4KUDA

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
96
structure length
96
Chain Sequence
PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein/transcription/dna
total genus 29
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kudA00
2F8NB 3AV2B 4KUDD 5B33A 3W96D 3KXBD 5CPJD 1P3MB 5B31G 3AZFD 2AROC 4YM6D 3REJD 4XUJC 5B0YB 5DNMA 5AVBB 3REID 1P3OD 3MGQA 3REKA 1AOIB 4WV4B 1KX4A 3X1TA 3C1BC 1P34A 3REKB 4Z5TC 3X1SB 5B33D 1KX5C 3LZ1B 3LJAB 2BYKA 1EQZB 1P3AA 3VH5T 4AWLB 4X23B 2PYOB 5DNMD 3REHC 2RVQC 3AZGA 2HIOD 3MGQD 3REKD 5BNVA 2LY8A 3AFAB 1KX4D 3X1TD 1P3LC 5GXQB 3AZGB 3AZEA 3AN2D 4QLCB 1P34D 2YFWB 5AVCB 3MGSA 3LZ0B 1P3AD 1M1AC 4J8UC 5AV8C 3AZKC 5AY8C 5B31C 1ZLAC 3LELC 5JRGB 3AZED 1P3FD 4XZQA 1P3BA 1M18C 1WWIA 3MGSD 5E5AA 1P3BB 4WU9A 3W99C 1HTAA 3KWQC 5CPKC 3B0DB 3AZNC 5B2IA 3MGRC 4WU9B 5CP6B 5GSUC 5G49A 3AZMB 4WNNA 3WKJB 4KGCB 4KUDC 4LD9D 3W96C 4XZQD 3KXBC 1P3BD 5CPJC 5B1MB 1WWSA 5GT3A 3AZFC 5AV5D 3C1CA 5E5AD 4YM6C 3REJC 3NQJB 4ZBJC 5GT3B 2CV5A 4CSRB 3X1UA 5JA4A 3REIC 4H9NA 3X1VA 1P3OC 5B2ID 1M19B 3WAAA 3AV1B 5JA4B 3AYWB 3B0CT 2NZDA 5B33C 3UTBB 2HUEB 1R4VA 3C1CD 5GT0B 2NZDB 1HQ3A 1P3KD 4NE6A 5DNMC 2CV5D 3X1UD 3X1VD 2HIOC 3MGQC 5CPIB 1KX4C 3X1TC 3WAAD 4HGAC 3AN2C 2IO5C 3MGPD 1P34C 1U35A 5KDMA 4UUZA 3B0CW 1P3AC 1P3GA 2FJ7D 1HQ3D 5B0ZA 5AV9A 4DRBA 4WU8B 4M6BA 5AV9B 5F99B 3AZEC 1U35D 1P3FC 4YS3B 3KSYA 4Z66A 4J8XB 3MGSC 1S32A 1BH8A 2JSSA 1P3GD 5DNNB 3AZHA 5B0ZD 3B6GA 5B1LB 3MNNB 1ID3A 1KX3A 3TU4A 4EO5C 3O62A 4NE3A 5BT1C 3O62B 4LD9C 2F8NA 1ULYA 4XZQC 3A6NA 5B24B 3AV2A 4Z66D 1B67A 5AV5C 1P3PB 1S32D 5E5AC 3A6NB 1P3MA 5B40D 3AZHD 3B6GD 5B0YA 5BNXB 5B2IC 4E45A 1KX3D 1ID3D 3NQUB 5AVBA 3TU4D 3WTPB 1AOIA 3RELB 4E44A 4H9QB 2F8ND 3X1SA 3AV2D 4H9SC 4ZUXB 3LZ1A 3C1CC 4G92B 3LJAA 3WTPE 1P3KC 1P3MD 1EQZA 4J8WB 2CV5C 3X1UC 3X1VC 4X23A 1TAFB 2PYOA 3WA9B 5B0YD 3W98A 5AVBD 3WAAC 3AZLB 1AOID 3MGPC 3AFAA 3W98B 3KUYB 5GXQA 3W97B 4QLCA 2YFWA 4H9PA 3X1SD 5AVCA 2FJ7C 3LZ1D 1HQ3C 3LJAD 3LZ0A 4H9PB 1EQZD 1F66B 1H3OB 4X23D 2F8NG 2PYOD 3W98D 5B2JA 3B6FA 5FUGA 1U35C 3AFAD 4Z2MG 5B2JB 5JRGA 4R8PB 5GXQD 5FUGB 3AZGD 2NQBA 3B6FB 4QLCD 5AV6B 2L5AA 4J8VC 5AVCD 3UTAA 1P3GC 2NQBB 5B0ZC 5C3IB 3LZ0D 3UT9A 3UTAB 3AZJA 3V9RA 3UT9B 5CP6A 3AZMA 3AZJB 5JRGD 3V9RB 3MVDB 4Z66C 3WKJA 4KGCA 1S32C 5B1MA 3UTAD 5B40C 3AZHC 3B6GC 4G91B 1KX3C 1ID3C 3NQJA 3TU4C 4CSRA 5BS7A 1P3IB 3AZJD 5B32B 4WU9D 1M19A 1TZYB 5CP6D 3AV1A 3AZIB 3AZMD 4JJNA 3AYWA 3AV2C 3WKJD 4KGCD 3UTBA 4JJNB 5B1MD 1P3MC 5GT0A 2AROA 5B0YC 5GT3D 5AVBC 1AOIC 2AROB 4CAYA 1M19D 5CPIA 4XUJB 3AV1D 3REKC 3AYWD 4CAYB 3X1SC 3LZ1C 3LJAC 3C1BB 3UTBD 1EQZC 2NZDD 4Z5TB 5GT0D 4AWLC 4X23C 2PYOC 1KX5B 2F8NH 4WU8A 5CPID 3AFAC 5F99A 5GXQC 3AZGC 4Z2MH 4QLCC 3REHB 4DRAA 4YS3A 5AVCC 4J8XA 1BFMA 1P3LB 3LZ0C 5DNNA 5B1LA 3MNNA 4WU8D 5AY8A 5AV9D 1M1AB 4J8UB 5F99D 5AV8B 5JRGC 3AZKB 3LELA 5AY8B 5B31B 1ZLAB 5B24A 4YS3D 4J8XD 1P3PA 4J8VB 3LELB 1A7WA 1M18A 1P3BC 5DNND 5B1LD 3B0DC 3MNND 5BNXA 1M18B 4WU9C 3NQUA 3AZNA 5CP6C 3WTPA 1KU5A 3KWQB 2BYMB 3AZMC 5CPKB 3W99B 3RELA 3AZNB 3WKJC 4KGCC 4H9QA 3O62D 3MGRB 4KUDA 5GSUB 5B1MC 5B24D 4ZUXA 1P3PD 3A6ND 4KUDB 3W96B 3REJA 5GT3C 3KXBB 4J8WA 5CPJB 5BS7C 1TAFA 3AZFB 3WA9A 1M19C 4YM6B 3AZND 3REJB 3WTPD 1Q9CA 3AV1C 3AZLA 4ZBJB 1JFIB 3AYWC 3RELD 3VH6T 5BO0B 3KUYA 3REIB 1P3OB 3W97A 3UTBC 2HUEC 4ZUXD 2NZDC 5GT0C 5B33B 4J8WD 1F66A 1H3OA 3WA9D 2HIOA 5CPIC 3AZLD 5DNMB 3AN2A 3R45A 2HIOB 3KUYD 3MGQB 4R8PA 3W97D 1KX4B 3X1TB 5AV6A 4HGAB 1BH9A 3R45B 2IO5B 3VH6W 3AN2B 1P34B 2F8NK 1BH9B 4WU8C 1F66D 2BYKB 4H9OA 1P3AB 5AV9C 5F99C 4H9OB 3B0BA 5B2JD 3B6FD 4YS3C 4R8PD 3MVDA 4J8XC 5BNVB 1P3FA 5AV6D 3AZEB 2NQBD 1P3FB 5DNNC 5B1LC 3MNNC 3VH6A 3MGSB 3VH5W 1P3IA 5B32A 1TZYA 3UT9D 3AZIA 4NFTA 3O62C 4EO5B 5B24C 4LD9A 3MVDD 1B6WA 1P3PC 5AV5A 4WZSB 3A6NC 4LD9B 4XZQB 5AV5B 5E5AB 1F1EA 3WTPC 1P3ID 5B32D 3RELC 1TZYD 4XUJA 5BT1D 3AZID 5B2IB 3VH5A 5G49B 4ZUXC 4G92C 2CWEA 4H9SA 3C1BA 4WNNB 4JJND 4NE5A 1P3KA 4J8WC 4Z5TA 3WA9C 1KX5A 3C1CB 4KHAA 1P3KB 3AZLC 2AROD 2CV5B 4H9RA 3X1UB 3X1VB 4H9NB 4KHAB 4XUJD 3MGPA 3KUYC 3W97C 3W98C 3REHA 3WAAB 4H9RB 3MGPB 2FJ7A 3C1BD 1P3LA 5B32G 4Z5TD 1F66C 2FJ7B 1KX5D 1HQ3B 2YFVA 1M1AA 4J8UA 2YFVB 5B2JC 5AV8A 4R8PC 3AZKA 3B6FC 3REHD 2RVQD 5B31A 1ZLAA 5AV6C 2NQBC 1U35B 4J8VA 1P3LD 5KDMB 4UUZB 5C3IC 3UTAC 1P3GB 5B0ZB 3UT9C 3KWQA 2BYMA 5CHLB 5CPKA 3W99A 1M1AD 4J8UD 3AZJC 5AV8D 3AZKD 3MVDC 1N1JA 5AY8D 3MGRA 5B31D 1ZLAD 5GSUA 1N1JB 3LELD 5B40A 4J8VD 4Z66B 4G91C 3W96A 1S32B 3KXBA 5CPJA 1BH8B 5B40B 3AZFA 1P3IC 1M18D 5B32C 3AZHB 4YM6A 3B6GB 1TZYC 3W99D 3KWQD 3AZIC 5CPKD 1KX3B 1ID3B 1JFIA 3TU4B 5BO0A 3REIA 1P3OA 3MGRD 5GSUD 4JJNC
