3AN2A

The structure of the centromeric nucleosome containing cenp-a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
GWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure of the human centromeric nucleosome containing CENP-A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 20
structure length 89
sequence length 89
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3an2A00
5CPJC 4NE5A 4NE3A 1KX4B 3B6FB 3W97C 4H9OA 3AZMA 1M19C 1ULYA 5BNVA 5B32G 4YS3B 3B0CW 1P3MB 3MNND 3KUYA 3C1BC 3MNNA 2NQBB 4WU9D 3X1UC 5B33C 4X23B 4ZUXA 5AVBD 4WU9A 3WAAC 5B32D 5AV8B 1BH9A 3UTAD 5CPKD 1P3FB 5AVBA 5GT0B 3KUYB 1U35A 5BNXB 2YFWA 5B32A 4QLCC 3MGSC 3MGQA 3UTAA 5CPKA 3WKJB 5B31B 3UT9D 3TU4D 1P3BB 1KX3A 2YFVB 1AOIC 4ZUXB 2PYOB 3WTPD 3UT9A 3TU4A 1P34A 5CPIB 1KX5B 2HUEB 3X1TD 4J8VC 4LD9B 3WTPA 3AZHC 3VH6T 5B0YD 3X1TA 3A6NB 3REJD 1KX3B 1M1AB 1B67A 3B0DC 5B0YA 5BT1D 5B2JD 1P3KD 3REJA 3X1VC 2L5AA 3MGPA 3AYWA 3AV2C 1P3GB 1WWSA 5B40B 3W96B 5B2JA 2CV5C 5DNMA 1P3KA 1M18A 4HGAC 5BS7C 3AZJB 3KSYA 3AZNC 3AZLD 1TZYC 3W98D 4Z66C 5F99C 5AV6A 3MVDC 3X1SB 3MGPB 3WA9D 3KXBC 5CPJD 4AWLC 4YM6D 1P3AB 5JRGB 3WA9A 5CPJA 1BH8A 5B1MD 3AZFD 3W97A 2FJ7B 4CSRA 1M19A 4ZBJC 5AV6B 5B1MA 3AZFA 4G92C 1P3IB 1ZLAC 4H9PA 2BYMA 3REIB 3C1BA 1P3LD 1BH8B 3X1UA 3KWQD 1M19B 1ID3C 4WU9C 5GT3B 4KUDB 3KWQA 5AVCC 5AVBC 4J8XD 5FUGA 2BYKB 4QLCA 3C1BB 3R45A 4KHAB 4J8XA 4G91B 5B33B 3LELC 1AOIA 5AY8B 1N1JA 3UT9C 3TU4C 1H3OB 3WAAB 4KGCD 2JSSA 4R8PB 5AV5C 3WTPC 4J8VA 3AN2B 2NZDD 4WU8D 3AZHA 1EQZD 4KGCA 5FUGB 4QLCB 3MGSB 3X1TC 2NZDA 1EQZA 2CV5D 3LJAB 3REKB 2HIOB 3AV2A 1P3OC 3REHD 5BO0A 4H9RA 2CV5A 1P3KC 5BS7A 5F99D 3LZ1B 3B0BA 3REHA 3AZEC 5B0ZD 5F99A 3AZLC 1S32D 3W98C 3B0DB 4XUJB 3MVDA 3X1VB 3AV2B 1S32A 3O62D 4HGAB 3WA9C 4YM6C 3AZNB 3O62A 5B2IB 1TZYB 4Z66B 1ZLAD 4WZSB 3B6FD 4WNNB 1HTAA 3W99C 5B1MC 5AV9C 3AZFC 1ZLAA 3LZ0B 3C1CB 3KXBB 4AWLB 5G49A 5B24D 5B1LC 1ID3D 5B24A 1BFMA 4H9OB 3AZMB 1KU5A 5AVCD 1P3LC 4ZBJB 1ID3A 4XZQD 3KWQC 5BNVB 5C3IC 5AVCA 5DNND 2F8NG 5AV8D 4E44A 3MNNB 3LELD 4J8XC 5DNNA 4JJNC 3LELA 5AV5D 4WU9B 1BH9B 5CHLB 5AV5A 5AVBB 2F8ND 1U35B 4KGCC 5B32B 2YFWB 3MGQB 1JFIA 3UTAB 3NQJA 5CPKB 2NZDC 2F8NA 1F66C 1HQ3D 4WU8C 1EQZC 3AZKC 1P3OD 4Z2MH 1R4VA 5GSUD 1HQ3A 3UT9B 3TU4B 1P34B 1P3OA 5GSUA 3AZED 3WTPB 5B40D 3REHC 3AZEA 3MGRD 3X1TB 5B0ZC 3AZLA 5B0YB 3W98A 3VH5W 3REJB 3AZIC 3AYWB 1S32C 1WWIA 4EO5C 5B2JB 4H9NA 5DNMB 1P3KB 1M18B 1F1EA 3NQUA 4YM6A 3B0CT 3O62C 3AV1D 3W99D 5AV9D 3AV1A 3AZLB 5AV9A 3W99A 2FJ7D 3B6FC 3WTPE 5B1LD 3WA9B 5CPJB 1P3PD 5B1LA 5B24C 5GXQD 4CAYA 1P3MC 5CP6D 3W97B 4CSRB 1P3PA 1P3LA 5B1MB 5GXQA 3AFAD 3AZFB 4H9PB 2BYMB 3AZGD 5GT3D 3AFAA 4XZQC 4JJND 3AZGA 5DNNC 5AV8C 3X1UB 4JJNA 4J8UD 4Z5TD 3KWQB 3UTBD 5B31C 4J8UA 1P3BC 1TAFA 1F66D 4R8PD 3AZKD 4Z5TA 3UTBA 3R45B 5KDMA 4NE6A 5CPIC 4J8XB 4WU8A 1F66A 1Q9CA 3AZKA 5E5AD 1AOIB 1HQ3C 1N1JB 3RELD 3B6GD 2RVQD 3A6NC 5GSUC 4E45A 4J8VB 3REKD 3VH5T 3RELA 2HIOD 1B6WA 3AZHB 4KGCB 2NZDB 5B40C 4UUZA 3LZ1D 3AZID 4J8WD 1EQZB 3VH6A 5B0ZA 3MGRC 4M6BA 3AZJC 3V9RA 3AZIA 4J8WA 2F8NH 2AROD 5BO0B 4H9RB 2CV5B 4DRBA 3REHB 5F99B 1KX4D 2F8NK 3AV1C 5B2ID 5JRGC 3MVDB 1KX4A 3B6FA 1S32B 2FJ7C 4YS3D 1P3MD 3O62B 1P3MA 1P3PC 2NQBD 5GXQC 5B31G 5CP6C 4G92B 4X23D 3AZMD 1ZLAB 4H9QA 2NQBA 3AFAC 4XZQA 5G49B 4X23A 1P3FD 3AZGC 5GT3C 5GT0D 3KUYD 4KUDC 5AV8A 5B24B 3WKJD 1P3FA 5GT0A 5B31D 1P3BD 5BNXA 1ID3B 3WKJA 4ZUXD 5AVCB 5B31A 4J8UC 1P3BA 2PYOD 4G91C 4H9QB 5CPID 1KX5D 4XZQB 2YFVA 4Z5TC 3UTBC 5AY8C 2PYOA 4LD9D 1U35D 5CPIA 5DNNB 1KX5A 4R8PC 3MGQD 3AN2C 4LD9A 3A6ND 3LELB 1KX3D 1M1AD 3A6NA 5E5AC 5AV5B 3RELC 1P34D 1M1AA 1P3GD 2RVQC 3B6GC 1JFIB 3W96D 4DRAA 3NQJB 3LJAC 3REKC 3AZJD 2F8NB 2HIOC 1P3GA 5B40A 3W96A 3MGRA 3AZJA 1HQ3B 3LZ1C 4J8WC 1P3OB 5GSUB 3X1SD 3MGPD 3AYWD 2AROC 4H9SC 2IO5C 4XUJC 5DNMD 3AZEB 3X1SA 1P3AD 1M18D 3VH5A 5JRGD 1P3AA 3MGRB 3W98B 5JRGA 1KX4C 5B2IC 5AV6D 1P3ID 4H9NB 2FJ7A 3NQUB 4YM6B 3REID 1P3IA 4YS3C 3LZ0C 3C1CC 1A7WA 3REIA 3AV1B 5AV9B 5JA4A 3W99B 5CP6A 3W97D 1M19D 2NQBC 4KUDD 4X23C 3AZMC 5GT3A 4KUDA 5B1LB 4CAYB 4Z2MG 3C1BD 1P3FC 5GT0C 3KUYC 1P3PB 1P3LB 2BYKA 5GXQB 5JA4B 3X1UD 3WKJC 4KHAA 5CP6B 5B33D 3MNNC 5C3IB 5AY8D 3AFAB 3WAAD 5B33A 4ZUXC 2PYOC 3AN2D 5AY8A 3AZGB 1H3OA 1KX5C 3WAAA 2HUEC 4QLCD 4R8PA 3MGSD 4LD9C 3AN2A 4JJNB 1U35C 5B32C 3MGQC 4NFTA 3MGSA 3UTAC 5CPKC 5E5AA 1AOID 1KX3C 4J8UB 3LJAD 1TAFB 1M1AC 3B6GA 4Z5TB 3UTBB 4J8VD 5KDMB 3LJAA 3REKA 1P34C 1P3GC 2HIOA 1F66B 4WU8B 3AZHD 3W96C 3AZKB 3LZ1A 2CWEA 4XUJD 5E5AB 4WV4B 3X1VD 3RELB 3AV2D 2AROA 5B0YC 3B6GB 4H9SA 4XUJA 3REJC 3X1SC 3MGPC 3X1VA 3AYWC 3VH6W 4UUZB 5BT1C 3AZND 5B2JC 5DNMC 2LY8A 5B0ZB 1TZYD 1P3AC 1M18C 3V9RB 4Z66D 3AZIB 3AZNA 4J8WB 5B2IA 1TZYA 4EO5B 3MVDD 4Z66A 3LZ0D 4WNNA 3C1CD 5AV6C 2AROB 3KXBD 2IO5B 1P3IC 4YS3A 3LZ0A 3C1CA 3KXBA 3REIC
