9C 3REJA 2CV5A 5B24D 5AVCA 1P3KD 3IP4C 2NQBC 2CWEA 3AZJD 1TZYA 2Y2JA 5B1LB 1EQZB 4NE6A 1T3UA 1M18D 2IO5B 4R8PC 4J8WB 3A6NA 1KX5D 3NQJA 1P3MB 3H0LC 5AV9B 4DRBA 1ZLAA 5AV6C 3AN2A 3AZJC 2FFFB 4J8VA 3AZHA 1F66A 3C1BA 4LD9A 1M18C 4H9NB 5CHLB 2ZY2A 1S32B 4WZSB 3AZKD 1U35A 2F2AC 3AZLB 3AFAB 1M1AB 5BS7C 3X1UB 1ID3C 4G91C 5AY8D 3REHC 5CPID 3B0DB 2PYOA 4J8XA 3KUYA 3X1TA 1HQ3D 3LJAB 5JA4A 1P3BC 4NE3A 3AZKC 3MNNB 1P3AC 3W98A 3WA9D 5JRGA 3B6FA 3X1VA 3AV1A 2CV5D 3REJD 5AV8A 5AY8C 5CPIC 5CP6C 2FJ7A 3B6GB 1P3LA 3AZIB 4QLCA 5GT0B 1HQ3C 2HIOA 5AVCD 5DNMA 1TZYD 5BO0B 3TU4C 3WAAA 3H0RC 2G5IC 4X23A 4XZQB 4Z5TA 4YM6C 3AZGB 2YFVA 4UUZA 1ZLAD 3AN2D 5B2JB 3LZ1A 4CSRB 3MGRA 4J8VD 3MVDA 3AZHD 3C1BD 1F66D 3LELA 4LD9D 3A6NC 1P3FA 5CPJB 1U35D 1ZLAC 5GXQA 1N1JA 3UT9B 4H9PB 1M19A 2PYOD 3AZFB 1S32C 2BYMA 1P3IB 4J8XD 1P3PB 3KUYD 3AFAC 1P3OA 1M1AC 3X1TD 3AYWA 3B0DC 3AZNA 3MGQB 5F99A 5E5AA 5GSUB 3W98D 5JRGD 2F8NB 3LJAC 3X1VD 1JFIA 3REIB 3AV1D 5B1MA 3B6FD 5AV8D 3UTBA 2PYOC 4WU9A 1P3GA 2FJ7D 3MNNC 4J8XC 1P3LD 3W97C 3P5JB 3UTAB 4QLCD 3X1TC 2HIOD 5B31B 4JJNC 5DNMD 5BNVB 5B2IB 3AZIC 1KX3B 3W98C 2NQBA 5JRGC 4J8UB 5AV8C 3WAAD 4X23D 2BG1A 4Z5TD 2G5HC 5KDMA 4QLCC 4HGAB 5B33B 3LZ1D 5AV6A 5AV5B 4XUJB 2JCHA 3MVDD 5BT1D 3LELD 2AROA 1TAFB 2NZDB 3W99A 1P3FD 3KFUG 4Z5TC 3W96A 1BFMA 4YS3B 5GXQD 5BS7A 3LZ1C 3MGRC 1M19D 2Y2GA 5CPJC 3MVDC 1ID3A 4H9RA 5BT1C 3LELC 3REHA 5B32B 3AV2C 1P3OD 3AYWD 3A1IA 3AZFC 1BH8A 1P3BA 3AZND 5F99D 5E5AD 3REKA 5GXQC 3H0MC 2JE5A 1BH9B 1H3OA 2J8PA 5B1MD 1P3AA 1KX4A 3UTBD 1M19C 4WU9D 1P3GD 5B24B 5GSUC 3R45A 5CP6A 1AOIC 3B0CW 4KUDB 4Z66B 1P3KB 3V9RB 3UTAC 2NQBD 2Y2KA 3TU4A 4NE5A 1P3GC 4WJ3C 1KX5B 1Z2CB 4R8PD 4ZUXB 1ULYA 4YM6A 5B0ZB 5AV6D 4J8WA 3AZEC 2DF4C 2YFWB 4NFTA 1P3MA 2AROD 3KWQB 5AV9A 3W99D 2F8NH 3EPLA 3W96D 3WTPB 3C1CB 4H9NA 3VH6T 5C3IB 4YS3C 3O62B 3REHD 1ID3D 1S32A 2AROC 3KXBB 3W99C 3AFAA 3AZLA 1M1AA 2ZY4A 1B67A 3X1UA 3W96C 1P3BD 3REKD 3WA9B 1P3AD 1KX4D 2CV5B 3REJB 3LJAA 3AZMB 4E44A 5CP6D 3EPHA 3W97A 3MNNA 2RVQD 4ZBJB 4JJNA 3A1KA 3REKC 3AZIA 3TU4D 1KX4C 3LZ0B 5GT0A 1P34B 5AVBB 4H9OB 5BNXA 2RVQC 4YM6D 1WWSA 4J8WD 2HUEB 3KSYA 5G49B 4XZQA 1P3MD 3C1BB 4LD9B 4WU8B 5DNNB 5AV9D 5B2JA 3A6ND 3B0BA 4CSRA 5B1LC 1EQZC 3KWQC 4KGCB 2IO5C 5B0YB 4J8WC 3EG5B 1Q9CA 3WTPC 1P3MC 4KHAA 5CPJA 1S32D 5AV9C 3AZLD 3AFAD 3AV2A 2Y2OA 1M1AD 2XD5A 3X1UD 4H9PA 3AZFA 1P3IA 3KXBC 3B6FB 3X1VB 3MGPB 3AV1B 3LJAD 3WKJB 3MGSB 4AWLB 1P3LB 3MGQA 3MNND 5GSUA 3W97D 3AZLC 2HIOB 2F8NA 3REIA 3X1UC 1AOIA 5DNMB 4JJND 3AZID 4CAYB 3UTAA 5CPKB 5GT0D 3WAAB 3X1SB 4X23B 2F8NK 5BNVA 3VH6A 5FUGB 2W8SA 4J8UA 3B6GC 2F8NG 4XZQD 2Y2LA 3AZEA 5GT0C 4G92B 1P3FB 5B2JD 5GT3B 4XUJA 5B31G 4WU8C 5B40B 1TAFA 2NZDA 4WNNB 4XZQC 3MGRD 3NQUB 2BYKB 5CPJD 3AZGC 1P3OB 4YS3A 3AV2D 5B0YC 5B2JC 3AZNB 5E5AB 3AZFD 1P3ID 3RELB 4DQYB 4M6BA 3MGQD
chains in the Genus database with same CATH topology
5GSUD 1KU5A 2F8ND 3UT9C 3REID 1BH9A 1AOID 3MGSC 1P3IC 1P3PC 2NQBB 3UTAD 4E45A 4KUDA 5B32G 4Z66A 3V9RA 4R8PB 3MGQC 1A7WA 5KDMB 2JSSA 2Y2QA 4H9SA 5CPKC 4DRAA 3REIC 4J8UD 3AZJB 3AZED 4ZUXA 5B31C 1M18B 5B0ZA 3EPJA 3VH5T 5B2IC 1KX3C 4XUJD 2YFWA 5B1LA 4J8UC 3KWQA 1EQZA 2NZDD 5GT3C 2Y2PA 4G91B 5B40C 3WTPA 4YS3D 4HGAC 3C1CA 5B33C 3VH6W 5AV5C 1HTAA 4XUJC 3O62A 3AZKB 3KXBA 2NZDC 5AY8B 5CPIB 3RELC 1B6WA 1HQ3B 2ZY3A 3AZMA 5B32C 3TU4B 4H9QB 4KUDD 4Z66D 4YM6B 3LZ0A 5AVCB 1P34A 5AVBA 5B24C 4H9OA 3B6GA 1TZYB 4ZUXD 5B0ZD 4KUDC 4Z66C 1P3KC 3A6NB 4H9SC 5G49A 3NQJB 5BO0A 4EO5B 5B1LD 4WU8A 5DNNA 3KWQD 1EQZD 1ZLAB 3AN2B 1KX5C 3WTPD 4J8VB 4ZUXC 3AZHB 2Y2NA 1F66B 1WWIA 3AZGA 