chains in the Genus database with same CATH superfamily
2F8NB 3AV2B 4KUDD 5B33A 3W96D 3KXBD 3P5JB 5CPJD 1P3MB 5B31G 3AZFD 2AROC 4YM6D 3REJD 4XUJC 5B0YB 5DNMA 5AVBB 3REID 1P3OD 3MGQA 3REKA 1AOIB 4WV4B 1KX4A 3X1TA 3C1BC 1P34A 3REKB 4Z5TC 3X1SB 2JE5A 5B33D 1KX5C 3LZ1B 3LJAB 2BYKA 1EQZB 1P3AA 3VH5T 4AWLB 4X23B 2PYOB 3EG5B 5DNMD 3REHC 2RVQC 3AZGA 2HIOD 3IP4C 3A1KA 3MGQD 3REKD 5BNVA 2LY8A 2J8PA 3AFAB 1KX4D 3X1TD 1P3LC 5GXQB 3AZGB 3AZEA 3AN2D 4QLCB 1P34D 2YFWB 5AVCB 3H0RC 3MGSA 3LZ0B 1P3AD 1M1AC 4J8UC 5AV8C 3AZKC 5AY8C 5B31C 1ZLAC 3LELC 5JRGB 3AZED 1P3FD 4XZQA 1P3BA 1M18C 1WWIA 3MGSD 5E5AA 1P3BB 4WU9A 3W99C 1HTAA 3KWQC 5CPKC 3B0DB 3AZNC 5B2IA 2W8SA 3MGRC 4WU9B 5CP6B 5GSUC 5G49A 3AZMB 4WNNA 3WKJB 4KGCB 4KUDC 4LD9D 3W96C 4XZQD 3KXBC 1P3BD 5CPJC 5B1MB 1WWSA 5GT3A 3AZFC 5AV5D 3C1CA 5E5AD 4YM6C 2UWXA 2VQRA 3REJC 3NQJB 4ZBJC 5GT3B 2CV5A 4CSRB 5JA4A 3X1UA 3REIC 4H9NA 3X1VA 1P3OC 5B2ID 1M19B 3WAAA 3AV1B 5JA4B 3AYWB 3B0CT 2NZDA 5B33C 3UTBB 2HUEB 1R4VA 1W2EA 3C1CD 5GT0B 2NZDB 1HQ3A 1P3KD 4NE6A 5DNMC 2CV5D 3X1UD 3X1VD 2HIOC 3MGQC 5CPIB 1KX4C 3X1TC 3WAAD 4HGAC 3AN2C 2IO5C 3MGPD 1P34C 1U35A 5KDMA 4UUZA 3B0CW 1P3AC 1P3GA 2FJ7D 1HQ3D 5B0ZA 4DRBA 5AV9A 3A1IA 4WU8B 4M6BA 2Y2JA 5AV9B 5F99B 3AZEC 1PZRA 1U35D 1P3FC 4YS3B 3KSYA 4Z66A 4J8XB 3MGSC 1S32A 1BH8A 2JSSA 1P3GD 3EPHA 5DNNB 3AZHA 5B0ZD 3B6GA 5B1LB 3MNNB 1ID3A 1KX3A 3TU4A 4EO5C 3FDDA 3O62A 4NE3A 5BT1C 3O62B 4LD9C 2F8NA 1ULYA 4XZQC 3A6NA 5B24B 4WJ3C 3AV2A 4Z66D 1B67A 3F6TA 5AV5C 1P3PB 1S32D 5E5AC 3A6NB 1P3MA 5B40D 3AZHD 3B6GD 5B0YA 5BNXB 5B2IC 4E45A 1KX3D 1ID3D 3NQUB 5AVBA 3TU4D 3WTPB 2ZY3A 1AOIA 3RELB 4E44A 4H9QB 2Y2QA 2F8ND 3X1SA 3AV2D 4H9SC 4ZUXB 3LZ1A 3C1CC 4G92B 3LJAA 3WTPE 1P3KC 1P3MD 1EQZA 4J8WB 2CV5C 3X1UC 3X1VC 4X23A 1TAFB 2PYOA 3WA9B 5B0YD 2Y2KA 3W98A 5AVBD 3WAAC 2XD5A 3AZLB 1AOID 3MGPC 3AFAA 3W98B 3KUYB 5GXQA 3W97B 4QLCA 2YFWA 4H9PA 3X1SD 5AVCA 2FJ7C 3LZ1D 1HQ3C 3LJAD 2Y2MA 3LZ0A 4H9PB 1EQZD 1F66B 1H3OB 4X23D 2F8NG 2PYOD 3W98D 5B2JA 3B6FA 5FUGA 1U35C 3AFAD 4Z2MG 5B2JB 5JRGA 5GXQD 4R8PB 5FUGB 3AZGD 2NQBA 3B6FB 4QLCD 5AV6B 2L5AA 4J8VC 5AVCD 3UTAA 1P3GC 2NQBB 5B0ZC 5C3IB 3LZ0D 3UT9A 3UTAB 2JCHA 2FFFB 3AZJA 3V9RA 3UT9B 5CP6A 3AZMA 3AZJB 2G5HC 5JRGD 3V9RB 3MVDB 4Z66C 3WKJA 4KGCA 1S32C 5B1MA 3UTAD 5B40C 3AZHC 3B6GC 4G91B 1KX3C 1ID3C 3NQJA 3TU4C 4CSRA 5BS7A 1P3IB 3AZJD 2ZY5A 5B32B 4WU9D 1M19A 1TZYB 5CP6D 3AV1A 3AZIB 3AZMD 4JJNA 3AYWA 3AV2C 3WKJD 4KGCD 3UTBA 4JJNB 5B1MD 1P3MC 5GT0A 2AROA 5B0YC 5GT3D 5AVBC 1AOIC 2AROB 4CAYA 1M19D 5CPIA 4XUJB 3AV1D 3REKC 3AYWD 4CAYB 3X1SC 3LZ1C 3LJAC 3C1BB 3UTBD 1EQZC 2NZDD 4Z5TB 5GT0D 4AWLC 4X23C 2PYOC 1KX5B 2F8NH 4WU8A 2RIQA 5CPID 3AFAC 5F99A 2ZM5A 5GXQC 3AZGC 4Z2MH 4QLCC 3REHB 4DRAA 4YS3A 5AVCC 4J8XA 1BFMA 1P3LB 3LZ0C 5DNNA 5B1LA 3MNNA 4WU8D 5AY8A 5AV9D 1M1AB 2F2AC 4J8UB 5F99D 5AV8B 5JRGC 3AZKB 3KFUG 3LELA 5AY8B 5B31B 1ZLAB 5B24A 4YS3D 2Y2IA 3EPKA 4J8XD 1P3PA 4J8VB 3LELB 1A7WA 1M18A 1P3BC 5DNND 3H0LC 5B1LD 3B0DC 3MNND 5BNXA 1M18B 4WU9C 3NQUA 3AZNA 5CP6C 3WTPA 1KU5A 3KWQB 2BYMB 2G5IC 3AZMC 5CPKB 3W99B 3RELA 3AZNB 3WKJC 4KGCC 4H9QA 3O62D 3MGRB 3AL0C 4KUDA 5GSUB 5B1MC 5B24D 4ZUXA 1P3PD 2Y2PA 3A6ND 4KUDB 2Y2LA 3W96B 3REJA 5GT3C 3KXBB 4J8WA 5CPJB 5BS7C 1TAFA 3AZFB 3WA9A 1M19C 4YM6B 3AZND 3REJB 3WTPD 1Q9CA 3AV1C 3AZLA 4ZBJB 1JFIB 3AYWC 3RELD 3VH6T 5BO0B 3KUYA 3REIB 1P3OB 2BG1A 3W97A 3UTBC 2HUEC 3EPJA 4ZUXD 2NZDC 5GT0C 5B33B 4J8WD 1F66A 1H3OA 3WA9D 2HIOA 5CPIC 3AZLD 5DNMB 4UPKA 3AN2A 3R45A 2HIOB 3KUYD 3MGQB 4R8PA 3W97D 1KX4B 3X1TB 5AV6A 4HGAB 1BH9A 3R45B 2IO5B 3VH6W 3AN2B 1P34B 2F8NK 1BH9B 4WU8C 1F66D 2BYKB 4H9OA 1P3AB 5AV9C 5F99C 4H9OB 3B0BA 5B2JD 3B6FD 4YS3C 4R8PD 3MVDA 4J8XC 5BNVB 1P3FA 5AV6D 3AZEB 2NQBD 1P3FB 5DNNC 5B1LC 3MNNC 3VH6A 3MGSB 3VH5W 1P3IA 5B32A 1TZYA 3UT9D 3AZIA 4NFTA 3O62C 4EO5B 5B24C 4LD9A 3MVDD 1B6WA 1P3PC 5AV5A 4WZSB 3A6NC 4LD9B 4XZQB 1Z2CB 4DQYB 2Y2HA 5AV5B 5E5AB 1F1EA 3WTPC 1P3ID 5B32D 3RELC 1TZYD 4XUJA 5BT1D 3AZID 5B2IB 3VH5A 5G49B 4ZUXC 4G92C 2CWEA 4H9SA 3C1BA 4WNNB 4JJND 4NE5A 1P3KA 4J8WC 4Z5TA 2Y2NA 3WA9C 1KX5A 3C1CB 4KHAA 1P3KB 3AZLC 2AROD 2CV5B 4H9RA 3X1UB 3X1VB 4H9NB 4KHAB 4XUJD 3MGPA 3KUYC 3W97C 3W98C 3REHA 3WAAB 4H9RB 3MGPB 2FJ7A 3C1BD 1P3LA 5B32G 4Z5TD 1F66C 2FJ7B 1KX5D 1HQ3B 2YFVA 1M1AA 4J8UA 2YFVB 5B2JC 5AV8A 4R8PC 3AZKA 3B6FC 3REHD 2RVQD 5B31A 1ZLAA 5AV6C 3EPLA 1U35B 2NQBC 4J8VA 1P3LD 5KDMB 4UUZB 5C3IC 2Y2OA 2DF4C 3UTAC 2ZY2A 1P3GB 2DQNC 5B0ZB 3UT9C 3KWQA 2BYMA 5CHLB 5CPKA 3W99A 1M1AD 4J8UD 3AZJC 5AV8D 3AZKD 3MVDC 1N1JA 3H0MC 5AY8D 3MGRA 5B31D 1ZLAD 5GSUA 1N1JB 3LELD 5B40A 4J8VD 2ZY4A 4Z66B 2XD1A 4G91C 3W96A 1S32B 3KXBA 5CPJA 1BH8B 5B40B 3AZFA 1P3IC 1M18D 5B32C 3AZHB 4YM6A 2Y2GA 3B6GB 1TZYC 3W99D 3KWQD 3AZIC 5CPKD 1KX3B 1ID3B 1T3UA 1JFIA 3TU4B 5BO0A 3REIA 1P3OA 3MGRD 5GSUD 4JJNC