chains in the Genus database with same CATH superfamily
5CPJC 4NE5A 4NE3A 1KX4B 3B6FB 3W97C 4H9OA 3AZMA 1M19C 1ULYA 5BNVA 5B32G 4YS3B 3B0CW 1P3MB 3MNND 3KUYA 3C1BC 3MNNA 2NQBB 4WU9D 3X1UC 5B33C 4X23B 3P5JB 4ZUXA 5AVBD 4WU9A 3WAAC 5B32D 5AV8B 1BH9A 3UTAD 5CPKD 1P3FB 5AVBA 5GT0B 3KUYB 1U35A 5BNXB 2YFWA 5B32A 4QLCC 3MGSC 3MGQA 3UTAA 5CPKA 3WKJB 4WJ3C 5B31B 3UT9D 3TU4D 1P3BB 1KX3A 2Y2IA 2YFVB 1AOIC 4ZUXB 2PYOB 3WTPD 3UT9A 3TU4A 1P34A 5CPIB 1KX5B 2HUEB 3X1TD 4J8VC 4LD9B 3WTPA 3AZHC 2Y2KA 3VH6T 5B0YD 3X1TA 3A6NB 3REJD 1KX3B 1M1AB 1B67A 3B0DC 5B0YA 5BT1D 5B2JD 1P3KD 3REJA 3X1VC 2L5AA 3MGPA 3AYWA 3AV2C 1P3GB 1WWSA 5B40B 2Y2MA 3W96B 5B2JA 2CV5C 5DNMA 1P3KA 3EPHA 1M18A 4HGAC 5BS7C 3AZJB 3KSYA 3AZNC 3AZLD 1TZYC 3W98D 2Y2PA 4Z66C 5F99C 5AV6A 3MVDC 3AL0C 3X1SB 2ZY2A 3MGPB 3WA9D 3KXBC 5CPJD 4AWLC 4YM6D 1P3AB 2J8PA 5JRGB 3WA9A 5CPJA 1BH8A 5B1MD 3AZFD 3W97A 2FJ7B 4CSRA 1M19A 2F2AC 4ZBJC 5AV6B 2XD1A 3FDDA 5B1MA 3AZFA 4G92C 1P3IB 1ZLAC 4H9PA 2BYMA 3REIB 1T3UA 3C1BA 1P3LD 1BH8B 3X1UA 3KWQD 1M19B 1ID3C 4WU9C 5GT3B 3F6TA 4KUDB 3KWQA 5AVCC 5AVBC 4J8XD 5FUGA 2BYKB 4QLCA 3C1BB 3R45A 4KHAB 4J8XA 4G91B 5B33B 3LELC 2ZM5A 1AOIA 5AY8B 1N1JA 3UT9C 3TU4C 1H3OB 3WAAB 4KGCD 2JSSA 4R8PB 5AV5C 3WTPC 4J8VA 3AN2B 2NZDD 4WU8D 3AZHA 1EQZD 4KGCA 5FUGB 4QLCB 3MGSB 3X1TC 2NZDA 2Y2QA 1EQZA 2CV5D 3LJAB 3REKB 2HIOB 3AV2A 1P3OC 2Y2OA 5BO0A 3REHD 4H9RA 2CV5A 1P3KC 5BS7A 5F99D 3LZ1B 3B0BA 3REHA 3AZEC 5B0ZD 2Y2LA 5F99A 3AZLC 1S32D 3W98C 3B0DB 4XUJB 3MVDA 3X1VB 3AV2B 1S32A 3H0RC 3O62D 4HGAB 3WA9C 4YM6C 3AZNB 3O62A 5B2IB 1TZYB 4Z66B 1ZLAD 4WZSB 3B6FD 4WNNB 1HTAA 3W99C 5B1MC 5AV9C 3AZFC 1ZLAA 3LZ0B 3C1CB 3KXBB 4AWLB 5G49A 5B24D 2Y2JA 5B1LC 1ID3D 5B24A 1BFMA 4H9OB 3AZMB 1KU5A 5AVCD 1P3LC 4ZBJB 1ID3A 4XZQD 3KWQC 5BNVB 5C3IC 5AVCA 5DNND 2F8NG 5AV8D 4E44A 2ZY5A 3MNNB 3LELD 4J8XC 5DNNA 4JJNC 3LELA 5AV5D 4WU9B 1BH9B 5CHLB 5AV5A 5AVBB 2F8ND 1U35B 4KGCC 5B32B 2YFWB 3MGQB 1JFIA 3UTAB 3NQJA 5CPKB 2NZDC 2F8NA 1F66C 1HQ3D 4WU8C 1EQZC 3AZKC 3EPKA 1P3OD 4Z2MH 1R4VA 5GSUD 2G5HC 1HQ3A 3UT9B 3TU4B 1P34B 1P3OA 2RIQA 5GSUA 3AZED 3WTPB 5B40D 3REHC 3AZEA 3MGRD 3X1TB 2Y2GA 5B0ZC 3AZLA 5B0YB 3W98A 3VH5W 3REJB 3AZIC 3AYWB 1S32C 1WWIA 4EO5C 5B2JB 4H9NA 5DNMB 1P3KB 1M18B 1F1EA 3NQUA 4YM6A 3B0CT 3O62C 3AV1D 3W99D 5AV9D 2Y2NA 3AV1A 3AZLB 5AV9A 3W99A 2FJ7D 3B6FC 3WTPE 5B1LD 3WA9B 5CPJB 1P3PD 5B1LA 5B24C 5GXQD 4CAYA 1P3MC 5CP6D 3W97B 4CSRB 1P3PA 1P3LA 5B1MB 5GXQA 3AFAD 3AZFB 4H9PB 2BYMB 3AZGD 5GT3D 3AFAA 4XZQC 4JJND 3AZGA 5DNNC 5AV8C 3X1UB 4JJNA 2BG1A 4J8UD 2UWXA 2ZY4A 4Z5TD 3KWQB 3UTBD 5B31C 4J8UA 1P3BC 1TAFA 1F66D 4R8PD 3AZKD 4Z5TA 3UTBA 3R45B 5KDMA 4NE6A 5CPIC 4J8XB 4WU8A 3H0LC 1F66A 1Q9CA 3AZKA 5E5AD 2G5IC 1HQ3C 1AOIB 1N1JB 3RELD 3B6GD 2RVQD 3A6NC 5GSUC 4E45A 4J8VB 3REKD 3VH5T 3RELA 2HIOD 1B6WA 3AZHB 4KGCB 2NZDB 5B40C 4UUZA 3LZ1D 3AZID 4J8WD 1EQZB 3VH6A 5B0ZA 3MGRC 4M6BA 3AZJC 3V9RA 3AZIA 4J8WA 2F8NH 2AROD 5BO0B 4H9RB 2CV5B 3A1IA 4DRBA 3REHB 3EG5B 5F99B 1KX4D 2F8NK 3AV1C 5B2ID 1PZRA 5JRGC 3MVDB 2JE5A 1KX4A 3B6FA 4DQYB 1S32B 2FJ7C 4YS3D 1P3MD 3O62B 1Z2CB 1P3MA 1P3PC 2NQBD 5GXQC 5B31G 5CP6C 4G92B 4X23D 3AZMD 1ZLAB 4H9QA 2NQBA 3AFAC 4XZQA 5G49B 4X23A 3EPLA 1P3FD 3AZGC 5GT3C 5GT0D 3KUYD 4KUDC 5AV8A 5B24B 3WKJD 1P3FA 5GT0A 5B31D 1P3BD 5BNXA 1ID3B 2FFFB 3WKJA 4ZUXD 5AVCB 5B31A 4J8UC 1P3BA 2PYOD 4G91C 4H9QB 5CPID 2ZY3A 4UPKA 4XZQB 2YFVA 3IP4C 4Z5TC 3UTBC 1KX5D 5AY8C 2PYOA 4LD9D 1U35D 5CPIA 5DNNB 1KX5A 4R8PC 3MGQD 3AN2C 4LD9A 3A6ND 3LELB 1KX3D 1M1AD 2XD5A 1W2EA 5E5AC 3A6NA 5AV5B 3RELC 1P34D 1M1AA 1P3GD 2RVQC 3B6GC 1JFIB 3W96D 4DRAA 2JCHA 3NQJB 3LJAC 3REKC 3AZJD 2F8NB 2HIOC 1P3GA 5B40A 3W96A 3MGRA 3AZJA 1HQ3B 3LZ1C 4J8WC 3H0MC 1P3OB 5GSUB 3X1SD 3MGPD 3AYWD 2AROC 4H9SC 2IO5C 4XUJC 5DNMD 3AZEB 3X1SA 1P3AD 1M18D 3VH5A 5JRGD 3KFUG 1P3AA 3MGRB 3W98B 5JRGA 2W8SA 1KX4C 5B2IC 5AV6D 1P3ID 4H9NB 2FJ7A 3NQUB 4YM6B 3REID 1P3IA 3EPJA 4YS3C 3LZ0C 3C1CC 1A7WA 3REIA 3AV1B 5AV9B 5JA4A 3W99B 5CP6A 3W97D 1M19D 2NQBC 4KUDD 4X23C 3AZMC 5GT3A 4KUDA 5B1LB 4CAYB 4Z2MG 3C1BD 1P3FC 5GT0C 