4KUDA

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
96
structure length
96
Chain Sequence
PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/transcription/dna
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kudA00
3AZFB 3REJA 1M1AD 3MGSC 1AOIC 3KXBC 1P3FC 1KX4D 3X1SC 2NQBD 5B1LD 3AZMB 4LD9D 3X1UC 4R8PD 4XUJD 4J8UA 3X1TC 2NZDA 3MGRB 3UT9B 2F8NK 1P3IA 1H3OB 4G92B 3B6GA 3W97C 5JRGD 4WV4B 2F8NA 4ZBJB 3AZGD 2HUEC 5B32B 1U35B 3WA9B 5F99D 2CV5B 5B24B 2YFWA 4J8WC 2YFVB 3AZHD 3LZ0C 5AV6B 5DNNC 3LZ1B 3REHA 3W96A 4WU8A 1P3MD 3AZFC 3VH5W 1P3OB 1F66B 3AZMC 5E5AD 5BNXB 3UTBD 5CP6D 4Z5TD 4J8VB 1HQ3D 3NQUA 3AFAA 3B0CT 1P3LB 3MNNA 3MGRC 3UT9C 4X23B 1B6WA 4G92C 5AV8A 3KWQD 4H9RB 1P3PB 3AV1A 3O62B 4ZBJC 2IO5B 3MGQB 3C1BB 5B32C 3AN2A 1U35C 3WA9C 4H9PB 4KHAA 2CV5C 5FUGB 1ZLAB 5B24C 3KUYB 3MVDB 5AV6C 5CPID 3LZ1C 3AZIA 1P3OC 1F66C 3LELA 2AROA 5AVBA 1BH9B 4YS3B 4J8VC 3AZKB 2NZDD 4KUDA 1P3ID 1P3LC 4X23C 1JFIB 3W98A 1P3PC 2F8ND 3O62C 4KGCD 1P3BB 2BYKB 4H9NB 2IO5C 3MGQC 5DNMD 3C1BC 4J8XA 2FJ7A 1EQZB 3C1CA 1ZLAC 3KUYC 3MVDC 3W96D 3X1VA 3REIA 3AFAD 4YS3C 3AZKC 3W99B 5CPKB 5KDMB 4G91B 3V9RB 3UTAB 1P3BC 1S32B 5GT3A 1EQZC 5B31B 1B67A 3WKJA 3VH6T 5AY8B 5B2IA 5CPJB 1N1JA 5BNVB 3A6NA 3LELD 3KSYA 1P34D 1P3GD 5B1LA 1TAFA 4KUDD 4XUJA 3W99C 5CPKC 4G91C 5B0ZB 3UTAC 4J8XD 5B1MB 2FJ7D 1S32C 1P3AB 5DNNB 3RELD 3LJAA 3C1CD 1M19B 5B31C 4WNNA 1M1AB 2NQBB 1KX5B 5B33D 5AY8C 3TU4B 4LD9B 5CPJC 4R8PB 3REID 2HIOD 1ID3B 3B0BA 4NE3A 5JRGB 4JJNB 3B6FD 3VH5T 1WWSA 5BS7C 5B0ZC 1F1EA 2BYMA 4XZQB 5B1MC 5B2JB 4E44A 1P3AC 3AZHB 1M19C 3WKJD 5GSUA 5AVCB 1P3KD 1P3MB 1M1AC 2NQBC 1KX5C 3WTPB 4LD9C 3TU4C 5E5AB 2PYOB 3UTBB 5CPIA 5CP6B 3A6ND 4R8PC 4H9SA 1HQ3B 1TZYB 4Z66B 1ID3C 3MGPD 5B40B 5JRGC 3KWQB 4JJNC 5BO0A 5GXQB 4WU9B 4ZUXD 4UUZA 5F99C 4XZQC 4KGCA 3WAAB 5B2JC 3LJAD 3UT9A 5DNMA 2CWEA 4YM6D 3AZHC 3REJB 3AZEA 5AVCC 1P3MC 1KX3D 5GT0A 3AZJD 3WTPC 5E5AC 2PYOC 3UTBC 4J8UB 5CP6C 1HQ3C 2NZDB 1TZYC 2RVQD 3B6GB 4Z66C 1R4VA 5B40C 3KWQC 1AOID 2F8NB 3MGSD 3KXBD 5GXQC 4WU9C 3X1UD 5JA4B 2YFWB 3WAAC 1P3LA 3W97D 5GSUD 3REHB 4WU8B 3W96B 3REJC 4H9OB 4J8UC 3NQUB 3NQJA 2NZDC 3MNNB 3B6GC 1P3IC 5AV8B 1P34A 1P3GA 3AZLB 4NFTA 3AV1B 2LY8A 1ULYA 3AN2B 4Z2MH 4EO5B 4KHAB 3AZKA 3UT9D 3REHC 3AZIB 3W96C 3AZED 3RELA 4WU8C 5GT0D 2BYKA 5B32D 2AROB 1U35D 5AVBB 3WA9D 4QLCA 5B33A 4KUDB 2CV5D 3R45A 3MNNC 5B24D 3W98B 5AV8C 2HIOA 5AV6D 3AZLC 3AV1C 3B6FA 3AN2C 1M18A 4EO5C 4J8VD 1P3LD 4X23D 5AV5A 3X1VB 3AZIC 3O62D 3AV2A 3MGQD 3C1BD 1KU5A 1P3KA 2AROC 5AVBC 1S32A 3AYWA 5B0YA 5B31A 4KUDC 3B0CW 3W98C 3KUYD 3MGPA 3AZNA 5GT3B 4ZUXA 3C1CC 4YS3D 3WKJB 3AZKD 5B2IB 3X1VC 5AV9B 3REKA 1N1JB 4YM6A 4CSRB 1P3BD 3A6NB 5G49A 1KX3A 1KX4B 5B1LB 4QLCD 3AZJA 1P3AA 1EQZD 1TAFB 4XUJB 3VH6A 2F8NH 1BFMA 1HTAA 1AOIA 3MGSA 3KXBA 1P3FA 1M18D 3X1SA 3LJAB 1A7WA 3AZGB 5GT3C 3WKJC 4WNNB 5F99B 3X1UA 3W99D 3X1TA 5CPKD 5AV5D 5B32G 5B2IC 3W97A 3UTAD 5AV9C 1BH8A 3AV2D 3A6NC 5BT1D 1KX4C 1S32D 5B1LC 3AYWD 5B0YD 5B31D 4NE6A 4H9QA 4Z5TB 4XUJC 4CAYA 5AY8D 4J8WA 3LZ0A 3AZND 5DNNA 2BYMB 3AZFA 3LJAC 3AZGC 4Z66A 5GSUB 3AZMA 5B40A 2L5AA 3VH5A 3B0DB 3MGRA 3REKD 1H3OA 5CPIB 3WAAA 5B1MD 2RVQC 1P3AD 5B32A 1M19D 1U35A 5BO0B 3WA9A 4Z5TC 2CV5A 1P3IB 1KX5D 5B24A 3TU4D 2YFVA 5AV6A 4UUZB 3LZ1A 4KGCB 1P3FD 3X1SD 1P3OA 1ID3D 5DNMB 1F66A 5GSUC 4JJND 3AZEB 5BNXA 5GT0B 3B0DC 3X1TD 4J8VA 4X23A 5CPIC 4H9RA 2JSSA 4H9SC 1P3PA 5JA4A 4XZQD 3O62A 5B2JD 4M6BA 3MGQA 3C1BA 5AVCD 3AFAB 4H9PA 4J8WD 5FUGA 1ZLAA 3WTPD 3LZ0D 5DNND 2PYOD 4H9OA 3MVDA 3KUYA 3AZFD 4KGCC 1TZYD 4Z66D 3AZMD 5DNMC 5B40D 3AZEC 3AZLA 5GT0C 1BH9A 4YS3A 5GXQD 4WU9D 3MGRD 1JFIA 3NQJB 5B31G 5C3IB 1P3BA 3WAAD 3LELB 4H9NA 1P34B 1P3GB 3REJD 1EQZA 3AFAC 4E45A 4HGAB 3LZ1D 4J8UD 4NE5A 1P3OD 3B6GD 4J8XB 1F66D 2FJ7B 3RELB 3C1CB 4Z2MG 3W99A 4QLCB 5CPKA 5KDMA 5B33B 1P3PD 3V9RA 3UTAA 5C3IC 3R45B 3REIB 3LELC 2HIOB 1P34C 1P3GC 3REHD 4WU8D 3B6FB 4HGAC 1ZLAD 1M18B 3MVDD 5AY8A 5CPJA 3WTPE 3MNND 5BNVA 4J8XC 5AV8D 2FJ7C 5AV5B 3AZLD 3RELC 3AV1D 4AWLB 3AV2B 1P3KB 4DRBA 3AN2D 5BS7A 4QLCC 1Q9CA 5CHLB 5B33C 3AYWB 5B0YB 5B0ZA 3REIC 2HIOC 5B1MA 3MGPB 3AZID 3AZNB 5AV9A 1M19A 4CSRA 3B6FC 1M1AA 4DRAA 1M18C 2AROD 4ZUXB 5AVBD 1KX4A 2NQBA 1KX5A 4LD9A 3TU4A 4R8PA 3W98D 5AV5C 1ID3A 3REKB 4J8WB 4YM6B 5JRGA 4JJNA 4AWLC 5G49B 3AV2C 1P3KC 1KX3B 3AZJB 5BT1C 3AZGA 3AYWC 5B0YC 5F99A 4XZQA 5B2JA 3X1VD 3MGPC 3AZHA 3AZNC 1AOIB 5AVCA 3MGSB 3KXBB 1P3FB 1P3MA 3X1SB 4ZUXC 4WZSB 3WTPA 5CPJD 5E5AA 3X1UB 3UTBA 2PYOA 5CP6A 2F8NG 4Z5TA 3X1TB 1HQ3A 1TZYA 3W97B 3REKC 1BH8B 4YM6C 3KWQA 1KX3C 5GXQA 3AZJC 4WU9A 2HUEB 3VH6W 5GT3D 5B0ZD 1WWIA 4H9QB 4CAYB 5B2ID 3LZ0B 5AV9D