3C1CD 5B0ZC 4KGCA 5B0YA 4Z2MH 3O62D 1U35B 2VQRA 3KXBD 2PYOB 3W97B 4J8XB 3KUYB 3C1CC 3WTPE 3MGPA 3X1TB 5JA4B 5C3IC 4JJNB 3UT9A 3WKJA 3MGSA 3AZMD 3O62C 2ZM5A 3W98B 1P3PA 5JRGB 3VH5A 2Y2MA 5AV8B 5BNXB 2FJ7B 2RIQA 3WA9C 4CAYA 4QLCB 5CPKA 3REJC 3LZ0D 2CV5C 1P34D 5AVBD 3X1SA 3AZMC 4UPKA 3B6GD 5FUGA 5AVCC 1PZRA 4ZBJC 5B31A 1TZYC 4Z5TB 1KX3A 5B2IA 2YFVB 4WU8D 4UUZB 5DNND 3LZ0C 2UWXA 1P34C 5AVBC 3LZ1B 1F1EA 3MGRB 5GT3A 4KHAB 4EO5C 3MVDB 4KGCD 3AV2B 5B40A 3LELB 3AZGD 3AN2C 5B0YD 2HUEC 5B33A 4WNNA 2DQNC 4J8VC 5AV5A 3F6TA 3NQUA 2BYKA 3C1BC 3AZHC 5DNNC 5GXQB 1F66C 4LD9C 1N1JB 1M19B 2BYMB 1U35C 4KGCC 2Y2IA 3RELA 4WV4B 3MGPD 1AOIB 3UT9D 1R4VA 3MGSD 3AYWB 3WKJD 2LY8A 5F99B 3KUYC 1P3PD 1JFIB 2Y2HA 1W2EA 5B1MB 5B32A 3UTBB 4WU9B 1P3GB 3B6FC 3X1VC 3MGPC 3AV1C 5CPKD 2XD1A 3X1SD 3WKJC 2FJ7C 4AWLC 1P3LC 4R8PA 5B24A 3AZEB 2HIOC 5B31D 5DNMC 1P3KA 3AZJA 5B2ID 1KX3D 3WAAC 3X1SC 4X23C 1M18A 5AV6B 3VH5W 5GT3D 1KX5A 5B40D 4Z2MG 2AROB 3FDDA 3W99B 2ZY5A 5B33D 2L5AA 3W96B 5AV5D 4G92C 1P3FC 1ID3B 4H9RB 3REHB 3RELD 3AZKA 1BH8B 1P3BB 1P3OC 5AY8A 5CPIA 3REKB 5B32D 1H3OB 1P3AB 1KX4B 1HQ3A 3AYWC 3AZNC 3AL0C 5F99C 5E5AC 3R45B 5CP6B 3EPKA 5B1MC 3WA9A 4H9QA 3UTBC 3B0CT 4WU9C 3REJA 2CV5A 5B24D 5AVCA 1P3KD 3IP4C 2NQBC 2CWEA 3AZJD 1TZYA 2Y2JA 5B1LB 1EQZB 4NE6A 1T3UA 1M18D 2IO5B 4R8PC 4J8WB 3A6NA 1KX5D 3NQJA 1P3MB 3H0LC 5AV9B 4DRBA 1ZLAA 5AV6C 3AN2A 3AZJC 2FFFB 4J8VA 3AZHA 1F66A 3C1BA 4LD9A 1M18C 4H9NB 5CHLB 2ZY2A 1S32B 4WZSB 3AZKD 1U35A 2F2AC 3AZLB 3AFAB 1M1AB 5BS7C 3X1UB 1ID3C 4G91C 5AY8D 3REHC 5CPID 3B0DB 2PYOA 4J8XA 3KUYA 3X1TA 1HQ3D 3LJAB 5JA4A 1P3BC 4NE3A 3AZKC 3MNNB 1P3AC 3W98A 3WA9D 5JRGA 3B6FA 3X1VA 3AV1A 2CV5D 3REJD 5AV8A 5AY8C 5CPIC 5CP6C 2FJ7A 3B6GB 1P3LA 3AZIB 4QLCA 5GT0B 1HQ3C 2HIOA 5AVCD 5DNMA 1TZYD 5BO0B 3TU4C 3WAAA 3H0RC 2G5IC 4X23A 4XZQB 4Z5TA 4YM6C 3AZGB 2YFVA 4UUZA 1ZLAD 3AN2D 5B2JB 3LZ1A 4CSRB 3MGRA 4J8VD 3MVDA 3AZHD 3C1BD 1F66D 3LELA 4LD9D 3A6NC 1P3FA 5CPJB 1U35D 1ZLAC 5GXQA 1N1JA 3UT9B 4H9PB 1M19A 2PYOD 3AZFB 1S32C 2BYMA 1P3IB 4J8XD 1P3PB 3KUYD 3AFAC 1P3OA 1M1AC 3X1TD 3AYWA 3B0DC 3AZNA 3MGQB 5F99A 5E5AA 5GSUB 3W98D 5JRGD 2F8NB 3LJAC 3X1VD 1JFIA 3REIB 3AV1D 5B1MA 3B6FD 5AV8D 3UTBA 2PYOC 4WU9A 1P3GA 2FJ7D 3MNNC 4J8XC 1P3LD 3W97C 3P5JB 3UTAB 4QLCD 3X1TC 2HIOD 5B31B 4JJNC 5DNMD 5BNVB 5B2IB 3AZIC 1KX3B 3W98C 2NQBA 5JRGC 4J8UB 5AV8C 3WAAD 4X23D 2BG1A 4Z5TD 2G5HC 5KDMA 4QLCC 4HGAB 5B33B 3LZ1D 5AV6A 5AV5B 4XUJB 2JCHA 3MVDD 5BT1D 3LELD 2AROA 1TAFB 2NZDB 3W99A 1P3FD 3KFUG 4Z5TC 3W96A 1BFMA 4YS3B 5GXQD 5BS7A 3LZ1C 3MGRC 1M19D 2Y2GA 5CPJC 3MVDC 1ID3A 4H9RA 5BT1C 3LELC 3REHA 5B32B 3AV2C 1P3OD 3AYWD 3A1IA 3AZFC 1BH8A 1P3BA 3AZND 5F99D 5E5AD 3REKA 5GXQC 3H0MC 2JE5A 1BH9B 1H3OA 2J8PA 5B1MD 1P3AA 1KX4A 3UTBD 1M19C 4WU9D 1P3GD 5B24B 5GSUC 3R45A 5CP6A 1AOIC 3B0CW 4KUDB 4Z66B 1P3KB 3V9RB 3UTAC 2NQBD 2Y2KA 3TU4A 4NE5A 1P3GC 4WJ3C 1KX5B 1Z2CB 4R8PD 4ZUXB 1ULYA 4YM6A 5B0ZB 5AV6D 4J8WA 3AZEC 2DF4C 2YFWB 4NFTA 1P3MA 2AROD 3KWQB 5AV9A 3W99D 2F8NH 3EPLA 3W96D 3WTPB 3C1CB 4H9NA 3VH6T 5C3IB 4YS3C 3O62B 3REHD 1ID3D 1S32A 2AROC 3KXBB 3W99C 3AFAA 3AZLA 1M1AA 2ZY4A 1B67A 3X1UA 3W96C 1P3BD 3REKD 3WA9B 1P3AD 1KX4D 2CV5B 3REJB 3LJAA 3AZMB 4E44A 5CP6D 3EPHA 3W97A 3MNNA 2RVQD 4ZBJB 4JJNA 3A1KA 3REKC 3AZIA 3TU4D 1KX4C 3LZ0B 5GT0A 1P34B 5AVBB 4H9OB 5BNXA 2RVQC 4YM6D 1WWSA 4J8WD 2HUEB 3KSYA 5G49B 4XZQA 1P3MD 3C1BB 4LD9B 4WU8B 5DNNB 5AV9D 5B2JA 3A6ND 3B0BA 4CSRA 5B1LC 1EQZC 3KWQC 4KGCB 2IO5C 5B0YB 4J8WC 3EG5B 1Q9CA 3WTPC 1P3MC 4KHAA 5CPJA 1S32D 5AV9C 3AZLD 3AFAD 3AV2A 2Y2OA 1M1AD 2XD5A 3X1UD 4H9PA 