4KUDA

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
96
structure length
96
Chain Sequence
PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein/transcription/dna
total genus 29
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kudA00
2PYOD 3AN2D 5DNND 4J8WA 4WU8A 5B1LC 5B0ZC 3AZJC 3MGQA 1AOIA 3B6FD 4XUJB 3AV1D 4YS3B 5B24B 3AZLA 4Z5TD 5AVCD 3B0DB 1P3OA 4J8WC 4WU8C 3O62A 3W98A 1KX4A 1P3BA 3AZLC 1P3PB 1TZYC 3AZKB 5B32G 5B2JD 3O62C 2AROA 4ZUXA 3UTBC 1P3BC 3TU4D 1KX4C 3W98C 3REHD 1P3IA 5CP6B 4CSRA 4KUDD 4H9NA 1P3LD 4WU9A 3REKB 1F66D 2RVQD 1TAFB 4JJND 3B6GD 4KGCD 1P3IC 5B2IA 4H9QB 5AV9A 3AZIA 1A7WA 2PYOA 3AN2A 5DNNA 4Z66D 4KHAA 1P3GD 3B6FA 3AV1A 1BH9B 1M1AD 5B2IC 4Z5TA 5AVCA 3WAAB 3AZIC 3AN2C 1F1EA 5GT3D 3B6FC 5GXQD 3AV1C 3C1CB 5CPKB 4CAYB 4Z5TC 3LZ0D 2HIOC 4QLCB 3LZ1B 1P34B 3W96B 1M19B 5B2JA 5GSUC 3VH6A 3TU4A 3REHA 5AV5D 1KU5A 4KUDA 4WV4B 5BNVA 1P3LA 1P3PD 1F66A 3VH6T 3TU4C 3MNND 4JJNA 3REHC 3B6GA 4KGCA 3AV2B 2NZDB 4X23C 3AZHB 3AZFB 1WWIA 1F66C 1EQZD 4Z66A 2BYKA 1P3GA 4JJNC 3B6GC 5CPJB 4KGCC 1M1AA 3B0BA 4HGAC 3UT9D 3AZGD 5AV6B 4H9RA 4Z66C 5BO0B 1P3GC 5GT3A 5GXQA 1M1AC 5JRGD 5DNMB 5B0YD 3LZ0A 3MVDB 3NQJB 1KX3C 3WAAD 4Z2MH 5GT3C 5GXQC 5AV5A 4XUJC 2JSSA 5B24C 1P3PA 5GT0D 3B0DC 3X1SB 3WTPD 3W97B 3MNNA 4M6BA 3V9RB 5AV5C 1P3PC 3WKJA 1EQZA 5C3IB 3AZEB 3MGRD 4J8XB 1ZLAA 3AYWD 3UT9A 5CP6C 3AZGA 3AV2D 1EQZC 4R8PB 2F8NK 3REKC 5JRGA 5B0YA 3UT9C 1HQ3B 4G92B 3AZGC 3UTAB 3WAAA 1M18B 4AWLB 2CV5B 5JRGC 1TZYD 3AZNB 5BT1D 5B0YC 3UTBD 3KSYA 3AZMB 4YM6B 5B31B 3X1TD 3WAAC 4CAYA 5GT0A 1N1JB 3WTPA 3KXBB 1H3OB 1P3KB 5CPID 1B6WA 3KUYA 5GT0C 3WTPC 5AVBB 3REIB 3MGRA 4XZQB 1M19C 3AYWA 5B1MB 5BNXA 3AV2A 1S32D 3X1VB 3MGRC 4NE6A 3AYWC 5B40B 4H9PA 3AV2C 2F8NH 2HIOD 5B33B 1TZYA 4R8PD 3UTBA 5GSUD 5AV8B 1ULYA 3AFAD 1WWSA 3X1TA 2YFWA 3LELD 1HQ3D 4UUZB 3NQJA 5JA4B 5AV6C 1R4VA 5BT1C 3MGSB 2F8ND 5F99B 3X1TC 5CPIA 5B32B 4X23D 3B0CT 3W99B 5FUGA 4J8UB 4WNNB 5CPIC 4NFTA 1S32A 3X1UD 1P3AB 1KX5B 3REJB 3VH5A 5AVBD 4XZQD 4ZBJB 5AY8D 1S32C 2HIOA 1KX3D 3VH5T 3NQUA 5E5AB 5BS7A 4R8PA 4J8XC 5GSUA 3AFAA 3LELA 1HQ3A 5G49B 4XUJD 4G91C 4YS3D 1JFIA 5B24D 5B33D 4R8PC 5BS7C 2F8NA 2HUEB 3AFAC 3LELC 2IO5B 1HQ3C 4G92C 4X23A 3LJAB 2FJ7B 3AZKD 1P3FB 3X1UA 5B31C 3MGPB 5CP6D 5B32D 2BYMA 4E45A 5AVBA 3KXBC 4XZQA 3REKD 1BH8B 5AY8A 4J8UD 3X1UC 4Z2MG 1BFMA 2YFVA 1KX3A 1ID3B 4H9OB 5AVBC 3REIC 5KDMA 4H9SC 4XZQC 5AY8C 3A6NB 5B1MC 3WA9B 4LD9B 4XUJA 4YS3A 5B24A 5B1LB 5B33A 5B0ZB 3VH6W 1HTAA 4YS3C 3C1CD 5B40C 5CPKD 4J8WB 4WU8B 3LZ1D 4QLCD 5B33C 4UUZA 3MGQB 1AOIB 1P34D 3W96D 3AZKA 1M19D 1P3OB 5CP6A 3O62B 3W98B 3KWQB 3AZKC 3REKA 4J8UA 2FJ7D 1TAFA 4WNNA 5B32C 2NZDD 2AROB 4H9QA 4ZUXB 3AZHD 3MGPD 3AZFD 1P3IB 4J8UC 4CSRB 5CPJD 1BH9A 4WU9B 2NQBB 4J8VB 1P3AC 5AV6D 1ID3D 3REJC 5B2IB 5AV9B 3AZIB 3C1CA 5CPKA 4NE5A 4ZBJC 2PYOB 5DNNB 5DNMD 3LZ1A 4QLCA 3MVDD 5G49A 3B6FB 1P34A 3AV1B 3W96A 3RELB 1M19A 4Z5TB 5AVCB 3C1CC 5CPKC 3LZ1C 4QLCC 1P34C 3C1BB 3W96C 4DRAA 3X1SD 2HUEC 2FJ7A 3W97D 2NZDA 5B2JB 3AZHA 3MGPA 3REHB 3AZFA 5B2ID 2FJ7C 3AZED 2LY8A 3KWQD 4J8XD 5CPJA 1P3FC 1P3LB 4KUDB 2NZDC 1F66B 3AZHC 4WZSB 3MGPC 3AZFC 3B6GB 4KGCB 5AV6A 1ID3A 5BO0A 4HGAB 5CPJC 5DNMA 4Z66B 3MVDA 2BYKB 1P3GB 2NQBD 4J8VD 3UTAD 1ID3C 1M18D 2CV5D 3AZND 5DNMC 4H9RB 3MVDC 3AZMD 5GXQB 4YM6D 5B31D 3LZ0B 3X1SA 3W97A 3KXBD 3V9RA 3RELD 1P3KD 5AV5B 3MGQC 1AOIC 3X1SC 3C1BD 3W97C 3REID 3KWQA 3AZEA 4J8XA 5B1MD 1P3OC 3MNNB 5C3IC 3AZEC 3KWQC 3X1VD 3WKJB 1EQZB 5B40D 1ZLAB 2NQBA 4J8VA 3UTAA 2AROC 4ZUXC 1P3MB 1M18A 3UT9B 3B0CW 2CV5A 3AZGB 3AZNA 3AZMA 5AV8D 1U35B 4YM6A 4WU9C 2NQBC 4J8VC 5B31A 3UTAC 5JRGB 3R45B 1M18C 5B0YB 4AWLC 1N1JA 2CV5C 3KXBA 2CWEA 3AZNC 3MGSD 3RELA 5AV9C 3AZMC 1H3OA 5F99D 4YM6C 1P3KA 5DNNC 2PYOC 3C1BA 3REIA 3VH5W 4H9SA 3RELC 3W99D 5AVCC 5GT0B 5B1MA 4EO5B 3WTPB 1P3KC 3C1BC 1P3AD 3X1VA 5CHLB 1KX5D 3KUYB 3REJD 5B40A 3MGRB 5B2JC 3AYWB 3AZJB 3X1VC 3WTPE 5BNXB 5E5AD 4KUDC 5AV8A 1P3LC 1Q9CA 3WKJD 2RVQC 5JA4A 1ZLAD 4H9PB 3AZLB 3MGSA 1P3MD 5AV8C 5F99A 1TZYB 5B32A 3UTBB 1U35D 1KX4B 1P3BB 3MGSC 3X1TB 2YFWB 3LJAD 3W99A 5F99C 1P3FD 1P3AA 5CPIB 1KX5A 3W99C 3LZ0C 3REJA 4H9NB 5FUGB 1KX5C 1S32B 5E5AA 3KUYD 3A6ND 3AN2B 3WA9D 4LD9D 4KHAB 3MNNC 5B1LD 5B0ZD 5E5AC 3AZJD 1P3MA 2HIOB 4G91B 4NE3A 3WKJC 3NQUB 1U35A 1ZLAC 5GSUB 4J8WD 4WU8D 3AFAB 3R45A 3LELB 3LJAA 3MGQD 1P3MC 1AOID 1JFIB 2F8NG 1P3FA 3AZLD 2IO5C 1U35C 2F8NB 2L5AA 1P3OD 3TU4B 5B31G 3LJAC 3O62D 3W98D 1KX4D 1P3BD 4DRBA 4X23B 4E44A 5BNVB 1BH8A 4JJNB 4H9OA 2AROD 4ZUXD 3X1UB 1P3ID 3A6NA 2BYMB 3WA9A 4EO5C 4LD9A 1B67A 4WU9D 1M1AB 5AY8B 5B1LA 5B0ZA 3AZJA 3KUYC 3A6NC 2YFVB 1KX3B 3WA9C 5AV9D 4LD9C 3AZID 5GT3B 5KDMB