chains in the Genus database with same CATH topology
2F8NB 3AV2B 4KUDD 5B33A 3W96D 3KXBD 3P5JB 5CPJD 1P3MB 5B31G 3AZFD 2AROC 4YM6D 3REJD 4XUJC 5B0YB 5DNMA 5AVBB 3REID 1P3OD 3MGQA 3REKA 1AOIB 4WV4B 1KX4A 3X1TA 3C1BC 1P34A 3REKB 4Z5TC 3X1SB 2JE5A 5B33D 1KX5C 3LZ1B 3LJAB 2BYKA 1EQZB 1P3AA 3VH5T 4AWLB 4X23B 2PYOB 3EG5B 5DNMD 3REHC 2RVQC 3AZGA 2HIOD 3IP4C 3A1KA 3MGQD 3REKD 5BNVA 2LY8A 2J8PA 3AFAB 1KX4D 3X1TD 1P3LC 5GXQB 3AZGB 3AZEA 3AN2D 4QLCB 1P34D 2YFWB 5AVCB 3H0RC 3MGSA 3LZ0B 1P3AD 1M1AC 4J8UC 5AV8C 3AZKC 5AY8C 5B31C 1ZLAC 3LELC 5JRGB 3AZED 1P3FD 4XZQA 1P3BA 1M18C 1WWIA 3MGSD 5E5AA 1P3BB 4WU9A 3W99C 1HTAA 3KWQC 5CPKC 3B0DB 3AZNC 5B2IA 2W8SA 3MGRC 4WU9B 5CP6B 5GSUC 5G49A 3AZMB 4WNNA 3WKJB 4KGCB 4KUDC 4LD9D 3W96C 4XZQD 3KXBC 1P3BD 5CPJC 5B1MB 1WWSA 5GT3A 3AZFC 5AV5D 3C1CA 5E5AD 4YM6C 2UWXA 2VQRA 3REJC 3NQJB 4ZBJC 5GT3B 2CV5A 4CSRB 5JA4A 3X1UA 3REIC 4H9NA 3X1VA 1P3OC 5B2ID 1M19B 3WAAA 3AV1B 5JA4B 3AYWB 3B0CT 2NZDA 5B33C 3UTBB 2HUEB 1R4VA 1W2EA 3C1CD 5GT0B 2NZDB 1HQ3A 1P3KD 4NE6A 5DNMC 2CV5D 3X1UD 3X1VD 2HIOC 3MGQC 5CPIB 1KX4C 3X1TC 3WAAD 4HGAC 3AN2C 2IO5C 3MGPD 1P34C 1U35A 5KDMA 4UUZA 3B0CW 1P3AC 1P3GA 2FJ7D 1HQ3D 5B0ZA 4DRBA 5AV9A 3A1IA 4WU8B 4M6BA 2Y2JA 5AV9B 5F99B 3AZEC 1PZRA 1U35D 1P3FC 4YS3B 3KSYA 4Z66A 4J8XB 3MGSC 1S32A 1BH8A 2JSSA 1P3GD 3EPHA 5DNNB 3AZHA 5B0ZD 3B6GA 5B1LB 3MNNB 1ID3A 1KX3A 3TU4A 4EO5C 3FDDA 3O62A 4NE3A 5BT1C 3O62B 4LD9C 2F8NA 1ULYA 4XZQC 3A6NA 5B24B 4WJ3C 3AV2A 4Z66D 1B67A 3F6TA 5AV5C 1P3PB 1S32D 5E5AC 3A6NB 1P3MA 5B40D 3AZHD 3B6GD 5B0YA 5BNXB 5B2IC 4E45A 1KX3D 1ID3D 3NQUB 5AVBA 3TU4D 3WTPB 2ZY3A 1AOIA 3RELB 4E44A 4H9QB 2Y2QA 2F8ND 3X1SA 3AV2D 4H9SC 4ZUXB 3LZ1A 3C1CC 4G92B 3LJAA 3WTPE 1P3KC 1P3MD 1EQZA 4J8WB 2CV5C 3X1UC 3X1VC 4X23A 1TAFB 2PYOA 3WA9B 5B0YD 2Y2KA 3W98A 5AVBD 3WAAC 2XD5A 3AZLB 1AOID 3MGPC 3AFAA 3W98B 3KUYB 5GXQA 3W97B 4QLCA 2YFWA 4H9PA 3X1SD 5AVCA 2FJ7C 3LZ1D 1HQ3C 3LJAD 2Y2MA 3LZ0A 4H9PB 1EQZD 1F66B 1H3OB 4X23D 2F8NG 2PYOD 3W98D 5B2JA 3B6FA 5FUGA 1U35C 3AFAD 4Z2MG 5B2JB 5JRGA 5GXQD 4R8PB 5FUGB 3AZGD 2NQBA 3B6FB 4QLCD 5AV6B 2L5AA 4J8VC 5AVCD 3UTAA 1P3GC 2NQBB 5B0ZC 5C3IB 3LZ0D 3UT9A 3UTAB 2JCHA 2FFFB 3AZJA 3V9RA 3UT9B 5CP6A 3AZMA 3AZJB 2G5HC 5JRGD 3V9RB 3MVDB 4Z66C 3WKJA 4KGCA 1S32C 5B1MA 3UTAD 5B40C 3AZHC 3B6GC 4G91B 1KX3C 1ID3C 3NQJA 3TU4C 4CSRA 5BS7A 1P3IB 3AZJD 2ZY5A 5B32B 4WU9D 1M19A 1TZYB 5CP6D 3AV1A 3AZIB 3AZMD 4JJNA 3AYWA 3AV2C 3WKJD 4KGCD 3UTBA 4JJNB 5B1MD 1P3MC 5GT0A 2AROA 5B0YC 5GT3D 5AVBC 1AOIC 2AROB 4CAYA 1M19D 5CPIA 4XUJB 3AV1D 3REKC 3AYWD 4CAYB 3X1SC 3LZ1C 3LJAC 3C1BB 3UTBD 1EQZC 2NZDD 4Z5TB 5GT0D 4AWLC 4X23C 2PYOC 1KX5B 2F8NH 4WU8A 2RIQA 5CPID 3AFAC 5F99A 2ZM5A 5GXQC 3AZGC 4Z2MH 4QLCC 3REHB 4DRAA 4YS3A 5AVCC 4J8XA 1BFMA 1P3LB 3LZ0C 5DNNA 5B1LA 3MNNA 4WU8D 5AY8A 5AV9D 1M1AB 2F2AC 4J8UB 5F99D 5AV8B 5JRGC 3AZKB 3KFUG 3LELA 5AY8B 5B31B 1ZLAB 5B24A 4YS3D 2Y2IA 3EPKA 4J8XD 1P3PA 4J8VB 3LELB 1A7WA 1M18A 1P3BC 5DNND 3H0LC 5B1LD 3B0DC 3MNND 5BNXA 1M18B 4WU9C 3NQUA 3AZNA 5CP6C 3WTPA 1KU5A 3KWQB 2BYMB 2G5IC 3AZMC 5CPKB 3W99B 3RELA 3AZNB 3WKJC 4KGCC 4H9QA 3O62D 3MGRB 3AL0C 4KUDA 5GSUB 5B1MC 5B24D 4ZUXA 1P3PD 2Y2PA 3A6ND 4KUDB 2Y2LA 3W96B 3REJA 5GT3C 3KXBB 4J8WA 5CPJB 5BS7C 1TAFA 3AZFB 3WA9A 1M19C 4YM6B 3AZND 3REJB 3WTPD 1Q9CA 3AV1C 3AZLA 4ZBJB 1JFIB 3AYWC 3RELD 3VH6T 5BO0B 3KUYA 3REIB 1P3OB 2BG1A 3W97A 3UTBC 2HUEC 3EPJA 4ZUXD 2NZDC 5GT0C 5B33B 4J8WD 1F66A 1H3OA 3WA9D 2HIOA 5CPIC 3AZLD 5DNMB 4UPKA 3AN2A 3R45A 2HIOB 3KUYD 3MGQB 4R8PA 3W97D 1KX4B 3X1TB 5AV6A 4HGAB 1BH9A 3R45B 2IO5B 3VH6W 3AN2B 1P34B 2F8NK 1BH9B 4WU8C 1F66D 2BYKB 4H9OA 1P3AB 5AV9C 5F99C 4H9OB 3B0BA 5B2JD 3B6FD 4YS3C 4R8PD 3MVDA 4J8XC 5BNVB 1P3FA 5AV6D 3AZEB 2NQBD 1P3FB 5DNNC 5B1LC 3MNNC 3VH6A 3MGSB 3VH5W 1P3IA 5B32A 1TZYA 