chains in the Genus database with same CATH superfamily
3AZFB 3REJA 1M1AD 3MGSC 1AOIC 3KXBC 1P3FC 1KX4D 3X1SC 3IP4C 2NQBD 5B1LD 3AZMB 4LD9D 3X1UC 4R8PD 4XUJD 4J8UA 3X1TC 2NZDA 3MGRB 3UT9B 2F8NK 1P3IA 1H3OB 4G92B 3B6GA 3W97C 5JRGD 2Y2NA 4WV4B 2F8NA 3P5JB 4ZBJB 3AZGD 2HUEC 5B32B 1U35B 3WA9B 5F99D 2CV5B 5B24B 2YFWA 4J8WC 2YFVB 3AZHD 3LZ0C 5AV6B 5DNNC 3LZ1B 3REHA 3W96A 4WU8A 1P3MD 3AZFC 3VH5W 1P3OB 1F66B 3AZMC 5E5AD 5BNXB 3UTBD 5CP6D 4Z5TD 4J8VB 1HQ3D 3NQUA 3AFAA 3B0CT 1P3LB 3MNNA 3MGRC 3UT9C 4X23B 1B6WA 3FDDA 5AV8A 4G92C 3KWQD 4H9RB 1P3PB 3AV1A 3O62B 4UPKA 3H0MC 4ZBJC 2IO5B 3MGQB 3C1BB 5B32C 3AN2A 1U35C 3WA9C 4H9PB 4KHAA 2CV5C 5FUGB 1ZLAB 5B24C 3KUYB 3MVDB 5AV6C 5CPID 3AL0C 3LZ1C 3AZIA 1P3OC 1F66C 2ZY3A 3LELA 2AROA 5AVBA 1BH9B 4YS3B 4J8VC 3AZKB 2NZDD 4KUDA 1P3ID 1P3LC 4X23C 1JFIB 3W98A 1P3PC 2F8ND 3O62C 4KGCD 2XD1A 1P3BB 2BYKB 4H9NB 2IO5C 3MGQC 5DNMD 3C1BC 4J8XA 2FJ7A 2Y2QA 1EQZB 3C1CA 1ZLAC 3KUYC 3MVDC 3W96D 3X1VA 3REIA 3AFAD 4YS3C 3AZKC 2UWXA 3W99B 5CPKB 5KDMB 4G91B 3V9RB 3UTAB 1P3BC 1S32B 5GT3A 1EQZC 5B31B 1B67A 3WKJA 2DF4C 3VH6T 5AY8B 5B2IA 5CPJB 1N1JA 5BNVB 3A6NA 3LELD 3KSYA 1P34D 1P3GD 5B1LA 1TAFA 4KUDD 4XUJA 3W99C 5CPKC 3A1IA 4G91C 5B0ZB 3UTAC 4J8XD 5B1MB 2Y2MA 2FJ7D 1S32C 1P3AB 3RELD 3LJAA 3C1CD 1M19B 5B31C 2ZM5A 2Y2GA 4WNNA 1M1AB 2NQBB 1KX5B 5B33D 5AY8C 3TU4B 4LD9B 5CPJC 4R8PB 3REID 2HIOD 3EPLA 1ID3B 3B0BA 2W8SA 4NE3A 5JRGB 4JJNB 3B6FD 3VH5T 1WWSA 5BS7C 5B0ZC 1F1EA 2BYMA 4XZQB 5B1MC 5B2JB 4E44A 1P3AC 3AZHB 1M19C 3WKJD 5GSUA 5AVCB 1P3KD 1P3MB 1M1AC 2NQBC 3F6TA 1KX5C 3WTPB 2DQNC 3TU4C 4LD9C 5E5AB 2PYOB 3EG5B 3UTBB 5CP6B 5CPIA 3A6ND 4R8PC 4DQYB 4H9SA 1HQ3B 1TZYB 4Z66B 1ID3C 3MGPD 5B40B 5JRGC 3KWQB 4JJNC 5BO0A 5GXQB 4WU9B 4ZUXD 4UUZA 5F99C 4XZQC 4KGCA 3WAAB 5B2JC 3LJAD 3UT9A 5DNMA 2CWEA 4YM6D 3AZHC 3REJB 3AZEA 5AVCC 1P3MC 1KX3D 5GT0A 3AZJD 3WTPC 5E5AC 1Z2CB 3UTBC 4J8UB 5CP6C 2PYOC 1HQ3C 2NZDB 1TZYC 2RVQD 3B6GB 4Z66C 1R4VA 5B40C 3KWQC 1AOID 2F8NB 3MGSD 3KXBD 1PZRA 5GXQC 4WU9C 3X1UD 5JA4B 2YFWB 3WAAC 1P3LA 3W97D 5GSUD 3REHB 4WU8B 3W96B 3REJC 4H9OB 4J8UC 3NQUB 3NQJA 2NZDC 3MNNB 3B6GC 1P3IC 5AV8B 1P34A 1P3GA 3EPHA 3AZLB 4NFTA 5AV9D 2LY8A 3AV1B 2JE5A 1ULYA 2ZY2A 3AN2B 4Z2MH 4EO5B 2Y2KA 4KHAB 3AZKA 3UT9D 3REHC 3AZIB 3W96C 3AZED 3RELA 4WU8C 5GT0D 2BYKA 5B32D 2AROB 1U35D 5AVBB 3WA9D 4QLCA 5B33A 4KUDB 2CV5D 3R45A 3MNNC 5B24D 3W98B 5AV8C 2HIOA 5AV6D 3AZLC 3AV1C 3B6FA 3AN2C 1M18A 4EO5C 4J8VD 1P3LD 2XD5A 4X23D 5AV5A 3X1VB 3AZIC 3O62D 3AV2A 3MGQD 3C1BD 1KU5A 1P3KA 2AROC 5AVBC 1S32A 3AYWA 3EPKA 5B0YA 5B31A 4KUDC 3B0CW 3W98C 3KUYD 3MGPA 3AZNA 2Y2OA 2ZY4A 1T3UA 5GT3B 4ZUXA 3C1CC 4YS3D 3WKJB 2Y2JA 3AZKD 2Y2LA 5B2IB 3X1VC 5AV9B 3REKA 1N1JB 4CSRB 4YM6A 1P3BD 3A6NB 2G5HC 5G49A 1KX3A 1KX4B 5B1LB 4QLCD 3AZJA 1P3AA 1EQZD 1TAFB 4XUJB 3VH6A 2F8NH 1BFMA 2Y2PA 1HTAA 1AOIA 3MGSA 3KXBA 1P3FA 1M18D 3X1SA 3LJAB 1A7WA 3AZGB 5GT3C 3WKJC 4WNNB 5F99B 3X1UA 3W99D 3X1TA 5CPKD 5AV5D 5B32G 5B2IC 3W97A 3UTAD 5AV9C 1BH8A 3AV2D 3A6NC 5BT1D 1KX4C 1S32D 5B1LC 3AYWD 5B0YD 5B31D 4NE6A 4H9QA 4Z5TB 4XUJC 4CAYA 5AY8D 4J8WA 3LZ0A 3AZND 5DNNA 2BYMB 3AZFA 2VQRA 3LJAC 3AZGC 4Z66A 5GSUB 3AZMA 5B40A 2L5AA 3VH5A 3B0DB 3MGRA 3REKD 1H3OA 2RIQA 5CPIB 3WAAA 5B1MD 2RVQC 1P3AD 5B32A 1M19D 1U35A 5BO0B 3WA9A 4Z5TC 2CV5A 1P3IB 1KX5D 5B24A 3TU4D 2YFVA 5AV6A 4UUZB 3LZ1A 3H0RC 1P3FD 4KGCB 3X1SD 1P3OA 1ID3D 5DNMB 1F66A 2JCHA 5GSUC 4JJND 3AZEB 5BNXA 2G5IC 3KFUG 5GT0B 3B0DC 3X1TD 4J8VA 4X23A 5CPIC 4H9RA 2JSSA 4H9SC 1P3PA 5JA4A 4XZQD 3O62A 5B2JD 4M6BA 3MGQA 3C1BA 5AVCD 3AFAB 4H9PA 4J8WD 5FUGA 1ZLAA 3WTPD 3LZ0D 5DNND 2PYOD 4H9OA 3MVDA 3KUYA 3AZFD 4KGCC 1TZYD 4Z66D 3AZMD 5DNMC 5B40D 3AZEC 3AZLA 5GT0C 1BH9A 4YS3A 5GXQD 4WU9D 3MGRD 2BG1A 1JFIA 3NQJB 5B31G 5C3IB 1P3BA 3WAAD 3LELB 4H9NA 1P34B 1P3GB 3REJD 1EQZA 3AFAC 4E45A 3H0LC 4HGAB 3LZ1D 4J8UD 4NE5A 2ZY5A 2FFFB 1P3OD 3B6GD 4J8XB 1F66D 2FJ7B 3RELB 3C1CB 4Z2MG 3W99A 4QLCB 5CPKA 5KDMA 5B33B 1P3PD 3V9RA 3UTAA 5C3IC 3R45B 3REIB 3LELC 2HIOB 1P34C 1P3GC 3REHD 4WU8D 3B6FB 4HGAC 1ZLAD 1M18B 2F2AC 3MVDD 5AY8A 5CPJA 3WTPE 3MNND 2Y2HA 5BNVA 3EPJA 4J8XC 5AV8D 2FJ7C 5AV5B 3AZLD 3RELC 3AV1D 4AWLB 3AV2B 1P3KB 4DRBA 3AN2D 5BS7A 4QLCC 1Q9CA 5CHLB 5B33C 3AYWB 5B0YB 5B0ZA 3REIC 2HIOC 5B1MA 3MGPB 3AZID 3AZNB 5AV9A 1M19A 4CSRA 3B6FC 1M1AA 4DRAA 1M18C 2AROD 4ZUXB 5AVBD 1KX4A 2NQBA 1KX5A 4LD9A 3TU4A 4R8PA 3W98D 5AV5C 1ID3A 3REKB 4J8WB 4YM6B 5JRGA 3A1KA 4JJNA 4AWLC 2J8PA 5G49B 3AV2C 1P3KC 1KX3B 3AZJB 5BT1C 1W2EA 3AZGA 3AYWC 5B0YC 2Y2IA 5F99A 4XZQA 4WJ3C 5B2JA 3X1VD 3MGPC 3AZHA 3AZNC 1AOIB 5AVCA 3MGSB 3KXBB 1P3FB 1P3MA 3X1SB 4ZUXC 4WZSB 3WTPA 5CPJD 5E5AA 3X1UB 3UTBA 2PYOA 5CP6A 2F8NG 4Z5TA 3X1TB 1HQ3A 1TZYA 3W97B 3REKC 1BH8B 4YM6C 3KWQA 1KX3C 5GXQA 3AZJC 4WU9A 2HUEB 3VH6W 5GT3D 5B0ZD 1WWIA 4H9QB 4CAYB 5B2ID 3LZ0B 5DNNB