chains in the Genus database with same CATH superfamily
2PYOD 3AN2D 5DNND 4J8WA 4WU8A 2XD5A 5B1LC 5B0ZC 3MGQA 3AZJC 1AOIA 3B6FD 3EG5B 4XUJB 3AV1D 4YS3B 5B24B 3AZLA 4Z5TD 5AVCD 3B0DB 1P3OA 4J8WC 4WU8C 3O62A 3W98A 1KX4A 1P3BA 3AZLC 1P3PB 1TZYC 3AZKB 5B32G 5B2JD 3O62C 2AROA 4ZUXA 3UTBC 1P3BC 3TU4D 1KX4C 3W98C 3REHD 1P3IA 5CP6B 4CSRA 4KUDD 4H9NA 1P3LD 4WU9A 3REKB 1F66D 2RVQD 1TAFB 4JJND 3B6GD 4KGCD 1P3IC 5B2IA 4H9QB 5AV9A 3AZIA 1A7WA 2PYOA 3AN2A 5DNNA 4Z66D 4KHAA 1P3GD 3B6FA 3AV1A 1BH9B 1M1AD 5B2IC 4Z5TA 5AVCA 3WAAB 3AZIC 2VQRA 3AN2C 1F1EA 5GT3D 3B6FC 5GXQD 3AV1C 3C1CB 5CPKB 4WJ3C 4CAYB 4Z5TC 3LZ0D 2HIOC 4QLCB 3LZ1B 1P34B 3W96B 1M19B 5B2JA 5GSUC 3VH6A 3TU4A 3REHA 5AV5D 1KU5A 4KUDA 4WV4B 5BNVA 3IP4C 1P3LA 1P3PD 1F66A 3VH6T 3TU4C 3MNND 4JJNA 3REHC 3B6GA 4KGCA 3AV2B 2NZDB 4X23C 3AZHB 3AZFB 1WWIA 1F66C 1EQZD 4Z66A 2BYKA 1P3GA 4JJNC 3B6GC 5CPJB 4KGCC 1M1AA 3B0BA 4HGAC 3UT9D 3AZGD 5AV6B 4H9RA 4Z66C 5BO0B 1P3GC 5GT3A 5GXQA 1M1AC 5JRGD 5DNMB 5B0YD 3LZ0A 3MVDB 3NQJB 1KX3C 3WAAD 4Z2MH 5GT3C 5GXQC 5AV5A 4XUJC 2JSSA 5B24C 1P3PA 5GT0D 3B0DC 3X1SB 3WTPD 3W97B 3MNNA 4M6BA 3V9RB 5AV5C 3H0RC 2F2AC 1P3PC 3WKJA 1EQZA 5C3IB 3AZEB 3MGRD 4J8XB 1ZLAA 3AYWD 3UT9A 5CP6C 3AZGA 3AV2D 1EQZC 4R8PB 2F8NK 3REKC 5JRGA 5B0YA 3UT9C 1HQ3B 4G92B 3AZGC 3UTAB 3WAAA 2W8SA 1M18B 5AV9D 4AWLB 2CV5B 5JRGC 1TZYD 3AZNB 5BT1D 5B0YC 3UTBD 2Y2NA 3KSYA 3AZMB 4YM6B 5B31B 3X1TD 3WAAC 2UWXA 4CAYA 5GT0A 1N1JB 3WTPA 1W2EA 3KXBB 1H3OB 1P3KB 5CPID 1B6WA 3KUYA 5GT0C 3H0LC 3WTPC 5AVBB 3REIB 3MGRA 4XZQB 1M19C 3AYWA 5B1MB 5BNXA 3AV2A 1S32D 3X1VB 3MGRC 4NE6A 3AYWC 5B40B 4H9PA 3AV2C 2F8NH 2HIOD 5B33B 1TZYA 4R8PD 3UTBA 5GSUD 5AV8B 3H0MC 1ULYA 3AFAD 1WWSA 2Y2JA 3X1TA 2YFWA 3LELD 1HQ3D 4UUZB 3NQJA 5JA4B 5AV6C 1R4VA 1PZRA 5BT1C 3MGSB 2F8ND 5F99B 3X1TC 5CPIA 5B32B 4X23D 2Y2OA 3B0CT 3W99B 5FUGA 4J8UB 4WNNB 5CPIC 4NFTA 1S32A 3X1UD 1P3AB 1KX5B 3REJB 3VH5A 5AVBD 4XZQD 4ZBJB 5AY8D 1S32C 2HIOA 1KX3D 3VH5T 3NQUA 3P5JB 5E5AB 5BS7A 4R8PA 5GSUA 4J8XC 3AFAA 3LELA 1HQ3A 5G49B 4XUJD 4G91C 4YS3D 1JFIA 5B24D 5B33D 4R8PC 5BS7C 2F8NA 2HUEB 3AFAC 3LELC 2IO5B 1HQ3C 4G92C 4X23A 3LJAB 2FJ7B 3AZKD 1P3FB 3X1UA 5B31C 3MGPB 5CP6D 5B32D 2BYMA 4E45A 5AVBA 3KXBC 4XZQA 3REKD 1BH8B 5AY8A 4J8UD 3X1UC 4Z2MG 1BFMA 2YFVA 1KX3A 1ID3B 4H9OB 5AVBC 3REIC 5KDMA 4H9SC 4XZQC 5AY8C 3A6NB 5B1MC 2BG1A 2JE5A 3WA9B 2J8PA 4LD9B 4XUJA 4YS3A 5B24A 5B1LB 5B33A 5B0ZB 3VH6W 1HTAA 4YS3C 3C1CD 5B40C 5CPKD 4J8WB 4WU8B 3LZ1D 4QLCD 5B33C 4UUZA 3MGQB 1AOIB 1P34D 3W96D 3AZKA 1M19D 1P3OB 5CP6A 3O62B 3W98B 3KWQB 3AZKC 3REKA 4J8UA 2FJ7D 1TAFA 4WNNA 2XD1A 5B32C 2NZDD 2AROB 4H9QA 4ZUXB 3AZHD 3MGPD 3AZFD 1P3IB 4J8UC 4CSRB 5CPJD 1BH9A 4WU9B 2NQBB 4J8VB 1P3AC 5AV6D 1ID3D 3REJC 5B2IB 5AV9B 3AZIB 3C1CA 5CPKA 4NE5A 4ZBJC 2PYOB 3FDDA 5DNNB 5DNMD 3LZ1A 4QLCA 3MVDD 5G49A 1Z2CB 2JCHA 1P34A 3AV1B 3B6FB 3W96A 3RELB 1M19A 4Z5TB 5AVCB 2G5IC 3C1CC 5CPKC 3LZ1C 2RIQA 4QLCC 1P34C 3C1BB 3W96C 2G5HC 4DRAA 3X1SD 2HUEC 2FJ7A 3W97D 2NZDA 5B2JB 3AZHA 3MGPA 3REHB 3AZFA 2Y2HA 2FJ7C 3AZED 2LY8A 3KWQD 2Y2IA 4J8XD 5CPJA 1P3LB 1P3FC 4KUDB 2NZDC 1F66B 3AZHC 4WZSB 3MGPC 3AZFC 3B6GB 4KGCB 2Y2KA 5AV6A 1ID3A 5BO0A 4HGAB 5CPJC 5DNMA 4Z66B 3MVDA 2BYKB 1P3GB 2NQBD 4J8VD 3UTAD 1ID3C 1M18D 2CV5D 3AZND 5DNMC 4H9RB 3MVDC 3AZMD 5GXQB 4YM6D 5B31D 2Y2LA 3LZ0B 3X1SA 3W97A 3KXBD 3V9RA 3RELD 1P3KD 5AV5B 3MGQC 1AOIC 3X1SC 3C1BD 3W97C 2DQNC 3REID 3KWQA 3AZEA 4J8XA 5B1MD 1P3OC 1T3UA 3MNNB 5C3IC 3AZEC 3KWQC 3X1VD 3WKJB 1EQZB 2ZY2A 5B40D 1ZLAB 2NQBA 4J8VA 3UTAA 2AROC 4ZUXC 1P3MB 1M18A 3UT9B 3B0CW 2CV5A 3AZGB 3AZNA 3A1KA 3AZMA 5AV8D 1U35B 4YM6A 4WU9C 2NQBC 4J8VC 5B31A 3UTAC 5JRGB 3R45B 1M18C 5B0YB 4AWLC 1N1JA 2ZM5A 2CV5C 3KXBA 2CWEA 3AZNC 3MGSD 3RELA 5AV9C 2ZY4A 4UPKA 3AZMC 1H3OA 5F99D 4YM6C 3A1IA 5DNNC 3EPLA 1P3KA 2PYOC 3C1BA 3REIA 3VH5W 4H9SA 3RELC 3W99D 5AVCC 5GT0B 5B1MA 4EO5B 3WTPB 1P3KC 3C1BC 1P3AD 3X1VA 5CHLB 1KX5D 3KUYB 3REJD 2FFFB 5B40A 3MGRB 5B2JC 3AYWB 3AZJB 3X1VC 3WTPE 5BNXB 5E5AD 4KUDC 5AV8A 1P3LC 1Q9CA 3WKJD 2RVQC 5JA4A 1ZLAD 3AL0C 4H9PB 3AZLB 3MGSA 1P3MD 5AV8C 5F99A 1TZYB 2Y2GA 5B32A 3UTBB 1U35D 1KX4B 1P3BB 3MGSC 3X1TB 2YFWB 3LJAD 3W99A 5F99C 1P3FD 1P3AA 5CPIB 1KX5A 3W99C 3LZ0C 2ZY3A 3REJA 4DQYB 4H9NB 5FUGB 1KX5C 1S32B 3EPHA 5E5AA 2DF4C 3KUYD 3A6ND 3AN2B 3WA9D 4LD9D 4KHAB 3MNNC 5B1LD 5B0ZD 5E5AC 3AZJD 1P3MA 2HIOB 3KFUG 4G91B 4NE3A 3WKJC 3NQUB 2Y2PA 1U35A 5GSUB 1ZLAC 4J8WD 4WU8D 3AFAB 3R45A 3LELB 3LJAA 3F6TA 3MGQD 1P3MC 1JFIB 1AOID 2F8NG 1P3FA 3AZLD 2IO5C 2ZY5A 1U35C 2F8NB 2L5AA 1P3OD 3TU4B 5B31G 3LJAC 3EPJA 3O62D 3W98D 1KX4D 1P3BD 4DRBA 4X23B 4E44A 5BNVB 1BH8A 3EPKA 4JJNB 4H9OA 2AROD 4ZUXD 2Y2QA 3X1UB 1P3ID 3A6NA 2BYMB 3WA9A 4EO5C 4LD9A 1B67A 4WU9D 1M1AB 5AY8B 2Y2MA 5B1LA 5B0ZA 3AZJA 3KUYC 3A6NC 2YFVB 1KX3B 3WA9C 5B2ID 4LD9C 3AZID 5GT3B 5KDMB