3UT9D 3AZIA 4NFTA 3O62C 4EO5B 5B24C 4LD9A 3MVDD 1B6WA 1P3PC 5AV5A 4WZSB 3A6NC 4LD9B 4XZQB 1Z2CB 4DQYB 2Y2HA 5AV5B 5E5AB 1F1EA 3WTPC 1P3ID 5B32D 3RELC 1TZYD 4XUJA 5BT1D 3AZID 5B2IB 3VH5A 5G49B 4ZUXC 4G92C 2CWEA 4H9SA 3C1BA 4WNNB 4JJND 4NE5A 1P3KA 4J8WC 4Z5TA 2Y2NA 3WA9C 1KX5A 3C1CB 4KHAA 1P3KB 3AZLC 2AROD 2CV5B 4H9RA 3X1UB 3X1VB 4H9NB 4KHAB 4XUJD 3MGPA 3KUYC 3W97C 3W98C 3REHA 3WAAB 4H9RB 3MGPB 2FJ7A 3C1BD 1P3LA 5B32G 4Z5TD 1F66C 2FJ7B 1KX5D 1HQ3B 2YFVA 1M1AA 4J8UA 2YFVB 5B2JC 5AV8A 4R8PC 3AZKA 3B6FC 3REHD 2RVQD 5B31A 1ZLAA 5AV6C 3EPLA 1U35B 2NQBC 4J8VA 1P3LD 5KDMB 4UUZB 5C3IC 2Y2OA 2DF4C 3UTAC 2ZY2A 1P3GB 2DQNC 5B0ZB 3UT9C 3KWQA 2BYMA 5CHLB 5CPKA 3W99A 1M1AD 4J8UD 3AZJC 5AV8D 3AZKD 3MVDC 1N1JA 3H0MC 5AY8D 3MGRA 5B31D 1ZLAD 5GSUA 1N1JB 3LELD 5B40A 4J8VD 2ZY4A 4Z66B 2XD1A 4G91C 3W96A 1S32B 3KXBA 5CPJA 1BH8B 5B40B 3AZFA 1P3IC 1M18D 5B32C 3AZHB 4YM6A 2Y2GA 3B6GB 1TZYC 3W99D 3KWQD 3AZIC 5CPKD 1KX3B 1ID3B 1T3UA 1JFIA 3TU4B 5BO0A 3REIA 1P3OA 3MGRD 5GSUD 4JJNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8N B;  3AV2 B;  4KUD D;  5B33 A;  3W96 D;  3KXB D;  5CPJ D;  1P3M B;  5B31 G;  3AZF D;  2ARO C;  4YM6 D;  3REJ D;  4XUJ C;  5B0Y B;  5DNM A;  5AVB B;  3REI D;  1P3O D;  3MGQ A;  3REK A;  1AOI B;  4WV4 B;  1KX4 A;  3X1T A;  3C1B C;  1P34 A;  3REK B;  4Z5T C;  3X1S B;  5B33 D;  1KX5 C;  3LZ1 B;  3LJA B;  2BYK A;  1EQZ B;  1P3A A;  3VH5 T;  4AWL B;  4X23 B;  2PYO B;  5DNM D;  3REH C;  2RVQ C;  3AZG A;  2HIO D;  3MGQ D;  3REK D;  5BNV A;  2LY8 A;  3AFA B;  1KX4 D;  3X1T D;  1P3L C;  5GXQ B;  3AZG B;  3AZE A;  3AN2 D;  4QLC B;  1P34 D;  2YFW B;  5AVC B;  3MGS A;  3LZ0 B;  1P3A D;  1M1A C;  4J8U C;  5AV8 C;  3AZK C;  5AY8 C;  5B31 C;  1ZLA C;  3LEL C;  5JRG B;  3AZE D;  1P3F D;  4XZQ A;  1P3B A;  1M18 C;  1WWI A;  3MGS D;  5E5A A;  1P3B B;  4WU9 A;  3W99 C;  1HTA A;  3KWQ C;  5CPK C;  3B0D B;  3AZN C;  5B2I A;  3MGR C;  4WU9 B;  5CP6 B;  5GSU C;  5G49 A;  3AZM B;  4WNN A;  3WKJ B;  4KGC B;  4KUD C;  4LD9 D;  3W96 C;  4XZQ D;  3KXB C;  1P3B D;  5CPJ C;  5B1M B;  1WWS A;  5GT3 A;  3AZF C;  5AV5 D;  3C1C A;  5E5A D;  4YM6 C;  3REJ C;  3NQJ B;  4ZBJ C;  5GT3 B;  2CV5 A;  4CSR B;  3X1U A;  5JA4 A;  3REI C;  4H9N A;  3X1V A;  1P3O C;  5B2I D;  1M19 B;  3WAA A;  3AV1 B;  5JA4 B;  3AYW B;  3B0C T;  2NZD A;  5B33 C;  3UTB B;  2HUE B;  1R4V A;  3C1C D;  5GT0 B;  2NZD B;  1HQ3 A;  1P3K D;  4NE6 A;  5DNM C;  2CV5 D;  3X1U D;  3X1V D;  2HIO C;  3MGQ C;  5CPI B;  1KX4 C;  3X1T C;  3WAA D;  4HGA C;  3AN2 C;  2IO5 C;  3MGP D;  1P34 C;  1U35 A;  5KDM A;  4UUZ A;  3B0C W;  1P3A C;  1P3G A;  2FJ7 D;  1HQ3 D;  5B0Z A;  5AV9 A;  4DRB A;  4WU8 B;  4M6B A;  5AV9 B;  5F99 B;  3AZE C;  1U35 D;  1P3F C;  4YS3 B;  3KSY A;  4Z66 A;  4J8X B;  3MGS C;  1S32 A;  1BH8 A;  2JSS A;  1P3G D;  5DNN B;  3AZH A;  5B0Z D;  3B6G A;  5B1L B;  3MNN B;  1ID3 A;  1KX3 A;  3TU4 A;  4EO5 C;  3O62 A;  4NE3 A;  5BT1 C;  3O62 B;  4LD9 C;  2F8N A;  1ULY A;  4XZQ C;  3A6N A;  5B24 B;  3AV2 A;  4Z66 D;  1B67 A;  5AV5 C;  1P3P B;  1S32 D;  5E5A C;  3A6N B;  1P3M A;  5B40 D;  3AZH D;  3B6G D;  5B0Y A;  5BNX B;  5B2I C;  4E45 A;  1KX3 D;  1ID3 D;  3NQU B;  5AVB A;  3TU4 D;  3WTP B;  1AOI A;  3REL B;  4E44 A;  4H9Q B;  2F8N D;  3X1S A;  3AV2 D;  4H9S C;  4ZUX B;  3LZ1 A;  3C1C C;  4G92 B;  3LJA A;  3WTP E;  1P3K C;  1P3M D;  1EQZ A;  4J8W B;  2CV5 C;  3X1U C;  3X1V C;  4X23 A;  1TAF B;  2PYO A;  3WA9 B;  5B0Y D;  3W98 A;  5AVB D;  3WAA C;  3AZL B;  1AOI D;  3MGP C;  3AFA A;  3W98 B;  3KUY B;  5GXQ A;  3W97 B;  4QLC A;  2YFW A;  4H9P A;  3X1S D;  5AVC A;  2FJ7 C;  3LZ1 D;  1HQ3 C;  3LJA D;  3LZ0 A;  4H9P B;  1EQZ D;  1F66 B;  1H3O B;  4X23 D;  2F8N G;  2PYO D;  3W98 D;  5B2J A;  3B6F A;  5FUG A;  1U35 C;  3AFA D;  4Z2M G;  5B2J B;  5JRG A;  4R8P B;  5GXQ D;  5FUG B;  3AZG D;  2NQB A;  3B6F B;  4QLC D;  5AV6 B;  2L5A A;  4J8V C;  5AVC D;  3UTA A;  1P3G C;  2NQB B;  5B0Z C;  5C3I B;  3LZ0 D;  3UT9 A;  3UTA B;  3AZJ A;  3V9R A;  3UT9 B;  5CP6 A;  3AZM A;  3AZJ B;  5JRG D;  3V9R B;  3MVD B;  4Z66 C;  3WKJ A;  4KGC A;  1S32 C;  5B1M A;  3UTA D;  5B40 C;  3AZH C;  3B6G C;  4G91 B;  1KX3 C;  1ID3 C;  3NQJ A;  3TU4 C;  4CSR A;  5BS7 A;  1P3I B;  3AZJ D;  5B32 B;  4WU9 D;  1M19 A;  1TZY B;  5CP6 D;  3AV1 A;  3AZI B;  3AZM D;  4JJN A;  3AYW A;  3AV2 C;  3WKJ D;  4KGC D;  3UTB A;  