3AN2A

The structure of the centromeric nucleosome containing cenp-a
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
GWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure of the human centromeric nucleosome containing CENP-A
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 89
sequence length 89
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3an2A00
5B1LD 1AOID 5AVCA 4WU8C 3B6GC 5B31A 3X1SD 5B0YD 2FJ7A 3X1VA 4Z66B 3AZLD 4J8VD 5CPKC 1HQ3B 4ZUXD 4WZSB 1EQZA 4YS3C 1JFIB 3V9RA 1Q9CA 4UUZA 3REJD 1A7WA 3B6FD 2HIOB 4XUJB 3REIB 4KGCB 5E5AC 1B6WA 1TZYD 4J8UC 3W96B 1BFMA 1HTAA 5CPIC 3AZIA 4KUDC 1P3BA 4DRBA 3KXBC 5C3IB 5AV8D 4Z66A 3AZND 3AZMC 3AZFC 1HQ3A 4KHAB 4QLCD 4YM6C 3KWQA 1ID3C 4R8PC 2AROD 4LD9B 1S32C 4WU8B 2HIOA 1KX3D 4KGCA 3W96A 4X23C 1M18C 2PYOC 5DNMC 1KX5B 3MVDB 3AZHD 1ZLAB 3MGPA 3WKJB 3O62B 4KHAA 3WTPB 5AV6D 4LD9A 2BYMB 3MGRC 4WU8A 1P34D 1M19C 3AFAD 3LELB 5CPIB 4WU9B 3VH6W 1M1AC 2F8NB 4H9SA 2RVQD 3KXBB 4J8XC 3AV1D 3C1CD 3AZGC 5AV9D 4JJND 3UT9D 3LJAC 1KX5A 4XZQB 4G92B 3W99D 3O62A 3WTPA 4YS3A 3A6ND 5B2IC 4WV4B 2BYMA 1P3GC 3LELA 1P3LC 5CPIA 4WU9A 5GT3C 4H9RB 2F8NA 3MGSD 4J8WD 3WAAD 3KXBA 2PYOB 5DNMB 1P3FD 5AY8C 4EO5C 1KX4B 1P3MC 4Z5TB 5JRGD 1P3IB 3MGRB 5AV5C 1M19B 5CHLB 3RELC 1F66C 3UTAC 1ULYA 5B1MD 3W98B 4H9RA 5DNND 5B0ZD 5B31G 3LZ0D 3UTBB 5F99B 1M18A 5B1LC 5AVBD 1AOIC 2PYOA 5DNMA 5GT0D 3X1SC 5CPJD 5B0YC 3AZKC 5JA4A 3REKD 1U35D 3VH6T 5B32D 4Z5TA 3AZLC 5CP6D 3MGRA 1P3GB 1M19A 5B2JB 4ZUXC 2YFWB 3X1VB 5GT3B 3AN2D 5B31D 3REJC 5B33C 3W97B 1EQZB 3B6FC 1KU5A 3UTBA 5F99A 3V9RB 4E45A 2FJ7D 1TZYC 3LJAA 1P3PD 5AY8B 1H3OB 4G91B 2IO5C 4EO5B 5B24B 3AZIB 2CWEA 5B2IA 5AV8C 3AZNC 1P3BB 2NQBB 3RELB 4HGAC 4ZBJB 4QLCC 5B2JA 1P3GA 2YFWA 4H9PB 2AROC 3X1TB 5GT3A 5FUGB 5GXQB 3KUYB 5B1LB 3KWQB 5B40D 3W97A 2CV5B 4H9OB 1KX3C 3MGQB 5B0YB 3AZKB 5AY8A 1H3OA 1HQ3D 3VH6A 5B24A 3AZLB 3WA9C 5AV5A 3AZHC 2NQBA 3RELA 4XUJD 3REID 4H9PA 3AZEB 3MGPB 5B33B 3X1TA 5AV6C 5FUGA 5GXQA 3KUYA 3REHD 4NE6A 5B1LA 1AOIA 1P34C 3VH5W 2CV5A 4H9OA 3X1UB 3AFAC 4AWLC 2IO5B 3MGQA 5B0YA 3AZKA 2RVQC 3B6GB 3AV1C 3C1CC 4JJNC 3AZLA 3UT9C 2NZDC 2HUEC 4HGAB 4LD9D 3W99C 5CPKB 3A6NC 3AZEA 5B33A 1P3AD 3B6FA 4YS3B 4CAYB 1TZYA 2L5AA 3X1UA 4CSRB 3LZ1D 1KX5D 3MVDD 1ZLAD 5E5AB 4J8UB 3WAAC 3MGSC 4J8WC 3B6GA 3O62D 3WA9B 3WKJD 3WTPD 1P3FC 4KUDB 3B0CT 5CPKA 3AZMB 5AV6B 3LELD 3AZFB 5JRGC 4WU9D 3MNND 4YM6B 1ID3B 4R8PB 1P34B 2F8ND 4CAYA 3AV2D 3NQUB 4AWLB 5BNVB 1S32B 5B1MC 4CSRA 3AV1B 5B0ZC 3R45B 5DNNC 4XZQD 3LZ0C 5E5AA 4X23B 4J8UA 1P3OD 4H9QB 2NZDB 3C1BD 3UT9B 3WA9A 3AZJD 5GT0C 3AZHA 4KUDA 1M18B 5CPJC 3VH5T 3A6NB 3REKC 1U35C 3AZMA 5AV6A 3AZFA 5JA4B 5KDMB 5CP6C 4YM6A 1ID3A 4R8PA 1P34A 3NQUA 3AN2C 5B32G 5BNVA 1S32A 5B31C 3MGSB 1WWIA 3AV1A 3C1CA 2BYKB 3R45A 1M1AB 4X23A 4H9QA 2NZDA 2FJ7C 3UT9A 3TU4C 1P3KD 1KX4D 4J8XB 4Z5TD 3AZGB 5GSUC 3NQJB 1P3ID 1P3PC 3AYWD 3A6NA 3LJAB 3W98D 5KDMA 5BT1D 3UTBD 5F99D 5B2IB 4J8VC 3LZ0B 3MGSA 1P3LB 5B40C 5AVCD 2BYKA 1M1AA 1BH8B 3VH5A 4J8XA 3AZGA 3NQJA 2LY8A 3REKB 1HQ3C 1U35B 5B2JD 3X1VD 5CP6B 1P3MB 1WWSA 3W97D 1EQZD 4XUJC 3REIC 3AN2B 5AV5B 5B0ZA 5G49B 3LZ0A 3REHC 1F66B 3UTAB 4DRAA 3TU4B 1P3LA 5B24D 5GT0A 3B0CW 5BNXB 5GSUB 3AZID 1P3PB 1BH8A 1AOIB 1P3BD 3REKA 2NQBD 3RELD 3X1SB 1U35A 5BO0B 4Z66D 5CP6A 3X1TD 5GXQD 3KUYD 4LD9C 1P3MA 3KWQD 4J8VB 2CV5D 3AN2A 4ZUXB 3MGQD 5B40B 1P3AC 4H9SC 3AZKD 5G49A 2HIOD 1F66A 4KGCD 3UTAA 3TU4A 3REJB 3W96D 3B6FB 5BNXA 5GSUA 1P3PA 4Z2MG 3LZ1C 1KX5C 3MVDC 1ZLAC 1TZYB 3WKJC 3O62C 3WTPC 3X1SA 3B0DC 5BO0A 3AZED 3MGPD 5B33D 5AV9C 5AV8B 3AZNB 4J8VA 4NE5A 3X1UD 3LELC 3REHB 3MNNC 4QLCB 4WU9C 4ZUXA 5B40A 2AROB 4WU8D 3B6GD 2JSSA 3AV2C 3REJA 1KX3B 5BS7C 4XZQC 2F8NG 4G92C 1TAFB 1P3OC 3C1BC 5CPKD 3AZJC 1JFIA 4XUJA 4YS3D 3REIA 3AZHB 5AV8A 3AZNA 1P3AB 3REHA 4QLCA 2AROA 5E5AD 4J8UD 3WA9D 4E44A 5CPID 1R4VA 3LZ1B 4KUDD 3AFAB 1KX3A 3KXBD 1TAFA 3B0DB 1P3KC 1KX4C 3AZMD 4Z5TC 3AZFD 3C1CB 4Z2MH 1P3IC 5AV9B 4YM6D 3AYWC 1ID3D 4JJNB 5AVBC 4R8PD 2HUEB 4WNNB 3MNNB 3W99B 1P3AA 1S32D 3W98C 5BT1C 3AV2B 4H9NB 4M6BA 5F99C 