chains in the Genus database with same CATH topology
2PYOD 3AN2D 5DNND 4J8WA 4WU8A 2XD5A 5B1LC 5B0ZC 3MGQA 3AZJC 1AOIA 3B6FD 3EG5B 4XUJB 3AV1D 4YS3B 5B24B 3AZLA 4Z5TD 5AVCD 3B0DB 1P3OA 4J8WC 4WU8C 3O62A 3W98A 1KX4A 1P3BA 3AZLC 1P3PB 1TZYC 3AZKB 5B32G 5B2JD 3O62C 2AROA 4ZUXA 3UTBC 1P3BC 3TU4D 1KX4C 3W98C 3REHD 1P3IA 5CP6B 4CSRA 4KUDD 4H9NA 1P3LD 4WU9A 3REKB 1F66D 2RVQD 1TAFB 4JJND 3B6GD 4KGCD 1P3IC 5B2IA 4H9QB 5AV9A 3AZIA 1A7WA 2PYOA 3AN2A 5DNNA 4Z66D 4KHAA 1P3GD 3B6FA 3AV1A 1BH9B 1M1AD 5B2IC 4Z5TA 5AVCA 3WAAB 3AZIC 2VQRA 3AN2C 1F1EA 5GT3D 3B6FC 5GXQD 3AV1C 3C1CB 5CPKB 4WJ3C 4CAYB 4Z5TC 3LZ0D 2HIOC 4QLCB 3LZ1B 1P34B 3W96B 1M19B 5B2JA 5GSUC 3VH6A 3TU4A 3REHA 5AV5D 1KU5A 4KUDA 4WV4B 5BNVA 3IP4C 1P3LA 1P3PD 1F66A 3VH6T 3TU4C 3MNND 4JJNA 3REHC 3B6GA 4KGCA 3AV2B 2NZDB 4X23C 3AZHB 3AZFB 1WWIA 1F66C 1EQZD 4Z66A 2BYKA 1P3GA 4JJNC 3B6GC 5CPJB 4KGCC 1M1AA 3B0BA 4HGAC 3UT9D 3AZGD 5AV6B 4H9RA 4Z66C 5BO0B 1P3GC 5GT3A 5GXQA 1M1AC 5JRGD 5DNMB 5B0YD 3LZ0A 3MVDB 3NQJB 1KX3C 3WAAD 4Z2MH 5GT3C 5GXQC 5AV5A 4XUJC 2JSSA 5B24C 1P3PA 5GT0D 3B0DC 3X1SB 3WTPD 3W97B 3MNNA 4M6BA 3V9RB 5AV5C 3H0RC 2F2AC 1P3PC 3WKJA 1EQZA 5C3IB 3AZEB 3MGRD 4J8XB 1ZLAA 3AYWD 3UT9A 5CP6C 3AZGA 3AV2D 1EQZC 4R8PB 2F8NK 3REKC 5JRGA 5B0YA 3UT9C 1HQ3B 4G92B 3AZGC 3UTAB 3WAAA 2W8SA 1M18B 5AV9D 4AWLB 2CV5B 5JRGC 1TZYD 3AZNB 5BT1D 5B0YC 3UTBD 2Y2NA 3KSYA 3AZMB 4YM6B 5B31B 3X1TD 3WAAC 2UWXA 4CAYA 5GT0A 1N1JB 3WTPA 1W2EA 3KXBB 1H3OB 1P3KB 5CPID 1B6WA 3KUYA 5GT0C 3H0LC 3WTPC 5AVBB 3REIB 3MGRA 4XZQB 1M19C 3AYWA 5B1MB 5BNXA 3AV2A 1S32D 3X1VB 3MGRC 4NE6A 3AYWC 5B40B 4H9PA 3AV2C 2F8NH 2HIOD 5B33B 1TZYA 4R8PD 3UTBA 5GSUD 5AV8B 3H0MC 1ULYA 3AFAD 1WWSA 2Y2JA 3X1TA 2YFWA 3LELD 1HQ3D 4UUZB 3NQJA 5JA4B 5AV6C 1R4VA 1PZRA 5BT1C 3MGSB 2F8ND 5F99B 3X1TC 5CPIA 5B32B 4X23D 2Y2OA 3B0CT 3W99B 5FUGA 4J8UB 4WNNB 5CPIC 4NFTA 1S32A 3X1UD 1P3AB 1KX5B 3REJB 3VH5A 5AVBD 4XZQD 4ZBJB 5AY8D 1S32C 2HIOA 1KX3D 3VH5T 3NQUA 3P5JB 5E5AB 5BS7A 4R8PA 5GSUA 4J8XC 3AFAA 3LELA 1HQ3A 5G49B 4XUJD 4G91C 4YS3D 1JFIA 5B24D 5B33D 4R8PC 5BS7C 2F8NA 2HUEB 3AFAC 3LELC 2IO5B 1HQ3C 4G92C 4X23A 3LJAB 2FJ7B 3AZKD 1P3FB 3X1UA 5B31C 3MGPB 5CP6D 5B32D 2BYMA 4E45A 5AVBA 3KXBC 4XZQA 3REKD 1BH8B 5AY8A 4J8UD 3X1UC 4Z2MG 1BFMA 2YFVA 1KX3A 1ID3B 4H9OB 5AVBC 3REIC 5KDMA 4H9SC 4XZQC 5AY8C 3A6NB 5B1MC 2BG1A 2JE5A 3WA9B 2J8PA 4LD9B 4XUJA 4YS3A 5B24A 5B1LB 5B33A 5B0ZB 3VH6W 1HTAA 4YS3C 3C1CD 5B40C 5CPKD 4J8WB 4WU8B 3LZ1D 4QLCD 5B33C 4UUZA 3MGQB 1AOIB 1P34D 3W96D 3AZKA 1M19D 1P3OB 5CP6A 3O62B 3W98B 3KWQB 3AZKC 3REKA 4J8UA 2FJ7D 1TAFA 4WNNA 2XD1A 5B32C 2NZDD 2AROB 4H9QA 4ZUXB 3AZHD 3MGPD 3AZFD 1P3IB 4J8UC 4CSRB 5CPJD 1BH9A 4WU9B 2NQBB 4J8VB 1P3AC 5AV6D 1ID3D 3REJC 5B2IB 5AV9B 3AZIB 3C1CA 5CPKA 4NE5A 4ZBJC 2PYOB 3FDDA 5DNNB 5DNMD 3LZ1A 4QLCA 3MVDD 5G49A 1Z2CB 2JCHA 1P34A 3AV1B 3B6FB 3W96A 3RELB 1M19A 4Z5TB 5AVCB 2G5IC 3C1CC 5CPKC 3LZ1C 2RIQA 4QLCC 1P34C 3C1BB 3W96C 2G5HC 4DRAA 3X1SD 2HUEC 2FJ7A 3W97D 2NZDA 5B2JB 3AZHA 3MGPA 3REHB 3AZFA 2Y2HA 2FJ7C 3AZED 2LY8A 3KWQD 2Y2IA 4J8XD 5CPJA 1P3LB 1P3FC 4KUDB 2NZDC 1F66B 3AZHC 4WZSB 3MGPC 3AZFC 3B6GB 4KGCB 2Y2KA 5AV6A 1ID3A 5BO0A 4HGAB 5CPJC 5DNMA 4Z66B 3MVDA 2BYKB 1P3GB 2NQBD 4J8VD 3UTAD 1ID3C 1M18D 2CV5D 3AZND 5DNMC 4H9RB 3MVDC 3AZMD 5GXQB 4YM6D 5B31D 2Y2LA 3LZ0B 3X1SA 3W97A 3KXBD 3V9RA 3RELD 1P3KD 5AV5B 3MGQC 1AOIC 3X1SC 3C1BD 3W97C 2DQNC 3REID 3KWQA 3AZEA 4J8XA 5B1MD 1P3OC 1T3UA 3MNNB 5C3IC 3AZEC 3KWQC 3X1VD 3WKJB 1EQZB 2ZY2A 5B40D 1ZLAB 2NQBA 4J8VA 3UTAA 2AROC 4ZUXC 1P3MB 1M18A 3UT9B 3B0CW 2CV5A 3AZGB 3AZNA 3A1KA 3AZMA 5AV8D 1U35B 4YM6A 4WU9C 2NQBC 4J8VC 5B31A 3UTAC 5JRGB 3R45B 1M18C 5B0YB 4AWLC 1N1JA 2ZM5A 2CV5C 3KXBA 2CWEA 3AZNC 3MGSD 3RELA 5AV9C 2ZY4A 4UPKA 3AZMC 1H3OA 5F99D 4YM6C 3A1IA 5DNNC 3EPLA 