3KUYC 1P3PB 1P3LB 2BYKA 5GXQB 5JA4B 3X1UD 3WKJC 4KHAA 5CP6B 5B33D 3MNNC 5C3IB 5AY8D 3AFAB 3WAAD 5B33A 4ZUXC 2PYOC 3AN2D 5AY8A 3AZGB 1H3OA 1KX5C 3WAAA 2HUEC 4QLCD 4R8PA 3MGSD 4LD9C 3AN2A 4JJNB 1U35C 5B32C 2DQNC 3MGQC 4NFTA 3MGSA 3UTAC 5CPKC 5E5AA 1AOID 2VQRA 1KX3C 4J8UB 3LJAD 1TAFB 1M1AC 3B6GA 4Z5TB 2DF4C 3UTBB 4J8VD 5KDMB 3LJAA 3REKA 2Y2HA 1P34C 1P3GC 2HIOA 1F66B 4WU8B 3AZHD 3W96C 3AZKB 3LZ1A 2CWEA 4XUJD 5E5AB 4WV4B 3X1VD 3RELB 3AV2D 2AROA 5B0YC 3B6GB 3A1KA 4H9SA 4XUJA 3REJC 3X1SC 3MGPC 3X1VA 3AYWC 3VH6W 4UUZB 5BT1C 3AZND 5B2JC 5DNMC 2LY8A 5B0ZB 1TZYD 1P3AC 1M18C 3V9RB 4Z66D 3AZIB 3AZNA 4J8WB 5B2IA 1TZYA 4EO5B 3MVDD 4Z66A 3LZ0D 4WNNA 3C1CD 5AV6C 2AROB 3KXBD 2IO5B 1P3IC 4YS3A 3LZ0A 3C1CA 3KXBA 3REIC
chains in the Genus database with same CATH topology
5CPJC 4NE5A 4NE3A 1KX4B 3B6FB 3W97C 4H9OA 3AZMA 1M19C 1ULYA 5BNVA 5B32G 4YS3B 3B0CW 1P3MB 3MNND 3KUYA 3C1BC 3MNNA 2NQBB 4WU9D 3X1UC 5B33C 4X23B 3P5JB 4ZUXA 5AVBD 4WU9A 3WAAC 5B32D 5AV8B 1BH9A 3UTAD 5CPKD 1P3FB 5AVBA 5GT0B 3KUYB 1U35A 5BNXB 2YFWA 5B32A 4QLCC 3MGSC 3MGQA 3UTAA 5CPKA 3WKJB 4WJ3C 5B31B 3UT9D 3TU4D 1P3BB 1KX3A 2Y2IA 2YFVB 1AOIC 4ZUXB 2PYOB 3WTPD 3UT9A 3TU4A 1P34A 5CPIB 1KX5B 2HUEB 3X1TD 4J8VC 4LD9B 3WTPA 3AZHC 2Y2KA 3VH6T 5B0YD 3X1TA 3A6NB 3REJD 1KX3B 1M1AB 1B67A 3B0DC 5B0YA 5BT1D 5B2JD 1P3KD 3REJA 3X1VC 2L5AA 3MGPA 3AYWA 3AV2C 1P3GB 1WWSA 5B40B 2Y2MA 3W96B 5B2JA 2CV5C 5DNMA 1P3KA 3EPHA 1M18A 4HGAC 5BS7C 3AZJB 3KSYA 3AZNC 3AZLD 1TZYC 3W98D 2Y2PA 4Z66C 5F99C 5AV6A 3MVDC 3AL0C 3X1SB 2ZY2A 3MGPB 3WA9D 3KXBC 5CPJD 4AWLC 4YM6D 1P3AB 2J8PA 5JRGB 3WA9A 5CPJA 1BH8A 5B1MD 3AZFD 3W97A 2FJ7B 4CSRA 1M19A 2F2AC 4ZBJC 5AV6B 2XD1A 3FDDA 5B1MA 3AZFA 4G92C 1P3IB 1ZLAC 4H9PA 2BYMA 3REIB 1T3UA 3C1BA 1P3LD 1BH8B 3X1UA 3KWQD 1M19B 1ID3C 4WU9C 5GT3B 3F6TA 4KUDB 3KWQA 5AVCC 5AVBC 4J8XD 5FUGA 2BYKB 4QLCA 3C1BB 3R45A 4KHAB 4J8XA 4G91B 5B33B 3LELC 2ZM5A 1AOIA 5AY8B 1N1JA 3UT9C 3TU4C 1H3OB 3WAAB 4KGCD 2JSSA 4R8PB 5AV5C 3WTPC 4J8VA 3AN2B 2NZDD 4WU8D 3AZHA 1EQZD 4KGCA 5FUGB 4QLCB 3MGSB 3X1TC 2NZDA 2Y2QA 1EQZA 2CV5D 3LJAB 3REKB 2HIOB 3AV2A 1P3OC 2Y2OA 5BO0A 3REHD 4H9RA 2CV5A 1P3KC 5BS7A 5F99D 3LZ1B 3B0BA 3REHA 3AZEC 5B0ZD 2Y2LA 5F99A 3AZLC 1S32D 3W98C 3B0DB 4XUJB 3MVDA 3X1VB 3AV2B 1S32A 3H0RC 3O62D 4HGAB 3WA9C 4YM6C 3AZNB 3O62A 5B2IB 1TZYB 4Z66B 1ZLAD 4WZSB 3B6FD 4WNNB 1HTAA 3W99C 5B1MC 5AV9C 3AZFC 1ZLAA 3LZ0B 3C1CB 3KXBB 4AWLB 5G49A 5B24D 2Y2JA 5B1LC 1ID3D 5B24A 1BFMA 4H9OB 3AZMB 1KU5A 5AVCD 1P3LC 4ZBJB 1ID3A 4XZQD 3KWQC 5BNVB 5C3IC 5AVCA 5DNND 2F8NG 5AV8D 4E44A 2ZY5A 3MNNB 3LELD 4J8XC 5DNNA 4JJNC 3LELA 5AV5D 4WU9B 1BH9B 5CHLB 5AV5A 5AVBB 2F8ND 1U35B 4KGCC 5B32B 2YFWB 3MGQB 1JFIA 3UTAB 3NQJA 5CPKB 2NZDC 2F8NA 1F66C 1HQ3D 4WU8C 1EQZC 3AZKC 3EPKA 1P3OD 4Z2MH 1R4VA 5GSUD 2G5HC 1HQ3A 3UT9B 3TU4B 1P34B 1P3OA 2RIQA 5GSUA 3AZED 3WTPB 5B40D 3REHC 3AZEA 3MGRD 3X1TB 2Y2GA 5B0ZC 3AZLA 5B0YB 3W98A 3VH5W 3REJB 3AZIC 3AYWB 1S32C 1WWIA 4EO5C 5B2JB 4H9NA 5DNMB 1P3KB 1M18B 1F1EA 3NQUA 4YM6A 3B0CT 3O62C 3AV1D 3W99D 5AV9D 2Y2NA 3AV1A 3AZLB 5AV9A 3W99A 2FJ7D 3B6FC 3WTPE 5B1LD 3WA9B 5CPJB 1P3PD 5B1LA 5B24C 5GXQD 4CAYA 1P3MC 5CP6D 3W97B 4CSRB 1P3PA 1P3LA 5B1MB 5GXQA 3AFAD 3AZFB 4H9PB 2BYMB 3AZGD 5GT3D 3AFAA 4XZQC 4JJND 3AZGA 5DNNC 5AV8C 3X1UB 4JJNA 2BG1A 4J8UD 2UWXA 2ZY4A 4Z5TD 3KWQB 3UTBD 5B31C 4J8UA 1P3BC 1TAFA 1F66D 4R8PD 3AZKD 4Z5TA 3UTBA 3R45B 5KDMA 4NE6A 5CPIC 4J8XB 4WU8A 3H0LC 1F66A 1Q9CA 3AZKA 5E5AD 2G5IC 1HQ3C 1AOIB 1N1JB 3RELD 3B6GD 2RVQD 3A6NC 5GSUC 4E45A 4J8VB 3REKD 3VH5T 3RELA 2HIOD 1B6WA 3AZHB 4KGCB 2NZDB 5B40C 4UUZA 3LZ1D 3AZID 4J8WD 1EQZB 3VH6A 5B0ZA 3MGRC 4M6BA 3AZJC 3V9RA 3AZIA 4J8WA 2F8NH 2AROD 5BO0B 4H9RB 2CV5B 3A1IA 4DRBA 3REHB 3EG5B 5F99B 1KX4D 2F8NK 3AV1C 5B2ID 1PZRA 5JRGC 3MVDB 2JE5A 1KX4A 3B6FA 4DQYB 1S32B 2FJ7C 4YS3D 1P3MD 3O62B 1Z2CB 1P3MA 1P3PC 2NQBD 5GXQC 5B31G 5CP6C 4G92B 4X23D 3AZMD 1ZLAB 4H9QA 2NQBA 3AFAC 4XZQA 5G49B 4X23A 3EPLA 1P3FD 3AZGC 5GT3C 5GT0D 3KUYD 4KUDC 5AV8A 5B24B 3WKJD 1P3FA 5GT0A 5B31D 1P3BD 5BNXA 1ID3B 2FFFB 3WKJA 4ZUXD 5AVCB 5B31A 4J8UC 1P3BA 2PYOD 4G91C 4H9QB 5CPID 2ZY3A 4UPKA 4XZQB 2YFVA 3IP4C 4Z5TC 3UTBC 1KX5D 5AY8C 2PYOA 4LD9D 1U35D 5CPIA 5DNNB 1KX5A 4R8PC 3MGQD 3AN2C 4LD9A 3A6ND 3LELB 1KX3D 1M1AD 2XD5A 1W2EA 5E5AC 3A6NA 5AV5B 3RELC 1P34D 1M1AA 1P3GD 2RVQC 3B6GC 1JFIB 3W96D 4DRAA 2JCHA 3NQJB 3LJAC 3REKC 3AZJD 2F8NB 2HIOC 1P3GA 5B40A 3W96A 3MGRA 3AZJA 1HQ3B 3LZ1C 4J8WC 