3AZFA 1P3IA 3KXBC 3B6FB 3X1VB 3MGPB 3AV1B 3LJAD 3WKJB 3MGSB 4AWLB 1P3LB 3MGQA 3MNND 5GSUA 3W97D 3AZLC 2HIOB 2F8NA 3REIA 3X1UC 1AOIA 5DNMB 4JJND 3AZID 4CAYB 3UTAA 5CPKB 5GT0D 3WAAB 3X1SB 4X23B 2F8NK 5BNVA 3VH6A 5FUGB 2W8SA 4J8UA 3B6GC 2F8NG 4XZQD 2Y2LA 3AZEA 5GT0C 4G92B 1P3FB 5B2JD 5GT3B 4XUJA 5B31G 4WU8C 5B40B 1TAFA 2NZDA 4WNNB 4XZQC 3MGRD 3NQUB 2BYKB 5CPJD 3AZGC 1P3OB 4YS3A 3AV2D 5B0YC 5B2JC 3AZNB 5E5AB 3AZFD 1P3ID 3RELB 4DQYB 4M6BA 3MGQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GSU D;  1KU5 A;  2F8N D;  3UT9 C;  3REI D;  1BH9 A;  1AOI D;  3MGS C;  1P3I C;  1P3P C;  2NQB B;  3UTA D;  4E45 A;  4KUD A;  5B32 G;  4Z66 A;  3V9R A;  4R8P B;  3MGQ C;  1A7W A;  5KDM B;  2JSS A;  4H9S A;  5CPK C;  4DRA A;  3REI C;  4J8U D;  3AZJ B;  3AZE D;  4ZUX A;  5B31 C;  1M18 B;  5B0Z A;  3VH5 T;  5B2I C;  1KX3 C;  4XUJ D;  2YFW A;  5B1L A;  4J8U C;  3KWQ A;  1EQZ A;  2NZD D;  5GT3 C;  4G91 B;  5B40 C;  3WTP A;  4YS3 D;  4HGA C;  3C1C A;  5B33 C;  3VH6 W;  5AV5 C;  1HTA A;  4XUJ C;  3O62 A;  3AZK B;  3KXB A;  2NZD C;  5AY8 B;  5CPI B;  3REL C;  1B6W A;  1HQ3 B;  3AZM A;  5B32 C;  3TU4 B;  4H9Q B;  4KUD D;  4Z66 D;  4YM6 B;  3LZ0 A;  5AVC B;  1P34 A;  5AVB A;  5B24 C;  4H9O A;  3B6G A;  1TZY B;  4ZUX D;  5B0Z D;  4KUD C;  4Z66 C;  1P3K C;  3A6N B;  4H9S C;  5G49 A;  3NQJ B;  5BO0 A;  4EO5 B;  4WU8 A;  5B1L D;  5DNN A;  3KWQ D;  1EQZ D;  1ZLA B;  3AN2 B;  1KX5 C;  3WTP D;  4J8V B;  4ZUX C;  3AZH B;  1F66 B;  4KGC A;  1WWI A;  3AZG A;  3C1C D;  5B0Z C;  5B0Y A;  4Z2M H;  3O62 D;  1U35 B;  3KXB D;  2PYO B;  3W97 B;  4J8X B;  3KUY B;  3C1C C;  3WTP E;  3MGP A;  3X1T B;  5JA4 B;  5C3I C;  4JJN B;  3UT9 A;  3WKJ A;  3MGS A;  3AZM D;  3O62 C;  3W98 B;  1P3P A;  5JRG B;  3VH5 A;  5AV8 B;  5BNX B;  2FJ7 B;  3WA9 C;  4CAY A;  4QLC B;  5CPK A;  3REJ C;  3LZ0 D;  2CV5 C;  1P34 D;  5AVB D;  3X1S A;  3AZM C;  3B6G D;  5FUG A;  5AVC C;  4ZBJ C;  5B31 A;  1TZY C;  4Z5T B;  1KX3 A;  5B2I A;  2YFV B;  4WU8 D;  4UUZ B;  5DNN D;  3LZ0 C;  1P34 C;  5AVB C;  3LZ1 B;  1F1E A;  3MGR B;  5GT3 A;  4KHA B;  4EO5 C;  3MVD B;  4KGC D;  3AV2 B;  5B40 A;  3LEL B;  3AZG D;  3AN2 C;  5B0Y D;  2HUE C;  5B33 A;  4WNN A;  4J8V C;  5AV5 A;  3NQU A;  3C1B C;  2BYK A;  3AZH C;  1F66 C;  5DNN C;  5GXQ B;  4LD9 C;  1N1J B;  1M19 B;  2BYM B;  1U35 C;  4KGC C;  3REL A;  4WV4 B;  3MGP D;  1AOI B;  3UT9 D;  1R4V A;  3MGS D;  3AYW B;  3WKJ D;  2LY8 A;  5F99 B;  3KUY C;  1P3P D;  1JFI B;  5B32 A;  5B1M B;  3UTB B;  4WU9 B;  1P3G B;  3B6F C;  3X1V C;  3MGP C;  3AV1 C;  5CPK D;  3X1S D;  3WKJ C;  2FJ7 C;  4AWL C;  1P3L C;  4R8P A;  5B24 A;  3AZE B;  2HIO C;  5B31 D;  5DNM C;  1P3K A;  3AZJ A;  5B2I D;  1KX3 D;  3WAA C;  3X1S C;  4X23 C;  1M18 A;  5AV6 B;  3VH5 W;  5GT3 D;  1KX5 A;  5B40 D;  4Z2M G;  2ARO B;  3W99 B;  5B33 D;  2L5A A;  3W96 B;  5AV5 D;  4G92 C;  1P3F C;  1ID3 B;  4H9R B;  3REH B;  3REL D;  3AZK A;  1BH8 B;  1P3B B;  1P3O C;  5AY8 A;  5CPI A;  3REK B;  5B32 D;  1H3O B;  1P3A B;  1KX4 B;  1HQ3 A;  3AYW C;  3AZN C;  5F99 C;  5E5A C;  3R45 B;  5CP6 B;  5B1M C;  3WA9 A;  4H9Q A;  3UTB C;  3B0C T;  4WU9 C;  3REJ A;  2CV5 A;  5B24 D;  5AVC A;  1P3K D;  2NQB C;  2CWE A;  3AZJ D;  1TZY A;  5B1L B;  1EQZ B;  4NE6 A;  1M18 D;  2IO5 B;  4R8P C;  4J8W B;  3A6N A;  1KX5 D;  3NQJ A;  1P3M B;  5AV9 B;  4DRB A;  1ZLA A;  5AV6 C;  3AN2 A;  3AZJ C;  4J8V A;  3AZH A;  1F66 A;  3C1B A;  4LD9 A;  1M18 C;  4H9N B;  5CHL B;  1S32 B;  4WZS B;  3AZK D;  1U35 A;  3AZL B;  3AFA B;  1M1A B;  5BS7 C;  3X1U B;  1ID3 