1P3KA 2PYOC 3C1BA 3REIA 3VH5W 4H9SA 3RELC 3W99D 5AVCC 5GT0B 5B1MA 4EO5B 3WTPB 1P3KC 3C1BC 1P3AD 3X1VA 5CHLB 1KX5D 3KUYB 3REJD 2FFFB 5B40A 3MGRB 5B2JC 3AYWB 3AZJB 3X1VC 3WTPE 5BNXB 5E5AD 4KUDC 5AV8A 1P3LC 1Q9CA 3WKJD 2RVQC 5JA4A 1ZLAD 3AL0C 4H9PB 3AZLB 3MGSA 1P3MD 5AV8C 5F99A 1TZYB 2Y2GA 5B32A 3UTBB 1U35D 1KX4B 1P3BB 3MGSC 3X1TB 2YFWB 3LJAD 3W99A 5F99C 1P3FD 1P3AA 5CPIB 1KX5A 3W99C 3LZ0C 2ZY3A 3REJA 4DQYB 4H9NB 5FUGB 1KX5C 1S32B 3EPHA 5E5AA 2DF4C 3KUYD 3A6ND 3AN2B 3WA9D 4LD9D 4KHAB 3MNNC 5B1LD 5B0ZD 5E5AC 3AZJD 1P3MA 2HIOB 3KFUG 4G91B 4NE3A 3WKJC 3NQUB 2Y2PA 1U35A 5GSUB 1ZLAC 4J8WD 4WU8D 3AFAB 3R45A 3LELB 3LJAA 3F6TA 3MGQD 1P3MC 1JFIB 1AOID 2F8NG 1P3FA 3AZLD 2IO5C 2ZY5A 1U35C 2F8NB 2L5AA 1P3OD 3TU4B 5B31G 3LJAC 3EPJA 3O62D 3W98D 1KX4D 1P3BD 4DRBA 4X23B 4E44A 5BNVB 1BH8A 3EPKA 4JJNB 4H9OA 2AROD 4ZUXD 2Y2QA 3X1UB 1P3ID 3A6NA 2BYMB 3WA9A 4EO5C 4LD9A 1B67A 4WU9D 1M1AB 5AY8B 2Y2MA 5B1LA 5B0ZA 3AZJA 3KUYC 3A6NC 2YFVB 1KX3B 3WA9C 5B2ID 4LD9C 3AZID 5GT3B 5KDMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYO D;  3AN2 D;  5DNN D;  4J8W A;  4WU8 A;  5B1L C;  5B0Z C;  3AZJ C;  3MGQ A;  1AOI A;  3B6F D;  4XUJ B;  3AV1 D;  4YS3 B;  5B24 B;  3AZL A;  4Z5T D;  5AVC D;  3B0D B;  1P3O A;  4J8W C;  4WU8 C;  3O62 A;  3W98 A;  1KX4 A;  1P3B A;  3AZL C;  1P3P B;  1TZY C;  3AZK B;  5B32 G;  5B2J D;  3O62 C;  2ARO A;  4ZUX A;  3UTB C;  1P3B C;  3TU4 D;  1KX4 C;  3W98 C;  3REH D;  1P3I A;  5CP6 B;  4CSR A;  4KUD D;  4H9N A;  1P3L D;  4WU9 A;  3REK B;  1F66 D;  2RVQ D;  1TAF B;  4JJN D;  3B6G D;  4KGC D;  1P3I C;  5B2I A;  4H9Q B;  5AV9 A;  3AZI A;  1A7W A;  2PYO A;  3AN2 A;  5DNN A;  4Z66 D;  4KHA A;  1P3G D;  3B6F A;  3AV1 A;  1BH9 B;  1M1A D;  5B2I C;  4Z5T A;  5AVC A;  3WAA B;  3AZI C;  3AN2 C;  1F1E A;  5GT3 D;  3B6F C;  5GXQ D;  3AV1 C;  3C1C B;  5CPK B;  4CAY B;  4Z5T C;  3LZ0 D;  2HIO C;  4QLC B;  3LZ1 B;  1P34 B;  3W96 B;  1M19 B;  5B2J A;  5GSU C;  3VH6 A;  3TU4 A;  3REH A;  5AV5 D;  1KU5 A;  4KUD A;  4WV4 B;  5BNV A;  1P3L A;  1P3P D;  1F66 A;  3VH6 T;  3TU4 C;  3MNN D;  4JJN A;  3REH C;  3B6G A;  4KGC A;  3AV2 B;  2NZD B;  4X23 C;  3AZH B;  3AZF B;  1WWI A;  1F66 C;  1EQZ D;  4Z66 A;  2BYK A;  1P3G A;  4JJN C;  3B6G C;  5CPJ B;  4KGC C;  1M1A A;  3B0B A;  4HGA C;  3UT9 D;  3AZG D;  5AV6 B;  4H9R A;  4Z66 C;  5BO0 B;  1P3G C;  5GT3 A;  5GXQ A;  1M1A C;  5JRG D;  5DNM B;  5B0Y D;  3LZ0 A;  3MVD B;  3NQJ B;  1KX3 C;  3WAA D;  4Z2M H;  5GT3 C;  5GXQ C;  5AV5 A;  4XUJ C;  2JSS A;  5B24 C;  1P3P A;  5GT0 D;  3B0D C;  3X1S B;  3WTP D;  3W97 B;  3MNN A;  4M6B A;  3V9R B;  5AV5 C;  1P3P C;  3WKJ A;  1EQZ A;  5C3I B;  3AZE B;  3MGR D;  4J8X B;  1ZLA A;  3AYW D;  3UT9 A;  5CP6 C;  3AZG A;  3AV2 D;  1EQZ C;  4R8P B;  2F8N K;  3REK C;  5JRG A;  5B0Y A;  3UT9 C;  1HQ3 B;  4G92 B;  3AZG C;  3UTA B;  3WAA A;  1M18 B;  4AWL B;  2CV5 B;  5JRG C;  1TZY D;  3AZN B;  5BT1 D;  5B0Y C;  3UTB D;  3KSY A;  3AZM B;  4YM6 B;  5B31 B;  3X1T D;  3WAA C;  4CAY A;  5GT0 A;  1N1J B;  3WTP A;  3KXB B;  1H3O B;  1P3K B;  5CPI D;  1B6W A;  3KUY A;  5GT0 C;  3WTP C;  5AVB B;  3REI B;  3MGR A;  4XZQ B;  1M19 C;  3AYW A;  5B1M B;  5BNX A;  3AV2 A;  1S32 D;  3X1V B;  3MGR C;  4NE6 A;  3AYW C;  5B40 B;  4H9P A;  3AV2 C;  2F8N H;  2HIO D;  5B33 B;  1TZY A;  4R8P D;  3UTB A;  5GSU D;  5AV8 B;  1ULY A;  3AFA D;  1WWS A;  3X1T A;  2YFW A;  3LEL D;  1HQ3 D;  4UUZ B;  3NQJ A;  5JA4 B;  5AV6 C;  1R4V A;  5BT1 C;  3MGS B;  2F8N D;  5F99 B;  3X1T C;  5CPI A;  5B32 B;  4X23 D;  3B0C T;  3W99 B;  5FUG A;  4J8U B;  4WNN B;  5CPI C;  4NFT A;  1S32 A;  3X1U D;  1P3A B;  1KX5 B;  3REJ B;  3VH5 A;  5AVB D;  4XZQ D;  4ZBJ B;  5AY8 D;  1S32 C;  2HIO A;  1KX3 D;  3VH5 T;  3NQU A;  5E5A B;  5BS7 A;  4R8P A;  4J8X C;  5GSU A;  3AFA A;  3LEL A;  1HQ3 A;  5G49 B;  4XUJ D;  4G91 C;  4YS3 D;  1JFI A;  5B24 D;  5B33 D;  4R8P C;  5BS7 C;  2F8N A;  2HUE B;  3AFA C;  3LEL C;  2IO5 B;  1HQ3 C;  4G92 C;  4X23 A;  3LJA B;  2FJ7 B;  3AZK D;  1P3F B;  3X1U A;  5B31 C;  3MGP B;  5CP6 D;  5B32 D;  2BYM A;  4E45 A;  5AVB A;  3KXB C;  4XZQ A;  3REK D;  1BH8 B;  5AY8 A;  4J8U D;  3X1U C;  4Z2M G;  1BFM A;  2YFV A;  1KX3 A;  1ID3 B;  4H9O B;  5AVB C;  3REI C;  5KDM A;  4H9S C;  4XZQ C;  5AY8 C;  3A6N B;  5B1M C;  3WA9 B;  4LD9 B;  4XUJ A;  4YS3 A;  5B24 A;  5B1L B;  5B33 A;  5B0Z B;  3VH6 W;  