3H0MC 1P3OB 5GSUB 3X1SD 3MGPD 3AYWD 2AROC 4H9SC 2IO5C 4XUJC 5DNMD 3AZEB 3X1SA 1P3AD 1M18D 3VH5A 5JRGD 3KFUG 1P3AA 3MGRB 3W98B 5JRGA 2W8SA 1KX4C 5B2IC 5AV6D 1P3ID 4H9NB 2FJ7A 3NQUB 4YM6B 3REID 1P3IA 3EPJA 4YS3C 3LZ0C 3C1CC 1A7WA 3REIA 3AV1B 5AV9B 5JA4A 3W99B 5CP6A 3W97D 1M19D 2NQBC 4KUDD 4X23C 3AZMC 5GT3A 4KUDA 5B1LB 4CAYB 4Z2MG 3C1BD 1P3FC 5GT0C 3KUYC 1P3PB 1P3LB 2BYKA 5GXQB 5JA4B 3X1UD 3WKJC 4KHAA 5CP6B 5B33D 3MNNC 5C3IB 5AY8D 3AFAB 3WAAD 5B33A 4ZUXC 2PYOC 3AN2D 5AY8A 3AZGB 1H3OA 1KX5C 3WAAA 2HUEC 4QLCD 4R8PA 3MGSD 4LD9C 3AN2A 4JJNB 1U35C 5B32C 2DQNC 3MGQC 4NFTA 3MGSA 3UTAC 5CPKC 5E5AA 1AOID 2VQRA 1KX3C 4J8UB 3LJAD 1TAFB 1M1AC 3B6GA 4Z5TB 2DF4C 3UTBB 4J8VD 5KDMB 3LJAA 3REKA 2Y2HA 1P34C 1P3GC 2HIOA 1F66B 4WU8B 3AZHD 3W96C 3AZKB 3LZ1A 2CWEA 4XUJD 5E5AB 4WV4B 3X1VD 3RELB 3AV2D 2AROA 5B0YC 3B6GB 3A1KA 4H9SA 4XUJA 3REJC 3X1SC 3MGPC 3X1VA 3AYWC 3VH6W 4UUZB 5BT1C 3AZND 5B2JC 5DNMC 2LY8A 5B0ZB 1TZYD 1P3AC 1M18C 3V9RB 4Z66D 3AZIB 3AZNA 4J8WB 5B2IA 1TZYA 4EO5B 3MVDD 4Z66A 3LZ0D 4WNNA 3C1CD 5AV6C 2AROB 3KXBD 2IO5B 1P3IC 4YS3A 3LZ0A 3C1CA 3KXBA 3REIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ C;  4NE5 A;  4NE3 A;  1KX4 B;  3B6F B;  3W97 C;  4H9O A;  3AZM A;  1M19 C;  1ULY A;  5BNV A;  5B32 G;  4YS3 B;  3B0C W;  1P3M B;  3MNN D;  3KUY A;  3C1B C;  3MNN A;  2NQB B;  4WU9 D;  3X1U C;  5B33 C;  4X23 B;  4ZUX A;  5AVB D;  4WU9 A;  3WAA C;  5B32 D;  5AV8 B;  1BH9 A;  3UTA D;  5CPK D;  1P3F B;  5AVB A;  5GT0 B;  3KUY B;  1U35 A;  5BNX B;  2YFW A;  5B32 A;  4QLC C;  3MGS C;  3MGQ A;  3UTA A;  5CPK A;  3WKJ B;  5B31 B;  3UT9 D;  3TU4 D;  1P3B B;  1KX3 A;  2YFV B;  1AOI C;  4ZUX B;  2PYO B;  3WTP D;  3UT9 A;  3TU4 A;  1P34 A;  5CPI B;  1KX5 B;  2HUE B;  3X1T D;  4J8V C;  4LD9 B;  3WTP A;  3AZH C;  3VH6 T;  5B0Y D;  3X1T A;  3A6N B;  3REJ D;  1KX3 B;  1M1A B;  1B67 A;  3B0D C;  5B0Y A;  5BT1 D;  5B2J D;  1P3K D;  3REJ A;  3X1V C;  2L5A A;  3MGP A;  3AYW A;  3AV2 C;  1P3G B;  1WWS A;  5B40 B;  3W96 B;  5B2J A;  2CV5 C;  5DNM A;  1P3K A;  1M18 A;  4HGA C;  5BS7 C;  3AZJ B;  3KSY A;  3AZN C;  3AZL D;  1TZY C;  3W98 D;  4Z66 C;  5F99 C;  5AV6 A;  3MVD C;  3X1S B;  3MGP B;  3WA9 D;  3KXB C;  5CPJ D;  4AWL C;  4YM6 D;  1P3A B;  5JRG B;  3WA9 A;  5CPJ A;  1BH8 A;  5B1M D;  3AZF D;  3W97 A;  2FJ7 B;  4CSR A;  1M19 A;  4ZBJ C;  5AV6 B;  5B1M A;  3AZF A;  4G92 C;  1P3I B;  1ZLA C;  4H9P A;  2BYM A;  3REI B;  3C1B A;  1P3L D;  1BH8 B;  3X1U A;  3KWQ D;  1M19 B;  1ID3 C;  4WU9 C;  5GT3 B;  4KUD B;  3KWQ A;  5AVC C;  5AVB C;  4J8X D;  5FUG A;  2BYK B;  4QLC A;  3C1B B;  3R45 A;  4KHA B;  4J8X A;  4G91 B;  5B33 B;  3LEL C;  1AOI A;  5AY8 B;  1N1J A;  3UT9 C;  3TU4 C;  1H3O B;  3WAA B;  4KGC D;  2JSS A;  4R8P B;  5AV5 C;  3WTP C;  4J8V A;  3AN2 B;  2NZD D;  4WU8 D;  3AZH A;  1EQZ D;  4KGC A;  5FUG B;  4QLC B;  3MGS B;  3X1T C;  2NZD A;  1EQZ A;  2CV5 D;  3LJA B;  3REK B;  2HIO B;  3AV2 A;  1P3O C;  3REH D;  5BO0 A;  4H9R A;  2CV5 A;  1P3K C;  5BS7 A;  5F99 D;  3LZ1 B;  3B0B A;  3REH A;  3AZE C;  5B0Z D;  5F99 A;  3AZL C;  1S32 D;  3W98 C;  3B0D B;  4XUJ B;  3MVD A;  3X1V B;  3AV2 B;  1S32 A;  3O62 D;  4HGA B;  3WA9 C;  4YM6 C;  3AZN B;  3O62 A;  5B2I B;  1TZY B;  4Z66 B;  1ZLA D;  4WZS B;  3B6F D;  4WNN B;  1HTA A;  3W99 C;  5B1M C;  5AV9 C;  3AZF C;  1ZLA A;  3LZ0 B;  3C1C B;  3KXB B;  4AWL B;  5G49 A;  5B24 D;  5B1L C;  1ID3 D;  5B24 A;  1BFM A;  4H9O B;  3AZM B;  1KU5 A;  5AVC D;  1P3L C;  4ZBJ B;  1ID3 A;  4XZQ D;  3KWQ C;  5BNV B;  5C3I C;  5AVC A;  5DNN D;  2F8N G;  5AV8 D;  4E44 A;  3MNN B;  3LEL D;  4J8X C;  5DNN A;  4JJN C;  3LEL A;  5AV5 D;  4WU9 B;  1BH9 B;  5CHL B;  5AV5 A;  5AVB B;  2F8N D;  1U35 B;  4KGC C;  5B32 B;  2YFW B;  3MGQ B;  1JFI A;  3UTA B;  3NQJ A;  5CPK B;  2NZD C;  2F8N A;  1F66 C;  1HQ3 D;  4WU8 C;  1EQZ C;  3AZK C;  1P3O D;  4Z2M H;  1R4V A;  5GSU D;  1HQ3 A;  3UT9 B;  3TU4 B;  1P34 B;  1P3O A;  5GSU A;  3AZE D;  3WTP B;  5B40 D;  3REH C;  3AZE A;  3MGR D;  3X1T B;  5B0Z C;  3AZL A;  5B0Y B;  3W98 A;  3VH5 W;  3REJ B;  3AZI C;  3AYW B;  1S32 C;  1WWI A;  4EO5 C;  5B2J B;  4H9N A;  5DNM B;  1P3K B;  1M18 B;  1F1E A;  3NQU A;  4YM6 A;  3B0C T;  3O62 C;  3AV1 D;  3W99 D;  5AV9 D;  3AV1 A;  3AZL B;  5AV9 A;  3W99 A;  2FJ7 D;  3B6F C;  3WTP E;  5B1L D;  3WA9 B;  5CPJ B;  1P3P D;  5B1L A;  5B24 C;  5GXQ D;  4CAY A;  1P3M C;  5CP6 