C;  4G91 C;  5AY8 D;  3REH C;  5CPI D;  3B0D B;  2PYO A;  4J8X A;  3KUY A;  3X1T A;  1HQ3 D;  3LJA B;  5JA4 A;  1P3B C;  4NE3 A;  3AZK C;  3MNN B;  1P3A C;  3W98 A;  3WA9 D;  5JRG A;  3B6F A;  3X1V A;  3AV1 A;  2CV5 D;  3REJ D;  5AV8 A;  5AY8 C;  5CPI C;  5CP6 C;  2FJ7 A;  3B6G B;  1P3L A;  3AZI B;  4QLC A;  5GT0 B;  1HQ3 C;  2HIO A;  5AVC D;  5DNM A;  1TZY D;  5BO0 B;  3TU4 C;  3WAA A;  4X23 A;  4XZQ B;  4Z5T A;  4YM6 C;  3AZG B;  2YFV A;  4UUZ A;  1ZLA D;  3AN2 D;  5B2J B;  3LZ1 A;  4CSR B;  3MGR A;  4J8V D;  3MVD A;  3AZH D;  3C1B D;  1F66 D;  3LEL A;  4LD9 D;  3A6N C;  1P3F A;  5CPJ B;  1U35 D;  1ZLA C;  5GXQ A;  1N1J A;  3UT9 B;  4H9P B;  1M19 A;  2PYO D;  3AZF B;  1S32 C;  2BYM A;  1P3I B;  4J8X D;  1P3P B;  3KUY D;  3AFA C;  1P3O A;  1M1A C;  3X1T D;  3AYW A;  3B0D C;  3AZN A;  3MGQ B;  5F99 A;  5E5A A;  5GSU B;  3W98 D;  5JRG D;  2F8N B;  3LJA C;  3X1V D;  1JFI A;  3REI B;  3AV1 D;  5B1M A;  3B6F D;  5AV8 D;  3UTB A;  2PYO C;  4WU9 A;  1P3G A;  2FJ7 D;  3MNN C;  4J8X C;  1P3L D;  3W97 C;  3UTA B;  4QLC D;  3X1T C;  2HIO D;  5B31 B;  4JJN C;  5DNM D;  5BNV B;  5B2I B;  3AZI C;  1KX3 B;  3W98 C;  2NQB A;  5JRG C;  4J8U B;  5AV8 C;  3WAA D;  4X23 D;  4Z5T D;  5KDM A;  4QLC C;  4HGA B;  5B33 B;  3LZ1 D;  5AV6 A;  5AV5 B;  4XUJ B;  3MVD D;  5BT1 D;  3LEL D;  2ARO A;  1TAF B;  2NZD B;  3W99 A;  1P3F D;  4Z5T C;  3W96 A;  1BFM A;  4YS3 B;  5GXQ D;  5BS7 A;  3LZ1 C;  3MGR C;  1M19 D;  5CPJ C;  3MVD C;  1ID3 A;  4H9R A;  5BT1 C;  3LEL C;  3REH A;  5B32 B;  3AV2 C;  1P3O D;  3AYW D;  3AZF C;  1BH8 A;  1P3B A;  3AZN D;  5F99 D;  5E5A D;  3REK A;  5GXQ C;  1P3A A;  1BH9 B;  1H3O A;  5B1M D;  1KX4 A;  3UTB D;  1M19 C;  4WU9 D;  1P3G D;  5B24 B;  5GSU C;  3R45 A;  5CP6 A;  1AOI C;  3B0C W;  4KUD B;  4Z66 B;  1P3K B;  3V9R B;  3UTA C;  2NQB D;  3TU4 A;  4NE5 A;  1P3G C;  1KX5 B;  4R8P D;  4ZUX B;  1ULY A;  4YM6 A;  5B0Z B;  5AV6 D;  4J8W A;  3AZE C;  2YFW B;  4NFT A;  1P3M A;  2ARO D;  3KWQ B;  5AV9 A;  3W99 D;  2F8N H;  3W96 D;  3WTP B;  3C1C B;  4H9N A;  3VH6 T;  5C3I B;  4YS3 C;  3O62 B;  3REH D;  1ID3 D;  1S32 A;  2ARO C;  3KXB B;  3W99 C;  3AFA A;  3AZL A;  1M1A A;  1B67 A;  3X1U A;  3W96 C;  1P3B D;  3REK D;  3WA9 B;  1P3A D;  1KX4 D;  2CV5 B;  3REJ B;  3LJA A;  3AZM B;  4E44 A;  5CP6 D;  3W97 A;  3MNN A;  2RVQ D;  4ZBJ B;  4JJN A;  3REK C;  3AZI A;  3TU4 D;  1KX4 C;  3LZ0 B;  5GT0 A;  1P34 B;  5AVB B;  4H9O B;  5BNX A;  2RVQ C;  4YM6 D;  1WWS A;  4J8W D;  2HUE B;  3KSY A;  5G49 B;  4XZQ A;  1P3M D;  3C1B B;  4LD9 B;  4WU8 B;  5DNN B;  5AV9 D;  5B2J A;  3A6N D;  3B0B A;  4CSR A;  5B1L C;  1EQZ C;  3KWQ C;  4KGC B;  2IO5 C;  5B0Y B;  4J8W C;  1Q9C A;  3WTP C;  1P3M C;  4KHA A;  5CPJ A;  1S32 D;  5AV9 C;  3AZL D;  3AFA D;  3AV2 A;  1M1A D;  3X1U D;  4H9P A;  3AZF A;  1P3I A;  3KXB C;  3B6F B;  3X1V B;  3MGP B;  3AV1 B;  3LJA D;  3WKJ B;  3MGS B;  4AWL B;  1P3L B;  3MGQ A;  3MNN D;  5GSU A;  3W97 D;  3AZL C;  2HIO B;  2F8N A;  3REI A;  3X1U C;  1AOI A;  5DNM B;  4JJN D;  3AZI D;  4CAY B;  3UTA A;  5CPK B;  5GT0 D;  3WAA B;  3X1S B;  4X23 B;  2F8N K;  5BNV A;  3VH6 A;  5FUG B;  4J8U A;  3B6G C;  2F8N G;  4XZQ D;  3AZE A;  5GT0 C;  4G92 B;  1P3F B;  5B2J D;  5GT3 B;  4XUJ A;  5B31 G;  4WU8 C;  5B40 B;  1TAF A;  2NZD A;  4WNN B;  4XZQ C;  3MGR D;  3NQU B;  2BYK B;  5CPJ D;  3AZG C;  1P3O B;  4YS3 A;  3AV2 D;  5B0Y C;  5B2J C;  3AZN B;  5E5A B;  3AZF D;  1P3I D;  3REL B;  4M6B A;  3MGQ D; 
#chains in the Genus database with same CATH topology