chains in the Genus database with same CATH topology
3AZFB 3REJA 1M1AD 3MGSC 1AOIC 3KXBC 1P3FC 1KX4D 3X1SC 3IP4C 2NQBD 5B1LD 3AZMB 4LD9D 3X1UC 4R8PD 4XUJD 4J8UA 3X1TC 2NZDA 3MGRB 3UT9B 2F8NK 1P3IA 1H3OB 4G92B 3B6GA 3W97C 5JRGD 2Y2NA 4WV4B 2F8NA 3P5JB 4ZBJB 3AZGD 2HUEC 5B32B 1U35B 3WA9B 5F99D 2CV5B 5B24B 2YFWA 4J8WC 2YFVB 3AZHD 3LZ0C 5AV6B 5DNNC 3LZ1B 3REHA 3W96A 4WU8A 1P3MD 3AZFC 3VH5W 1P3OB 1F66B 3AZMC 5E5AD 5BNXB 3UTBD 5CP6D 4Z5TD 4J8VB 1HQ3D 3NQUA 3AFAA 3B0CT 1P3LB 3MNNA 3MGRC 3UT9C 4X23B 1B6WA 3FDDA 5AV8A 4G92C 3KWQD 4H9RB 1P3PB 3AV1A 3O62B 4UPKA 3H0MC 4ZBJC 2IO5B 3MGQB 3C1BB 5B32C 3AN2A 1U35C 3WA9C 4H9PB 4KHAA 2CV5C 5FUGB 1ZLAB 5B24C 3KUYB 3MVDB 5AV6C 5CPID 3AL0C 3LZ1C 3AZIA 1P3OC 1F66C 2ZY3A 3LELA 2AROA 5AVBA 1BH9B 4YS3B 4J8VC 3AZKB 2NZDD 4KUDA 1P3ID 1P3LC 4X23C 1JFIB 3W98A 1P3PC 2F8ND 3O62C 4KGCD 2XD1A 1P3BB 2BYKB 4H9NB 2IO5C 3MGQC 5DNMD 3C1BC 4J8XA 2FJ7A 2Y2QA 1EQZB 3C1CA 1ZLAC 3KUYC 3MVDC 3W96D 3X1VA 3REIA 3AFAD 4YS3C 3AZKC 2UWXA 3W99B 5CPKB 5KDMB 4G91B 3V9RB 3UTAB 1P3BC 1S32B 5GT3A 1EQZC 5B31B 1B67A 3WKJA 2DF4C 3VH6T 5AY8B 5B2IA 5CPJB 1N1JA 5BNVB 3A6NA 3LELD 3KSYA 1P34D 1P3GD 5B1LA 1TAFA 4KUDD 4XUJA 3W99C 5CPKC 3A1IA 4G91C 5B0ZB 3UTAC 4J8XD 5B1MB 2Y2MA 2FJ7D 1S32C 1P3AB 3RELD 3LJAA 3C1CD 1M19B 5B31C 2ZM5A 2Y2GA 4WNNA 1M1AB 2NQBB 1KX5B 5B33D 5AY8C 3TU4B 4LD9B 5CPJC 4R8PB 3REID 2HIOD 3EPLA 1ID3B 3B0BA 2W8SA 4NE3A 5JRGB 4JJNB 3B6FD 3VH5T 1WWSA 5BS7C 5B0ZC 1F1EA 2BYMA 4XZQB 5B1MC 5B2JB 4E44A 1P3AC 3AZHB 1M19C 3WKJD 5GSUA 5AVCB 1P3KD 1P3MB 1M1AC 2NQBC 3F6TA 1KX5C 3WTPB 2DQNC 3TU4C 4LD9C 5E5AB 2PYOB 3EG5B 3UTBB 5CP6B 5CPIA 3A6ND 4R8PC 4DQYB 4H9SA 1HQ3B 1TZYB 4Z66B 1ID3C 3MGPD 5B40B 5JRGC 3KWQB 4JJNC 5BO0A 5GXQB 4WU9B 4ZUXD 4UUZA 5F99C 4XZQC 4KGCA 3WAAB 5B2JC 3LJAD 3UT9A 5DNMA 2CWEA 4YM6D 3AZHC 3REJB 3AZEA 5AVCC 1P3MC 1KX3D 5GT0A 3AZJD 3WTPC 5E5AC 1Z2CB 3UTBC 4J8UB 5CP6C 2PYOC 1HQ3C 2NZDB 1TZYC 2RVQD 3B6GB 4Z66C 1R4VA 5B40C 3KWQC 1AOID 2F8NB 3MGSD 3KXBD 1PZRA 5GXQC 4WU9C 3X1UD 5JA4B 2YFWB 3WAAC 1P3LA 3W97D 5GSUD 3REHB 4WU8B 3W96B 3REJC 4H9OB 4J8UC 3NQUB 3NQJA 2NZDC 3MNNB 3B6GC 1P3IC 5AV8B 1P34A 1P3GA 3EPHA 3AZLB 4NFTA 5AV9D 2LY8A 3AV1B 2JE5A 1ULYA 2ZY2A 3AN2B 4Z2MH 4EO5B 2Y2KA 4KHAB 3AZKA 3UT9D 3REHC 3AZIB 3W96C 3AZED 3RELA 4WU8C 5GT0D 2BYKA 5B32D 2AROB 1U35D 5AVBB 3WA9D 4QLCA 5B33A 4KUDB 2CV5D 3R45A 3MNNC 5B24D 3W98B 5AV8C 2HIOA 5AV6D 3AZLC 3AV1C 3B6FA 3AN2C 1M18A 4EO5C 4J8VD 1P3LD 2XD5A 4X23D 5AV5A 3X1VB 3AZIC 3O62D 3AV2A 3MGQD 3C1BD 1KU5A 1P3KA 2AROC 5AVBC 1S32A 3AYWA 3EPKA 5B0YA 5B31A 4KUDC 3B0CW 3W98C 3KUYD 3MGPA 3AZNA 2Y2OA 2ZY4A 1T3UA 5GT3B 4ZUXA 3C1CC 4YS3D 3WKJB 2Y2JA 3AZKD 2Y2LA 5B2IB 3X1VC 5AV9B 3REKA 1N1JB 4CSRB 4YM6A 1P3BD 3A6NB 2G5HC 5G49A 1KX3A 1KX4B 5B1LB 4QLCD 3AZJA 1P3AA 1EQZD 1TAFB 4XUJB 3VH6A 2F8NH 1BFMA 2Y2PA 1HTAA 1AOIA 3MGSA 3KXBA 1P3FA 1M18D 3X1SA 3LJAB 1A7WA 3AZGB 5GT3C 3WKJC 4WNNB 5F99B 3X1UA 3W99D 3X1TA 5CPKD 5AV5D 5B32G 5B2IC 3W97A 3UTAD 5AV9C 1BH8A 3AV2D 3A6NC 5BT1D 1KX4C 1S32D 5B1LC 3AYWD 5B0YD 5B31D 4NE6A 4H9QA 4Z5TB 4XUJC 4CAYA 5AY8D 4J8WA 3LZ0A 3AZND 5DNNA 2BYMB 3AZFA 2VQRA 3LJAC 3AZGC 4Z66A 5GSUB 3AZMA 5B40A 2L5AA 3VH5A 3B0DB 3MGRA 3REKD 1H3OA 2RIQA 5CPIB 3WAAA 5B1MD 2RVQC 1P3AD 5B32A 1M19D 1U35A 5BO0B 3WA9A 4Z5TC 2CV5A 1P3IB 1KX5D 5B24A 3TU4D 2YFVA 5AV6A 4UUZB 3LZ1A 3H0RC 1P3FD 4KGCB 3X1SD 1P3OA 1ID3D 5DNMB 1F66A 2JCHA 5GSUC 4JJND 3AZEB 5BNXA 2G5IC 3KFUG 5GT0B 3B0DC 3X1TD 4J8VA 4X23A 5CPIC 4H9RA 2JSSA 4H9SC 1P3PA 5JA4A 4XZQD 3O62A 5B2JD 4M6BA 3MGQA 3C1BA 5AVCD 3AFAB 4H9PA 4J8WD 5FUGA 1ZLAA 3WTPD 3LZ0D 5DNND 2PYOD 4H9OA 3MVDA 3KUYA 3AZFD 4KGCC 1TZYD 4Z66D 3AZMD 5DNMC 5B40D 3AZEC 3AZLA 5GT0C 1BH9A 4YS3A 5GXQD 4WU9D 3MGRD 2BG1A 1JFIA 3NQJB 5B31G 5C3IB 1P3BA 3WAAD 3LELB 4H9NA 1P34B 1P3GB 3REJD 