4X23D 3UTBC 5B32C 4NE3A 2NZDD 1BH9B 3LZ1A 3MVDA 1ZLAA 1P3OB 1M18D 3AFAA 3C1BB 3WKJA 5AVCC 3AZJB 2PYOD 5DNMD 3WTPE 3WAAB 4J8WB 1N1JB 1P3FB 5AV9A 2F8NH 4JJNA 5B2JC 3X1VC 4WNNA 3MNNA 3W99A 3MGRD 1M19D 3W97C 5JRGB 3AV2A 1EQZC 4H9NA 1M1AD 2YFVB 4J8XD 5BS7A 1BH9A 4XZQA 3AZGD 1P3OA 4G91C 3C1BA 1P3KB 5B1MB 3AZJA 5B24C 5B0ZB 5DNNB 3LJAD 3AZIC 3AYWB 3WAAA 4J8WA 5AVBB 3B0BA 1N1JA 1P3BC 1P3FA 5GT0B 2NQBC 4NFTA 4ZBJC 5CPJB 5B2ID 4Z66C 1B67A 3X1TC 5GXQC 3KUYC 1P3GD 5B32B 3KWQC 1P3LD 5JRGA 2CV5C 5GT3D 2YFVA 3MGQC 5AVCB 2HIOC 4KGCC 5B31B 1P3KA 1KX4A 5B1MA 3W96C 5DNNA 1P3IA 1F1EA 3AYWA 5AY8D 2F8NK 5AVBA 2FJ7B 1P3MD 5C3IC 5CPJA 5AV5D 3AZEC 3MGPC 3W98A 1F66D 3KSYA 5B32A 3UTAD 3TU4D 4UUZB 3X1UC 5GSUD
chains in the Genus database with same CATH superfamily
5B1LD 3EPLA 1AOID 5AVCA 4WU8C 3B6GC 2UWXA 5B31A 3X1SD 5B0YD 2F2AC 2FJ7A 3X1VA 4Z66B 3AZLD 4J8VD 5CPKC 2BG1A 1HQ3B 2Y2GA 4ZUXD 4WZSB 1EQZA 4UPKA 4YS3C 1JFIB 3V9RA 1Q9CA 2XD1A 4UUZA 1A7WA 2DQNC 3REJD 3B6FD 2HIOB 4XUJB 3REIB 4KGCB 5E5AC 1B6WA 1TZYD 4J8UC 3W96B 1BFMA 1HTAA 5CPIC 3AZIA 4KUDC 1P3BA 4DRBA 3KXBC 5C3IB 5AV8D 4Z66A 3AZND 3AZMC 3AZFC 1HQ3A 4KHAB 4QLCD 4YM6C 3KWQA 1ID3C 4R8PC 2AROD 4LD9B 1S32C 4WU8B 2Y2HA 2HIOA 1KX3D 4KGCA 3W96A 4X23C 1M18C 2PYOC 5DNMC 1KX5B 2Y2OA 3MVDB 3AZHD 3MGPA 1ZLAB 3WKJB 3O62B 4KHAA 3IP4C 3WTPB 2Y2MA 5AV6D 4LD9A 2BYMB 3MGRC 4WU8A 1P34D 1M19C 3AFAD 3LELB 5CPIB 4WU9B 3VH6W 1M1AC 2F8NB 4H9SA 2RVQD 3KXBB 4J8XC 3AV1D 3C1CD 3AZGC 5AV9D 1Z2CB 4JJND 3UT9D 3LJAC 1KX5A 4XZQB 4G92B 3W99D 3O62A 3WTPA 4YS3A 3A6ND 3A1KA 5B2IC 4WV4B 2BYMA 1P3GC 3LELA 1P3LC 5CPIA 4WU9A 5GT3C 4H9RB 2F8NA 3MGSD 4J8WD 3WAAD 3KXBA 2PYOB 5DNMB 1P3FD 5AY8C 4EO5C 1KX4B 1P3MC 4Z5TB 5JRGD 1P3IB 3MGRB 5AV5C 1M19B 5CHLB 3RELC 1F66C 3UTAC 1ULYA 5B1MD 3W98B 4H9RA 5DNND 5B0ZD 5B31G 3LZ0D 3UTBB 5F99B 1M18A 5B1LC 5AVBD 1AOIC 2PYOA 5DNMA 5GT0D 3X1SC 5CPJD 5B0YC 3AZKC 5JA4A 3REKD 1U35D 3VH6T 5B32D 4Z5TA 3AZLC 5CP6D 3MGRA 1P3GB 1M19A 4ZUXC 5B2JB 2YFWB 3X1VB 5GT3B 3AN2D 5B31D 2G5IC 3REJC 5B33C 3W97B 1EQZB 3B6FC 1KU5A 3UTBA 5F99A 3V9RB 3A1IA 4E45A 2FJ7D 1TZYC 3LJAA 1P3PD 5AY8B 1H3OB 4G91B 2IO5C 4EO5B 2ZY5A 5B24B 3AZIB 2CWEA 5B2IA 5AV8C 3AZNC 1P3BB 2NQBB 2Y2IA 3RELB 4HGAC 4ZBJB 4QLCC 5B2JA 1P3GA 2YFWA 4H9PB 2AROC 3X1TB 5GT3A 5FUGB 2XD5A 5GXQB 3KUYB 5B1LB 3KWQB 5B40D 3W97A 2CV5B 4H9OB 1KX3C 3MGQB 5B0YB 3AZKB 4DQYB 5AY8A 1H3OA 1HQ3D 3VH6A 2RIQA 5B24A 3AZLB 3WA9C 2ZY3A 5AV5A 3AZHC 2NQBA 3RELA 4XUJD 3REID 4H9PA 3AZEB 3MGPB 5B33B 3X1TA 5AV6C 5FUGA 5GXQA 3KUYA 3REHD 4NE6A 5B1LA 1AOIA 2Y2NA 1P34C 3VH5W 2CV5A 4H9OA 3X1UB 3AFAC 1T3UA 4AWLC 2IO5B 3MGQA 5B0YA 3AZKA 2RVQC 3B6GB 3AV1C 3C1CC 4JJNC 3AZLA 3UT9C 2NZDC 2HUEC 4HGAB 4LD9D 3W99C 5CPKB 3A6NC 3AZEA 2Y2QA 5B33A 1P3AD 3B6FA 4YS3B 4CAYB 2FFFB 1TZYA 2L5AA 3X1UA 4CSRB 3LZ1D 1KX5D 3MVDD 1ZLAD 5E5AB 4J8UB 3FDDA 3WAAC 3MGSC 4J8WC 3O62D 3B6GA 3WA9B 3WTPD 3WKJD 1P3FC 3AL0C 4KUDB 3B0CT 5CPKA 3AZMB 5AV6B 3EPHA 3LELD 3AZFB 5JRGC 4WU9D 3MNND 4YM6B 1ID3B 4R8PB 1P34B 2F8ND 3H0MC 4CAYA 3AV2D 3NQUB 4AWLB 5BNVB 1S32B 5B1MC 4CSRA 3AV1B 5B0ZC 3R45B 5DNNC 4XZQD 3LZ0C 5E5AA 4X23B 4J8UA 1P3OD 4H9QB 2NZDB 3C1BD 3UT9B 3WA9A 3AZJD 5GT0C 3AZHA 4KUDA 1M18B 5CPJC 2Y2LA 3VH5T 3A6NB 3REKC 1U35C 3AZMA 5AV6A 3AZFA 5JA4B 5KDMB 5CP6C 4YM6A 1ID3A 4R8PA 3EG5B 1P34A 3NQUA 3AN2C 5B32G 5BNVA 1S32A 5B31C 3MGSB 1WWIA 3AV1A 3C1CA 2BYKB 3R45A 1M1AB 4X23A 4H9QA 2NZDA 2FJ7C 3UT9A 3TU4C 1P3KD 1KX4D 4J8XB 4Z5TD 3AZGB 5GSUC 3NQJB 1P3ID 1P3PC 3AYWD 3A6NA 3LJAB 2W8SA 3W98D 5KDMA 5BT1D 3UTBD 5F99D 5B2IB 4J8VC 3LZ0B 3MGSA 1P3LB 5B40C 5AVCD 2BYKA 1M1AA 1BH8B 3VH5A 4J8XA 3AZGA 2LY8A 3NQJA 3REKB 1HQ3C 1U35B 5B2JD 3X1VD 5CP6B 1W2EA 1WWSA 3H0RC 1P3MB 3W97D 1EQZD 4XUJC 3REIC 3AN2B 5AV5B 5B0ZA 5G49B 3LZ0A 3REHC 1F66B 3UTAB 4DRAA 3TU4B 1P3LA 2Y2JA 5GT0A 3B0CW 1PZRA 5BNXB 5GSUB 5B24D 3AZID 1P3PB 1BH8A 1AOIB 1P3BD 3REKA 2NQBD 3RELD 3KFUG 3X1SB 1U35A 5BO0B 4Z66D 5CP6A 3X1TD 5GXQD 3KUYD 4LD9C 1P3MA 3EPJA 3KWQD 4J8VB 2CV5D 3AN2A 4ZUXB 3MGQD 5B40B 1P3AC 4H9SC 3AZKD 5G49A 2HIOD 1F66A 4KGCD 2JE5A 