1HTA A;  4YS3 C;  3C1C D;  5B40 C;  5CPK D;  4J8W B;  4WU8 B;  3LZ1 D;  4QLC D;  5B33 C;  4UUZ A;  3MGQ B;  1AOI B;  1P34 D;  3W96 D;  3AZK A;  1M19 D;  1P3O B;  5CP6 A;  3O62 B;  3W98 B;  3KWQ B;  3AZK C;  3REK A;  4J8U A;  2FJ7 D;  1TAF A;  4WNN A;  5B32 C;  2NZD D;  2ARO B;  4H9Q A;  4ZUX B;  3AZH D;  3MGP D;  3AZF D;  1P3I B;  4J8U C;  4CSR B;  5CPJ D;  1BH9 A;  4WU9 B;  2NQB B;  4J8V B;  1P3A C;  5AV6 D;  1ID3 D;  3REJ C;  5B2I B;  5AV9 B;  3AZI B;  3C1C A;  5CPK A;  4NE5 A;  4ZBJ C;  2PYO B;  5DNN B;  5DNM D;  3LZ1 A;  4QLC A;  3MVD D;  5G49 A;  3B6F B;  1P34 A;  3AV1 B;  3W96 A;  3REL B;  1M19 A;  4Z5T B;  5AVC B;  3C1C C;  5CPK C;  3LZ1 C;  4QLC C;  1P34 C;  3C1B B;  3W96 C;  4DRA A;  3X1S D;  2HUE C;  2FJ7 A;  3W97 D;  2NZD A;  5B2J B;  3AZH A;  3MGP A;  3REH B;  3AZF A;  5B2I D;  2FJ7 C;  3AZE D;  2LY8 A;  3KWQ D;  4J8X D;  5CPJ A;  1P3F C;  1P3L B;  4KUD B;  2NZD C;  1F66 B;  3AZH C;  4WZS B;  3MGP C;  3AZF C;  3B6G B;  4KGC B;  5AV6 A;  1ID3 A;  5BO0 A;  4HGA B;  5CPJ C;  5DNM A;  4Z66 B;  3MVD A;  2BYK B;  1P3G B;  2NQB D;  4J8V D;  3UTA D;  1ID3 C;  1M18 D;  2CV5 D;  3AZN D;  5DNM C;  4H9R B;  3MVD C;  3AZM D;  5GXQ B;  4YM6 D;  5B31 D;  3LZ0 B;  3X1S A;  3W97 A;  3KXB D;  3V9R A;  3REL D;  1P3K D;  5AV5 B;  3MGQ C;  1AOI C;  3X1S C;  3C1B D;  3W97 C;  3REI D;  3KWQ A;  3AZE A;  4J8X A;  5B1M D;  1P3O C;  3MNN B;  5C3I C;  3AZE C;  3KWQ C;  3X1V D;  3WKJ B;  1EQZ B;  5B40 D;  1ZLA B;  2NQB A;  4J8V A;  3UTA A;  2ARO C;  4ZUX C;  1P3M B;  1M18 A;  3UT9 B;  3B0C W;  2CV5 A;  3AZG B;  3AZN A;  3AZM A;  5AV8 D;  1U35 B;  4YM6 A;  4WU9 C;  2NQB C;  4J8V C;  5B31 A;  3UTA C;  5JRG B;  3R45 B;  1M18 C;  5B0Y B;  4AWL C;  1N1J A;  2CV5 C;  3KXB A;  2CWE A;  3AZN C;  3MGS D;  3REL A;  5AV9 C;  3AZM C;  1H3O A;  5F99 D;  4YM6 C;  1P3K A;  5DNN C;  2PYO C;  3C1B A;  3REI A;  3VH5 W;  4H9S A;  3REL C;  3W99 D;  5AVC C;  5GT0 B;  5B1M A;  4EO5 B;  3WTP B;  1P3K C;  3C1B C;  1P3A D;  3X1V A;  5CHL B;  1KX5 D;  3KUY B;  3REJ D;  5B40 A;  3MGR B;  5B2J C;  3AYW B;  3AZJ B;  3X1V C;  3WTP E;  5BNX B;  5E5A D;  4KUD C;  5AV8 A;  1P3L C;  1Q9C A;  3WKJ D;  2RVQ C;  5JA4 A;  1ZLA D;  4H9P B;  3AZL B;  3MGS A;  1P3M D;  5AV8 C;  5F99 A;  1TZY B;  5B32 A;  3UTB B;  1U35 D;  1KX4 B;  1P3B B;  3MGS C;  3X1T B;  2YFW B;  3LJA D;  3W99 A;  5F99 C;  1P3F D;  1P3A A;  5CPI B;  1KX5 A;  3W99 C;  3LZ0 C;  3REJ A;  4H9N B;  5FUG B;  1KX5 C;  1S32 B;  5E5A A;  3KUY D;  3A6N D;  3AN2 B;  3WA9 D;  4LD9 D;  4KHA B;  3MNN C;  5B1L D;  5B0Z D;  5E5A C;  3AZJ D;  1P3M A;  2HIO B;  4G91 B;  4NE3 A;  3WKJ C;  3NQU B;  1U35 A;  1ZLA C;  5GSU B;  4J8W D;  4WU8 D;  3AFA B;  3R45 A;  3LEL B;  3LJA A;  3MGQ D;  1P3M C;  1AOI D;  1JFI B;  2F8N G;  1P3F A;  3AZL D;  2IO5 C;  1U35 C;  2F8N B;  2L5A A;  1P3O D;  3TU4 B;  5B31 G;  3LJA C;  3O62 D;  3W98 D;  1KX4 D;  1P3B D;  4DRB A;  4X23 B;  4E44 A;  5BNV B;  1BH8 A;  4JJN B;  4H9O A;  2ARO D;  4ZUX D;  3X1U B;  1P3I D;  3A6N A;  2BYM B;  3WA9 A;  4EO5 C;  4LD9 A;  1B67 A;  4WU9 D;  1M1A B;  5AY8 B;  5B1L A;  5B0Z A;  3AZJ A;  3KUY C;  3A6N C;  2YFV B;  1KX3 B;  3WA9 C;  5AV9 D;  4LD9 C;  3AZI D;  5GT3 B;  5KDM B; 
#chains in the Genus database with same CATH topology
 2PYO D;  3AN2 D;  5DNN D;  4J8W A;  4WU8 A;  2XD5 A;  5B1L C;  5B0Z C;  3MGQ A;  3AZJ C;  1AOI A;  3B6F D;  3EG5 B;  4XUJ B;  3AV1 D;  4YS3 B;  5B24 B;  3AZL A;  4Z5T D;  5AVC D;  3B0D B;  1P3O A;  4J8W C;  4WU8 C;  3O62 A;  3W98 A;  1KX4 A;  1P3B A;  3AZL C;  1P3P B;  1TZY C;  3AZK B;  5B32 G;  5B2J D;  3O62 C;  2ARO A;  4ZUX A;  3UTB C;  1P3B C;  3TU4 D;  1KX4 C;  3W98 C;  3REH D;  1P3I A;  5CP6 B;  4CSR A;  4KUD D;  4H9N A;  1P3L D;  4WU9 A;  3REK B;  1F66 D;  2RVQ D;  1TAF B;  4JJN D;  3B6G D;  4KGC D;  1P3I C;  5B2I A;  4H9Q B;  5AV9 A;  3AZI A;  1A7W A;  2PYO A;  3AN2 A;  5DNN A;  4Z66 D;  4KHA A;  1P3G D;  3B6F A;  3AV1 A;  1BH9 B;  1M1A D;  5B2I C;  4Z5T A;  5AVC A;  3WAA B;  3AZI C;  2VQR A;  3AN2 C;  1F1E A;  5GT3 D;  3B6F C;  5GXQ D;  3AV1 C;  3C1C B;  5CPK B;  4WJ3 C;  4CAY B;  4Z5T C;  3LZ0 D;  2HIO C;  4QLC B;  3LZ1 B;  1P34 B;  3W96 B;  1M19 B;  5B2J A;  5GSU C;  3VH6 A;  3TU4 A;  3REH A;  5AV5 D;  1KU5 A;  4KUD A;  4WV4 B;  5BNV A;  3IP4 C;  1P3L A;  1P3P D;  1F66 A;  3VH6 T;  3TU4 C;  3MNN D;  4JJN A;  3REH C;  