1EQZA 3AFAC 4E45A 3H0LC 4HGAB 3LZ1D 4J8UD 4NE5A 2ZY5A 2FFFB 1P3OD 3B6GD 4J8XB 1F66D 2FJ7B 3RELB 3C1CB 4Z2MG 3W99A 4QLCB 5CPKA 5KDMA 5B33B 1P3PD 3V9RA 3UTAA 5C3IC 3R45B 3REIB 3LELC 2HIOB 1P34C 1P3GC 3REHD 4WU8D 3B6FB 4HGAC 1ZLAD 1M18B 2F2AC 3MVDD 5AY8A 5CPJA 3WTPE 3MNND 2Y2HA 5BNVA 3EPJA 4J8XC 5AV8D 2FJ7C 5AV5B 3AZLD 3RELC 3AV1D 4AWLB 3AV2B 1P3KB 4DRBA 3AN2D 5BS7A 4QLCC 1Q9CA 5CHLB 5B33C 3AYWB 5B0YB 5B0ZA 3REIC 2HIOC 5B1MA 3MGPB 3AZID 3AZNB 5AV9A 1M19A 4CSRA 3B6FC 1M1AA 4DRAA 1M18C 2AROD 4ZUXB 5AVBD 1KX4A 2NQBA 1KX5A 4LD9A 3TU4A 4R8PA 3W98D 5AV5C 1ID3A 3REKB 4J8WB 4YM6B 5JRGA 3A1KA 4JJNA 4AWLC 2J8PA 5G49B 3AV2C 1P3KC 1KX3B 3AZJB 5BT1C 1W2EA 3AZGA 3AYWC 5B0YC 2Y2IA 5F99A 4XZQA 4WJ3C 5B2JA 3X1VD 3MGPC 3AZHA 3AZNC 1AOIB 5AVCA 3MGSB 3KXBB 1P3FB 1P3MA 3X1SB 4ZUXC 4WZSB 3WTPA 5CPJD 5E5AA 3X1UB 3UTBA 2PYOA 5CP6A 2F8NG 4Z5TA 3X1TB 1HQ3A 1TZYA 3W97B 3REKC 1BH8B 4YM6C 3KWQA 1KX3C 5GXQA 3AZJC 4WU9A 2HUEB 3VH6W 5GT3D 5B0ZD 1WWIA 4H9QB 4CAYB 5B2ID 3LZ0B 5DNNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZF B;  3REJ A;  1M1A D;  3MGS C;  1AOI C;  3KXB C;  1P3F C;  1KX4 D;  3X1S C;  2NQB D;  5B1L D;  3AZM B;  4LD9 D;  3X1U C;  4R8P D;  4XUJ D;  4J8U A;  3X1T C;  2NZD A;  3MGR B;  3UT9 B;  2F8N K;  1P3I A;  1H3O B;  4G92 B;  3B6G A;  3W97 C;  5JRG D;  4WV4 B;  2F8N A;  4ZBJ B;  3AZG D;  2HUE C;  5B32 B;  1U35 B;  3WA9 B;  5F99 D;  2CV5 B;  5B24 B;  2YFW A;  4J8W C;  2YFV B;  3AZH D;  3LZ0 C;  5AV6 B;  5DNN C;  3LZ1 B;  3REH A;  3W96 A;  4WU8 A;  1P3M D;  3AZF C;  3VH5 W;  1P3O B;  1F66 B;  3AZM C;  5E5A D;  5BNX B;  3UTB D;  5CP6 D;  4Z5T D;  4J8V B;  1HQ3 D;  3NQU A;  3AFA A;  3B0C T;  1P3L B;  3MNN A;  3MGR C;  3UT9 C;  4X23 B;  1B6W A;  4G92 C;  5AV8 A;  3KWQ D;  4H9R B;  1P3P B;  3AV1 A;  3O62 B;  4ZBJ C;  2IO5 B;  3MGQ B;  3C1B B;  5B32 C;  3AN2 A;  1U35 C;  3WA9 C;  4H9P B;  4KHA A;  2CV5 C;  5FUG B;  1ZLA B;  5B24 C;  3KUY B;  3MVD B;  5AV6 C;  5CPI D;  3LZ1 C;  3AZI A;  1P3O C;  1F66 C;  3LEL A;  2ARO A;  5AVB A;  1BH9 B;  4YS3 B;  4J8V C;  3AZK B;  2NZD D;  4KUD A;  1P3I D;  1P3L C;  4X23 C;  1JFI B;  3W98 A;  1P3P C;  2F8N D;  3O62 C;  4KGC D;  1P3B B;  2BYK B;  4H9N B;  2IO5 C;  3MGQ C;  5DNM D;  3C1B C;  4J8X A;  2FJ7 A;  1EQZ B;  3C1C A;  1ZLA C;  3KUY C;  3MVD C;  3W96 D;  3X1V A;  3REI A;  3AFA D;  4YS3 C;  3AZK C;  3W99 B;  5CPK B;  5KDM B;  4G91 B;  3V9R B;  3UTA B;  1P3B C;  1S32 B;  5GT3 A;  1EQZ C;  5B31 B;  1B67 A;  3WKJ A;  3VH6 T;  5AY8 B;  5B2I A;  5CPJ B;  1N1J A;  5BNV B;  3A6N A;  3LEL D;  3KSY A;  1P34 D;  1P3G D;  5B1L A;  1TAF A;  4KUD D;  4XUJ A;  3W99 C;  5CPK C;  4G91 C;  5B0Z B;  3UTA C;  4J8X D;  5B1M B;  2FJ7 D;  1S32 C;  1P3A B;  5DNN B;  3REL D;  3LJA A;  3C1C D;  1M19 B;  5B31 C;  4WNN A;  1M1A B;  2NQB B;  1KX5 B;  5B33 D;  5AY8 C;  3TU4 B;  4LD9 B;  5CPJ C;  4R8P B;  3REI D;  2HIO D;  1ID3 B;  3B0B A;  4NE3 A;  5JRG B;  4JJN B;  3B6F D;  3VH5 T;  1WWS A;  5BS7 C;  5B0Z C;  1F1E A;  2BYM A;  4XZQ B;  5B1M C;  5B2J B;  4E44 A;  1P3A C;  3AZH B;  1M19 C;  3WKJ D;  5GSU A;  5AVC B;  1P3K D;  1P3M B;  1M1A C;  2NQB C;  1KX5 C;  3WTP B;  4LD9 C;  3TU4 C;  5E5A B;  2PYO B;  3UTB B;  5CPI A;  5CP6 B;  3A6N D;  4R8P C;  4H9S A;  1HQ3 B;  1TZY B;  4Z66 B;  1ID3 C;  3MGP D;  5B40 B;  5JRG C;  3KWQ B;  4JJN C;  5BO0 A;  5GXQ B;  4WU9 B;  4ZUX D;  4UUZ A;  5F99 C;  4XZQ C;  4KGC A;  3WAA B;  5B2J C;  3LJA D;  3UT9 A;  5DNM A;  2CWE A;  4YM6 D;  3AZH C;  3REJ B;  3AZE A;  5AVC C;  1P3M C;  1KX3 D;  5GT0 A;  3AZJ D;  3WTP C;  5E5A C;  2PYO C;  3UTB C;  4J8U B;  5CP6 C;  1HQ3 C;  2NZD B;  1TZY C;  2RVQ D;  3B6G B;  4Z66 C;  1R4V A;  5B40 C;  3KWQ C;  1AOI D;  2F8N B;  3MGS D;  3KXB D;  5GXQ C;  4WU9 C;  3X1U D;  5JA4 B;  2YFW B;  3WAA C;  1P3L A;  3W97 D;  5GSU D;  3REH B;  4WU8 B;  3W96 B;  3REJ C;  4H9O B;  4J8U C;  3NQU B;  3NQJ A;  2NZD C;  3MNN B;  3B6G C;  1P3I C;  5AV8 B;  1P34 A;  1P3G A;  3AZL B;  4NFT A;  3AV1 B;  2LY8 A;  1ULY A;  3AN2 B;  4Z2M H;  4EO5 B;  4KHA B;  3AZK A;  3UT9 D;  3REH C;  3AZI B;  3W96 C;  3AZE D;  3REL A;  4WU8 C;  5GT0 D;  2BYK A;  5B32 D;  2ARO B;  1U35 D;  5AVB B;  3WA9 D;  4QLC A;  5B33 A;  4KUD B;  2CV5 D;  3R45 A;  3MNN C;  5B24 D;  3W98 B;  5AV8 C;  2HIO A;  5AV6 D;  3AZL C;  3AV1 C;  3B6F A;  3AN2 C;  1M18 A;  4EO5 C;  4J8V D;  1P3L D;  4X23 D;  5AV5 A;  