D;  3W97 B;  4CSR B;  1P3P A;  1P3L A;  5B1M B;  5GXQ A;  3AFA D;  3AZF B;  4H9P B;  2BYM B;  3AZG D;  5GT3 D;  3AFA A;  4XZQ C;  4JJN D;  3AZG A;  5DNN C;  5AV8 C;  3X1U B;  4JJN A;  4J8U D;  4Z5T D;  3KWQ B;  3UTB D;  5B31 C;  4J8U A;  1P3B C;  1TAF A;  1F66 D;  4R8P D;  3AZK D;  4Z5T A;  3UTB A;  3R45 B;  5KDM A;  4NE6 A;  5CPI C;  4J8X B;  4WU8 A;  1F66 A;  1Q9C A;  3AZK A;  5E5A D;  1AOI B;  1HQ3 C;  1N1J B;  3REL D;  3B6G D;  2RVQ D;  3A6N C;  5GSU C;  4E45 A;  4J8V B;  3REK D;  3VH5 T;  3REL A;  2HIO D;  1B6W A;  3AZH B;  4KGC B;  2NZD B;  5B40 C;  4UUZ A;  3LZ1 D;  3AZI D;  4J8W D;  1EQZ B;  3VH6 A;  5B0Z A;  3MGR C;  4M6B A;  3AZJ C;  3V9R A;  3AZI A;  4J8W A;  2F8N H;  2ARO D;  5BO0 B;  4H9R B;  2CV5 B;  4DRB A;  3REH B;  5F99 B;  1KX4 D;  2F8N K;  3AV1 C;  5B2I D;  5JRG C;  3MVD B;  1KX4 A;  3B6F A;  1S32 B;  2FJ7 C;  4YS3 D;  1P3M D;  3O62 B;  1P3M A;  1P3P C;  2NQB D;  5GXQ C;  5B31 G;  5CP6 C;  4G92 B;  4X23 D;  3AZM D;  1ZLA B;  4H9Q A;  2NQB A;  3AFA C;  4XZQ A;  5G49 B;  4X23 A;  1P3F D;  3AZG C;  5GT3 C;  5GT0 D;  3KUY D;  4KUD C;  5AV8 A;  5B24 B;  3WKJ D;  1P3F A;  5GT0 A;  5B31 D;  1P3B D;  5BNX A;  1ID3 B;  3WKJ A;  4ZUX D;  5AVC B;  5B31 A;  4J8U C;  1P3B A;  2PYO D;  4G91 C;  4H9Q B;  5CPI D;  1KX5 D;  4XZQ B;  2YFV A;  4Z5T C;  3UTB C;  5AY8 C;  2PYO A;  4LD9 D;  1U35 D;  5CPI A;  5DNN B;  1KX5 A;  4R8P C;  3MGQ D;  3AN2 C;  4LD9 A;  3A6N D;  3LEL B;  1KX3 D;  1M1A D;  3A6N A;  5E5A C;  5AV5 B;  3REL C;  1P34 D;  1M1A A;  1P3G D;  2RVQ C;  3B6G C;  1JFI B;  3W96 D;  4DRA A;  3NQJ B;  3LJA C;  3REK C;  3AZJ D;  2F8N B;  2HIO C;  1P3G A;  5B40 A;  3W96 A;  3MGR A;  3AZJ A;  1HQ3 B;  3LZ1 C;  4J8W C;  1P3O B;  5GSU B;  3X1S D;  3MGP D;  3AYW D;  2ARO C;  4H9S C;  2IO5 C;  4XUJ C;  5DNM D;  3AZE B;  3X1S A;  1P3A D;  1M18 D;  3VH5 A;  5JRG D;  1P3A A;  3MGR B;  3W98 B;  5JRG A;  1KX4 C;  5B2I C;  5AV6 D;  1P3I D;  4H9N B;  2FJ7 A;  3NQU B;  4YM6 B;  3REI D;  1P3I A;  4YS3 C;  3LZ0 C;  3C1C C;  1A7W A;  3REI A;  3AV1 B;  5AV9 B;  5JA4 A;  3W99 B;  5CP6 A;  3W97 D;  1M19 D;  2NQB C;  4KUD D;  4X23 C;  3AZM C;  5GT3 A;  4KUD A;  5B1L B;  4CAY B;  4Z2M G;  3C1B D;  1P3F C;  5GT0 C;  3KUY C;  1P3P B;  1P3L B;  2BYK A;  5GXQ B;  5JA4 B;  3X1U D;  3WKJ C;  4KHA A;  5CP6 B;  5B33 D;  3MNN C;  5C3I B;  5AY8 D;  3AFA B;  3WAA D;  5B33 A;  4ZUX C;  2PYO C;  3AN2 D;  5AY8 A;  3AZG B;  1H3O A;  1KX5 C;  3WAA A;  2HUE C;  4QLC D;  4R8P A;  3MGS D;  4LD9 C;  3AN2 A;  4JJN B;  1U35 C;  5B32 C;  3MGQ C;  4NFT A;  3MGS A;  3UTA C;  5CPK C;  5E5A A;  1AOI D;  1KX3 C;  4J8U B;  3LJA D;  1TAF B;  1M1A C;  3B6G A;  4Z5T B;  3UTB B;  4J8V D;  5KDM B;  3LJA A;  3REK A;  1P34 C;  1P3G C;  2HIO A;  1F66 B;  4WU8 B;  3AZH D;  3W96 C;  3AZK B;  3LZ1 A;  2CWE A;  4XUJ D;  5E5A B;  4WV4 B;  3X1V D;  3REL B;  3AV2 D;  2ARO A;  5B0Y C;  3B6G B;  4H9S A;  4XUJ A;  3REJ C;  3X1S C;  3MGP C;  3X1V A;  3AYW C;  3VH6 W;  4UUZ B;  5BT1 C;  3AZN D;  5B2J C;  5DNM C;  2LY8 A;  5B0Z B;  1TZY D;  1P3A C;  1M18 C;  3V9R B;  4Z66 D;  3AZI B;  3AZN A;  4J8W B;  5B2I A;  1TZY A;  4EO5 B;  3MVD D;  4Z66 A;  3LZ0 D;  4WNN A;  3C1C D;  5AV6 C;  2ARO B;  3KXB D;  2IO5 B;  1P3I C;  4YS3 A;  3LZ0 A;  3C1C A;  3KXB A;  3REI C; 
#chains in the Genus database with same CATH topology
 5CPJ C;  4NE5 A;  4NE3 A;  1KX4 B;  3B6F B;  3W97 C;  4H9O A;  3AZM A;  1M19 C;  1ULY A;  5BNV A;  5B32 G;  4YS3 B;  3B0C W;  1P3M B;  3MNN D;  3KUY A;  3C1B C;  3MNN A;  2NQB B;  4WU9 D;  3X1U C;  5B33 C;  4X23 B;  3P5J B;  4ZUX A;  5AVB D;  4WU9 A;  3WAA C;  5B32 D;  5AV8 B;  1BH9 A;  3UTA D;  5CPK D;  1P3F B;  5AVB A;  5GT0 B;  3KUY B;  1U35 A;  5BNX B;  2YFW A;  5B32 A;  4QLC C;  3MGS C;  3MGQ A;  3UTA A;  5CPK A;  3WKJ B;  4WJ3 C;  5B31 B;  3UT9 D;  3TU4 D;  1P3B B;  1KX3 A;  2Y2I A;  2YFV B;  1AOI C;  4ZUX B;  2PYO B;  3WTP D;  3UT9 A;  3TU4 A;  1P34 A;  5CPI B;  1KX5 B;  2HUE B;  3X1T D;  4J8V C;  4LD9 B;  3WTP A;  3AZH C;  2Y2K A;  3VH6 T;  5B0Y D;  3X1T A;  3A6N B;  3REJ D;  1KX3 B;  1M1A B;  1B67 A;  3B0D C;  5B0Y A;  5BT1 D;  5B2J D;  1P3K D;  3REJ A;  3X1V C;  2L5A A;  3MGP A;  3AYW A;  3AV2 C;  1P3G B;  1WWS A;  5B40 B;  2Y2M A;  3W96 B;  5B2J A;  2CV5 C;  5DNM A;  1P3K A;  3EPH A;  1M18 A;  4HGA C;  5BS7 C;  3AZJ B;  3KSY A;  3AZN C;  3AZL D;  1TZY C;  3W98 D;  2Y2P