3UTAA 3TU4A 3REJB 3W96D 3B6FB 5BNXA 5GSUA 1P3PA 4Z2MG 3LZ1C 1KX5C 3MVDC 1ZLAC 1TZYB 3WKJC 3O62C 3WTPC 3X1SA 2ZY4A 3B0DC 5BO0A 3AZED 3MGPD 5B33D 5AV9C 2VQRA 5AV8B 3AZNB 4J8VA 4NE5A 3X1UD 3LELC 3REHB 3MNNC 4QLCB 4WU9C 4ZUXA 5B40A 2DF4C 2AROB 4WU8D 4WJ3C 3B6GD 2JSSA 3AV2C 3REJA 1KX3B 5BS7C 4XZQC 2F8NG 4G92C 1TAFB 1P3OC 2ZM5A 3C1BC 5CPKD 3AZJC 1JFIA 4XUJA 4YS3D 3REIA 3F6TA 3AZHB 5AV8A 2Y2PA 3AZNA 1P3AB 2ZY2A 3EPKA 3REHA 4QLCA 2AROA 5E5AD 4J8UD 3WA9D 4E44A 5CPID 1R4VA 3LZ1B 4KUDD 3AFAB 1KX3A 2G5HC 3KXBD 1TAFA 3B0DB 1P3KC 1KX4C 3AZMD 4Z5TC 3AZFD 3C1CB 4Z2MH 1P3IC 5AV9B 4YM6D 3AYWC 1ID3D 4JJNB 5AVBC 4R8PD 2HUEB 4WNNB 3MNNB 3W99B 1P3AA 1S32D 3W98C 5BT1C 3AV2B 4H9NB 4M6BA 5F99C 4X23D 3UTBC 5B32C 4NE3A 2NZDD 1BH9B 3LZ1A 3MVDA 1ZLAA 1P3OB 1M18D 3AFAA 3C1BB 3WKJA 5AVCC 3AZJB 2PYOD 5DNMD 3WTPE 3WAAB 4J8WB 1N1JB 1P3FB 5AV9A 2F8NH 4JJNA 5B2JC 3X1VC 4WNNA 3MNNA 3W99A 3MGRD 1M19D 3W97C 5JRGB 3P5JB 3AV2A 1EQZC 4H9NA 1M1AD 2YFVB 4J8XD 5BS7A 1BH9A 4XZQA 3AZGD 1P3OA 4G91C 3C1BA 1P3KB 5B1MB 3AZJA 5B24C 5B0ZB 5DNNB 3LJAD 3AZIC 3AYWB 3WAAA 4J8WA 5AVBB 3B0BA 1N1JA 1P3BC 1P3FA 5GT0B 2NQBC 4NFTA 4ZBJC 5CPJB 5B2ID 4Z66C 1B67A 3X1TC 5GXQC 3KUYC 1P3GD 5B32B 3KWQC 1P3LD 5JRGA 2CV5C 5GT3D 2YFVA 3MGQC 2JCHA 5AVCB 2HIOC 4KGCC 5B31B 1P3KA 1KX4A 5B1MA 3W96C 5DNNA 1P3IA 1F1EA 3AYWA 5AY8D 2F8NK 5AVBA 2FJ7B 1P3MD 2J8PA 5C3IC 2Y2KA 5CPJA 5AV5D 3AZEC 3MGPC 3H0LC 3W98A 1F66D 3KSYA 5B32A 3UTAD 3TU4D 4UUZB 3X1UC 5GSUD
chains in the Genus database with same CATH topology
5B1LD 3EPLA 1AOID 5AVCA 4WU8C 3B6GC 2UWXA 5B31A 3X1SD 5B0YD 2F2AC 2FJ7A 3X1VA 4Z66B 3AZLD 4J8VD 5CPKC 2BG1A 1HQ3B 2Y2GA 4ZUXD 4WZSB 1EQZA 4UPKA 4YS3C 1JFIB 3V9RA 1Q9CA 2XD1A 4UUZA 1A7WA 2DQNC 3REJD 3B6FD 2HIOB 4XUJB 3REIB 4KGCB 5E5AC 1B6WA 1TZYD 4J8UC 3W96B 1BFMA 1HTAA 5CPIC 3AZIA 4KUDC 1P3BA 4DRBA 3KXBC 5C3IB 5AV8D 4Z66A 3AZND 3AZMC 3AZFC 1HQ3A 4KHAB 4QLCD 4YM6C 3KWQA 1ID3C 4R8PC 2AROD 4LD9B 1S32C 4WU8B 2Y2HA 2HIOA 1KX3D 4KGCA 3W96A 4X23C 1M18C 2PYOC 5DNMC 1KX5B 2Y2OA 3MVDB 3AZHD 3MGPA 1ZLAB 3WKJB 3O62B 4KHAA 3IP4C 3WTPB 2Y2MA 5AV6D 4LD9A 2BYMB 3MGRC 4WU8A 1P34D 1M19C 3AFAD 3LELB 5CPIB 4WU9B 3VH6W 1M1AC 2F8NB 4H9SA 2RVQD 3KXBB 4J8XC 3AV1D 3C1CD 3AZGC 5AV9D 1Z2CB 4JJND 3UT9D 3LJAC 1KX5A 4XZQB 4G92B 3W99D 3O62A 3WTPA 4YS3A 3A6ND 3A1KA 5B2IC 4WV4B 2BYMA 1P3GC 3LELA 1P3LC 5CPIA 4WU9A 5GT3C 4H9RB 2F8NA 3MGSD 4J8WD 3WAAD 3KXBA 2PYOB 5DNMB 1P3FD 5AY8C 4EO5C 1KX4B 1P3MC 4Z5TB 5JRGD 1P3IB 3MGRB 5AV5C 1M19B 5CHLB 3RELC 1F66C 3UTAC 1ULYA 5B1MD 3W98B 4H9RA 5DNND 5B0ZD 5B31G 3LZ0D 3UTBB 5F99B 1M18A 5B1LC 5AVBD 1AOIC 2PYOA 5DNMA 5GT0D 3X1SC 5CPJD 5B0YC 3AZKC 5JA4A 3REKD 1U35D 3VH6T 5B32D 4Z5TA 3AZLC 5CP6D 3MGRA 1P3GB 1M19A 4ZUXC 5B2JB 2YFWB 3X1VB 5GT3B 3AN2D 5B31D 2G5IC 3REJC 5B33C 3W97B 1EQZB 3B6FC 1KU5A 3UTBA 5F99A 3V9RB 3A1IA 4E45A 2FJ7D 1TZYC 3LJAA 1P3PD 5AY8B 1H3OB 4G91B 2IO5C 4EO5B 2ZY5A 5B24B 3AZIB 2CWEA 5B2IA 5AV8C 3AZNC 1P3BB 2NQBB 2Y2IA 3RELB 4HGAC 4ZBJB 4QLCC 5B2JA 1P3GA 2YFWA 4H9PB 2AROC 3X1TB 5GT3A 5FUGB 2XD5A 5GXQB 3KUYB 5B1LB 3KWQB 5B40D 3W97A 2CV5B 4H9OB 1KX3C 3MGQB 5B0YB 3AZKB 4DQYB 5AY8A 1H3OA 1HQ3D 3VH6A 2RIQA 5B24A 3AZLB 3WA9C 2ZY3A 5AV5A 3AZHC 2NQBA 3RELA 4XUJD 3REID 4H9PA 3AZEB 3MGPB 5B33B 3X1TA 5AV6C 5FUGA 5GXQA 3KUYA 3REHD 4NE6A 5B1LA 1AOIA 2Y2NA 1P34C 3VH5W 2CV5A 4H9OA 3X1UB 3AFAC 1T3UA 4AWLC 2IO5B 3MGQA 5B0YA 3AZKA 2RVQC 3B6GB 3AV1C 3C1CC 4JJNC 3AZLA 3UT9C 2NZDC 2HUEC 4HGAB 4LD9D 3W99C 5CPKB 3A6NC 3AZEA 2Y2QA 5B33A 1P3AD 3B6FA 4YS3B 4CAYB 2FFFB 1TZYA 2L5AA 3X1UA 4CSRB 3LZ1D 1KX5D 3MVDD 1ZLAD 5E5AB 4J8UB 3FDDA 3WAAC 3MGSC 4J8WC 3O62D 3B6GA 3WA9B 3WTPD 3WKJD 1P3FC 3AL0C 4KUDB 3B0CT 5CPKA 3AZMB 5AV6B 3EPHA 3LELD 3AZFB 5JRGC 4WU9D 3MNND 4YM6B 1ID3B 4R8PB 1P34B 2F8ND 3H0MC 4CAYA 3AV2D 3NQUB 4AWLB 5BNVB 1S32B 5B1MC 4CSRA 3AV1B 5B0ZC 3R45B 5DNNC 4XZQD 3LZ0C 5E5AA 4X23B 4J8UA 1P3OD 4H9QB 2NZDB 3C1BD 3UT9B 3WA9A 3AZJD 5GT0C 3AZHA 4KUDA 1M18B 5CPJC 2Y2LA 3VH5T 3A6NB 3REKC 1U35C 3AZMA 5AV6A 3AZFA 5JA4B 5KDMB 5CP6C 4YM6A 1ID3A 4R8PA 3EG5B 1P34A 3NQUA 3AN2C 