4JJN B;  5B1M D;  1P3M C;  5GT0 A;  2ARO A;  5B0Y C;  5GT3 D;  5AVB C;  1AOI C;  2ARO B;  4CAY A;  1M19 D;  5CPI A;  4XUJ B;  3AV1 D;  3REK C;  3AYW D;  4CAY B;  3X1S C;  3LZ1 C;  3LJA C;  3C1B B;  3UTB D;  1EQZ C;  2NZD D;  4Z5T B;  5GT0 D;  4AWL C;  4X23 C;  2PYO C;  1KX5 B;  2F8N H;  4WU8 A;  5CPI D;  3AFA C;  5F99 A;  5GXQ C;  3AZG C;  4Z2M H;  4QLC C;  3REH B;  4DRA A;  4YS3 A;  5AVC C;  4J8X A;  1BFM A;  1P3L B;  3LZ0 C;  5DNN A;  5B1L A;  3MNN A;  4WU8 D;  5AY8 A;  5AV9 D;  1M1A B;  4J8U B;  5F99 D;  5AV8 B;  5JRG C;  3AZK B;  3LEL A;  5AY8 B;  5B31 B;  1ZLA B;  5B24 A;  4YS3 D;  4J8X D;  1P3P A;  4J8V B;  3LEL B;  1A7W A;  1M18 A;  1P3B C;  5DNN D;  5B1L D;  3B0D C;  3MNN D;  5BNX A;  1M18 B;  4WU9 C;  3NQU A;  3AZN A;  5CP6 C;  3WTP A;  1KU5 A;  3KWQ B;  2BYM B;  3AZM C;  5CPK B;  3W99 B;  3REL A;  3AZN B;  3WKJ C;  4KGC C;  4H9Q A;  3O62 D;  3MGR B;  4KUD A;  5GSU B;  5B1M C;  5B24 D;  4ZUX A;  1P3P D;  3A6N D;  4KUD B;  3W96 B;  3REJ A;  5GT3 C;  3KXB B;  4J8W A;  5CPJ B;  5BS7 C;  1TAF A;  3AZF B;  3WA9 A;  1M19 C;  4YM6 B;  3AZN D;  3REJ B;  3WTP D;  1Q9C A;  3AV1 C;  3AZL A;  4ZBJ B;  1JFI B;  3AYW C;  3REL D;  3VH6 T;  5BO0 B;  3KUY A;  3REI B;  1P3O B;  3W97 A;  3UTB C;  2HUE C;  4ZUX D;  2NZD C;  5GT0 C;  5B33 B;  4J8W D;  1F66 A;  1H3O A;  3WA9 D;  2HIO A;  5CPI C;  3AZL D;  5DNM B;  3AN2 A;  3R45 A;  2HIO B;  3KUY D;  3MGQ B;  4R8P A;  3W97 D;  1KX4 B;  3X1T B;  5AV6 A;  4HGA B;  1BH9 A;  3R45 B;  2IO5 B;  3VH6 W;  3AN2 B;  1P34 B;  2F8N K;  1BH9 B;  4WU8 C;  1F66 D;  2BYK B;  4H9O A;  1P3A B;  5AV9 C;  5F99 C;  4H9O B;  3B0B A;  5B2J D;  3B6F D;  4YS3 C;  4R8P D;  3MVD A;  4J8X C;  5BNV B;  1P3F A;  5AV6 D;  3AZE B;  2NQB D;  1P3F B;  5DNN C;  5B1L C;  3MNN C;  3VH6 A;  3MGS B;  3VH5 W;  1P3I A;  5B32 A;  1TZY A;  3UT9 D;  3AZI A;  4NFT A;  3O62 C;  4EO5 B;  5B24 C;  4LD9 A;  3MVD D;  1B6W A;  1P3P C;  5AV5 A;  4WZS B;  3A6N C;  4LD9 B;  4XZQ B;  5AV5 B;  5E5A B;  1F1E A;  3WTP C;  1P3I D;  5B32 D;  3REL C;  1TZY D;  4XUJ A;  5BT1 D;  3AZI D;  5B2I B;  3VH5 A;  5G49 B;  4ZUX C;  4G92 C;  2CWE A;  4H9S A;  3C1B A;  4WNN B;  4JJN D;  4NE5 A;  1P3K A;  4J8W C;  4Z5T A;  3WA9 C;  1KX5 A;  3C1C B;  4KHA A;  1P3K B;  3AZL C;  2ARO D;  2CV5 B;  4H9R A;  3X1U B;  3X1V B;  4H9N B;  4KHA B;  4XUJ D;  3MGP A;  3KUY C;  3W97 C;  3W98 C;  3REH A;  3WAA B;  4H9R B;  3MGP B;  2FJ7 A;  3C1B D;  1P3L A;  5B32 G;  4Z5T D;  1F66 C;  2FJ7 B;  1KX5 D;  1HQ3 B;  2YFV A;  1M1A A;  4J8U A;  2YFV B;  5B2J C;  5AV8 A;  4R8P C;  3AZK A;  3B6F C;  3REH D;  2RVQ D;  5B31 A;  1ZLA A;  5AV6 C;  2NQB C;  1U35 B;  4J8V A;  1P3L D;  5KDM B;  4UUZ B;  5C3I C;  3UTA C;  1P3G B;  5B0Z B;  3UT9 C;  3KWQ A;  2BYM A;  5CHL B;  5CPK A;  3W99 A;  1M1A D;  4J8U D;  3AZJ C;  5AV8 D;  3AZK D;  3MVD C;  1N1J A;  5AY8 D;  3MGR A;  5B31 D;  1ZLA D;  5GSU A;  1N1J B;  3LEL D;  5B40 A;  4J8V D;  4Z66 B;  4G91 C;  3W96 A;  1S32 B;  3KXB A;  5CPJ A;  1BH8 B;  5B40 B;  3AZF A;  1P3I C;  1M18 D;  5B32 C;  3AZH B;  4YM6 A;  3B6G B;  1TZY C;  3W99 D;  3KWQ D;  3AZI C;  5CPK D;  1KX3 B;  1ID3 B;  1JFI A;  3TU4 B;  5BO0 A;  3REI A;  1P3O A;  3MGR D;  5GSU D;  4JJN C; 
#chains in the Genus database with same CATH topology
 2F8N B;  3AV2 B;  4KUD D;  5B33 A;  3W96 D;  3KXB D;  3P5J B;  5CPJ D;  1P3M B;  5B31 G;  3AZF D;  2ARO C;  4YM6 D;  3REJ D;  4XUJ C;  5B0Y B;  5DNM A;  5AVB B;  3REI D;  1P3O D;  3MGQ A;  3REK A;  1AOI B;  4WV4 B;  1KX4 A;  3X1T A;  3C1B C;  1P34 A;  3REK B;  4Z5T C;  3X1S B;  2JE5 A;  5B33 D;  1KX5 C;  3LZ1 B;  3LJA B;  2BYK A;  1EQZ B;  1P3A A;  3VH5 T;  4AWL B;  4X23 B;  2PYO B;  3EG5 B;  5DNM D;  3REH C;  2RVQ C;  3AZG A;  2HIO D;  3IP4 C;  3A1K A;  3MGQ D;  3REK D;  5BNV A;  2LY8 A;  2J8P A;  3AFA B;  1KX4 D;  3X1T D;  1P3L C;  5GXQ B;  3AZG B;  3AZE A;  3AN2 D;  4QLC B;  1P34 D;  2YFW B;  5AVC B;  3H0R C;  3MGS A;  3LZ0 B;  1P3A D;  1M1A C;  4J8U C;  5AV8 C;  3AZK C;  5AY8 C;  5B31 C;  1ZLA C;  3LEL C;  5JRG B;  3AZE D;  1P3F D;  4XZQ A;  1P3B A;  1M18 C;  1WWI A;  3MGS D;  5E5A A;  1P3B B;  4WU9 A;  3W99 C;  1HTA A;  3KWQ C;  5CPK C;  3B0D B;  3AZN C;  5B2I A;  2W8S A;  3MGR C;  4WU9 B;  5CP6 B;  5GSU C;  5G49 A;  3AZM B;  4WNN A;  3WKJ B;  4KGC B;  4KUD C;  4LD9 D;  3W96 C;  4XZQ D;  3KXB C;  1P3B D;  5CPJ C;  5B1M B;  