A;  4Z66 C;  5F99 C;  5AV6 A;  3MVD C;  3AL0 C;  3X1S B;  2ZY2 A;  3MGP B;  3WA9 D;  3KXB C;  5CPJ D;  4AWL C;  4YM6 D;  1P3A B;  2J8P A;  5JRG B;  3WA9 A;  5CPJ A;  1BH8 A;  5B1M D;  3AZF D;  3W97 A;  2FJ7 B;  4CSR A;  1M19 A;  2F2A C;  4ZBJ C;  5AV6 B;  2XD1 A;  3FDD A;  5B1M A;  3AZF A;  4G92 C;  1P3I B;  1ZLA C;  4H9P A;  2BYM A;  3REI B;  1T3U A;  3C1B A;  1P3L D;  1BH8 B;  3X1U A;  3KWQ D;  1M19 B;  1ID3 C;  4WU9 C;  5GT3 B;  3F6T A;  4KUD B;  3KWQ A;  5AVC C;  5AVB C;  4J8X D;  5FUG A;  2BYK B;  4QLC A;  3C1B B;  3R45 A;  4KHA B;  4J8X A;  4G91 B;  5B33 B;  3LEL C;  2ZM5 A;  1AOI A;  5AY8 B;  1N1J A;  3UT9 C;  3TU4 C;  1H3O B;  3WAA B;  4KGC D;  2JSS A;  4R8P B;  5AV5 C;  3WTP C;  4J8V A;  3AN2 B;  2NZD D;  4WU8 D;  3AZH A;  1EQZ D;  4KGC A;  5FUG B;  4QLC B;  3MGS B;  3X1T C;  2NZD A;  2Y2Q A;  1EQZ A;  2CV5 D;  3LJA B;  3REK B;  2HIO B;  3AV2 A;  1P3O C;  2Y2O A;  5BO0 A;  3REH D;  4H9R A;  2CV5 A;  1P3K C;  5BS7 A;  5F99 D;  3LZ1 B;  3B0B A;  3REH A;  3AZE C;  5B0Z D;  2Y2L A;  5F99 A;  3AZL C;  1S32 D;  3W98 C;  3B0D B;  4XUJ B;  3MVD A;  3X1V B;  3AV2 B;  1S32 A;  3H0R C;  3O62 D;  4HGA B;  3WA9 C;  4YM6 C;  3AZN B;  3O62 A;  5B2I B;  1TZY B;  4Z66 B;  1ZLA D;  4WZS B;  3B6F D;  4WNN B;  1HTA A;  3W99 C;  5B1M C;  5AV9 C;  3AZF C;  1ZLA A;  3LZ0 B;  3C1C B;  3KXB B;  4AWL B;  5G49 A;  5B24 D;  2Y2J A;  5B1L C;  1ID3 D;  5B24 A;  1BFM A;  4H9O B;  3AZM B;  1KU5 A;  5AVC D;  1P3L C;  4ZBJ B;  1ID3 A;  4XZQ D;  3KWQ C;  5BNV B;  5C3I C;  5AVC A;  5DNN D;  2F8N G;  5AV8 D;  4E44 A;  2ZY5 A;  3MNN B;  3LEL D;  4J8X C;  5DNN A;  4JJN C;  3LEL A;  5AV5 D;  4WU9 B;  1BH9 B;  5CHL B;  5AV5 A;  5AVB B;  2F8N D;  1U35 B;  4KGC C;  5B32 B;  2YFW B;  3MGQ B;  1JFI A;  3UTA B;  3NQJ A;  5CPK B;  2NZD C;  2F8N A;  1F66 C;  1HQ3 D;  4WU8 C;  1EQZ C;  3AZK C;  3EPK A;  1P3O D;  4Z2M H;  1R4V A;  5GSU D;  2G5H C;  1HQ3 A;  3UT9 B;  3TU4 B;  1P34 B;  1P3O A;  2RIQ A;  5GSU A;  3AZE D;  3WTP B;  5B40 D;  3REH C;  3AZE A;  3MGR D;  3X1T B;  2Y2G A;  5B0Z C;  3AZL A;  5B0Y B;  3W98 A;  3VH5 W;  3REJ B;  3AZI C;  3AYW B;  1S32 C;  1WWI A;  4EO5 C;  5B2J B;  4H9N A;  5DNM B;  1P3K B;  1M18 B;  1F1E A;  3NQU A;  4YM6 A;  3B0C T;  3O62 C;  3AV1 D;  3W99 D;  5AV9 D;  2Y2N A;  3AV1 A;  3AZL B;  5AV9 A;  3W99 A;  2FJ7 D;  3B6F C;  3WTP E;  5B1L D;  3WA9 B;  5CPJ B;  1P3P D;  5B1L A;  5B24 C;  5GXQ D;  4CAY A;  1P3M C;  5CP6 D;  3W97 B;  4CSR B;  1P3P A;  1P3L A;  5B1M B;  5GXQ A;  3AFA D;  3AZF B;  4H9P B;  2BYM B;  3AZG D;  5GT3 D;  3AFA A;  4XZQ C;  4JJN D;  3AZG A;  5DNN C;  5AV8 C;  3X1U B;  4JJN A;  2BG1 A;  4J8U D;  2UWX A;  2ZY4 A;  4Z5T D;  3KWQ B;  3UTB D;  5B31 C;  4J8U A;  1P3B C;  1TAF A;  1F66 D;  4R8P D;  3AZK D;  4Z5T A;  3UTB A;  3R45 B;  5KDM A;  4NE6 A;  5CPI C;  4J8X B;  4WU8 A;  3H0L C;  1F66 A;  1Q9C A;  3AZK A;  5E5A D;  2G5I C;  1HQ3 C;  1AOI B;  1N1J B;  3REL D;  3B6G D;  2RVQ D;  3A6N C;  5GSU C;  4E45 A;  4J8V B;  3REK D;  3VH5 T;  3REL A;  2HIO D;  1B6W A;  3AZH B;  4KGC B;  2NZD B;  5B40 C;  4UUZ A;  3LZ1 D;  3AZI D;  4J8W D;  1EQZ B;  3VH6 A;  5B0Z A;  3MGR C;  4M6B A;  3AZJ C;  3V9R A;  3AZI A;  4J8W A;  2F8N H;  2ARO D;  5BO0 B;  4H9R B;  2CV5 B;  3A1I A;  4DRB A;  3REH B;  3EG5 B;  5F99 B;  1KX4 D;  2F8N K;  3AV1 C;  5B2I D;  1PZR A;  5JRG C;  3MVD B;  2JE5 A;  1KX4 A;  3B6F A;  4DQY B;  1S32 B;  2FJ7 C;  4YS3 D;  1P3M D;  3O62 B;  1Z2C B;  1P3M A;  1P3P C;  2NQB D;  5GXQ C;  5B31 G;  5CP6 C;  4G92 B;  4X23 D;  3AZM D;  1ZLA B;  4H9Q A;  2NQB A;  3AFA C;  4XZQ A;  5G49 B;  4X23 A;  3EPL A;  1P3F D;  3AZG C;  5GT3 C;  5GT0 D;  3KUY D;  4KUD C;  5AV8 A;  5B24 B;  3WKJ D;  1P3F A;  5GT0 A;  5B31 D;  1P3B D;  5BNX A;  1ID3 B;  2FFF B;  3WKJ A;  4ZUX D;  5AVC B;  5B31 A;  4J8U C;  1P3B A;  2PYO D;  4G91 C;  4H9Q B;  5CPI D;  2ZY3 A;  4UPK A;  4XZQ B;  2YFV A;  3IP4 C;  4Z5T C;  3UTB C;  1KX5 D;  5AY8 C;  2PYO A;  4LD9 D;  1U35 D;  5CPI A;  5DNN B;  1KX5 A;  4R8P C;  3MGQ D;  3AN2 C;  4LD9 A;  3A6N D;  3LEL B;  1KX3 D;  1M1A D;  2XD5 A;  1W2E A;  5E5A C;  3A6N A;  5AV5 B;  3REL C;  1P34 D;  1M1A A;  1P3G D;  2RVQ C;  3B6G C;  1JFI B;  3W96 D;  4DRA A;  2JCH A;  3NQJ B;  3LJA C;  3REK C;  3AZJ D;  2F8N B;  2HIO C;  1P3G A;  5B40 A;  3W96 A;  3MGR A;  3AZJ A;  1HQ3 B;  3LZ1 C;  4J8W C;  3H0M C;  1P3O B;  5GSU B;  3X1S