 5GSU D;  1KU5 A;  2F8N D;  3UT9 C;  3REI D;  1BH9 A;  1AOI D;  3MGS C;  1P3I C;  1P3P C;  2NQB B;  3UTA D;  4E45 A;  4KUD A;  5B32 G;  4Z66 A;  3V9R A;  4R8P B;  3MGQ C;  1A7W A;  5KDM B;  2JSS A;  2Y2Q A;  4H9S A;  5CPK C;  4DRA A;  3REI C;  4J8U D;  3AZJ B;  3AZE D;  4ZUX A;  5B31 C;  1M18 B;  5B0Z A;  3EPJ A;  3VH5 T;  5B2I C;  1KX3 C;  4XUJ D;  2YFW A;  5B1L A;  4J8U C;  3KWQ A;  1EQZ A;  2NZD D;  5GT3 C;  2Y2P A;  4G91 B;  5B40 C;  3WTP A;  4YS3 D;  4HGA C;  3C1C A;  5B33 C;  3VH6 W;  5AV5 C;  1HTA A;  4XUJ C;  3O62 A;  3AZK B;  3KXB A;  2NZD C;  5AY8 B;  5CPI B;  3REL C;  1B6W A;  1HQ3 B;  2ZY3 A;  3AZM A;  5B32 C;  3TU4 B;  4H9Q B;  4KUD D;  4Z66 D;  4YM6 B;  3LZ0 A;  5AVC B;  1P34 A;  5AVB A;  5B24 C;  4H9O A;  3B6G A;  1TZY B;  4ZUX D;  5B0Z D;  4KUD C;  4Z66 C;  1P3K C;  3A6N B;  4H9S C;  5G49 A;  3NQJ B;  5BO0 A;  4EO5 B;  5B1L D;  4WU8 A;  5DNN A;  3KWQ D;  1EQZ D;  1ZLA B;  3AN2 B;  1KX5 C;  3WTP D;  4J8V B;  4ZUX C;  3AZH B;  2Y2N A;  1F66 B;  1WWI A;  3AZG A;  3C1C D;  5B0Z C;  4KGC A;  5B0Y A;  4Z2M H;  3O62 D;  1U35 B;  2VQR A;  3KXB D;  2PYO B;  3W97 B;  4J8X B;  3KUY B;  3C1C C;  3WTP E;  3MGP A;  3X1T B;  5JA4 B;  5C3I C;  4JJN B;  3UT9 A;  3WKJ A;  3MGS A;  3AZM D;  3O62 C;  2ZM5 A;  3W98 B;  1P3P A;  5JRG B;  3VH5 A;  2Y2M A;  5AV8 B;  5BNX B;  2FJ7 B;  2RIQ A;  3WA9 C;  4CAY A;  4QLC B;  5CPK A;  3REJ C;  3LZ0 D;  2CV5 C;  1P34 D;  5AVB D;  3X1S A;  3AZM C;  4UPK A;  3B6G D;  5FUG A;  5AVC C;  1PZR A;  4ZBJ C;  5B31 A;  1TZY C;  4Z5T B;  1KX3 A;  5B2I A;  2YFV B;  4WU8 D;  4UUZ B;  5DNN D;  3LZ0 C;  2UWX A;  1P34 C;  5AVB C;  3LZ1 B;  1F1E A;  3MGR B;  5GT3 A;  4KHA B;  4EO5 C;  3MVD B;  4KGC D;  3AV2 B;  5B40 A;  3LEL B;  3AZG D;  3AN2 C;  5B0Y D;  2HUE C;  5B33 A;  4WNN A;  2DQN C;  4J8V C;  5AV5 A;  3F6T A;  3NQU A;  2BYK A;  3C1B C;  3AZH C;  5DNN C;  5GXQ B;  1F66 C;  4LD9 C;  1N1J B;  1M19 B;  2BYM B;  1U35 C;  4KGC C;  2Y2I A;  3REL A;  4WV4 B;  3MGP D;  1AOI B;  3UT9 D;  1R4V A;  3MGS D;  3AYW B;  3WKJ D;  2LY8 A;  5F99 B;  3KUY C;  1P3P D;  1JFI B;  2Y2H A;  1W2E A;  5B1M B;  5B32 A;  3UTB B;  4WU9 B;  1P3G B;  3B6F C;  3X1V C;  3MGP C;  3AV1 C;  5CPK D;  2XD1 A;  3X1S D;  3WKJ C;  2FJ7 C;  4AWL C;  1P3L C;  4R8P A;  5B24 A;  3AZE B;  2HIO C;  5B31 D;  5DNM C;  1P3K A;  3AZJ A;  5B2I D;  1KX3 D;  3WAA C;  3X1S C;  4X23 C;  1M18 A;  5AV6 B;  3VH5 W;  5GT3 D;  1KX5 A;  5B40 D;  4Z2M G;  2ARO B;  3FDD A;  3W99 B;  2ZY5 A;  5B33 D;  2L5A A;  3W96 B;  5AV5 D;  4G92 C;  1P3F C;  1ID3 B;  4H9R B;  3REH B;  3REL D;  3AZK A;  1BH8 B;  1P3B B;  1P3O C;  5AY8 A;  5CPI A;  3REK B;  5B32 D;  1H3O B;  1P3A B;  1KX4 B;  1HQ3 A;  3AYW C;  3AZN C;  3AL0 C;  5F99 C;  5E5A C;  3R45 B;  5CP6 B;  3EPK A;  5B1M C;  3WA9 A;  4H9Q A;  3UTB C;  3B0C T;  4WU9 C;  3REJ A;  2CV5 A;  5B24 D;  5AVC A;  1P3K D;  3IP4 C;  2NQB C;  2CWE A;  3AZJ D;  1TZY A;  2Y2J A;  5B1L B;  1EQZ B;  4NE6 A;  1T3U A;  1M18 D;  2IO5 B;  4R8P C;  4J8W B;  3A6N A;  1KX5 D;  3NQJ A;  1P3M B;  3H0L C;  5AV9 B;  4DRB A;  1ZLA A;  5AV6 C;  3AN2 A;  3AZJ C;  2FFF B;  4J8V A;  3AZH A;  1F66 A;  3C1B A;  4LD9 A;  1M18 C;  4H9N B;  5CHL B;  2ZY2 A;  1S32 B;  4WZS B;  3AZK D;  1U35 A;  2F2A C;  3AZL B;  3AFA B;  1M1A B;  5BS7 C;  3X1U B;  1ID3 C;  4G91 C;  5AY8 D;  3REH C;  5CPI D;  3B0D B;  2PYO A;  4J8X A;  3KUY A;  3X1T A;  1HQ3 D;  3LJA B;  5JA4 A;  1P3B C;  4NE3 A;  3AZK C;  3MNN B;  1P3A C;  3W98 A;  3WA9 D;  5JRG A;  3B6F A;  3X1V A;  3AV1 A;  2CV5 D;  3REJ D;  