3B6G A;  4KGC A;  3AV2 B;  2NZD B;  4X23 C;  3AZH B;  3AZF B;  1WWI A;  1F66 C;  1EQZ D;  4Z66 A;  2BYK A;  1P3G A;  4JJN C;  3B6G C;  5CPJ B;  4KGC C;  1M1A A;  3B0B A;  4HGA C;  3UT9 D;  3AZG D;  5AV6 B;  4H9R A;  4Z66 C;  5BO0 B;  1P3G C;  5GT3 A;  5GXQ A;  1M1A C;  5JRG D;  5DNM B;  5B0Y D;  3LZ0 A;  3MVD B;  3NQJ B;  1KX3 C;  3WAA D;  4Z2M H;  5GT3 C;  5GXQ C;  5AV5 A;  4XUJ C;  2JSS A;  5B24 C;  1P3P A;  5GT0 D;  3B0D C;  3X1S B;  3WTP D;  3W97 B;  3MNN A;  4M6B A;  3V9R B;  5AV5 C;  3H0R C;  2F2A C;  1P3P C;  3WKJ A;  1EQZ A;  5C3I B;  3AZE B;  3MGR D;  4J8X B;  1ZLA A;  3AYW D;  3UT9 A;  5CP6 C;  3AZG A;  3AV2 D;  1EQZ C;  4R8P B;  2F8N K;  3REK C;  5JRG A;  5B0Y A;  3UT9 C;  1HQ3 B;  4G92 B;  3AZG C;  3UTA B;  3WAA A;  2W8S A;  1M18 B;  5AV9 D;  4AWL B;  2CV5 B;  5JRG C;  1TZY D;  3AZN B;  5BT1 D;  5B0Y C;  3UTB D;  2Y2N A;  3KSY A;  3AZM B;  4YM6 B;  5B31 B;  3X1T D;  3WAA C;  2UWX A;  4CAY A;  5GT0 A;  1N1J B;  3WTP A;  1W2E A;  3KXB B;  1H3O B;  1P3K B;  5CPI D;  1B6W A;  3KUY A;  5GT0 C;  3H0L C;  3WTP C;  5AVB B;  3REI B;  3MGR A;  4XZQ B;  1M19 C;  3AYW A;  5B1M B;  5BNX A;  3AV2 A;  1S32 D;  3X1V B;  3MGR C;  4NE6 A;  3AYW C;  5B40 B;  4H9P A;  3AV2 C;  2F8N H;  2HIO D;  5B33 B;  1TZY A;  4R8P D;  3UTB A;  5GSU D;  5AV8 B;  3H0M C;  1ULY A;  3AFA D;  1WWS A;  2Y2J A;  3X1T A;  2YFW A;  3LEL D;  1HQ3 D;  4UUZ B;  3NQJ A;  5JA4 B;  5AV6 C;  1R4V A;  1PZR A;  5BT1 C;  3MGS B;  2F8N D;  5F99 B;  3X1T C;  5CPI A;  5B32 B;  4X23 D;  2Y2O A;  3B0C T;  3W99 B;  5FUG A;  4J8U B;  4WNN B;  5CPI C;  4NFT A;  1S32 A;  3X1U D;  1P3A B;  1KX5 B;  3REJ B;  3VH5 A;  5AVB D;  4XZQ D;  4ZBJ B;  5AY8 D;  1S32 C;  2HIO A;  1KX3 D;  3VH5 T;  3NQU A;  3P5J B;  5E5A B;  5BS7 A;  4R8P A;  5GSU A;  4J8X C;  3AFA A;  3LEL A;  1HQ3 A;  5G49 B;  4XUJ D;  4G91 C;  4YS3 D;  1JFI A;  5B24 D;  5B33 D;  4R8P C;  5BS7 C;  2F8N A;  2HUE B;  3AFA C;  3LEL C;  2IO5 B;  1HQ3 C;  4G92 C;  4X23 A;  3LJA B;  2FJ7 B;  3AZK D;  1P3F B;  3X1U A;  5B31 C;  3MGP B;  5CP6 D;  5B32 D;  2BYM A;  4E45 A;  5AVB A;  3KXB C;  4XZQ A;  3REK D;  1BH8 B;  5AY8 A;  4J8U D;  3X1U C;  4Z2M G;  1BFM A;  2YFV A;  1KX3 A;  1ID3 B;  4H9O B;  5AVB C;  3REI C;  5KDM A;  4H9S C;  4XZQ C;  5AY8 C;  3A6N B;  5B1M C;  2BG1 A;  2JE5 A;  3WA9 B;  2J8P A;  4LD9 B;  4XUJ A;  4YS3 A;  5B24 A;  5B1L B;  5B33 A;  5B0Z B;  3VH6 W;  1HTA A;  4YS3 C;  3C1C D;  5B40 C;  5CPK D;  4J8W B;  4WU8 B;  3LZ1 D;  4QLC D;  5B33 C;  4UUZ A;  3MGQ B;  1AOI B;  1P34 D;  3W96 D;  3AZK A;  1M19 D;  1P3O B;  5CP6 A;  3O62 B;  3W98 B;  3KWQ B;  3AZK C;  3REK A;  4J8U A;  2FJ7 D;  1TAF A;  4WNN A;  2XD1 A;  5B32 C;  2NZD D;  2ARO B;  4H9Q A;  4ZUX B;  3AZH D;  3MGP D;  3AZF D;  1P3I B;  4J8U C;  4CSR B;  5CPJ D;  1BH9 A;  4WU9 B;  2NQB B;  4J8V B;  1P3A C;  5AV6 D;  1ID3 D;  3REJ C;  5B2I B;  5AV9 B;  3AZI B;  3C1C A;  5CPK A;  4NE5 A;  4ZBJ C;  2PYO B;  3FDD A;  5DNN B;  5DNM D;  3LZ1 A;  4QLC A;  3MVD D;  5G49 A;  1Z2C B;  2JCH A;  1P34 A;  3AV1 B;  3B6F B;  3W96 A;  3REL B;  1M19 A;  4Z5T B;  5AVC B;  2G5I C;  3C1C C;  5CPK C;  3LZ1 C;  2RIQ A;  4QLC C;  1P34 C;  3C1B B;  3W96 C;  2G5H C;  4DRA A;  3X1S D;  2HUE C;  2FJ7 A;  3W97 D;  2NZD A;  5B2J B;  3AZH A;  3MGP A;  3REH B;  3AZF A;  2Y2H A;  2FJ7 C;  3AZE D;  2LY8 A;  3KWQ D;  2Y2I A;  4J8X D;  5CPJ A;  1P3L B;  1P3F C;  4KUD B;  2NZD C;  1F66 B;  3AZH C;  4WZS B;  3MGP C;  3AZF C;  3B6G B;  4KGC B;  2Y2K A;  5AV6 A;  1ID3 A;  5BO0 A;  4HGA B;  5CPJ C;  5DNM A;  4Z66 B;  3MVD A;  2BYK B;  1P3G B;  2NQB D;  4J8V D;  3UTA D;  1ID3 C;  1M18 D;  2CV5 D;  3AZN D;  5DNM C;  4H9R B;  3MVD C;  3AZM D;  5GXQ B;  4YM6 D;  5B31 D;  2Y2L A;  3LZ0 B;  3X1S A;  3W97 A;  3KXB D;  3V9R A;  3REL D;  1P3K D;  5AV5 B;  3MGQ C;  1AOI C;  3X1S C;  3C1B D;  3W97 C;  2DQN C;  3REI D;  3KWQ A;  3AZE A;  4J8X A;  5B1M D;  1P3O C;  1T3U A;  3MNN B;  5C3I C;  3AZE C;  3KWQ C;  3X1V D;  3WKJ B;  1EQZ B;  2ZY2 A;  5B40 D;  1ZLA B;  2NQB A;  4J8V A;  3UTA A;  2ARO C;  4ZUX C;  1P3M B;  1M18 A;  3UT9 B;  3B0C W;  2CV5 A;  3AZG B;  3AZN A;  3A1K A;  3AZM A;  5AV8 D;  1U35 B;  4YM6 A;  4WU9 C;  2NQB C;  4J8V C;  5B31 A;  3UTA C;  5JRG B;  3R45 B;  1M18 C;  5B0Y B;  4AWL C;  1N1J A;  2ZM5 A;  2CV5 C;  3KXB A;  2CWE A;  3AZN C;  3MGS D;  3REL A;  5AV9 C;  2ZY4 A;  4UPK