1WWS A;  5GT3 A;  3AZF C;  5AV5 D;  3C1C A;  5E5A D;  4YM6 C;  2UWX A;  2VQR A;  3REJ C;  3NQJ B;  4ZBJ C;  5GT3 B;  2CV5 A;  4CSR B;  5JA4 A;  3X1U A;  3REI C;  4H9N A;  3X1V A;  1P3O C;  5B2I D;  1M19 B;  3WAA A;  3AV1 B;  5JA4 B;  3AYW B;  3B0C T;  2NZD A;  5B33 C;  3UTB B;  2HUE B;  1R4V A;  1W2E A;  3C1C D;  5GT0 B;  2NZD B;  1HQ3 A;  1P3K D;  4NE6 A;  5DNM C;  2CV5 D;  3X1U D;  3X1V D;  2HIO C;  3MGQ C;  5CPI B;  1KX4 C;  3X1T C;  3WAA D;  4HGA C;  3AN2 C;  2IO5 C;  3MGP D;  1P34 C;  1U35 A;  5KDM A;  4UUZ A;  3B0C W;  1P3A C;  1P3G A;  2FJ7 D;  1HQ3 D;  5B0Z A;  4DRB A;  5AV9 A;  3A1I A;  4WU8 B;  4M6B A;  2Y2J A;  5AV9 B;  5F99 B;  3AZE C;  1PZR A;  1U35 D;  1P3F C;  4YS3 B;  3KSY A;  4Z66 A;  4J8X B;  3MGS C;  1S32 A;  1BH8 A;  2JSS A;  1P3G D;  3EPH A;  5DNN B;  3AZH A;  5B0Z D;  3B6G A;  5B1L B;  3MNN B;  1ID3 A;  1KX3 A;  3TU4 A;  4EO5 C;  3FDD A;  3O62 A;  4NE3 A;  5BT1 C;  3O62 B;  4LD9 C;  2F8N A;  1ULY A;  4XZQ C;  3A6N A;  5B24 B;  4WJ3 C;  3AV2 A;  4Z66 D;  1B67 A;  3F6T A;  5AV5 C;  1P3P B;  1S32 D;  5E5A C;  3A6N B;  1P3M A;  5B40 D;  3AZH D;  3B6G D;  5B0Y A;  5BNX B;  5B2I C;  4E45 A;  1KX3 D;  1ID3 D;  3NQU B;  5AVB A;  3TU4 D;  3WTP B;  2ZY3 A;  1AOI A;  3REL B;  4E44 A;  4H9Q B;  2Y2Q A;  2F8N D;  3X1S A;  3AV2 D;  4H9S C;  4ZUX B;  3LZ1 A;  3C1C C;  4G92 B;  3LJA A;  3WTP E;  1P3K C;  1P3M D;  1EQZ A;  4J8W B;  2CV5 C;  3X1U C;  3X1V C;  4X23 A;  1TAF B;  2PYO A;  3WA9 B;  5B0Y D;  2Y2K A;  3W98 A;  5AVB D;  3WAA C;  2XD5 A;  3AZL B;  1AOI D;  3MGP C;  3AFA A;  3W98 B;  3KUY B;  5GXQ A;  3W97 B;  4QLC A;  2YFW A;  4H9P A;  3X1S D;  5AVC A;  2FJ7 C;  3LZ1 D;  1HQ3 C;  3LJA D;  2Y2M A;  3LZ0 A;  4H9P B;  1EQZ D;  1F66 B;  1H3O B;  4X23 D;  2F8N G;  2PYO D;  3W98 D;  5B2J A;  3B6F A;  5FUG A;  1U35 C;  3AFA D;  4Z2M G;  5B2J B;  5JRG A;  5GXQ D;  4R8P B;  5FUG B;  3AZG D;  2NQB A;  3B6F B;  4QLC D;  5AV6 B;  2L5A A;  4J8V C;  5AVC D;  3UTA A;  1P3G C;  2NQB B;  5B0Z C;  5C3I B;  3LZ0 D;  3UT9 A;  3UTA B;  2JCH A;  2FFF B;  3AZJ A;  3V9R A;  3UT9 B;  5CP6 A;  3AZM A;  3AZJ B;  2G5H C;  5JRG D;  3V9R B;  3MVD B;  4Z66 C;  3WKJ A;  4KGC A;  1S32 C;  5B1M A;  3UTA D;  5B40 C;  3AZH C;  3B6G C;  4G91 B;  1KX3 C;  1ID3 C;  3NQJ A;  3TU4 C;  4CSR A;  5BS7 A;  1P3I B;  3AZJ D;  2ZY5 A;  5B32 B;  4WU9 D;  1M19 A;  1TZY B;  5CP6 D;  3AV1 A;  3AZI B;  3AZM D;  4JJN A;  3AYW A;  3AV2 C;  3WKJ D;  4KGC D;  3UTB A;  4JJN B;  5B1M D;  1P3M C;  5GT0 A;  2ARO A;  5B0Y C;  5GT3 D;  5AVB C;  1AOI C;  2ARO B;  4CAY A;  1M19 D;  5CPI A;  4XUJ B;  3AV1 D;  3REK C;  3AYW D;  4CAY B;  3X1S C;  3LZ1 C;  3LJA C;  3C1B B;  3UTB D;  1EQZ C;  2NZD D;  4Z5T B;  5GT0 D;  4AWL C;  4X23 C;  2PYO C;  1KX5 B;  2F8N H;  4WU8 A;  2RIQ A;  5CPI D;  3AFA C;  5F99 A;  2ZM5 A;  5GXQ C;  3AZG C;  4Z2M H;  4QLC C;  3REH B;  4DRA A;  4YS3 A;  5AVC C;  4J8X A;  1BFM A;  1P3L B;  3LZ0 C;  5DNN A;  5B1L A;  3MNN A;  4WU8 D;  5AY8 A;  5AV9 D;  1M1A B;  2F2A C;  4J8U B;  5F99 D;  5AV8 B;  5JRG C;  3AZK B;  3KFU G;  3LEL A;  5AY8 B;  5B31 B;  1ZLA B;  5B24 A;  4YS3 D;  2Y2I A;  3EPK A;  4J8X D;  1P3P A;  4J8V B;  3LEL B;  1A7W A;  1M18 A;  1P3B C;  5DNN D;  3H0L C;  5B1L D;  3B0D C;  3MNN D;  5BNX A;  1M18 B;  4WU9 C;  3NQU A;  3AZN A;  5CP6 C;  3WTP A;  1KU5 A;  3KWQ B;  2BYM B;  2G5I C;  3AZM C;  5CPK B;  3W99 B;  3REL A;  3AZN B;  3WKJ C;  4KGC C;  4H9Q A;  3O62 D;  3MGR B;  3AL0 C;  4KUD A;  5GSU B;  5B1M C;  5B24 D;  4ZUX A;  1P3P D;  2Y2P A;  3A6N D;  4KUD B;  2Y2L A;  3W96 B;  3REJ A;  5GT3 C;  3KXB B;  4J8W A;  5CPJ B;  5BS7 C;  1TAF A;  3AZF B;  3WA9 A;  1M19 C;  4YM6 B;  3AZN D;  3REJ B;  3WTP D;  1Q9C A;  3AV1 C;  3AZL A;  4ZBJ B;  1JFI B;  3AYW C;  3REL D;  3VH6 T;  5BO0 B;  3KUY A;  3REI B;  1P3O B;  2BG1 A;  3W97 A;  3UTB C;  2HUE C;  3EPJ A;  4ZUX D;  2NZD C;  5GT0 C;  5B33 B;  4J8W D;  1F66 A;  1H3O A;  3WA9 D;  2HIO A;  5CPI C;  3AZL D;  5DNM B;  4UPK A;  3AN2 A;  3R45 A;  2HIO B;  3KUY D;  3MGQ B;  4R8P A;  3W97 D;  1KX4 B;  3X1T B;  5AV6 A;  4HGA B;  1BH9 A;  3R45 B;  2IO5 B;  3VH6 W;  3AN2 B;  1P34 B;  2F8N K;  1BH9 B;  4WU8 C;  1F66 D;  2BYK B;  4H9O A;  1P3A B;  5AV9 C;  5F99 C;  4H9O B;  3B0B A;  5B2J D;  3B6F D;  4YS3 C;  4R8P D;  3MVD A;  4J8X C;  5BNV B;  1P3F A;  5AV6 D;  3AZE B;  2NQB D;  1P3F B;  5DNN C;  5B1L