5B32G 5BNVA 1S32A 5B31C 3MGSB 1WWIA 3AV1A 3C1CA 2BYKB 3R45A 1M1AB 4X23A 4H9QA 2NZDA 2FJ7C 3UT9A 3TU4C 1P3KD 1KX4D 4J8XB 4Z5TD 3AZGB 5GSUC 3NQJB 1P3ID 1P3PC 3AYWD 3A6NA 3LJAB 2W8SA 3W98D 5KDMA 5BT1D 3UTBD 5F99D 5B2IB 4J8VC 3LZ0B 3MGSA 1P3LB 5B40C 5AVCD 2BYKA 1M1AA 1BH8B 3VH5A 4J8XA 3AZGA 2LY8A 3NQJA 3REKB 1HQ3C 1U35B 5B2JD 3X1VD 5CP6B 1W2EA 1WWSA 3H0RC 1P3MB 3W97D 1EQZD 4XUJC 3REIC 3AN2B 5AV5B 5B0ZA 5G49B 3LZ0A 3REHC 1F66B 3UTAB 4DRAA 3TU4B 1P3LA 2Y2JA 5GT0A 3B0CW 1PZRA 5BNXB 5GSUB 5B24D 3AZID 1P3PB 1BH8A 1AOIB 1P3BD 3REKA 2NQBD 3RELD 3KFUG 3X1SB 1U35A 5BO0B 4Z66D 5CP6A 3X1TD 5GXQD 3KUYD 4LD9C 1P3MA 3EPJA 3KWQD 4J8VB 2CV5D 3AN2A 4ZUXB 3MGQD 5B40B 1P3AC 4H9SC 3AZKD 5G49A 2HIOD 1F66A 4KGCD 2JE5A 3UTAA 3TU4A 3REJB 3W96D 3B6FB 5BNXA 5GSUA 1P3PA 4Z2MG 3LZ1C 1KX5C 3MVDC 1ZLAC 1TZYB 3WKJC 3O62C 3WTPC 3X1SA 2ZY4A 3B0DC 5BO0A 3AZED 3MGPD 5B33D 5AV9C 2VQRA 5AV8B 3AZNB 4J8VA 4NE5A 3X1UD 3LELC 3REHB 3MNNC 4QLCB 4WU9C 4ZUXA 5B40A 2DF4C 2AROB 4WU8D 4WJ3C 3B6GD 2JSSA 3AV2C 3REJA 1KX3B 5BS7C 4XZQC 2F8NG 4G92C 1TAFB 1P3OC 2ZM5A 3C1BC 5CPKD 3AZJC 1JFIA 4XUJA 4YS3D 3REIA 3F6TA 3AZHB 5AV8A 2Y2PA 3AZNA 1P3AB 2ZY2A 3EPKA 3REHA 4QLCA 2AROA 5E5AD 4J8UD 3WA9D 4E44A 5CPID 1R4VA 3LZ1B 4KUDD 3AFAB 1KX3A 2G5HC 3KXBD 1TAFA 3B0DB 1P3KC 1KX4C 3AZMD 4Z5TC 3AZFD 3C1CB 4Z2MH 1P3IC 5AV9B 4YM6D 3AYWC 1ID3D 4JJNB 5AVBC 4R8PD 2HUEB 4WNNB 3MNNB 3W99B 1P3AA 1S32D 3W98C 5BT1C 3AV2B 4H9NB 4M6BA 5F99C 4X23D 3UTBC 5B32C 4NE3A 2NZDD 1BH9B 3LZ1A 3MVDA 1ZLAA 1P3OB 1M18D 3AFAA 3C1BB 3WKJA 5AVCC 3AZJB 2PYOD 5DNMD 3WTPE 3WAAB 4J8WB 1N1JB 1P3FB 5AV9A 2F8NH 4JJNA 5B2JC 3X1VC 4WNNA 3MNNA 3W99A 3MGRD 1M19D 3W97C 5JRGB 3P5JB 3AV2A 1EQZC 4H9NA 1M1AD 2YFVB 4J8XD 5BS7A 1BH9A 4XZQA 3AZGD 1P3OA 4G91C 3C1BA 1P3KB 5B1MB 3AZJA 5B24C 5B0ZB 5DNNB 3LJAD 3AZIC 3AYWB 3WAAA 4J8WA 5AVBB 3B0BA 1N1JA 1P3BC 1P3FA 5GT0B 2NQBC 4NFTA 4ZBJC 5CPJB 5B2ID 4Z66C 1B67A 3X1TC 5GXQC 3KUYC 1P3GD 5B32B 3KWQC 1P3LD 5JRGA 2CV5C 5GT3D 2YFVA 3MGQC 2JCHA 5AVCB 2HIOC 4KGCC 5B31B 1P3KA 1KX4A 5B1MA 3W96C 5DNNA 1P3IA 1F1EA 3AYWA 5AY8D 2F8NK 5AVBA 2FJ7B 1P3MD 2J8PA 5C3IC 2Y2KA 5CPJA 5AV5D 3AZEC 3MGPC 3H0LC 3W98A 1F66D 3KSYA 5B32A 3UTAD 3TU4D 4UUZB 3X1UC 5GSUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1L D;  1AOI D;  5AVC A;  4WU8 C;  3B6G C;  5B31 A;  3X1S D;  5B0Y D;  2FJ7 A;  3X1V A;  4Z66 B;  3AZL D;  4J8V D;  5CPK C;  1HQ3 B;  4ZUX D;  4WZS B;  1EQZ A;  4YS3 C;  1JFI B;  3V9R A;  1Q9C A;  4UUZ A;  3REJ D;  1A7W A;  3B6F D;  2HIO B;  4XUJ B;  3REI B;  4KGC B;  5E5A C;  1B6W A;  1TZY D;  4J8U C;  3W96 B;  1BFM A;  1HTA A;  5CPI C;  3AZI A;  4KUD C;  1P3B A;  4DRB A;  3KXB C;  5C3I B;  5AV8 D;  4Z66 A;  3AZN D;  3AZM C;  3AZF C;  1HQ3 A;  4KHA B;  4QLC D;  4YM6 C;  3KWQ A;  1ID3 C;  4R8P C;  2ARO D;  4LD9 B;  1S32 C;  4WU8 B;  2HIO A;  1KX3 D;  4KGC A;  3W96 A;  4X23 C;  1M18 C;  2PYO C;  5DNM C;  1KX5 B;  3MVD B;  3AZH D;  1ZLA B;  3MGP A;  3WKJ B;  3O62 B;  4KHA A;  3WTP B;  5AV6 D;  4LD9 A;  2BYM B;  3MGR C;  4WU8 A;  1P34 D;  1M19 C;  3AFA D;  3LEL B;  5CPI B;  4WU9 B;  3VH6 W;  1M1A C;  2F8N B;  4H9S A;  2RVQ D;  3KXB B;  4J8X C;  3AV1 D;  3C1C D;  3AZG C;  5AV9 D;  4JJN D;  3UT9 D;  3LJA C;  1KX5 A;  4XZQ B;  4G92 B;  3W99 D;  3O62 A;  3WTP A;  4YS3 A;  3A6N D;  5B2I C;  4WV4 B;  2BYM A;  1P3G C;  3LEL A;  1P3L C;  5CPI A;  4WU9 A;  5GT3 C;  4H9R B;  2F8N A;  3MGS D;  4J8W D;  3WAA D;  3KXB A;  2PYO B;  5DNM B;  1P3F D;  5AY8 C;  4EO5 C;  1KX4 B;  1P3M C;  4Z5T B;  5JRG D;  1P3I B;  3MGR B;  5AV5 C;  1M19 B;  5CHL B;  3REL C;  1F66 C;  3UTA C;  1ULY A;  5B1M D;  3W98 B;  4H9R A;  5DNN D;  5B0Z D;  5B31 G;  3LZ0 D;  3UTB B;  5F99 B;  1M18 A;  5B1L C;  5AVB D;  1AOI C;  2PYO A;  5DNM A;  5GT0 D;  3X1S C;  5CPJ D;  5B0Y C;  3AZK C;  5JA4 A;  3REK D;  1U35 D;  3VH6 T;  5B32 D;  4Z5T A;  3AZL C;  5CP6 D;  3MGR A;  1P3G B;  1M19 A;  5B2J B;  4ZUX C;  2YFW B;  3X1V B;  5GT3 B;  3AN2 D;  5B31 D;  3REJ C;  5B33 C;  3W97 B;  1EQZ B;  3B6F C;  1KU5 A;  3UTB A;  5F99 A;  