A;  3AZM C;  1H3O A;  5F99 D;  4YM6 C;  3A1I A;  5DNN C;  3EPL A;  1P3K A;  2PYO C;  3C1B A;  3REI A;  3VH5 W;  4H9S A;  3REL C;  3W99 D;  5AVC C;  5GT0 B;  5B1M A;  4EO5 B;  3WTP B;  1P3K C;  3C1B C;  1P3A D;  3X1V A;  5CHL B;  1KX5 D;  3KUY B;  3REJ D;  2FFF B;  5B40 A;  3MGR B;  5B2J C;  3AYW B;  3AZJ B;  3X1V C;  3WTP E;  5BNX B;  5E5A D;  4KUD C;  5AV8 A;  1P3L C;  1Q9C A;  3WKJ D;  2RVQ C;  5JA4 A;  1ZLA D;  3AL0 C;  4H9P B;  3AZL B;  3MGS A;  1P3M D;  5AV8 C;  5F99 A;  1TZY B;  2Y2G A;  5B32 A;  3UTB B;  1U35 D;  1KX4 B;  1P3B B;  3MGS C;  3X1T B;  2YFW B;  3LJA D;  3W99 A;  5F99 C;  1P3F D;  1P3A A;  5CPI B;  1KX5 A;  3W99 C;  3LZ0 C;  2ZY3 A;  3REJ A;  4DQY B;  4H9N B;  5FUG B;  1KX5 C;  1S32 B;  3EPH A;  5E5A A;  2DF4 C;  3KUY D;  3A6N D;  3AN2 B;  3WA9 D;  4LD9 D;  4KHA B;  3MNN C;  5B1L D;  5B0Z D;  5E5A C;  3AZJ D;  1P3M A;  2HIO B;  3KFU G;  4G91 B;  4NE3 A;  3WKJ C;  3NQU B;  2Y2P A;  1U35 A;  5GSU B;  1ZLA C;  4J8W D;  4WU8 D;  3AFA B;  3R45 A;  3LEL B;  3LJA A;  3F6T A;  3MGQ D;  1P3M C;  1JFI B;  1AOI D;  2F8N G;  1P3F A;  3AZL D;  2IO5 C;  2ZY5 A;  1U35 C;  2F8N B;  2L5A A;  1P3O D;  3TU4 B;  5B31 G;  3LJA C;  3EPJ A;  3O62 D;  3W98 D;  1KX4 D;  1P3B D;  4DRB A;  4X23 B;  4E44 A;  5BNV B;  1BH8 A;  3EPK A;  4JJN B;  4H9O A;  2ARO D;  4ZUX D;  2Y2Q A;  3X1U B;  1P3I D;  3A6N A;  2BYM B;  3WA9 A;  4EO5 C;  4LD9 A;  1B67 A;  4WU9 D;  1M1A B;  5AY8 B;  2Y2M A;  5B1L A;  5B0Z A;  3AZJ A;  3KUY C;  3A6N C;  2YFV B;  1KX3 B;  3WA9 C;  5B2I D;  4LD9 C;  3AZI D;  5GT3 B;  5KDM B; 
#chains in the Genus database with same CATH homology
 2PYO D;  3AN2 D;  5DNN D;  4J8W A;  4WU8 A;  2XD5 A;  5B1L C;  5B0Z C;  3MGQ A;  3AZJ C;  1AOI A;  3B6F D;  3EG5 B;  4XUJ B;  3AV1 D;  4YS3 B;  5B24 B;  3AZL A;  4Z5T D;  5AVC D;  3B0D B;  1P3O A;  4J8W C;  4WU8 C;  3O62 A;  3W98 A;  1KX4 A;  1P3B A;  3AZL C;  1P3P B;  1TZY C;  3AZK B;  5B32 G;  5B2J D;  3O62 C;  2ARO A;  4ZUX A;  3UTB C;  1P3B C;  3TU4 D;  1KX4 C;  3W98 C;  3REH D;  1P3I A;  5CP6 B;  4CSR A;  4KUD D;  4H9N A;  1P3L D;  4WU9 A;  3REK B;  1F66 D;  2RVQ D;  1TAF B;  4JJN D;  3B6G D;  4KGC D;  1P3I C;  5B2I A;  4H9Q B;  5AV9 A;  3AZI A;  1A7W A;  2PYO A;  3AN2 A;  5DNN A;  4Z66 D;  4KHA A;  1P3G D;  3B6F A;  3AV1 A;  1BH9 B;  1M1A D;  5B2I C;  4Z5T A;  5AVC A;  3WAA B;  3AZI C;  2VQR A;  3AN2 C;  1F1E A;  5GT3 D;  3B6F C;  5GXQ D;  3AV1 C;  3C1C B;  5CPK B;  4WJ3 C;  4CAY B;  4Z5T C;  3LZ0 D;  2HIO C;  4QLC B;  3LZ1 B;  1P34 B;  3W96 B;  1M19 B;  5B2J A;  5GSU C;  3VH6 A;  3TU4 A;  3REH A;  5AV5 D;  1KU5 A;  4KUD A;  4WV4 B;  5BNV A;  3IP4 C;  1P3L A;  1P3P D;  1F66 A;  3VH6 T;  3TU4 C;  3MNN D;  4JJN A;  3REH C;  3B6G A;  4KGC A;  3AV2 B;  2NZD B;  4X23 C;  3AZH B;  3AZF B;  1WWI A;  1F66 C;  1EQZ D;  4Z66 A;  2BYK A;  1P3G A;  4JJN C;  3B6G C;  5CPJ B;  4KGC C;  1M1A A;  3B0B A;  4HGA C;  3UT9 D;  3AZG D;  5AV6 B;  4H9R A;  4Z66 C;  5BO0 B;  1P3G C;  5GT3 A;  5GXQ A;  1M1A C;  5JRG D;  5DNM B;  5B0Y D;  3LZ0 A;  3MVD B;  3NQJ B;  1KX3 C;  3WAA D;  4Z2M H;  5GT3 C;  5GXQ C;  5AV5 A;  4XUJ C;  2JSS A;  5B24 C;  1P3P A;  5GT0 D;  3B0D C;  3X1S B;  3WTP D;  3W97 B;  3MNN A;  4M6B A;  3V9R B;  5AV5 C;  3H0R C;  2F2A C;  1P3P C;  3WKJ A;  1EQZ A;  5C3I B;  3AZE B;  3MGR D;  4J8X B;  1ZLA A;  3AYW D;  3UT9 A;  5CP6 C;  3AZG A;  3AV2 D;  1EQZ C;  4R8P B;  2F8N K;  3REK C;  5JRG A;  5B0Y A;  3UT9 C;  1HQ3 B;  4G92 B;  3AZG C;  3UTA B;  3WAA A;  2W8S A;  1M18 B;  5AV9 D;  4AWL B;  2CV5 B;  5JRG C;  1TZY D;  3AZN B;  5BT1 D;  5B0Y C;  3UTB D;  2Y2N A;  3KSY A;  3AZM B;  4YM6 B;  5B31 B;  3X1T D;  3WAA C;  2UWX A;  4CAY A;  5GT0 A;  1N1J B;  3WTP A;  1W2E A;  3KXB B;  1H3O B;  1P3K B;  5CPI D;  1B6W A;  3KUY A;  5GT0 C;  3H0L C;  3WTP C;  5AVB B;  3REI B;  3MGR A;  4XZQ B;  1M19 C;  3AYW A;  5B1M B;  5BNX A;  3AV2 A;  1S32 D;  3X1V B;  3MGR C;  4NE6 A;  3AYW C;  5B40 B;  4H9P A;  3AV2 C;  2F8N H;  2HIO D;  5B33 B;  1TZY A;  4R8P D;  3UTB A;  5GSU D;  5AV8 B;  3H0M C;  1ULY A;  3AFA D;  1WWS A;  2Y2J A;  3X1T A;  2YFW A;  3LEL D;  1HQ3 D;  4UUZ B;  3NQJ A;  5JA4 B;  5AV6 C;  1R4V A;  1PZR A;  5BT1 C;  3MGS B;  2F8N D;  5F99 B;  3X1T C;  5CPI A;  5B32 B;  4X23 D;  2Y2O A;  3B0C T;  3W99 B;  5FUG A;  4J8U B;  4WNN B;  5CPI C;  4NFT A;  1S32 A;  3X1U D;  1P3A B;  1KX5 