D;  3MGP D;  3AYW D;  2ARO C;  4H9S C;  2IO5 C;  4XUJ C;  5DNM D;  3AZE B;  3X1S A;  1P3A D;  1M18 D;  3VH5 A;  5JRG D;  3KFU G;  1P3A A;  3MGR B;  3W98 B;  5JRG A;  2W8S A;  1KX4 C;  5B2I C;  5AV6 D;  1P3I D;  4H9N B;  2FJ7 A;  3NQU B;  4YM6 B;  3REI D;  1P3I A;  3EPJ A;  4YS3 C;  3LZ0 C;  3C1C C;  1A7W A;  3REI A;  3AV1 B;  5AV9 B;  5JA4 A;  3W99 B;  5CP6 A;  3W97 D;  1M19 D;  2NQB C;  4KUD D;  4X23 C;  3AZM C;  5GT3 A;  4KUD A;  5B1L B;  4CAY B;  4Z2M G;  3C1B D;  1P3F C;  5GT0 C;  3KUY C;  1P3P B;  1P3L B;  2BYK A;  5GXQ B;  5JA4 B;  3X1U D;  3WKJ C;  4KHA A;  5CP6 B;  5B33 D;  3MNN C;  5C3I B;  5AY8 D;  3AFA B;  3WAA D;  5B33 A;  4ZUX C;  2PYO C;  3AN2 D;  5AY8 A;  3AZG B;  1H3O A;  1KX5 C;  3WAA A;  2HUE C;  4QLC D;  4R8P A;  3MGS D;  4LD9 C;  3AN2 A;  4JJN B;  1U35 C;  5B32 C;  2DQN C;  3MGQ C;  4NFT A;  3MGS A;  3UTA C;  5CPK C;  5E5A A;  1AOI D;  2VQR A;  1KX3 C;  4J8U B;  3LJA D;  1TAF B;  1M1A C;  3B6G A;  4Z5T B;  2DF4 C;  3UTB B;  4J8V D;  5KDM B;  3LJA A;  3REK A;  2Y2H A;  1P34 C;  1P3G C;  2HIO A;  1F66 B;  4WU8 B;  3AZH D;  3W96 C;  3AZK B;  3LZ1 A;  2CWE A;  4XUJ D;  5E5A B;  4WV4 B;  3X1V D;  3REL B;  3AV2 D;  2ARO A;  5B0Y C;  3B6G B;  3A1K A;  4H9S A;  4XUJ A;  3REJ C;  3X1S C;  3MGP C;  3X1V A;  3AYW C;  3VH6 W;  4UUZ B;  5BT1 C;  3AZN D;  5B2J C;  5DNM C;  2LY8 A;  5B0Z B;  1TZY D;  1P3A C;  1M18 C;  3V9R B;  4Z66 D;  3AZI B;  3AZN A;  4J8W B;  5B2I A;  1TZY A;  4EO5 B;  3MVD D;  4Z66 A;  3LZ0 D;  4WNN A;  3C1C D;  5AV6 C;  2ARO B;  3KXB D;  2IO5 B;  1P3I C;  4YS3 A;  3LZ0 A;  3C1C A;  3KXB A;  3REI C; 
#chains in the Genus database with same CATH homology
 5CPJ C;  4NE5 A;  4NE3 A;  1KX4 B;  3B6F B;  3W97 C;  4H9O A;  3AZM A;  1M19 C;  1ULY A;  5BNV A;  5B32 G;  4YS3 B;  3B0C W;  1P3M B;  3MNN D;  3KUY A;  3C1B C;  3MNN A;  2NQB B;  4WU9 D;  3X1U C;  5B33 C;  4X23 B;  3P5J B;  4ZUX A;  5AVB D;  4WU9 A;  3WAA C;  5B32 D;  5AV8 B;  1BH9 A;  3UTA D;  5CPK D;  1P3F B;  5AVB A;  5GT0 B;  3KUY B;  1U35 A;  5BNX B;  2YFW A;  5B32 A;  4QLC C;  3MGS C;  3MGQ A;  3UTA A;  5CPK A;  3WKJ B;  4WJ3 C;  5B31 B;  3UT9 D;  3TU4 D;  1P3B B;  1KX3 A;  2Y2I A;  2YFV B;  1AOI C;  4ZUX B;  2PYO B;  3WTP D;  3UT9 A;  3TU4 A;  1P34 A;  5CPI B;  1KX5 B;  2HUE B;  3X1T D;  4J8V C;  4LD9 B;  3WTP A;  3AZH C;  2Y2K A;  3VH6 T;  5B0Y D;  3X1T A;  3A6N B;  3REJ D;  1KX3 B;  1M1A B;  1B67 A;  3B0D C;  5B0Y A;  5BT1 D;  5B2J D;  1P3K D;  3REJ A;  3X1V C;  2L5A A;  3MGP A;  3AYW A;  3AV2 C;  1P3G B;  1WWS A;  5B40 B;  2Y2M A;  3W96 B;  5B2J A;  2CV5 C;  5DNM A;  1P3K A;  3EPH A;  1M18 A;  4HGA C;  5BS7 C;  3AZJ B;  3KSY A;  3AZN C;  3AZL D;  1TZY C;  3W98 D;  2Y2P A;  4Z66 C;  5F99 C;  5AV6 A;  3MVD C;  3AL0 C;  3X1S B;  2ZY2 A;  3MGP B;  3WA9 D;  3KXB C;  5CPJ D;  4AWL C;  4YM6 D;  1P3A B;  2J8P A;  5JRG B;  3WA9 A;  5CPJ A;  1BH8 A;  5B1M D;  3AZF D;  3W97 A;  2FJ7 B;  4CSR A;  1M19 A;  2F2A C;  4ZBJ C;  5AV6 B;  2XD1 A;  3FDD A;  5B1M A;  3AZF A;  4G92 C;  1P3I B;  1ZLA C;  4H9P A;  2BYM A;  3REI B;  1T3U A;  3C1B A;  1P3L D;  1BH8 B;  3X1U A;  3KWQ D;  1M19 B;  1ID3 C;  4WU9 C;  5GT3 B;  3F6T A;  4KUD B;  3KWQ A;  5AVC C;  5AVB C;  4J8X D;  5FUG A;  2BYK B;  4QLC A;  3C1B B;  3R45 A;  4KHA B;  4J8X A;  4G91 B;  5B33 B;  3LEL C;  2ZM5 A;  1AOI A;  5AY8 B;  1N1J A;  3UT9 C;  3TU4 C;  1H3O B;  3WAA B;  4KGC D;  2JSS A;  4R8P B;  5AV5 C;  3WTP C;  4J8V A;  3AN2 B;  2NZD D;  4WU8 D;  3AZH A;  1EQZ D;  4KGC A;  5FUG B;  4QLC B;  3MGS B;  3X1T C;  2NZD A;  2Y2Q A;  1EQZ A;  2CV5 D;  3LJA B;  3REK B;  2HIO B;  3AV2 A;  1P3O C;  2Y2O A;  5BO0 A;  3REH D;  4H9R A;  2CV5 A;  1P3K C;  5BS7 A;  5F99 D;  3LZ1 B;  3B0B A;  3REH A;  3AZE C;  5B0Z D;  2Y2L A;  5F99 A;  3AZL C;  1S32 D;  3W98 C;  3B0D B;  4XUJ B;  3MVD A;  3X1V B;  3AV2 B;  1S32 A;  3H0R C;  3O62 D;  4HGA B;  3WA9 C;  4YM6 C;  3AZN B;  3O62 A;  5B2I B;  1TZY B;  4Z66 B;  1ZLA D;  4WZS B;  3B6F D;  4WNN B;  1HTA A;  3W99 C;  5B1M C;  5AV9 C;  3AZF C;  1ZLA A;  3LZ0 B;  3C1C B;  3KXB B;  4AWL B;  5G49 A;  5B24 D;  2Y2J A;  5B1L C;  1ID3 D;  5B24 A;  1BFM A;  4H9O B;  3AZM B;  1KU5 A;  5AVC D;  1P3L C;  4ZBJ B;  1ID3 A;  4XZQ D;  3KWQ C;  5BNV B;  5C3I C;  5AVC A;  5DNN D;  2F8N G;  5AV8 D;  4E44 A;  2ZY5 A;  3MNN B;  3LEL D;  4J8X C;  5DNN A;  4JJN C;  3LEL A;  5AV5 D;  4WU9 B;  1BH9 