3X1V B;  3AZI C;  3O62 D;  3AV2 A;  3MGQ D;  3C1B D;  1KU5 A;  1P3K A;  2ARO C;  5AVB C;  1S32 A;  3AYW A;  5B0Y A;  5B31 A;  4KUD C;  3B0C W;  3W98 C;  3KUY D;  3MGP A;  3AZN A;  5GT3 B;  4ZUX A;  3C1C C;  4YS3 D;  3WKJ B;  3AZK D;  5B2I B;  3X1V C;  5AV9 B;  3REK A;  1N1J B;  4YM6 A;  4CSR B;  1P3B D;  3A6N B;  5G49 A;  1KX3 A;  1KX4 B;  5B1L B;  4QLC D;  3AZJ A;  1P3A A;  1EQZ D;  1TAF B;  4XUJ B;  3VH6 A;  2F8N H;  1BFM A;  1HTA A;  1AOI A;  3MGS A;  3KXB A;  1P3F A;  1M18 D;  3X1S A;  3LJA B;  1A7W A;  3AZG B;  5GT3 C;  3WKJ C;  4WNN B;  5F99 B;  3X1U A;  3W99 D;  3X1T A;  5CPK D;  5AV5 D;  5B32 G;  5B2I C;  3W97 A;  3UTA D;  5AV9 C;  1BH8 A;  3AV2 D;  3A6N C;  5BT1 D;  1KX4 C;  1S32 D;  5B1L C;  3AYW D;  5B0Y D;  5B31 D;  4NE6 A;  4H9Q A;  4Z5T B;  4XUJ C;  4CAY A;  5AY8 D;  4J8W A;  3LZ0 A;  3AZN D;  5DNN A;  2BYM B;  3AZF A;  3LJA C;  3AZG C;  4Z66 A;  5GSU B;  3AZM A;  5B40 A;  2L5A A;  3VH5 A;  3B0D B;  3MGR A;  3REK D;  1H3O A;  5CPI B;  3WAA A;  5B1M D;  2RVQ C;  1P3A D;  5B32 A;  1M19 D;  1U35 A;  5BO0 B;  3WA9 A;  4Z5T C;  2CV5 A;  1P3I B;  1KX5 D;  5B24 A;  3TU4 D;  2YFV A;  5AV6 A;  4UUZ B;  3LZ1 A;  4KGC B;  1P3F D;  3X1S D;  1P3O A;  1ID3 D;  5DNM B;  1F66 A;  5GSU C;  4JJN D;  3AZE B;  5BNX A;  5GT0 B;  3B0D C;  3X1T D;  4J8V A;  4X23 A;  5CPI C;  4H9R A;  2JSS A;  4H9S C;  1P3P A;  5JA4 A;  4XZQ D;  3O62 A;  5B2J D;  4M6B A;  3MGQ A;  3C1B A;  5AVC D;  3AFA B;  4H9P A;  4J8W D;  5FUG A;  1ZLA A;  3WTP D;  3LZ0 D;  5DNN D;  2PYO D;  4H9O A;  3MVD A;  3KUY A;  3AZF D;  4KGC C;  1TZY D;  4Z66 D;  3AZM D;  5DNM C;  5B40 D;  3AZE C;  3AZL A;  5GT0 C;  1BH9 A;  4YS3 A;  5GXQ D;  4WU9 D;  3MGR D;  1JFI A;  3NQJ B;  5B31 G;  5C3I B;  1P3B A;  3WAA D;  3LEL B;  4H9N A;  1P34 B;  1P3G B;  3REJ D;  1EQZ A;  3AFA C;  4E45 A;  4HGA B;  3LZ1 D;  4J8U D;  4NE5 A;  1P3O D;  3B6G D;  4J8X B;  1F66 D;  2FJ7 B;  3REL B;  3C1C B;  4Z2M G;  3W99 A;  4QLC B;  5CPK A;  5KDM A;  5B33 B;  1P3P D;  3V9R A;  3UTA A;  5C3I C;  3R45 B;  3REI B;  3LEL C;  2HIO B;  1P34 C;  1P3G C;  3REH D;  4WU8 D;  3B6F B;  4HGA C;  1ZLA D;  1M18 B;  3MVD D;  5AY8 A;  5CPJ A;  3WTP E;  3MNN D;  5BNV A;  4J8X C;  5AV8 D;  2FJ7 C;  5AV5 B;  3AZL D;  3REL C;  3AV1 D;  4AWL B;  3AV2 B;  1P3K B;  4DRB A;  3AN2 D;  5BS7 A;  4QLC C;  1Q9C A;  5CHL B;  5B33 C;  3AYW B;  5B0Y B;  5B0Z A;  3REI C;  2HIO C;  5B1M A;  3MGP B;  3AZI D;  3AZN B;  5AV9 A;  1M19 A;  4CSR A;  3B6F C;  1M1A A;  4DRA A;  1M18 C;  2ARO D;  4ZUX B;  5AVB D;  1KX4 A;  2NQB A;  1KX5 A;  4LD9 A;  3TU4 A;  4R8P A;  3W98 D;  5AV5 C;  1ID3 A;  3REK B;  4J8W B;  4YM6 B;  5JRG A;  4JJN A;  4AWL C;  5G49 B;  3AV2 C;  1P3K C;  1KX3 B;  3AZJ B;  5BT1 C;  3AZG A;  3AYW C;  5B0Y C;  5F99 A;  4XZQ A;  5B2J A;  3X1V D;  3MGP C;  3AZH A;  3AZN C;  1AOI B;  5AVC A;  3MGS B;  3KXB B;  1P3F B;  1P3M A;  3X1S B;  4ZUX C;  4WZS B;  3WTP A;  5CPJ D;  5E5A A;  3X1U B;  3UTB A;  2PYO A;  5CP6 A;  2F8N G;  4Z5T A;  3X1T B;  1HQ3 A;  1TZY A;  3W97 B;  3REK C;  1BH8 B;  4YM6 C;  3KWQ A;  1KX3 C;  5GXQ A;  3AZJ C;  4WU9 A;  2HUE B;  3VH6 W;  5GT3 D;  5B0Z D;  1WWI A;  4H9Q B;  4CAY B;  5B2I D;  3LZ0 B;  5AV9 D; 
#chains in the Genus database with same CATH topology
 3AZF B;  3REJ A;  1M1A D;  3MGS C;  1AOI C;  3KXB C;  1P3F C;  1KX4 D;  3X1S C;  3IP4 C;  2NQB D;  5B1L D;  3AZM B;  4LD9 D;  3X1U C;  4R8P D;  4XUJ D;  4J8U A;  3X1T C;  2NZD A;  3MGR B;  3UT9 B;  2F8N K;  1P3I A;  1H3O B;  4G92 B;  3B6G A;  3W97 C;  5JRG D;  2Y2N A;  4WV4 B;  2F8N A;  3P5J B;  4ZBJ B;  3AZG D;  2HUE C;  5B32 B;  1U35 B;  3WA9 B;  5F99 D;  2CV5 B;  5B24 B;  2YFW A;  4J8W C;  2YFV B;  3AZH D;  3LZ0 C;  5AV6 B;  5DNN C;  3LZ1 B;  3REH A;  3W96 A;  4WU8 A;  1P3M D;  3AZF C;  3VH5 W;  1P3O B;  1F66 B;  3AZM C;  5E5A D;  5BNX B;  3UTB D;  5CP6 D;  4Z5T D;  4J8V B;  1HQ3 D;  3NQU A;  3AFA A;  3B0C T;  1P3L B;  3MNN A;  3MGR C;  3UT9 C;  4X23 B;  1B6W A;  3FDD A;  5AV8 A;  4G92 C;  3KWQ D;  4H9R B;  1P3P B;  3AV1 A;  3O62 B;  4UPK A;  3H0M C;  4ZBJ C;  2IO5 B;  3MGQ B;  3C1B B;  5B32 C;  3AN2 A;  1U35 C;  3WA9 C;  4H9P B;  4KHA A;  2CV5 C;  5FUG B;  1ZLA B;  5B24 C;  3KUY B;  3MVD B;  5AV6 C;  5CPI D;  3AL0 C;  3LZ1 C;  3AZI A;  1P3O C;  1F66 C;  2ZY3 A;  3LEL A;  2ARO A;  5AVB A;  1BH9 B;  4YS3 B;  4J8V C;  3AZK B;  2NZD D;  4KUD A;  1P3I D;  1P3L C;  4X23 C;  1JFI B;  3W98 A;  1P3P C;  2F8N D;  3O62 C;  4KGC D;  2XD1 A;  1P3B B;  2BYK B;  4H9N B;  2IO5 C;  3MGQ C;  5DNM D;  3C1B C;  4J8X A;  2FJ7 A;  2Y2Q A;  1EQZ B;  3C1C A;  1ZLA C;  3KUY C;  3MVD C;  3W96 D;  3X1V A;  3REI A;  3AFA D;  4YS3 C;  3AZK C;  2UWX A;  3W99 B;  5CPK B;  5KDM B;  4G91 B;  3V9R B;  3UTA B;  1P3B C;  1S32 B;  5GT3 A;  1EQZ C;  5B31 B;  1B67 A;  3WKJ A;  2DF4 C;  3VH6 T;  5AY8 B;  5B2I A;  5CPJ B;  1N1J A;  5BNV B;  3A6N A;  3LEL D;  3KSY A;  1P34 D;  1P3G D;  5B1L A;  1TAF A;  4KUD D;  4XUJ A;  3W99 C;  5CPK C;  3A1I A;  4G91 C;  5B0Z B;  3UTA C;  4J8X D;  5B1M B;  2Y2M A;  2FJ7 D;  1S32 C;  1P3A B;  3REL D;  3LJA A;  3C1C D;  1M19 B;  5B31 C;  2ZM5 A;  2Y2G A;  4WNN A;  1M1A B;  2NQB B;  1KX5 B;  5B33 D;  5AY8 C;  3TU4 B;  4LD9 B;  5CPJ C;  4R8P B;  3REI D;  2HIO D;  3EPL A;  1ID3 B;  3B0B A;  2W8S A;  4NE3 A;  5JRG B;  4JJN B;  3B6F D;  3VH5 T;  1WWS A;  5BS7 C;  5B0Z C;  1F1E A;  2BYM A;  4XZQ B;  5B1M C;  5B2J B;  4E44 A;  1P3A C;  3AZH B;  1M19 C;  3WKJ D;  5GSU A;  5AVC B;  1P3K D;  1P3M B;  1M1A C;  2NQB C;  3F6T A;  1KX5 C;  3WTP B;  2DQN C;  3TU4 C;  4LD9 C;  5E5A B;  2PYO B;  3EG5 B;  3UTB B;  5CP6 B;  5CPI A;  3A6N D;  4R8P C;  4DQY B;  4H9S A;  1HQ3 B;  1TZY B;  4Z66 B;  1ID3 C;  3MGP D;  5B40 B;  5JRG C;  3KWQ B;  4JJN C;  5BO0 A;  5GXQ B;  4WU9 B;  4ZUX D;  4UUZ A;  5F99 C;  4XZQ C;  4KGC A;  3WAA B;  5B2J C;  3LJA D;  3UT9 A;  5DNM A;  2CWE A;  4YM6 D;  3AZH C;  3REJ B;  3AZE A;  5AVC C;  1P3M C;  1KX3 D;  5GT0 A;  3AZJ D;  3WTP C;  5E5A C;  1Z2C B;  3UTB C;  4J8U B;  5CP6 C;  2PYO C;  1HQ3 C;  2NZD B;  1TZY C;  2RVQ D;  3B6G B;  4Z66 C;  1R4V A;  5B40 C;  3KWQ C;  1AOI D;  2F8N B;  3MGS D;  3KXB D;  1PZR A;  5GXQ C;  4WU9 C;  3X1U D;  5JA4 B;  2YFW B;  3WAA C;  1P3L A;  3W97 D;  5GSU D;  3REH B;  4WU8 B;  3W96 B;  3REJ C;  4H9O B;  4J8U C;  3NQU B;  3NQJ A;  2NZD C;  3MNN B;  3B6G C;  1P3I C;  5AV8 B;  1P34 A;  1P3G A;  3EPH A;  3AZL B;  4NFT A;  5AV9 D;  2LY8 A;  3AV1 B;  2JE5 A;  1ULY A;  2ZY2 A;  3AN2 B;  4Z2M H;  4EO5 B;  2Y2K A;  4KHA B;  3AZK A;  3UT9 D;  3REH C;  3AZI B;  3W96 C;  3AZE D;  3REL A;  4WU8 C;  5GT0 D;  2BYK A;  5B32 D;  2ARO B;  1U35 D;  5AVB B;  3WA9 D;  4QLC A;  5B33 A;  4KUD B;  2CV5 D;  3R45 A;  3MNN C;  5B24 D;  3W98 B;  5AV8 C;  2HIO A;  5AV6 D;  3AZL C;  3AV1 C;  3B6F A;  3AN2 C;  1M18 A;  4EO5 C;  4J8V D;  1P3L D;  2XD5 A;  4X23 D;  5AV5 A;  3X1V B;  3AZI C;  3O62 D;  3AV2 A;  3MGQ D;  3C1B D;  1KU5 A;  1P3K A;  2ARO C;  5AVB C;  1S32 A;  3AYW A;  3EPK A;  5B0Y A;  5B31 A;  4KUD C;  3B0C W;  3W98 C;  3KUY D;  3MGP A;  3AZN A;  2Y2O A;  2ZY4 A;  1T3U A;  5GT3 B;  4ZUX A;  3C1C C;  4YS3 D;  3WKJ B;  2Y2J A;  3AZK D;  2Y2L A;  5B2I B;  3X1V C;  5AV9 B;  3REK A;  1N1J B;  4CSR B;  4YM6 A;  1P3B D;  3A6N B;  2G5H C;  5G49 A;  1KX3 A;  1KX4 B;  5B1L B;  4QLC D;  3AZJ A;  1P3A A;  1EQZ D;  1TAF B;  4XUJ B;  3VH6 A;  2F8N H;  1BFM A;  2Y2P A;  1HTA A;  1AOI A;  3MGS A;  3KXB A;  1P3F A;  1M18 D;  3X1S A;  3LJA B;  1A7W A;  3AZG B;  5GT3 C;  3WKJ C;  4WNN B;  5F99 B;  3X1U A;  3W99 D;  3X1T A;  5CPK D;  5AV5 D;  5B32 G;  5B2I C;  3W97 A;  3UTA D;  5AV9 C;  1BH8 A;  3AV2 D;  3A6N C;  5BT1 D;  1KX4 C;  1S32 D;  5B1L C;  3AYW D;  5B0Y D;  5B31 D;  4NE6 A;  4H9Q A;  4Z5T B;  4XUJ C;  4CAY A;  5AY8 D;  4J8W A;  3LZ0 A;  3AZN D;  5DNN A;  2BYM B;  3AZF A;  2VQR A;  3LJA C;  3AZG C;  4Z66 A;  5GSU B;  3AZM A;  5B40 A;  2L5A A;  3VH5 A;  3B0D B;  3MGR A;  3REK D;  1H3O A;  2RIQ A;  5CPI B;  3WAA A;  5B1M D;  2RVQ C;  1P3A D;  5B32 A;  1M19 D;  1U35 A;  5BO0 B;  3WA9 A;  4Z5T C;  2CV5 A;  1P3I B;  1KX5 D;  5B24 A;  3TU4 D;  2YFV A;  5AV6 A;  4UUZ B;  3LZ1 A;  3H0R C;  1P3F D;  4KGC B;  3X1S D;  1P3O A;  1ID3 D;  5DNM B;  1F66 A;  2JCH A;  5GSU C;  4JJN D;  3AZE B;  5BNX A;  2G5I C;  3KFU G;  5GT0 B;  3B0D C;  3X1T D;  4J8V A;  4X23 A;  5CPI C;  4H9R A;  2JSS A;  4H9S C;  1P3P A;  5JA4 A;  4XZQ D;  3O62 A;  5B2J D;  4M6B A;  3MGQ A;  3C1B A;  5AVC D;  3AFA B;  4H9P A;  4J8W D;  5FUG A;  1ZLA A;  3WTP D;  3LZ0 D;  5DNN D;  2PYO D;  4H9O A;  3MVD A;  3KUY A;  3AZF D;  4KGC C;  1TZY D;  4Z66 D;  3AZM D;  5DNM C;  5B40 D;  3AZE C;  3AZL A;  5GT0 C;  1BH9 A;  4YS3 A;  5GXQ D;  4WU9 D;  3MGR D;  2BG1 A;  1JFI A;  3NQJ B;  5B31 G;  