3V9R B;  4E45 A;  2FJ7 D;  1TZY C;  3LJA A;  1P3P D;  5AY8 B;  1H3O B;  4G91 B;  2IO5 C;  4EO5 B;  5B24 B;  3AZI B;  2CWE A;  5B2I A;  5AV8 C;  3AZN C;  1P3B B;  2NQB B;  3REL B;  4HGA C;  4ZBJ B;  4QLC C;  5B2J A;  1P3G A;  2YFW A;  4H9P B;  2ARO C;  3X1T B;  5GT3 A;  5FUG B;  5GXQ B;  3KUY B;  5B1L B;  3KWQ B;  5B40 D;  3W97 A;  2CV5 B;  4H9O B;  1KX3 C;  3MGQ B;  5B0Y B;  3AZK B;  5AY8 A;  1H3O A;  1HQ3 D;  3VH6 A;  5B24 A;  3AZL B;  3WA9 C;  5AV5 A;  3AZH C;  2NQB A;  3REL A;  4XUJ D;  3REI D;  4H9P A;  3AZE B;  3MGP B;  5B33 B;  3X1T A;  5AV6 C;  5FUG A;  5GXQ A;  3KUY A;  3REH D;  4NE6 A;  5B1L A;  1AOI A;  1P34 C;  3VH5 W;  2CV5 A;  4H9O A;  3X1U B;  3AFA C;  4AWL C;  2IO5 B;  3MGQ A;  5B0Y A;  3AZK A;  2RVQ C;  3B6G B;  3AV1 C;  3C1C C;  4JJN C;  3AZL A;  3UT9 C;  2NZD C;  2HUE C;  4HGA B;  4LD9 D;  3W99 C;  5CPK B;  3A6N C;  3AZE A;  5B33 A;  1P3A D;  3B6F A;  4YS3 B;  4CAY B;  1TZY A;  2L5A A;  3X1U A;  4CSR B;  3LZ1 D;  1KX5 D;  3MVD D;  1ZLA D;  5E5A B;  4J8U B;  3WAA C;  3MGS C;  4J8W C;  3B6G A;  3O62 D;  3WA9 B;  3WKJ D;  3WTP D;  1P3F C;  4KUD B;  3B0C T;  5CPK A;  3AZM B;  5AV6 B;  3LEL D;  3AZF B;  5JRG C;  4WU9 D;  3MNN D;  4YM6 B;  1ID3 B;  4R8P B;  1P34 B;  2F8N D;  4CAY A;  3AV2 D;  3NQU B;  4AWL B;  5BNV B;  1S32 B;  5B1M C;  4CSR A;  3AV1 B;  5B0Z C;  3R45 B;  5DNN C;  4XZQ D;  3LZ0 C;  5E5A A;  4X23 B;  4J8U A;  1P3O D;  4H9Q B;  2NZD B;  3C1B D;  3UT9 B;  3WA9 A;  3AZJ D;  5GT0 C;  3AZH A;  4KUD A;  1M18 B;  5CPJ C;  3VH5 T;  3A6N B;  3REK C;  1U35 C;  3AZM A;  5AV6 A;  3AZF A;  5JA4 B;  5KDM B;  5CP6 C;  4YM6 A;  1ID3 A;  4R8P A;  1P34 A;  3NQU A;  3AN2 C;  5B32 G;  5BNV A;  1S32 A;  5B31 C;  3MGS B;  1WWI A;  3AV1 A;  3C1C A;  2BYK B;  3R45 A;  1M1A B;  4X23 A;  4H9Q A;  2NZD A;  2FJ7 C;  3UT9 A;  3TU4 C;  1P3K D;  1KX4 D;  4J8X B;  4Z5T D;  3AZG B;  5GSU C;  3NQJ B;  1P3I D;  1P3P C;  3AYW D;  3A6N A;  3LJA B;  3W98 D;  5KDM A;  5BT1 D;  3UTB D;  5F99 D;  5B2I B;  4J8V C;  3LZ0 B;  3MGS A;  1P3L B;  5B40 C;  5AVC D;  2BYK A;  1M1A A;  1BH8 B;  3VH5 A;  4J8X A;  3AZG A;  3NQJ A;  2LY8 A;  3REK B;  1HQ3 C;  1U35 B;  5B2J D;  3X1V D;  5CP6 B;  1P3M B;  1WWS A;  3W97 D;  1EQZ D;  4XUJ C;  3REI C;  3AN2 B;  5AV5 B;  5B0Z A;  5G49 B;  3LZ0 A;  3REH C;  1F66 B;  3UTA B;  4DRA A;  3TU4 B;  1P3L A;  5B24 D;  5GT0 A;  3B0C W;  5BNX B;  5GSU B;  3AZI D;  1P3P B;  1BH8 A;  1AOI B;  1P3B D;  3REK A;  2NQB D;  3REL D;  3X1S B;  1U35 A;  5BO0 B;  4Z66 D;  5CP6 A;  3X1T D;  5GXQ D;  3KUY D;  4LD9 C;  1P3M A;  3KWQ D;  4J8V B;  2CV5 D;  3AN2 A;  4ZUX B;  3MGQ D;  5B40 B;  1P3A C;  4H9S C;  3AZK D;  5G49 A;  2HIO D;  1F66 A;  4KGC D;  3UTA A;  3TU4 A;  3REJ B;  3W96 D;  3B6F B;  5BNX A;  5GSU A;  1P3P A;  4Z2M G;  3LZ1 C;  1KX5 C;  3MVD C;  1ZLA C;  1TZY B;  3WKJ C;  3O62 C;  3WTP C;  3X1S A;  3B0D C;  5BO0 A;  3AZE D;  3MGP D;  5B33 D;  5AV9 C;  5AV8 B;  3AZN B;  4J8V A;  4NE5 A;  3X1U D;  3LEL C;  3REH B;  3MNN C;  4QLC B;  4WU9 C;  4ZUX A;  5B40 A;  2ARO B;  4WU8 D;  3B6G D;  2JSS A;  3AV2 C;  3REJ A;  1KX3 B;  5BS7 C;  4XZQ C;  2F8N G;  4G92 C;  1TAF B;  1P3O C;  3C1B C;  5CPK D;  3AZJ C;  1JFI A;  4XUJ A;  4YS3 D;  3REI A;  3AZH B;  5AV8 A;  3AZN A;  1P3A B;  3REH A;  4QLC A;  2ARO A;  5E5A D;  4J8U D;  3WA9 D;  4E44 A;  5CPI D;  1R4V A;  3LZ1 B;  4KUD D;  3AFA B;  1KX3 A;  3KXB D;  1TAF A;  3B0D B;  1P3K C;  1KX4 C;  3AZM D;  4Z5T C;  3AZF D;  3C1C B;  4Z2M H;  1P3I C;  5AV9 B;  4YM6 D;  3AYW C;  1ID3 D;  4JJN B;  5AVB C;  4R8P D;  2HUE B;  4WNN B;  3MNN B;  3W99 B;  1P3A A;  1S32 D;  3W98 C;  5BT1 C;  3AV2 B;  4H9N B;  4M6B A;  5F99 C;  4X23 D;  3UTB C;  5B32 C;  4NE3 A;  2NZD D;  1BH9 B;  3LZ1 A;  3MVD A;  1ZLA A;  1P3O B;  1M18 D;  3AFA A;  3C1B B;  3WKJ A;  5AVC C;  3AZJ B;  2PYO D;  5DNM D;  3WTP E;  3WAA B;  4J8W B;  1N1J B;  1P3F B;  5AV9 A;  2F8N H;  4JJN A;  5B2J C;  3X1V C;  4WNN A;  3MNN A;  3W99 A;  3MGR D;  1M19 D;  3W97 C;  5JRG B;  3AV2 A;  1EQZ C;  4H9N A;  1M1A D;  2YFV B;  4J8X D;  5BS7 A;  1BH9 A;  4XZQ A;  3AZG D;  1P3O A;  4G91 C;  3C1B A;  1P3K B;  5B1M B;  3AZJ A;  5B24 C;  5B0Z B;  5DNN B;  3LJA D;  3AZI C;  3AYW B;  3WAA A;  4J8W A;  5AVB B;  3B0B A;  1N1J A;  1P3B C;  1P3F A;  5GT0 B;  2NQB C;  4NFT A;  4ZBJ C;  5CPJ B;  5B2I D;  4Z66 C;  1B67 A;  3X1T C;  5GXQ C;  3KUY C;  1P3G D;  5B32 B;  3KWQ C;  1P3L D;  5JRG A;  2CV5 C;  5GT3 D;  2YFV A;  3MGQ C;  5AVC B;  2HIO C;  4KGC C;  5B31 B;  1P3K A;  1KX4 A;  5B1M A;  3W96 C;  5DNN A;  1P3I A;  1F1E A;  3AYW A;  5AY8 D;  2F8N K;  5AVB A;  2FJ7 B;  1P3M D;  5C3I C;  5CPJ A;  5AV5 D;  3AZE C;  3MGP C;  3W98 A;  1F66 D;  3KSY A;  5B32 A;  3UTA D;  3TU4 D;  4UUZ B;  3X1U C;  5GSU D; 
#chains in the Genus database with same CATH topology
 5B1L D;  3EPL A;  1AOI D;  5AVC A;  4WU8 C;  3B6G C;  2UWX A;  5B31 A;  3X1S D;  5B0Y D;  2F2A C;  2FJ7 A;  3X1V A;  4Z66 B;  3AZL D;  4J8V D;  5CPK C;  2BG1 A;  1HQ3 B;  2Y2G A;  4ZUX D;  4WZS B;  1EQZ A;  4UPK A;  4YS3 C;  1JFI B;  3V9R A;  1Q9C A;  2XD1 A;  4UUZ A;  1A7W A;  2DQN C;  3REJ D;  3B6F D;  2HIO B;  4XUJ B;  3REI B;  4KGC B;  5E5A C;  1B6W A;  1TZY D;  4J8U C;  3W96 B;  1BFM A;  1HTA A;  5CPI C;  3AZI A;  4KUD C;  1P3B A;  4DRB A;  3KXB C;  5C3I B;  5AV8 D;  4Z66 A;  3AZN D;  3AZM C;  3AZF C;  1HQ3 A;  4KHA B;  4QLC D;  4YM6 C;  3KWQ A;  1ID3 C;  4R8P C;  2ARO D;  4LD9 B;  1S32 C;  4WU8 B;  2Y2H A;  2HIO A;  1KX3 D;  4KGC A;  3W96 A;  4X23 C;  1M18 C;  2PYO C;  5DNM C;  1KX5 B;  2Y2O A;  3MVD B;  3AZH D;  3MGP A;  1ZLA B;  3WKJ B;  3O62 B;  4KHA A;  3IP4 C;  3WTP B;  2Y2M A;  5AV6 D;  4LD9 A;  2BYM B;  3MGR C;  4WU8 A;  1P34 D;  1M19 C;  3AFA D;  3LEL B;  5CPI B;  4WU9 B;  3VH6 W;  1M1A C;  2F8N B;  4H9S A;  2RVQ D;  3KXB B;  4J8X C;  3AV1 D;  3C1C D;  3AZG C;  5AV9 D;  1Z2C B;  4JJN D;  3UT9 D;  3LJA C;  1KX5 A;  4XZQ B;  4G92 B;  3W99 D;  3O62 A;  3WTP A;  4YS3 A;  3A6N D;  3A1K A;  5B2I C;  4WV4 B;  2BYM A;  1P3G C;  3LEL A;  1P3L C;  5CPI A;  4WU9 A;  5GT3 C;  4H9R B;  2F8N A;  3MGS D;  4J8W D;  3WAA D;  3KXB A;  2PYO B;  5DNM B;  1P3F D;  5AY8 C;  4EO5 C;  1KX4 B;  1P3M C;  4Z5T B;  5JRG D;  1P3I B;  3MGR B;  5AV5 C;  1M19 B;  5CHL B;  3REL C;  1F66 C;  3UTA C;  1ULY A;  5B1M D;  3W98 B;  4H9R A;  5DNN D;  5B0Z D;  5B31 G;  3LZ0 D;  3UTB B;  5F99 B;  1M18 A;  5B1L C;  5AVB D;  1AOI C;  2PYO A;  5DNM A;  5GT0 D;  3X1S C;  5CPJ D;  5B0Y C;  3AZK C;  5JA4 A;  3REK D;  1U35 D;  3VH6 T;  5B32 D;  4Z5T A;  3AZL C;  5CP6 D;  3MGR A;  1P3G B;  1M19 A;  4ZUX C;  5B2J B;  2YFW B;  3X1V B;  5GT3 B;  3AN2 D;  5B31 D;  2G5I C;  3REJ C;  5B33 C;  3W97 B;  1EQZ B;  3B6F C;  1KU5 A;  3UTB A;  5F99 A;  3V9R B;  3A1I A;  4E45 A;  2FJ7 D;  1TZY C;  3LJA A;  1P3P D;  5AY8 B;  1H3O B;  4G91 B;  2IO5 C;  4EO5 B;  2ZY5 A;  5B24 B;  3AZI B;  2CWE A;  5B2I A;  5AV8 C;  3AZN C;  1P3B B;  2NQB B;  2Y2I A;  3REL B;  4HGA C;  4ZBJ B;  4QLC C;  5B2J A;  1P3G A;  2YFW A;  4H9P B;  2ARO C;  3X1T B;  5GT3 A;  5FUG B;  2XD5 A;  5GXQ B;  3KUY B;  5B1L B;  3KWQ B;  5B40 D;  3W97 A;  2CV5 B;  4H9O B;  1KX3 C;  3MGQ B;  5B0Y B;  3AZK B;  4DQY B;  5AY8 A;  1H3O A;  1HQ3 D;  3VH6 A;  2RIQ A;  5B24 A;  3AZL B;  3WA9 C;  2ZY3 A;  5AV5 A;  3AZH C;  2NQB A;  3REL A;  4XUJ D;  3REI D;  4H9P A;  3AZE B;  3MGP B;  5B33 B;  3X1T A;  5AV6 C;  5FUG A;  5GXQ A;  3KUY A;  3REH D;  4NE6 A;  5B1L A;  1AOI A;  2Y2N A;  1P34 C;  3VH5 W;  2CV5 A;  4H9O A;  3X1U B;  3AFA C;  1T3U A;  4AWL C;  2IO5 B;  3MGQ A;  5B0Y A;  3AZK A;  2RVQ C;  3B6G B;  3AV1 C;  3C1C C;  4JJN C;  3AZL A;  3UT9 C;  2NZD C;  2HUE C;  4HGA B;  4LD9 D;  3W99 C;  5CPK B;  3A6N C;  3AZE A;  2Y2Q A;  5B33 A;  1P3A D;  3B6F A;  4YS3 B;  4CAY B;  2FFF B;  1TZY A;  2L5A A;  3X1U A;  4CSR B;  3LZ1 D;  1KX5 D;  3MVD D;  1ZLA D;  5E5A B;  4J8U B;  3FDD A;  3WAA C;  3MGS C;  4J8W C;  3O62 D;  3B6G A;  3WA9 B;  3WTP D;  3WKJ D;  1P3F C;  3AL0 C;  4KUD B;  3B0C T;  5CPK A;  3AZM B;  5AV6 B;  3EPH A;  3LEL D;  3AZF B;  5JRG C;  4WU9 D;  3MNN D;  4YM6 B;  1ID3 B;  4R8P B;  1P34 B;  2F8N D;  3H0M C;  4CAY A;  3AV2 D;  3NQU B;  4AWL B;  5BNV B;  1S32 B;  5B1M C;  4CSR A;  3AV1 B;  5B0Z C;  3R45 B;  5DNN C;  4XZQ D;  3LZ0 C;  5E5A A;  4X23 B;  4J8U A;  1P3O D;  4H9Q B;  2NZD B;  3C1B D;  3UT9 B;  3WA9 A;  3AZJ D;  5GT0 C;  3AZH A;  4KUD A;  1M18 B;  5CPJ C;  2Y2L A;  3VH5 T;  3A6N B;  3REK C;  1U35 C;  3AZM A;  5AV6 A;  3AZF A;  5JA4 B;  5KDM B;  5CP6 C;  4YM6 A;  1ID3 A;  4R8P A;  3EG5 B;  1P34 A;  3NQU A;  3AN2 C;  5B32 G;  5BNV A;  1S32 A;  5B31 C;  3MGS B;  1WWI A;  3AV1 A;  3C1C A;  2BYK B;  3R45 A;  1M1A B;  4X23 A;  4H9Q A;  2NZD A;  2FJ7 C;  3UT9 A;  3TU4 C;  1P3K D;  1KX4 D;  4J8X B;  4Z5T D;  3AZG B;  5GSU C;  3NQJ B;  1P3I D;  1P3P C;  3AYW D;  3A6N A;  3LJA B;  2W8S A;  3W98 D;  5KDM A;  5BT1 D;  3UTB D;  5F99 D;  5B2I B;  4J8V C;  3LZ0 B;  3MGS A;  1P3L B;  5B40 C;  5AVC D;  2BYK A;  1M1A A;  1BH8 B;  3VH5 A;  4J8X A;  3AZG A;  2LY8 A;  3NQJ A;  3REK B;  1HQ3 C;  1U35 B;  5B2J D;  3X1V D;  5CP6 B;  1W2E A;  1WWS A;  3H0R C;  1P3M B;  3W97 D;  1EQZ D;  4XUJ C;  3REI C;  3AN2 B;  5AV5 B;  5B0Z A;  5G49 B;  3LZ0 A;  3REH C;  1F66 B;  3UTA B;  4DRA A;  3TU4 B;  1P3L A;  2Y2J A;  5GT0 A;  3B0C W;  1PZR A;  5BNX B;  5GSU B;  5B24 D;  3AZI D;  1P3P B;  1BH8 A;  1AOI B;  1P3B D;  3REK A;  2NQB D;  3REL D;  3KFU G;  3X1S B;  1U35 A;  5BO0 B;  4Z66 D;  5CP6 A;  3X1T D;  5GXQ D;  3KUY D;  4LD9 C;  1P3M A;  3EPJ A;  3KWQ D;  4J8V B;  2CV5 D;  3AN2 A;  4ZUX B;  3MGQ D;  5B40 B;  1P3A C;  4H9S C;  3AZK D;  5G49 A;  2HIO D;  1F66 A;  4KGC D;  2JE5 A;  3UTA A;  3TU4 A;  3REJ B;  3W96 D;  3B6F B;  5BNX A;  5GSU A;  1P3P A;  4Z2M G;  3LZ1 C;  1KX5 C;  3MVD C;  1ZLA C;  1TZY B;  3WKJ C;  3O62 C;  3WTP C;  3X1S A;  2ZY4 A;  3B0D C;  5BO0 A;  3AZE D;  3MGP D;  5B33 D;  5AV9 C;  2VQR A;  5AV8 B;  3AZN B;  4J8V A;  4NE5 A;  3X1U D;  3LEL C;  3REH B;  3MNN C;  4QLC B;  4WU9 C;  4ZUX A;  5B40 A;  2DF4 C;  2ARO B;  4WU8 D;  4WJ3 C;  3B6G D;  2JSS A;  3AV2 C;  3REJ A;  1KX3 B;  5BS7 C;  4XZQ C;  2F8N G;  4G92 C;  1TAF B;  1P3O C;  2ZM5 A;  3C1B C;  5CPK D;  3AZJ C;  1JFI A;  4XUJ A;  4YS3 D;  3REI A;  3F6T A;  3AZH B;  5AV8 A;  2Y2P A;  3AZN A;  1P3A B;  2ZY2 A;  3EPK A;  3REH A;  4QLC A;  2ARO A;  5E5A D;  4J8U D;  3WA9 D;  4E44 A;  5CPI D;  1R4V A;  3LZ1 B;  4KUD D;  3AFA B;  1KX3 A;  2G5H C;  3KXB D;  1TAF A;  3B0D B;  1P3K C;  1KX4 C;  3AZM D;  4Z5T C;  3AZF D;  3C1C B;  4Z2M H;  1P3I C;  5AV9 B;  4YM6 D;  3AYW C;  1ID3 D;  4JJN B;  5AVB C;  4R8P D;  2HUE B;  4WNN B;  3MNN B;  3W99 B;  1P3A A;  1S32 D;  3W98 C;  5BT1 C;  3AV2 B;  4H9N B;  4M6B A;  5F99 C;  4X23 D;  3UTB C;  5B32 C;  4NE3 A;  2NZD D;  1BH9 B;  3LZ1 A;  3MVD A;  1ZLA A;  1P3O B;  1M18 D;  3AFA A;  3C1B B;  3WKJ A;  5AVC C;  3AZJ B;  2PYO D;  5DNM D;  3WTP E;  3WAA B;  4J8W B;  1N1J B;  1P3F B;  5AV9 A;  2F8N H;  4JJN A;  5B2J C;  3X1V C;  4WNN A;  3MNN A;  3W99 A;  3MGR D;  1M19 D;  3W97 C;  5JRG B;  3P5J B;  3AV2 A;  1EQZ C;  4H9N A;  1M1A D;  2YFV B;  4J8X D;  5BS7 A;  1BH9 A;  4XZQ A;  3AZG D;  1P3O A;  4G91 C;  3C1B A;  1P3K B;  5B1M B;  3AZJ A;  5B24 C;  5B0Z B;  5DNN B;  3LJA D;  3AZI C;  3AYW B;  3WAA A;  4J8W A;  5AVB B;  3B0B A;  1N1J A;  1P3B C;  1P3F A;  5GT0 B;  2NQB C;  4NFT A;  4ZBJ C;  5CPJ B;  5B2I D;  4Z66 C;  1B67 A;  3X1T C;  5GXQ C;  3KUY C;  1P3G D;  5B32 B;  3KWQ C;  1P3L D;  5JRG A;  2CV5 C;  5GT3 D;  2YFV A;  3MGQ C;  2JCH A;  5AVC B;  2HIO C;  4KGC C;  5B31 B;  1P3K A;  1KX4 A;  5B1M A;  3W96 C;  5DNN A;  1P3I A;  1F1E A;  3AYW A;  5AY8 D;  2F8N K;  5AVB A;  2FJ7 B;  1P3M D;  2J8P A;  5C3I C;  2Y2K A;  5CPJ A;  5AV5 D;  3AZE C;  3MGP C;  3H0L C;  3W98 A;  1F66 D;  3KSY A;  5B32 A;  3UTA D;  3TU4 D;  4UUZ B;  3X1U C;  5GSU D; 
#chains in the Genus database with same CATH homology