C;  3MNN C;  3VH6 A;  3MGS B;  3VH5 W;  1P3I A;  5B32 A;  1TZY A;  3UT9 D;  3AZI A;  4NFT A;  3O62 C;  4EO5 B;  5B24 C;  4LD9 A;  3MVD D;  1B6W A;  1P3P C;  5AV5 A;  4WZS B;  3A6N C;  4LD9 B;  4XZQ B;  1Z2C B;  4DQY B;  2Y2H A;  5AV5 B;  5E5A B;  1F1E A;  3WTP C;  1P3I D;  5B32 D;  3REL C;  1TZY D;  4XUJ A;  5BT1 D;  3AZI D;  5B2I B;  3VH5 A;  5G49 B;  4ZUX C;  4G92 C;  2CWE A;  4H9S A;  3C1B A;  4WNN B;  4JJN D;  4NE5 A;  1P3K A;  4J8W C;  4Z5T A;  2Y2N A;  3WA9 C;  1KX5 A;  3C1C B;  4KHA A;  1P3K B;  3AZL C;  2ARO D;  2CV5 B;  4H9R A;  3X1U B;  3X1V B;  4H9N B;  4KHA B;  4XUJ D;  3MGP A;  3KUY C;  3W97 C;  3W98 C;  3REH A;  3WAA B;  4H9R B;  3MGP B;  2FJ7 A;  3C1B D;  1P3L A;  5B32 G;  4Z5T D;  1F66 C;  2FJ7 B;  1KX5 D;  1HQ3 B;  2YFV A;  1M1A A;  4J8U A;  2YFV B;  5B2J C;  5AV8 A;  4R8P C;  3AZK A;  3B6F C;  3REH D;  2RVQ D;  5B31 A;  1ZLA A;  5AV6 C;  3EPL A;  1U35 B;  2NQB C;  4J8V A;  1P3L D;  5KDM B;  4UUZ B;  5C3I C;  2Y2O A;  2DF4 C;  3UTA C;  2ZY2 A;  1P3G B;  2DQN C;  5B0Z B;  3UT9 C;  3KWQ A;  2BYM A;  5CHL B;  5CPK A;  3W99 A;  1M1A D;  4J8U D;  3AZJ C;  5AV8 D;  3AZK D;  3MVD C;  1N1J A;  3H0M C;  5AY8 D;  3MGR A;  5B31 D;  1ZLA D;  5GSU A;  1N1J B;  3LEL D;  5B40 A;  4J8V D;  2ZY4 A;  4Z66 B;  2XD1 A;  4G91 C;  3W96 A;  1S32 B;  3KXB A;  5CPJ A;  1BH8 B;  5B40 B;  3AZF A;  1P3I C;  1M18 D;  5B32 C;  3AZH B;  4YM6 A;  2Y2G A;  3B6G B;  1TZY C;  3W99 D;  3KWQ D;  3AZI C;  5CPK D;  1KX3 B;  1ID3 B;  1T3U A;  1JFI A;  3TU4 B;  5BO0 A;  3REI A;  1P3O A;  3MGR D;  5GSU D;  4JJN C; 
#chains in the Genus database with same CATH homology
 2F8N B;  3AV2 B;  4KUD D;  5B33 A;  3W96 D;  3KXB D;  3P5J B;  5CPJ D;  1P3M B;  5B31 G;  3AZF D;  2ARO C;  4YM6 D;  3REJ D;  4XUJ C;  5B0Y B;  5DNM A;  5AVB B;  3REI D;  1P3O D;  3MGQ A;  3REK A;  1AOI B;  4WV4 B;  1KX4 A;  3X1T A;  3C1B C;  1P34 A;  3REK B;  4Z5T C;  3X1S B;  2JE5 A;  5B33 D;  1KX5 C;  3LZ1 B;  3LJA B;  2BYK A;  1EQZ B;  1P3A A;  3VH5 T;  4AWL B;  4X23 B;  2PYO B;  3EG5 B;  5DNM D;  3REH C;  2RVQ C;  3AZG A;  2HIO D;  3IP4 C;  3A1K A;  3MGQ D;  3REK D;  5BNV A;  2LY8 A;  2J8P A;  3AFA B;  1KX4 D;  3X1T D;  1P3L C;  5GXQ B;  3AZG B;  3AZE A;  3AN2 D;  4QLC B;  1P34 D;  2YFW B;  5AVC B;  3H0R C;  3MGS A;  3LZ0 B;  1P3A D;  1M1A C;  4J8U C;  5AV8 C;  3AZK C;  5AY8 C;  5B31 C;  1ZLA C;  3LEL C;  5JRG B;  3AZE D;  1P3F D;  4XZQ A;  1P3B A;  1M18 C;  1WWI A;  3MGS D;  5E5A A;  1P3B B;  4WU9 A;  3W99 C;  1HTA A;  3KWQ C;  5CPK C;  3B0D B;  3AZN C;  5B2I A;  2W8S A;  3MGR C;  4WU9 B;  5CP6 B;  5GSU C;  5G49 A;  3AZM B;  4WNN A;  3WKJ B;  4KGC B;  4KUD C;  4LD9 D;  3W96 C;  4XZQ D;  3KXB C;  1P3B D;  5CPJ C;  5B1M B;  1WWS A;  5GT3 A;  3AZF C;  5AV5 D;  3C1C A;  5E5A D;  4YM6 C;  2UWX A;  2VQR A;  3REJ C;  3NQJ B;  4ZBJ C;  5GT3 B;  2CV5 A;  4CSR B;  5JA4 A;  3X1U A;  3REI C;  4H9N A;  3X1V A;  1P3O C;  5B2I D;  1M19 B;  3WAA A;  3AV1 B;  5JA4 B;  3AYW B;  3B0C T;  2NZD A;  5B33 C;  3UTB B;  2HUE B;  1R4V A;  1W2E A;  3C1C D;  5GT0 B;  2NZD B;  1HQ3 A;  1P3K D;  4NE6 A;  5DNM C;  2CV5 D;  3X1U D;  3X1V D;  2HIO C;  3MGQ C;  5CPI B;  1KX4 C;  3X1T C;  3WAA D;  4HGA C;  3AN2 C;  2IO5 C;  3MGP D;  1P34 C;  1U35 A;  5KDM A;  4UUZ A;  3B0C W;  1P3A C;  1P3G A;  2FJ7 D;  1HQ3 D;  5B0Z A;  4DRB A;  5AV9 A;  3A1I A;  4WU8 B;  4M6B A;  2Y2J A;  5AV9 B;  5F99 B;  3AZE C;  1PZR A;  1U35 D;  1P3F C;  4YS3 B;  3KSY A;  4Z66 A;  4J8X B;  3MGS C;  1S32 A;  1BH8 A;  2JSS A;  1P3G D;  3EPH A;  5DNN B;  3AZH A;  5B0Z D;  3B6G A;  5B1L B;  3MNN B;  1ID3 A;  1KX3 A;  3TU4 A;  4EO5 C;  3FDD A;  3O62 A;  4NE3 A;  5BT1 C;  3O62 B;  4LD9 C;  2F8N A;  1ULY A;  4XZQ C;  3A6N A;  5B24 B;  4WJ3 C;  3AV2 A;  4Z66 D;  1B67 A;  3F6T A;  5AV5 C;  1P3P B;  1S32 D;  5E5A C;  3A6N B;  1P3M A;  5B40 D;  3AZH D;  3B6G D;  5B0Y A;  5BNX B;  5B2I C;  4E45 A;  1KX3 D;  1ID3 D;  3NQU B;  5AVB A;  3TU4 D;  3WTP B;  2ZY3 A;  1AOI A;  3REL B;  4E44 A;  4H9Q B;  2Y2Q A;  2F8N D;  3X1S A;  3AV2 D;  4H9S C;  4ZUX B;  3LZ1 A;  3C1C C;  4G92 B;  3LJA A;  3WTP E;  1P3K C;  1P3M D;  1EQZ A;  4J8W B;  2CV5 C;  3X1U C;  3X1V C;  4X23 A;  1TAF B;  2PYO A;  3WA9 B;  5B0Y D;  2Y2K A;  3W98 A;  5AVB D;  3WAA C;  2XD5 A;  3AZL B;  1AOI D;  3MGP C;  3AFA A;  3W98 B;  3KUY B;  5GXQ A;  3W97 B;  4QLC A;  2YFW A;  4H9P