B;  3REJ B;  3VH5 A;  5AVB D;  4XZQ D;  4ZBJ B;  5AY8 D;  1S32 C;  2HIO A;  1KX3 D;  3VH5 T;  3NQU A;  3P5J B;  5E5A B;  5BS7 A;  4R8P A;  5GSU A;  4J8X C;  3AFA A;  3LEL A;  1HQ3 A;  5G49 B;  4XUJ D;  4G91 C;  4YS3 D;  1JFI A;  5B24 D;  5B33 D;  4R8P C;  5BS7 C;  2F8N A;  2HUE B;  3AFA C;  3LEL C;  2IO5 B;  1HQ3 C;  4G92 C;  4X23 A;  3LJA B;  2FJ7 B;  3AZK D;  1P3F B;  3X1U A;  5B31 C;  3MGP B;  5CP6 D;  5B32 D;  2BYM A;  4E45 A;  5AVB A;  3KXB C;  4XZQ A;  3REK D;  1BH8 B;  5AY8 A;  4J8U D;  3X1U C;  4Z2M G;  1BFM A;  2YFV A;  1KX3 A;  1ID3 B;  4H9O B;  5AVB C;  3REI C;  5KDM A;  4H9S C;  4XZQ C;  5AY8 C;  3A6N B;  5B1M C;  2BG1 A;  2JE5 A;  3WA9 B;  2J8P A;  4LD9 B;  4XUJ A;  4YS3 A;  5B24 A;  5B1L B;  5B33 A;  5B0Z B;  3VH6 W;  1HTA A;  4YS3 C;  3C1C D;  5B40 C;  5CPK D;  4J8W B;  4WU8 B;  3LZ1 D;  4QLC D;  5B33 C;  4UUZ A;  3MGQ B;  1AOI B;  1P34 D;  3W96 D;  3AZK A;  1M19 D;  1P3O B;  5CP6 A;  3O62 B;  3W98 B;  3KWQ B;  3AZK C;  3REK A;  4J8U A;  2FJ7 D;  1TAF A;  4WNN A;  2XD1 A;  5B32 C;  2NZD D;  2ARO B;  4H9Q A;  4ZUX B;  3AZH D;  3MGP D;  3AZF D;  1P3I B;  4J8U C;  4CSR B;  5CPJ D;  1BH9 A;  4WU9 B;  2NQB B;  4J8V B;  1P3A C;  5AV6 D;  1ID3 D;  3REJ C;  5B2I B;  5AV9 B;  3AZI B;  3C1C A;  5CPK A;  4NE5 A;  4ZBJ C;  2PYO B;  3FDD A;  5DNN B;  5DNM D;  3LZ1 A;  4QLC A;  3MVD D;  5G49 A;  1Z2C B;  2JCH A;  1P34 A;  3AV1 B;  3B6F B;  3W96 A;  3REL B;  1M19 A;  4Z5T B;  5AVC B;  2G5I C;  3C1C C;  5CPK C;  3LZ1 C;  2RIQ A;  4QLC C;  1P34 C;  3C1B B;  3W96 C;  2G5H C;  4DRA A;  3X1S D;  2HUE C;  2FJ7 A;  3W97 D;  2NZD A;  5B2J B;  3AZH A;  3MGP A;  3REH B;  3AZF A;  2Y2H A;  2FJ7 C;  3AZE D;  2LY8 A;  3KWQ D;  2Y2I A;  4J8X D;  5CPJ A;  1P3L B;  1P3F C;  4KUD B;  2NZD C;  1F66 B;  3AZH C;  4WZS B;  3MGP C;  3AZF C;  3B6G B;  4KGC B;  2Y2K A;  5AV6 A;  1ID3 A;  5BO0 A;  4HGA B;  5CPJ C;  5DNM A;  4Z66 B;  3MVD A;  2BYK B;  1P3G B;  2NQB D;  4J8V D;  3UTA D;  1ID3 C;  1M18 D;  2CV5 D;  3AZN D;  5DNM C;  4H9R B;  3MVD C;  3AZM D;  5GXQ B;  4YM6 D;  5B31 D;  2Y2L A;  3LZ0 B;  3X1S A;  3W97 A;  3KXB D;  3V9R A;  3REL D;  1P3K D;  5AV5 B;  3MGQ C;  1AOI C;  3X1S C;  3C1B D;  3W97 C;  2DQN C;  3REI D;  3KWQ A;  3AZE A;  4J8X A;  5B1M D;  1P3O C;  1T3U A;  3MNN B;  5C3I C;  3AZE C;  3KWQ C;  3X1V D;  3WKJ B;  1EQZ B;  2ZY2 A;  5B40 D;  1ZLA B;  2NQB A;  4J8V A;  3UTA A;  2ARO C;  4ZUX C;  1P3M B;  1M18 A;  3UT9 B;  3B0C W;  2CV5 A;  3AZG B;  3AZN A;  3A1K A;  3AZM A;  5AV8 D;  1U35 B;  4YM6 A;  4WU9 C;  2NQB C;  4J8V C;  5B31 A;  3UTA C;  5JRG B;  3R45 B;  1M18 C;  5B0Y B;  4AWL C;  1N1J A;  2ZM5 A;  2CV5 C;  3KXB A;  2CWE A;  3AZN C;  3MGS D;  3REL A;  5AV9 C;  2ZY4 A;  4UPK A;  3AZM C;  1H3O A;  5F99 D;  4YM6 C;  3A1I A;  5DNN C;  3EPL A;  1P3K A;  2PYO C;  3C1B A;  3REI A;  3VH5 W;  4H9S A;  3REL C;  3W99 D;  5AVC C;  5GT0 B;  5B1M A;  4EO5 B;  3WTP B;  1P3K C;  3C1B C;  1P3A D;  3X1V A;  5CHL B;  1KX5 D;  3KUY B;  3REJ D;  2FFF B;  5B40 A;  3MGR B;  5B2J C;  3AYW B;  3AZJ B;  3X1V C;  3WTP E;  5BNX B;  5E5A D;  4KUD C;  5AV8 A;  1P3L C;  1Q9C A;  3WKJ D;  2RVQ C;  5JA4 A;  1ZLA D;  3AL0 C;  4H9P B;  3AZL B;  3MGS A;  1P3M D;  5AV8 C;  5F99 A;  1TZY B;  2Y2G A;  5B32 A;  3UTB B;  1U35 D;  1KX4 B;  1P3B B;  3MGS C;  3X1T B;  2YFW B;  3LJA D;  3W99 A;  5F99 C;  1P3F D;  1P3A A;  5CPI B;  1KX5 A;  3W99 C;  3LZ0 C;  2ZY3 A;  3REJ A;  4DQY B;  4H9N B;  5FUG B;  1KX5 C;  1S32 B;  3EPH A;  5E5A A;  2DF4 C;  3KUY D;  3A6N D;  3AN2 B;  3WA9 D;  4LD9 D;  4KHA B;  3MNN C;  5B1L D;  5B0Z D;  5E5A C;  3AZJ D;  1P3M A;  2HIO B;  3KFU G;  4G91 B;  4NE3 A;  3WKJ C;  3NQU B;  2Y2P A;  1U35 A;  5GSU B;  1ZLA C;  4J8W D;  4WU8 D;  3AFA B;  3R45 A;  3LEL B;  3LJA A;  3F6T A;  3MGQ D;  1P3M C;  1JFI B;  1AOI D;  2F8N G;  1P3F A;  3AZL D;  2IO5 C;  2ZY5 A;  1U35 C;  2F8N B;  2L5A A;  1P3O D;  3TU4 B;  5B31 G;  3LJA C;  3EPJ A;  3O62 D;  3W98 D;  1KX4 D;  1P3B D;  4DRB A;  4X23 B;  4E44 A;  5BNV B;  1BH8 A;  3EPK A;  4JJN B;  4H9O A;  2ARO D;  4ZUX D;  2Y2Q A;  3X1U B;  1P3I D;  3A6N A;  2BYM B;  3WA9 A;  4EO5 C;  4LD9 A;  1B67 A;  4WU9 D;  1M1A B;  5AY8 B;  2Y2M A;  5B1L A;  5B0Z A;  3AZJ A;  3KUY C;  3A6N C;  2YFV B;  1KX3 B;  3WA9 C;  5B2I D;  4LD9 C;  3AZI D;  5GT3 B;  5KDM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...