5C3I B;  1P3B A;  3WAA D;  3LEL B;  4H9N A;  1P34 B;  1P3G B;  3REJ D;  1EQZ A;  3AFA C;  4E45 A;  3H0L C;  4HGA B;  3LZ1 D;  4J8U D;  4NE5 A;  2ZY5 A;  2FFF B;  1P3O D;  3B6G D;  4J8X B;  1F66 D;  2FJ7 B;  3REL B;  3C1C B;  4Z2M G;  3W99 A;  4QLC B;  5CPK A;  5KDM A;  5B33 B;  1P3P D;  3V9R A;  3UTA A;  5C3I C;  3R45 B;  3REI B;  3LEL C;  2HIO B;  1P34 C;  1P3G C;  3REH D;  4WU8 D;  3B6F B;  4HGA C;  1ZLA D;  1M18 B;  2F2A C;  3MVD D;  5AY8 A;  5CPJ A;  3WTP E;  3MNN D;  2Y2H A;  5BNV A;  3EPJ A;  4J8X C;  5AV8 D;  2FJ7 C;  5AV5 B;  3AZL D;  3REL C;  3AV1 D;  4AWL B;  3AV2 B;  1P3K B;  4DRB A;  3AN2 D;  5BS7 A;  4QLC C;  1Q9C A;  5CHL B;  5B33 C;  3AYW B;  5B0Y B;  5B0Z A;  3REI C;  2HIO C;  5B1M A;  3MGP B;  3AZI D;  3AZN B;  5AV9 A;  1M19 A;  4CSR A;  3B6F C;  1M1A A;  4DRA A;  1M18 C;  2ARO D;  4ZUX B;  5AVB D;  1KX4 A;  2NQB A;  1KX5 A;  4LD9 A;  3TU4 A;  4R8P A;  3W98 D;  5AV5 C;  1ID3 A;  3REK B;  4J8W B;  4YM6 B;  5JRG A;  3A1K A;  4JJN A;  4AWL C;  2J8P A;  5G49 B;  3AV2 C;  1P3K C;  1KX3 B;  3AZJ B;  5BT1 C;  1W2E A;  3AZG A;  3AYW C;  5B0Y C;  2Y2I A;  5F99 A;  4XZQ A;  4WJ3 C;  5B2J A;  3X1V D;  3MGP C;  3AZH A;  3AZN C;  1AOI B;  5AVC A;  3MGS B;  3KXB B;  1P3F B;  1P3M A;  3X1S B;  4ZUX C;  4WZS B;  3WTP A;  5CPJ D;  5E5A A;  3X1U B;  3UTB A;  2PYO A;  5CP6 A;  2F8N G;  4Z5T A;  3X1T B;  1HQ3 A;  1TZY A;  3W97 B;  3REK C;  1BH8 B;  4YM6 C;  3KWQ A;  1KX3 C;  5GXQ A;  3AZJ C;  4WU9 A;  2HUE B;  3VH6 W;  5GT3 D;  5B0Z D;  1WWI A;  4H9Q B;  4CAY B;  5B2I D;  3LZ0 B;  5DNN B; 
#chains in the Genus database with same CATH homology
 3AZF B;  3REJ A;  1M1A D;  3MGS C;  1AOI C;  3KXB C;  1P3F C;  1KX4 D;  3X1S C;  3IP4 C;  2NQB D;  5B1L D;  3AZM B;  4LD9 D;  3X1U C;  4R8P D;  4XUJ D;  4J8U A;  3X1T C;  2NZD A;  3MGR B;  3UT9 B;  2F8N K;  1P3I A;  1H3O B;  4G92 B;  3B6G A;  3W97 C;  5JRG D;  2Y2N A;  4WV4 B;  2F8N A;  3P5J B;  4ZBJ B;  3AZG D;  2HUE C;  5B32 B;  1U35 B;  3WA9 B;  5F99 D;  2CV5 B;  5B24 B;  2YFW A;  4J8W C;  2YFV B;  3AZH D;  3LZ0 C;  5AV6 B;  5DNN C;  3LZ1 B;  3REH A;  3W96 A;  4WU8 A;  1P3M D;  3AZF C;  3VH5 W;  1P3O B;  1F66 B;  3AZM C;  5E5A D;  5BNX B;  3UTB D;  5CP6 D;  4Z5T D;  4J8V B;  1HQ3 D;  3NQU A;  3AFA A;  3B0C T;  1P3L B;  3MNN A;  3MGR C;  3UT9 C;  4X23 B;  1B6W A;  3FDD A;  5AV8 A;  4G92 C;  3KWQ D;  4H9R B;  1P3P B;  3AV1 A;  3O62 B;  4UPK A;  3H0M C;  4ZBJ C;  2IO5 B;  3MGQ B;  3C1B B;  5B32 C;  3AN2 A;  1U35 C;  3WA9 C;  4H9P B;  4KHA A;  2CV5 C;  5FUG B;  1ZLA B;  5B24 C;  3KUY B;  3MVD B;  5AV6 C;  5CPI D;  3AL0 C;  3LZ1 C;  3AZI A;  1P3O C;  1F66 C;  2ZY3 A;  3LEL A;  2ARO A;  5AVB A;  1BH9 B;  4YS3 B;  4J8V C;  3AZK B;  2NZD D;  4KUD A;  1P3I D;  1P3L C;  4X23 C;  1JFI B;  3W98 A;  1P3P C;  2F8N D;  3O62 C;  4KGC D;  2XD1 A;  1P3B B;  2BYK B;  4H9N B;  2IO5 C;  3MGQ C;  5DNM D;  3C1B C;  4J8X A;  2FJ7 A;  2Y2Q A;  1EQZ B;  3C1C A;  1ZLA C;  3KUY C;  3MVD C;  3W96 D;  3X1V A;  3REI A;  3AFA D;  4YS3 C;  3AZK C;  2UWX A;  3W99 B;  5CPK B;  5KDM B;  4G91 B;  3V9R B;  3UTA B;  1P3B C;  1S32 B;  5GT3 A;  1EQZ C;  5B31 B;  1B67 A;  3WKJ A;  2DF4 C;  3VH6 T;  5AY8 B;  5B2I A;  5CPJ B;  1N1J A;  5BNV B;  3A6N A;  3LEL D;  3KSY A;  1P34 D;  1P3G D;  5B1L A;  1TAF A;  4KUD D;  4XUJ A;  3W99 C;  5CPK C;  3A1I A;  4G91 C;  5B0Z B;  3UTA C;  4J8X D;  5B1M B;  2Y2M A;  2FJ7 D;  1S32 C;  1P3A B;  3REL D;  3LJA A;  3C1C D;  1M19 B;  5B31 C;  2ZM5 A;  2Y2G A;  4WNN A;  1M1A B;  2NQB B;  1KX5 B;  5B33 D;  5AY8 C;  3TU4 B;  4LD9 B;  5CPJ C;  4R8P B;  3REI D;  2HIO D;  3EPL A;  1ID3 B;  3B0B A;  2W8S A;  4NE3 A;  5JRG B;  4JJN B;  3B6F D;  3VH5 T;  1WWS A;  5BS7 C;  5B0Z C;  1F1E A;  2BYM A;  4XZQ B;  5B1M C;  5B2J B;  4E44 A;  1P3A C;  3AZH B;  1M19 C;  3WKJ D;  5GSU A;  5AVC B;  1P3K D;  1P3M B;  1M1A C;  2NQB C;  3F6T A;  1KX5 C;  3WTP B;  2DQN C;  3TU4 C;  4LD9 C;  5E5A B;  2PYO B;  3EG5 B;  3UTB B;  5CP6 B;  5CPI A;  3A6N D;  4R8P C;  4DQY B;  4H9S A;  1HQ3 B;  1TZY B;  4Z66 B;  1ID3 C;  3MGP D;  5B40 B;  5JRG C;  3KWQ B;  4JJN C;  5BO0 A;  5GXQ B;  4WU9 B;  4ZUX D;  4UUZ A;  5F99 C;  4XZQ C;  4KGC A;  3WAA B;  5B2J C;  3LJA D;  3UT9 A;  5DNM A;  2CWE A;  4YM6 D;  3AZH C;  3REJ B;  3AZE A;  5AVC C;  1P3M C;  1KX3 D;  5GT0 A;  3AZJ D;  3WTP C;  5E5A C;  1Z2C B;  3UTB C;  4J8U