5AV8 A;  5AY8 C;  5CPI C;  5CP6 C;  2FJ7 A;  3B6G B;  1P3L A;  3AZI B;  4QLC A;  5GT0 B;  1HQ3 C;  2HIO A;  5AVC D;  5DNM A;  1TZY D;  5BO0 B;  3TU4 C;  3WAA A;  3H0R C;  2G5I C;  4X23 A;  4XZQ B;  4Z5T A;  4YM6 C;  3AZG B;  2YFV A;  4UUZ A;  1ZLA D;  3AN2 D;  5B2J B;  3LZ1 A;  4CSR B;  3MGR A;  4J8V D;  3MVD A;  3AZH D;  3C1B D;  1F66 D;  3LEL A;  4LD9 D;  3A6N C;  1P3F A;  5CPJ B;  1U35 D;  1ZLA C;  5GXQ A;  1N1J A;  3UT9 B;  4H9P B;  1M19 A;  2PYO D;  3AZF B;  1S32 C;  2BYM A;  1P3I B;  4J8X D;  1P3P B;  3KUY D;  3AFA C;  1P3O A;  1M1A C;  3X1T D;  3AYW A;  3B0D C;  3AZN A;  3MGQ B;  5F99 A;  5E5A A;  5GSU B;  3W98 D;  5JRG D;  2F8N B;  3LJA C;  3X1V D;  1JFI A;  3REI B;  3AV1 D;  5B1M A;  3B6F D;  5AV8 D;  3UTB A;  2PYO C;  4WU9 A;  1P3G A;  2FJ7 D;  3MNN C;  4J8X C;  1P3L D;  3W97 C;  3P5J B;  3UTA B;  4QLC D;  3X1T C;  2HIO D;  5B31 B;  4JJN C;  5DNM D;  5BNV B;  5B2I B;  3AZI C;  1KX3 B;  3W98 C;  2NQB A;  5JRG C;  4J8U B;  5AV8 C;  3WAA D;  4X23 D;  2BG1 A;  4Z5T D;  2G5H C;  5KDM A;  4QLC C;  4HGA B;  5B33 B;  3LZ1 D;  5AV6 A;  5AV5 B;  4XUJ B;  2JCH A;  3MVD D;  5BT1 D;  3LEL D;  2ARO A;  1TAF B;  2NZD B;  3W99 A;  1P3F D;  3KFU G;  4Z5T C;  3W96 A;  1BFM A;  4YS3 B;  5GXQ D;  5BS7 A;  3LZ1 C;  3MGR C;  1M19 D;  2Y2G A;  5CPJ C;  3MVD C;  1ID3 A;  4H9R A;  5BT1 C;  3LEL C;  3REH A;  5B32 B;  3AV2 C;  1P3O D;  3AYW D;  3A1I A;  3AZF C;  1BH8 A;  1P3B A;  3AZN D;  5F99 D;  5E5A D;  3REK A;  5GXQ C;  3H0M C;  2JE5 A;  1BH9 B;  1H3O A;  2J8P A;  5B1M D;  1P3A A;  1KX4 A;  3UTB D;  1M19 C;  4WU9 D;  1P3G D;  5B24 B;  5GSU C;  3R45 A;  5CP6 A;  1AOI C;  3B0C W;  4KUD B;  4Z66 B;  1P3K B;  3V9R B;  3UTA C;  2NQB D;  2Y2K A;  3TU4 A;  4NE5 A;  1P3G C;  4WJ3 C;  1KX5 B;  1Z2C B;  4R8P D;  4ZUX B;  1ULY A;  4YM6 A;  5B0Z B;  5AV6 D;  4J8W A;  3AZE C;  2DF4 C;  2YFW B;  4NFT A;  1P3M A;  2ARO D;  3KWQ B;  5AV9 A;  3W99 D;  2F8N H;  3EPL A;  3W96 D;  3WTP B;  3C1C B;  4H9N A;  3VH6 T;  5C3I B;  4YS3 C;  3O62 B;  3REH D;  1ID3 D;  1S32 A;  2ARO C;  3KXB B;  3W99 C;  3AFA A;  3AZL A;  1M1A A;  2ZY4 A;  1B67 A;  3X1U A;  3W96 C;  1P3B D;  3REK D;  3WA9 B;  1P3A D;  1KX4 D;  2CV5 B;  3REJ B;  3LJA A;  3AZM B;  4E44 A;  5CP6 D;  3EPH A;  3W97 A;  3MNN A;  2RVQ D;  4ZBJ B;  4JJN A;  3A1K A;  3REK C;  3AZI A;  3TU4 D;  1KX4 C;  3LZ0 B;  5GT0 A;  1P34 B;  5AVB B;  4H9O B;  5BNX A;  2RVQ C;  4YM6 D;  1WWS A;  4J8W D;  2HUE B;  3KSY A;  5G49 B;  4XZQ A;  1P3M D;  3C1B B;  4LD9 B;  4WU8 B;  5DNN B;  5AV9 D;  5B2J A;  3A6N D;  3B0B A;  4CSR A;  5B1L C;  1EQZ C;  3KWQ C;  4KGC B;  2IO5 C;  5B0Y B;  4J8W C;  3EG5 B;  1Q9C A;  3WTP C;  1P3M C;  4KHA A;  5CPJ A;  1S32 D;  5AV9 C;  3AZL D;  3AFA D;  3AV2 A;  2Y2O A;  1M1A D;  2XD5 A;  3X1U D;  4H9P A;  3AZF A;  1P3I A;  3KXB C;  3B6F B;  3X1V B;  3MGP B;  3AV1 B;  3LJA D;  3WKJ B;  3MGS B;  4AWL B;  1P3L B;  3MGQ A;  3MNN D;  5GSU A;  3W97 D;  3AZL C;  2HIO B;  2F8N A;  3REI A;  3X1U C;  1AOI A;  5DNM B;  4JJN D;  3AZI D;  4CAY B;  3UTA A;  5CPK B;  5GT0 D;  3WAA B;  3X1S B;  4X23 B;  2F8N K;  5BNV A;  3VH6 A;  5FUG B;  2W8S A;  4J8U A;  3B6G C;  2F8N G;  4XZQ D;  2Y2L A;  3AZE A;  5GT0 C;  4G92 B;  1P3F B;  5B2J D;  5GT3 B;  4XUJ A;  5B31 G;  4WU8 C;  5B40 B;  1TAF A;  2NZD A;  4WNN B;  4XZQ C;  3MGR D;  3NQU B;  2BYK B;  5CPJ D;  3AZG C;  1P3O B;  4YS3 A;  3AV2 D;  5B0Y C;  5B2J C;  3AZN B;  5E5A B;  3AZF D;  1P3I D;  3REL B;  4DQY B;  4M6B A;  3MGQ D; 
#chains in the Genus database with same CATH homology