B;  5CHL B;  5AV5 A;  5AVB B;  2F8N D;  1U35 B;  4KGC C;  5B32 B;  2YFW B;  3MGQ B;  1JFI A;  3UTA B;  3NQJ A;  5CPK B;  2NZD C;  2F8N A;  1F66 C;  1HQ3 D;  4WU8 C;  1EQZ C;  3AZK C;  3EPK A;  1P3O D;  4Z2M H;  1R4V A;  5GSU D;  2G5H C;  1HQ3 A;  3UT9 B;  3TU4 B;  1P34 B;  1P3O A;  2RIQ A;  5GSU A;  3AZE D;  3WTP B;  5B40 D;  3REH C;  3AZE A;  3MGR D;  3X1T B;  2Y2G A;  5B0Z C;  3AZL A;  5B0Y B;  3W98 A;  3VH5 W;  3REJ B;  3AZI C;  3AYW B;  1S32 C;  1WWI A;  4EO5 C;  5B2J B;  4H9N A;  5DNM B;  1P3K B;  1M18 B;  1F1E A;  3NQU A;  4YM6 A;  3B0C T;  3O62 C;  3AV1 D;  3W99 D;  5AV9 D;  2Y2N A;  3AV1 A;  3AZL B;  5AV9 A;  3W99 A;  2FJ7 D;  3B6F C;  3WTP E;  5B1L D;  3WA9 B;  5CPJ B;  1P3P D;  5B1L A;  5B24 C;  5GXQ D;  4CAY A;  1P3M C;  5CP6 D;  3W97 B;  4CSR B;  1P3P A;  1P3L A;  5B1M B;  5GXQ A;  3AFA D;  3AZF B;  4H9P B;  2BYM B;  3AZG D;  5GT3 D;  3AFA A;  4XZQ C;  4JJN D;  3AZG A;  5DNN C;  5AV8 C;  3X1U B;  4JJN A;  2BG1 A;  4J8U D;  2UWX A;  2ZY4 A;  4Z5T D;  3KWQ B;  3UTB D;  5B31 C;  4J8U A;  1P3B C;  1TAF A;  1F66 D;  4R8P D;  3AZK D;  4Z5T A;  3UTB A;  3R45 B;  5KDM A;  4NE6 A;  5CPI C;  4J8X B;  4WU8 A;  3H0L C;  1F66 A;  1Q9C A;  3AZK A;  5E5A D;  2G5I C;  1HQ3 C;  1AOI B;  1N1J B;  3REL D;  3B6G D;  2RVQ D;  3A6N C;  5GSU C;  4E45 A;  4J8V B;  3REK D;  3VH5 T;  3REL A;  2HIO D;  1B6W A;  3AZH B;  4KGC B;  2NZD B;  5B40 C;  4UUZ A;  3LZ1 D;  3AZI D;  4J8W D;  1EQZ B;  3VH6 A;  5B0Z A;  3MGR C;  4M6B A;  3AZJ C;  3V9R A;  3AZI A;  4J8W A;  2F8N H;  2ARO D;  5BO0 B;  4H9R B;  2CV5 B;  3A1I A;  4DRB A;  3REH B;  3EG5 B;  5F99 B;  1KX4 D;  2F8N K;  3AV1 C;  5B2I D;  1PZR A;  5JRG C;  3MVD B;  2JE5 A;  1KX4 A;  3B6F A;  4DQY B;  1S32 B;  2FJ7 C;  4YS3 D;  1P3M D;  3O62 B;  1Z2C B;  1P3M A;  1P3P C;  2NQB D;  5GXQ C;  5B31 G;  5CP6 C;  4G92 B;  4X23 D;  3AZM D;  1ZLA B;  4H9Q A;  2NQB A;  3AFA C;  4XZQ A;  5G49 B;  4X23 A;  3EPL A;  1P3F D;  3AZG C;  5GT3 C;  5GT0 D;  3KUY D;  4KUD C;  5AV8 A;  5B24 B;  3WKJ D;  1P3F A;  5GT0 A;  5B31 D;  1P3B D;  5BNX A;  1ID3 B;  2FFF B;  3WKJ A;  4ZUX D;  5AVC B;  5B31 A;  4J8U C;  1P3B A;  2PYO D;  4G91 C;  4H9Q B;  5CPI D;  2ZY3 A;  4UPK A;  4XZQ B;  2YFV A;  3IP4 C;  4Z5T C;  3UTB C;  1KX5 D;  5AY8 C;  2PYO A;  4LD9 D;  1U35 D;  5CPI A;  5DNN B;  1KX5 A;  4R8P C;  3MGQ D;  3AN2 C;  4LD9 A;  3A6N D;  3LEL B;  1KX3 D;  1M1A D;  2XD5 A;  1W2E A;  5E5A C;  3A6N A;  5AV5 B;  3REL C;  1P34 D;  1M1A A;  1P3G D;  2RVQ C;  3B6G C;  1JFI B;  3W96 D;  4DRA A;  2JCH A;  3NQJ B;  3LJA C;  3REK C;  3AZJ D;  2F8N B;  2HIO C;  1P3G A;  5B40 A;  3W96 A;  3MGR A;  3AZJ A;  1HQ3 B;  3LZ1 C;  4J8W C;  3H0M C;  1P3O B;  5GSU B;  3X1S D;  3MGP D;  3AYW D;  2ARO C;  4H9S C;  2IO5 C;  4XUJ C;  5DNM D;  3AZE B;  3X1S A;  1P3A D;  1M18 D;  3VH5 A;  5JRG D;  3KFU G;  1P3A A;  3MGR B;  3W98 B;  5JRG A;  2W8S A;  1KX4 C;  5B2I C;  5AV6 D;  1P3I D;  4H9N B;  2FJ7 A;  3NQU B;  4YM6 B;  3REI D;  1P3I A;  3EPJ A;  4YS3 C;  3LZ0 C;  3C1C C;  1A7W A;  3REI A;  3AV1 B;  5AV9 B;  5JA4 A;  3W99 B;  5CP6 A;  3W97 D;  1M19 D;  2NQB C;  4KUD D;  4X23 C;  3AZM C;  5GT3 A;  4KUD A;  5B1L B;  4CAY B;  4Z2M G;  3C1B D;  1P3F C;  5GT0 C;  3KUY C;  1P3P B;  1P3L B;  2BYK A;  5GXQ B;  5JA4 B;  3X1U D;  3WKJ C;  4KHA A;  5CP6 B;  5B33 D;  3MNN C;  5C3I B;  5AY8 D;  3AFA B;  3WAA D;  5B33 A;  4ZUX C;  2PYO C;  3AN2 D;  5AY8 A;  3AZG B;  1H3O A;  1KX5 C;  3WAA A;  2HUE C;  4QLC D;  4R8P A;  3MGS D;  4LD9 C;  3AN2 A;  4JJN B;  1U35 C;  5B32 C;  2DQN C;  3MGQ C;  4NFT A;  3MGS A;  3UTA C;  5CPK C;  5E5A A;  1AOI D;  2VQR A;  1KX3 C;  4J8U B;  3LJA D;  1TAF B;  1M1A C;  3B6G A;  4Z5T B;  2DF4 C;  3UTB B;  4J8V D;  5KDM B;  3LJA A;  3REK A;  2Y2H A;  1P34 C;  1P3G C;  2HIO A;  1F66 B;  4WU8 B;  3AZH D;  3W96 C;  3AZK B;  3LZ1 A;  2CWE A;  4XUJ D;  5E5A B;  4WV4 B;  3X1V D;  3REL B;  3AV2 D;  2ARO A;  5B0Y C;  3B6G B;  3A1K A;  4H9S A;  4XUJ A;  3REJ C;  3X1S C;  3MGP C;  3X1V A;  3AYW C;  3VH6 W;  4UUZ B;  5BT1 C;  3AZN D;  5B2J C;  5DNM C;  2LY8 A;  5B0Z B;  1TZY D;  1P3A C;  1M18 C;  3V9R B;  4Z66 D;  3AZI B;  3AZN A;  4J8W B;  5B2I A;  1TZY A;  4EO5 B;  3MVD D;  4Z66 A;  3LZ0 D;  4WNN A;  3C1C D;  5AV6 C;  2ARO B;  3KXB D;  2IO5 B;  1P3I C;  4YS3 A;  3LZ0 A;  3C1C A;  3KXB A;  3REI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...