B;  5CP6 C;  2PYO C;  1HQ3 C;  2NZD B;  1TZY C;  2RVQ D;  3B6G B;  4Z66 C;  1R4V A;  5B40 C;  3KWQ C;  1AOI D;  2F8N B;  3MGS D;  3KXB D;  1PZR A;  5GXQ C;  4WU9 C;  3X1U D;  5JA4 B;  2YFW B;  3WAA C;  1P3L A;  3W97 D;  5GSU D;  3REH B;  4WU8 B;  3W96 B;  3REJ C;  4H9O B;  4J8U C;  3NQU B;  3NQJ A;  2NZD C;  3MNN B;  3B6G C;  1P3I C;  5AV8 B;  1P34 A;  1P3G A;  3EPH A;  3AZL B;  4NFT A;  5AV9 D;  2LY8 A;  3AV1 B;  2JE5 A;  1ULY A;  2ZY2 A;  3AN2 B;  4Z2M H;  4EO5 B;  2Y2K A;  4KHA B;  3AZK A;  3UT9 D;  3REH C;  3AZI B;  3W96 C;  3AZE D;  3REL A;  4WU8 C;  5GT0 D;  2BYK A;  5B32 D;  2ARO B;  1U35 D;  5AVB B;  3WA9 D;  4QLC A;  5B33 A;  4KUD B;  2CV5 D;  3R45 A;  3MNN C;  5B24 D;  3W98 B;  5AV8 C;  2HIO A;  5AV6 D;  3AZL C;  3AV1 C;  3B6F A;  3AN2 C;  1M18 A;  4EO5 C;  4J8V D;  1P3L D;  2XD5 A;  4X23 D;  5AV5 A;  3X1V B;  3AZI C;  3O62 D;  3AV2 A;  3MGQ D;  3C1B D;  1KU5 A;  1P3K A;  2ARO C;  5AVB C;  1S32 A;  3AYW A;  3EPK A;  5B0Y A;  5B31 A;  4KUD C;  3B0C W;  3W98 C;  3KUY D;  3MGP A;  3AZN A;  2Y2O A;  2ZY4 A;  1T3U A;  5GT3 B;  4ZUX A;  3C1C C;  4YS3 D;  3WKJ B;  2Y2J A;  3AZK D;  2Y2L A;  5B2I B;  3X1V C;  5AV9 B;  3REK A;  1N1J B;  4CSR B;  4YM6 A;  1P3B D;  3A6N B;  2G5H C;  5G49 A;  1KX3 A;  1KX4 B;  5B1L B;  4QLC D;  3AZJ A;  1P3A A;  1EQZ D;  1TAF B;  4XUJ B;  3VH6 A;  2F8N H;  1BFM A;  2Y2P A;  1HTA A;  1AOI A;  3MGS A;  3KXB A;  1P3F A;  1M18 D;  3X1S A;  3LJA B;  1A7W A;  3AZG B;  5GT3 C;  3WKJ C;  4WNN B;  5F99 B;  3X1U A;  3W99 D;  3X1T A;  5CPK D;  5AV5 D;  5B32 G;  5B2I C;  3W97 A;  3UTA D;  5AV9 C;  1BH8 A;  3AV2 D;  3A6N C;  5BT1 D;  1KX4 C;  1S32 D;  5B1L C;  3AYW D;  5B0Y D;  5B31 D;  4NE6 A;  4H9Q A;  4Z5T B;  4XUJ C;  4CAY A;  5AY8 D;  4J8W A;  3LZ0 A;  3AZN D;  5DNN A;  2BYM B;  3AZF A;  2VQR A;  3LJA C;  3AZG C;  4Z66 A;  5GSU B;  3AZM A;  5B40 A;  2L5A A;  3VH5 A;  3B0D B;  3MGR A;  3REK D;  1H3O A;  2RIQ A;  5CPI B;  3WAA A;  5B1M D;  2RVQ C;  1P3A D;  5B32 A;  1M19 D;  1U35 A;  5BO0 B;  3WA9 A;  4Z5T C;  2CV5 A;  1P3I B;  1KX5 D;  5B24 A;  3TU4 D;  2YFV A;  5AV6 A;  4UUZ B;  3LZ1 A;  3H0R C;  1P3F D;  4KGC B;  3X1S D;  1P3O A;  1ID3 D;  5DNM B;  1F66 A;  2JCH A;  5GSU C;  4JJN D;  3AZE B;  5BNX A;  2G5I C;  3KFU G;  5GT0 B;  3B0D C;  3X1T D;  4J8V A;  4X23 A;  5CPI C;  4H9R A;  2JSS A;  4H9S C;  1P3P A;  5JA4 A;  4XZQ D;  3O62 A;  5B2J D;  4M6B A;  3MGQ A;  3C1B A;  5AVC D;  3AFA B;  4H9P A;  4J8W D;  5FUG A;  1ZLA A;  3WTP D;  3LZ0 D;  5DNN D;  2PYO D;  4H9O A;  3MVD A;  3KUY A;  3AZF D;  4KGC C;  1TZY D;  4Z66 D;  3AZM D;  5DNM C;  5B40 D;  3AZE C;  3AZL A;  5GT0 C;  1BH9 A;  4YS3 A;  5GXQ D;  4WU9 D;  3MGR D;  2BG1 A;  1JFI A;  3NQJ B;  5B31 G;  5C3I B;  1P3B A;  3WAA D;  3LEL B;  4H9N A;  1P34 B;  1P3G B;  3REJ D;  1EQZ A;  3AFA C;  4E45 A;  3H0L C;  4HGA B;  3LZ1 D;  4J8U D;  4NE5 A;  2ZY5 A;  2FFF B;  1P3O D;  3B6G D;  4J8X B;  1F66 D;  2FJ7 B;  3REL B;  3C1C B;  4Z2M G;  3W99 A;  4QLC B;  5CPK A;  5KDM A;  5B33 B;  1P3P D;  3V9R A;  3UTA A;  5C3I C;  3R45 B;  3REI B;  3LEL C;  2HIO B;  1P34 C;  1P3G C;  3REH D;  4WU8 D;  3B6F B;  4HGA C;  1ZLA D;  1M18 B;  2F2A C;  3MVD D;  5AY8 A;  5CPJ A;  3WTP E;  3MNN D;  2Y2H A;  5BNV A;  3EPJ A;  4J8X C;  5AV8 D;  2FJ7 C;  5AV5 B;  3AZL D;  3REL C;  3AV1 D;  4AWL B;  3AV2 B;  1P3K B;  4DRB A;  3AN2 D;  5BS7 A;  4QLC C;  1Q9C A;  5CHL B;  5B33 C;  3AYW B;  5B0Y B;  5B0Z A;  3REI C;  2HIO C;  5B1M A;  3MGP B;  3AZI D;  3AZN B;  5AV9 A;  1M19 A;  4CSR A;  3B6F C;  1M1A A;  4DRA A;  1M18 C;  2ARO D;  4ZUX B;  5AVB D;  1KX4 A;  2NQB A;  1KX5 A;  4LD9 A;  3TU4 A;  4R8P A;  3W98 D;  5AV5 C;  1ID3 A;  3REK B;  4J8W B;  4YM6 B;  5JRG A;  3A1K A;  4JJN A;  4AWL C;  2J8P A;  5G49 B;  3AV2 C;  1P3K C;  1KX3 B;  3AZJ B;  5BT1 C;  1W2E A;  3AZG A;  3AYW C;  5B0Y C;  2Y2I A;  5F99 A;  4XZQ A;  4WJ3 C;  5B2J A;  3X1V D;  3MGP C;  3AZH A;  3AZN C;  1AOI B;  5AVC A;  3MGS B;  3KXB B;  1P3F B;  1P3M A;  3X1S B;  4ZUX C;  4WZS B;  3WTP A;  5CPJ D;  5E5A A;  3X1U B;  3UTB A;  2PYO A;  5CP6 A;  2F8N G;  4Z5T A;  3X1T B;  1HQ3 A;  1TZY A;  3W97 B;  3REK C;  1BH8 B;  4YM6 C;  3KWQ A;  1KX3 C;  5GXQ A;  3AZJ C;  4WU9 A;  2HUE B;  3VH6 W;  5GT3 D;  5B0Z D;  1WWI A;  4H9Q B;  4CAY B;  5B2I D;  3LZ0 B;  5DNN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...