 5GSU D;  1KU5 A;  2F8N D;  3UT9 C;  3REI D;  1BH9 A;  1AOI D;  3MGS C;  1P3I C;  1P3P C;  2NQB B;  3UTA D;  4E45 A;  4KUD A;  5B32 G;  4Z66 A;  3V9R A;  4R8P B;  3MGQ C;  1A7W A;  5KDM B;  2JSS A;  2Y2Q A;  4H9S A;  5CPK C;  4DRA A;  3REI C;  4J8U D;  3AZJ B;  3AZE D;  4ZUX A;  5B31 C;  1M18 B;  5B0Z A;  3EPJ A;  3VH5 T;  5B2I C;  1KX3 C;  4XUJ D;  2YFW A;  5B1L A;  4J8U C;  3KWQ A;  1EQZ A;  2NZD D;  5GT3 C;  2Y2P A;  4G91 B;  5B40 C;  3WTP A;  4YS3 D;  4HGA C;  3C1C A;  5B33 C;  3VH6 W;  5AV5 C;  1HTA A;  4XUJ C;  3O62 A;  3AZK B;  3KXB A;  2NZD C;  5AY8 B;  5CPI B;  3REL C;  1B6W A;  1HQ3 B;  2ZY3 A;  3AZM A;  5B32 C;  3TU4 B;  4H9Q B;  4KUD D;  4Z66 D;  4YM6 B;  3LZ0 A;  5AVC B;  1P34 A;  5AVB A;  5B24 C;  4H9O A;  3B6G A;  1TZY B;  4ZUX D;  5B0Z D;  4KUD C;  4Z66 C;  1P3K C;  3A6N B;  4H9S C;  5G49 A;  3NQJ B;  5BO0 A;  4EO5 B;  5B1L D;  4WU8 A;  5DNN A;  3KWQ D;  1EQZ D;  1ZLA B;  3AN2 B;  1KX5 C;  3WTP D;  4J8V B;  4ZUX C;  3AZH B;  2Y2N A;  1F66 B;  1WWI A;  3AZG A;  3C1C D;  5B0Z C;  4KGC A;  5B0Y A;  4Z2M H;  3O62 D;  1U35 B;  2VQR A;  3KXB D;  2PYO B;  3W97 B;  4J8X B;  3KUY B;  3C1C C;  3WTP E;  3MGP A;  3X1T B;  5JA4 B;  5C3I C;  4JJN B;  3UT9 A;  3WKJ A;  3MGS A;  3AZM D;  3O62 C;  2ZM5 A;  3W98 B;  1P3P A;  5JRG B;  3VH5 A;  2Y2M A;  5AV8 B;  5BNX B;  2FJ7 B;  2RIQ A;  3WA9 C;  4CAY A;  4QLC B;  5CPK A;  3REJ C;  3LZ0 D;  2CV5 C;  1P34 D;  5AVB D;  3X1S A;  3AZM C;  4UPK A;  3B6G D;  5FUG A;  5AVC C;  1PZR A;  4ZBJ C;  5B31 A;  1TZY C;  4Z5T B;  1KX3 A;  5B2I A;  2YFV B;  4WU8 D;  4UUZ B;  5DNN D;  3LZ0 C;  2UWX A;  1P34 C;  5AVB C;  3LZ1 B;  1F1E A;  3MGR B;  5GT3 A;  4KHA B;  4EO5 C;  3MVD B;  4KGC D;  3AV2 B;  5B40 A;  3LEL B;  3AZG D;  3AN2 C;  5B0Y D;  2HUE C;  5B33 A;  4WNN A;  2DQN C;  4J8V C;  5AV5 A;  3F6T A;  3NQU A;  2BYK A;  3C1B C;  3AZH C;  5DNN C;  5GXQ B;  1F66 C;  4LD9 C;  1N1J B;  1M19 B;  2BYM B;  1U35 C;  4KGC C;  2Y2I A;  3REL A;  4WV4 B;  3MGP D;  1AOI B;  3UT9 D;  1R4V A;  3MGS D;  3AYW B;  3WKJ D;  2LY8 A;  5F99 B;  3KUY C;  1P3P D;  1JFI B;  2Y2H A;  1W2E A;  5B1M B;  5B32 A;  3UTB B;  4WU9 B;  1P3G B;  3B6F C;  3X1V C;  3MGP C;  3AV1 C;  5CPK D;  2XD1 A;  3X1S D;  3WKJ C;  2FJ7 C;  4AWL C;  1P3L C;  4R8P A;  5B24 A;  3AZE B;  2HIO C;  5B31 D;  5DNM C;  1P3K A;  3AZJ A;  5B2I D;  1KX3 D;  3WAA C;  3X1S C;  4X23 C;  1M18 A;  5AV6 B;  3VH5 W;  5GT3 D;  1KX5 A;  5B40 D;  4Z2M G;  2ARO B;  3FDD A;  3W99 B;  2ZY5 A;  5B33 D;  2L5A A;  3W96 B;  5AV5 D;  4G92 C;  1P3F C;  1ID3 B;  4H9R B;  3REH B;  3REL D;  3AZK A;  1BH8 B;  1P3B B;  1P3O C;  5AY8 A;  5CPI A;  3REK B;  5B32 D;  1H3O B;  1P3A B;  1KX4 B;  1HQ3 A;  3AYW C;  3AZN C;  3AL0 C;  5F99 C;  5E5A C;  3R45 B;  5CP6 B;  3EPK A;  5B1M C;  3WA9 A;  4H9Q A;  3UTB C;  3B0C T;  4WU9 C;  3REJ A;  2CV5 A;  5B24 D;  5AVC A;  1P3K D;  3IP4 C;  2NQB C;  2CWE A;  3AZJ D;  1TZY A;  2Y2J A;  5B1L B;  1EQZ B;  4NE6 A;  1T3U A;  1M18 D;  2IO5 B;  4R8P C;  4J8W B;  3A6N A;  1KX5 D;  3NQJ A;  1P3M B;  3H0L C;  5AV9 B;  4DRB A;  1ZLA A;  5AV6 C;  3AN2 A;  3AZJ C;  2FFF B;  4J8V A;  3AZH A;  1F66 A;  3C1B A;  4LD9 A;  1M18 C;  4H9N B;  5CHL B;  2ZY2 A;  1S32 B;  4WZS B;  3AZK D;  1U35 A;  2F2A C;  3AZL B;  3AFA B;  1M1A B;  5BS7 C;  3X1U B;  1ID3 C;  4G91 C;  5AY8 D;  3REH C;  5CPI D;  3B0D B;  2PYO A;  4J8X A;  3KUY A;  3X1T A;  1HQ3 D;  3LJA B;  5JA4 A;  1P3B C;  4NE3 A;  3AZK C;  3MNN B;  1P3A C;  3W98 A;  3WA9 D;  5JRG A;  3B6F A;  3X1V A;  3AV1 A;  2CV5 D;  3REJ D;  5AV8 A;  5AY8 C;  5CPI C;  5CP6 C;  2FJ7 A;  3B6G B;  1P3L A;  3AZI B;  4QLC A;  5GT0 B;  1HQ3 C;  2HIO A;  5AVC D;  5DNM A;  1TZY D;  5BO0 B;  3TU4 C;  3WAA A;  3H0R C;  2G5I C;  4X23 A;  4XZQ B;  4Z5T A;  4YM6 C;  3AZG B;  2YFV A;  4UUZ A;  1ZLA D;  3AN2 D;  5B2J B;  3LZ1 A;  4CSR B;  3MGR A;  4J8V D;  3MVD A;  3AZH D;  3C1B D;  1F66 D;  3LEL A;  4LD9 D;  3A6N C;  1P3F A;  5CPJ B;  1U35 D;  1ZLA C;  5GXQ A;  1N1J A;  3UT9 B;  4H9P B;  1M19 A;  2PYO D;  3AZF B;  1S32 C;  2BYM A;  1P3I B;  4J8X D;  1P3P B;  3KUY D;  3AFA C;  1P3O A;  1M1A C;  3X1T D;  3AYW A;  3B0D C;  3AZN A;  3MGQ B;  5F99 A;  5E5A A;  5GSU B;  3W98 D;  5JRG D;  2F8N B;  3LJA C;  3X1V D;  1JFI A;  3REI B;  3AV1 D;  5B1M A;  3B6F D;  5AV8 D;  3UTB A;  2PYO C;  4WU9 A;  1P3G A;  2FJ7 D;  3MNN C;  4J8X C;  1P3L D;  3W97 C;  3P5J B;  3UTA B;  4QLC D;  3X1T C;  2HIO D;  5B31 B;  4JJN C;  5DNM D;  5BNV B;  5B2I B;  3AZI C;  1KX3 B;  3W98 C;  2NQB A;  5JRG C;  4J8U B;  5AV8 C;  3WAA D;  4X23 D;  2BG1 A;  4Z5T D;  2G5H C;  5KDM A;  4QLC C;  4HGA B;  5B33 B;  3LZ1 D;  5AV6 A;  5AV5 B;  4XUJ B;  2JCH A;  3MVD D;  5BT1 D;  3LEL D;  2ARO A;  1TAF B;  2NZD B;  3W99 A;  1P3F D;  3KFU G;  4Z5T C;  3W96 A;  1BFM A;  4YS3 B;  5GXQ D;  5BS7 A;  3LZ1 C;  3MGR C;  1M19 D;  2Y2G A;  5CPJ C;  3MVD C;  1ID3 A;  4H9R A;  5BT1 C;  3LEL C;  3REH A;  5B32 B;  3AV2 C;  1P3O D;  3AYW D;  3A1I A;  3AZF C;  1BH8 A;  1P3B A;  3AZN D;  5F99 D;  5E5A D;  3REK A;  5GXQ C;  3H0M C;  2JE5 A;  1BH9 B;  1H3O A;  2J8P A;  5B1M D;  1P3A A;  1KX4 A;  3UTB D;  1M19 C;  4WU9 D;  1P3G D;  5B24 B;  5GSU C;  3R45 A;  5CP6 A;  1AOI C;  3B0C W;  4KUD B;  4Z66 B;  1P3K B;  3V9R B;  3UTA C;  2NQB D;  2Y2K A;  3TU4 A;  4NE5 A;  1P3G C;  4WJ3 C;  1KX5 B;  1Z2C B;  4R8P D;  4ZUX B;  1ULY A;  4YM6 A;  5B0Z B;  5AV6 D;  4J8W A;  3AZE C;  2DF4 C;  2YFW B;  4NFT A;  1P3M A;  2ARO D;  3KWQ B;  5AV9 A;  3W99 D;  2F8N H;  3EPL A;  3W96 D;  3WTP B;  3C1C B;  4H9N A;  3VH6 T;  5C3I B;  4YS3 C;  3O62 B;  3REH D;  1ID3 D;  1S32 A;  2ARO C;  3KXB B;  3W99 C;  3AFA A;  3AZL A;  1M1A A;  2ZY4 A;  1B67 A;  3X1U A;  3W96 C;  1P3B D;  3REK D;  3WA9 B;  1P3A D;  1KX4 D;  2CV5 B;  3REJ B;  3LJA A;  3AZM B;  4E44 A;  5CP6 D;  3EPH A;  3W97 A;  3MNN A;  2RVQ D;  4ZBJ B;  4JJN A;  3A1K A;  3REK C;  3AZI A;  3TU4 D;  1KX4 C;  3LZ0 B;  5GT0 A;  1P34 B;  5AVB B;  4H9O B;  5BNX A;  2RVQ C;  4YM6 D;  1WWS A;  4J8W D;  2HUE B;  3KSY A;  5G49 B;  4XZQ A;  1P3M D;  3C1B B;  4LD9 B;  4WU8 B;  5DNN B;  5AV9 D;  5B2J A;  3A6N D;  3B0B A;  4CSR A;  5B1L C;  1EQZ C;  3KWQ C;  4KGC B;  2IO5 C;  5B0Y B;  4J8W C;  3EG5 B;  1Q9C A;  3WTP C;  1P3M C;  4KHA A;  5CPJ A;  1S32 D;  5AV9 C;  3AZL D;  3AFA D;  3AV2 A;  2Y2O A;  1M1A D;  2XD5 A;  3X1U D;  4H9P A;  3AZF A;  1P3I A;  3KXB C;  3B6F B;  3X1V B;  3MGP B;  3AV1 B;  3LJA D;  3WKJ B;  3MGS B;  4AWL B;  1P3L B;  3MGQ A;  3MNN D;  5GSU A;  3W97 D;  3AZL C;  2HIO B;  2F8N A;  3REI A;  3X1U C;  1AOI A;  5DNM B;  4JJN D;  3AZI D;  4CAY B;  3UTA A;  5CPK B;  5GT0 D;  3WAA B;  3X1S B;  4X23 B;  2F8N K;  5BNV A;  3VH6 A;  5FUG B;  2W8S A;  4J8U A;  3B6G C;  2F8N G;  4XZQ D;  2Y2L A;  3AZE A;  5GT0 C;  4G92 B;  1P3F B;  5B2J D;  5GT3 B;  4XUJ A;  5B31 G;  4WU8 C;  5B40 B;  1TAF A;  2NZD A;  4WNN B;  4XZQ C;  3MGR D;  3NQU B;  2BYK B;  5CPJ D;  3AZG C;  1P3O B;  4YS3 A;  3AV2 D;  5B0Y C;  5B2J C;  3AZN B;  5E5A B;  3AZF D;  1P3I D;  3REL B;  4DQY B;  4M6B A;  3MGQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...