A;  3X1S D;  5AVC A;  2FJ7 C;  3LZ1 D;  1HQ3 C;  3LJA D;  2Y2M A;  3LZ0 A;  4H9P B;  1EQZ D;  1F66 B;  1H3O B;  4X23 D;  2F8N G;  2PYO D;  3W98 D;  5B2J A;  3B6F A;  5FUG A;  1U35 C;  3AFA D;  4Z2M G;  5B2J B;  5JRG A;  5GXQ D;  4R8P B;  5FUG B;  3AZG D;  2NQB A;  3B6F B;  4QLC D;  5AV6 B;  2L5A A;  4J8V C;  5AVC D;  3UTA A;  1P3G C;  2NQB B;  5B0Z C;  5C3I B;  3LZ0 D;  3UT9 A;  3UTA B;  2JCH A;  2FFF B;  3AZJ A;  3V9R A;  3UT9 B;  5CP6 A;  3AZM A;  3AZJ B;  2G5H C;  5JRG D;  3V9R B;  3MVD B;  4Z66 C;  3WKJ A;  4KGC A;  1S32 C;  5B1M A;  3UTA D;  5B40 C;  3AZH C;  3B6G C;  4G91 B;  1KX3 C;  1ID3 C;  3NQJ A;  3TU4 C;  4CSR A;  5BS7 A;  1P3I B;  3AZJ D;  2ZY5 A;  5B32 B;  4WU9 D;  1M19 A;  1TZY B;  5CP6 D;  3AV1 A;  3AZI B;  3AZM D;  4JJN A;  3AYW A;  3AV2 C;  3WKJ D;  4KGC D;  3UTB A;  4JJN B;  5B1M D;  1P3M C;  5GT0 A;  2ARO A;  5B0Y C;  5GT3 D;  5AVB C;  1AOI C;  2ARO B;  4CAY A;  1M19 D;  5CPI A;  4XUJ B;  3AV1 D;  3REK C;  3AYW D;  4CAY B;  3X1S C;  3LZ1 C;  3LJA C;  3C1B B;  3UTB D;  1EQZ C;  2NZD D;  4Z5T B;  5GT0 D;  4AWL C;  4X23 C;  2PYO C;  1KX5 B;  2F8N H;  4WU8 A;  2RIQ A;  5CPI D;  3AFA C;  5F99 A;  2ZM5 A;  5GXQ C;  3AZG C;  4Z2M H;  4QLC C;  3REH B;  4DRA A;  4YS3 A;  5AVC C;  4J8X A;  1BFM A;  1P3L B;  3LZ0 C;  5DNN A;  5B1L A;  3MNN A;  4WU8 D;  5AY8 A;  5AV9 D;  1M1A B;  2F2A C;  4J8U B;  5F99 D;  5AV8 B;  5JRG C;  3AZK B;  3KFU G;  3LEL A;  5AY8 B;  5B31 B;  1ZLA B;  5B24 A;  4YS3 D;  2Y2I A;  3EPK A;  4J8X D;  1P3P A;  4J8V B;  3LEL B;  1A7W A;  1M18 A;  1P3B C;  5DNN D;  3H0L C;  5B1L D;  3B0D C;  3MNN D;  5BNX A;  1M18 B;  4WU9 C;  3NQU A;  3AZN A;  5CP6 C;  3WTP A;  1KU5 A;  3KWQ B;  2BYM B;  2G5I C;  3AZM C;  5CPK B;  3W99 B;  3REL A;  3AZN B;  3WKJ C;  4KGC C;  4H9Q A;  3O62 D;  3MGR B;  3AL0 C;  4KUD A;  5GSU B;  5B1M C;  5B24 D;  4ZUX A;  1P3P D;  2Y2P A;  3A6N D;  4KUD B;  2Y2L A;  3W96 B;  3REJ A;  5GT3 C;  3KXB B;  4J8W A;  5CPJ B;  5BS7 C;  1TAF A;  3AZF B;  3WA9 A;  1M19 C;  4YM6 B;  3AZN D;  3REJ B;  3WTP D;  1Q9C A;  3AV1 C;  3AZL A;  4ZBJ B;  1JFI B;  3AYW C;  3REL D;  3VH6 T;  5BO0 B;  3KUY A;  3REI B;  1P3O B;  2BG1 A;  3W97 A;  3UTB C;  2HUE C;  3EPJ A;  4ZUX D;  2NZD C;  5GT0 C;  5B33 B;  4J8W D;  1F66 A;  1H3O A;  3WA9 D;  2HIO A;  5CPI C;  3AZL D;  5DNM B;  4UPK A;  3AN2 A;  3R45 A;  2HIO B;  3KUY D;  3MGQ B;  4R8P A;  3W97 D;  1KX4 B;  3X1T B;  5AV6 A;  4HGA B;  1BH9 A;  3R45 B;  2IO5 B;  3VH6 W;  3AN2 B;  1P34 B;  2F8N K;  1BH9 B;  4WU8 C;  1F66 D;  2BYK B;  4H9O A;  1P3A B;  5AV9 C;  5F99 C;  4H9O B;  3B0B A;  5B2J D;  3B6F D;  4YS3 C;  4R8P D;  3MVD A;  4J8X C;  5BNV B;  1P3F A;  5AV6 D;  3AZE B;  2NQB D;  1P3F B;  5DNN C;  5B1L C;  3MNN C;  3VH6 A;  3MGS B;  3VH5 W;  1P3I A;  5B32 A;  1TZY A;  3UT9 D;  3AZI A;  4NFT A;  3O62 C;  4EO5 B;  5B24 C;  4LD9 A;  3MVD D;  1B6W A;  1P3P C;  5AV5 A;  4WZS B;  3A6N C;  4LD9 B;  4XZQ B;  1Z2C B;  4DQY B;  2Y2H A;  5AV5 B;  5E5A B;  1F1E A;  3WTP C;  1P3I D;  5B32 D;  3REL C;  1TZY D;  4XUJ A;  5BT1 D;  3AZI D;  5B2I B;  3VH5 A;  5G49 B;  4ZUX C;  4G92 C;  2CWE A;  4H9S A;  3C1B A;  4WNN B;  4JJN D;  4NE5 A;  1P3K A;  4J8W C;  4Z5T A;  2Y2N A;  3WA9 C;  1KX5 A;  3C1C B;  4KHA A;  1P3K B;  3AZL C;  2ARO D;  2CV5 B;  4H9R A;  3X1U B;  3X1V B;  4H9N B;  4KHA B;  4XUJ D;  3MGP A;  3KUY C;  3W97 C;  3W98 C;  3REH A;  3WAA B;  4H9R B;  3MGP B;  2FJ7 A;  3C1B D;  1P3L A;  5B32 G;  4Z5T D;  1F66 C;  2FJ7 B;  1KX5 D;  1HQ3 B;  2YFV A;  1M1A A;  4J8U A;  2YFV B;  5B2J C;  5AV8 A;  4R8P C;  3AZK A;  3B6F C;  3REH D;  2RVQ D;  5B31 A;  1ZLA A;  5AV6 C;  3EPL A;  1U35 B;  2NQB C;  4J8V A;  1P3L D;  5KDM B;  4UUZ B;  5C3I C;  2Y2O A;  2DF4 C;  3UTA C;  2ZY2 A;  1P3G B;  2DQN C;  5B0Z B;  3UT9 C;  3KWQ A;  2BYM A;  5CHL B;  5CPK A;  3W99 A;  1M1A D;  4J8U D;  3AZJ C;  5AV8 D;  3AZK D;  3MVD C;  1N1J A;  3H0M C;  5AY8 D;  3MGR A;  5B31 D;  1ZLA D;  5GSU A;  1N1J B;  3LEL D;  5B40 A;  4J8V D;  2ZY4 A;  4Z66 B;  2XD1 A;  4G91 C;  3W96 A;  1S32 B;  3KXB A;  5CPJ A;  1BH8 B;  5B40 B;  3AZF A;  1P3I C;  1M18 D;  5B32 C;  3AZH B;  4YM6 A;  2Y2G A;  3B6G B;  1TZY C;  3W99 D;  3KWQ D;  3AZI C;  5CPK D;  1KX3 B;  1ID3 B;  1T3U A;  1JFI A;  3TU4 B;  5BO0 A;  3REI A;  1P3O A;  3MGR D;  5GSU D;  4JJN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...