 5B1L D;  3EPL A;  1AOI D;  5AVC A;  4WU8 C;  3B6G C;  2UWX A;  5B31 A;  3X1S D;  5B0Y D;  2F2A C;  2FJ7 A;  3X1V A;  4Z66 B;  3AZL D;  4J8V D;  5CPK C;  2BG1 A;  1HQ3 B;  2Y2G A;  4ZUX D;  4WZS B;  1EQZ A;  4UPK A;  4YS3 C;  1JFI B;  3V9R A;  1Q9C A;  2XD1 A;  4UUZ A;  1A7W A;  2DQN C;  3REJ D;  3B6F D;  2HIO B;  4XUJ B;  3REI B;  4KGC B;  5E5A C;  1B6W A;  1TZY D;  4J8U C;  3W96 B;  1BFM A;  1HTA A;  5CPI C;  3AZI A;  4KUD C;  1P3B A;  4DRB A;  3KXB C;  5C3I B;  5AV8 D;  4Z66 A;  3AZN D;  3AZM C;  3AZF C;  1HQ3 A;  4KHA B;  4QLC D;  4YM6 C;  3KWQ A;  1ID3 C;  4R8P C;  2ARO D;  4LD9 B;  1S32 C;  4WU8 B;  2Y2H A;  2HIO A;  1KX3 D;  4KGC A;  3W96 A;  4X23 C;  1M18 C;  2PYO C;  5DNM C;  1KX5 B;  2Y2O A;  3MVD B;  3AZH D;  3MGP A;  1ZLA B;  3WKJ B;  3O62 B;  4KHA A;  3IP4 C;  3WTP B;  2Y2M A;  5AV6 D;  4LD9 A;  2BYM B;  3MGR C;  4WU8 A;  1P34 D;  1M19 C;  3AFA D;  3LEL B;  5CPI B;  4WU9 B;  3VH6 W;  1M1A C;  2F8N B;  4H9S A;  2RVQ D;  3KXB B;  4J8X C;  3AV1 D;  3C1C D;  3AZG C;  5AV9 D;  1Z2C B;  4JJN D;  3UT9 D;  3LJA C;  1KX5 A;  4XZQ B;  4G92 B;  3W99 D;  3O62 A;  3WTP A;  4YS3 A;  3A6N D;  3A1K A;  5B2I C;  4WV4 B;  2BYM A;  1P3G C;  3LEL A;  1P3L C;  5CPI A;  4WU9 A;  5GT3 C;  4H9R B;  2F8N A;  3MGS D;  4J8W D;  3WAA D;  3KXB A;  2PYO B;  5DNM B;  1P3F D;  5AY8 C;  4EO5 C;  1KX4 B;  1P3M C;  4Z5T B;  5JRG D;  1P3I B;  3MGR B;  5AV5 C;  1M19 B;  5CHL B;  3REL C;  1F66 C;  3UTA C;  1ULY A;  5B1M D;  3W98 B;  4H9R A;  5DNN D;  5B0Z D;  5B31 G;  3LZ0 D;  3UTB B;  5F99 B;  1M18 A;  5B1L C;  5AVB D;  1AOI C;  2PYO A;  5DNM A;  5GT0 D;  3X1S C;  5CPJ D;  5B0Y C;  3AZK C;  5JA4 A;  3REK D;  1U35 D;  3VH6 T;  5B32 D;  4Z5T A;  3AZL C;  5CP6 D;  3MGR A;  1P3G B;  1M19 A;  4ZUX C;  5B2J B;  2YFW B;  3X1V B;  5GT3 B;  3AN2 D;  5B31 D;  2G5I C;  3REJ C;  5B33 C;  3W97 B;  1EQZ B;  3B6F C;  1KU5 A;  3UTB A;  5F99 A;  3V9R B;  3A1I A;  4E45 A;  2FJ7 D;  1TZY C;  3LJA A;  1P3P D;  5AY8 B;  1H3O B;  4G91 B;  2IO5 C;  4EO5 B;  2ZY5 A;  5B24 B;  3AZI B;  2CWE A;  5B2I A;  5AV8 C;  3AZN C;  1P3B B;  2NQB B;  2Y2I A;  3REL B;  4HGA C;  4ZBJ B;  4QLC C;  5B2J A;  1P3G A;  2YFW A;  4H9P B;  2ARO C;  3X1T B;  5GT3 A;  5FUG B;  2XD5 A;  5GXQ B;  3KUY B;  5B1L B;  3KWQ B;  5B40 D;  3W97 A;  2CV5 B;  4H9O B;  1KX3 C;  3MGQ B;  5B0Y B;  3AZK B;  4DQY B;  5AY8 A;  1H3O A;  1HQ3 D;  3VH6 A;  2RIQ A;  5B24 A;  3AZL B;  3WA9 C;  2ZY3 A;  5AV5 A;  3AZH C;  2NQB A;  3REL A;  4XUJ D;  3REI D;  4H9P A;  3AZE B;  3MGP B;  5B33 B;  3X1T A;  5AV6 C;  5FUG A;  5GXQ A;  3KUY A;  3REH D;  4NE6 A;  5B1L A;  1AOI A;  2Y2N A;  1P34 C;  3VH5 W;  2CV5 A;  4H9O A;  3X1U B;  3AFA C;  1T3U A;  4AWL C;  2IO5 B;  3MGQ A;  5B0Y A;  3AZK A;  2RVQ C;  3B6G B;  3AV1 C;  3C1C C;  4JJN C;  3AZL A;  3UT9 C;  2NZD C;  2HUE C;  4HGA B;  4LD9 D;  3W99 C;  5CPK B;  3A6N C;  3AZE A;  2Y2Q A;  5B33 A;  1P3A D;  3B6F A;  4YS3 B;  4CAY B;  2FFF B;  1TZY A;  2L5A A;  3X1U A;  4CSR B;  3LZ1 D;  1KX5 D;  3MVD D;  1ZLA D;  5E5A B;  4J8U B;  3FDD A;  3WAA C;  3MGS C;  4J8W C;  3O62 D;  3B6G A;  3WA9 B;  3WTP D;  3WKJ D;  1P3F C;  3AL0 C;  4KUD B;  3B0C T;  5CPK A;  3AZM B;  5AV6 B;  3EPH A;  3LEL D;  3AZF B;  5JRG C;  4WU9 D;  3MNN D;  4YM6 B;  1ID3 B;  4R8P B;  1P34 B;  2F8N D;  3H0M C;  4CAY A;  3AV2 D;  3NQU B;  4AWL B;  5BNV B;  1S32 B;  5B1M C;  4CSR A;  3AV1 B;  5B0Z C;  3R45 B;  5DNN C;  4XZQ D;  3LZ0 C;  5E5A A;  4X23 B;  4J8U A;  1P3O D;  4H9Q B;  2NZD B;  3C1B D;  3UT9 B;  3WA9 A;  3AZJ D;  5GT0 C;  3AZH A;  4KUD A;  1M18 B;  5CPJ C;  2Y2L A;  3VH5 T;  3A6N B;  3REK C;  1U35 C;  3AZM A;  5AV6 A;  3AZF A;  5JA4 B;  5KDM B;  5CP6 C;  4YM6 A;  1ID3 A;  4R8P A;  3EG5 B;  1P34 A;  3NQU A;  3AN2 C;  5B32 G;  5BNV A;  1S32 A;  5B31 C;  3MGS B;  1WWI A;  3AV1 A;  3C1C A;  2BYK B;  3R45 A;  1M1A B;  4X23 A;  4H9Q A;  2NZD A;  2FJ7 C;  3UT9 A;  3TU4 C;  1P3K D;  1KX4 D;  4J8X B;  4Z5T D;  3AZG B;  5GSU C;  3NQJ B;  1P3I D;  1P3P C;  3AYW D;  3A6N A;  3LJA B;  2W8S A;  3W98 D;  5KDM A;  5BT1 D;  3UTB D;  5F99 D;  5B2I B;  4J8V C;  3LZ0 B;  3MGS A;  1P3L B;  5B40 C;  5AVC D;  2BYK A;  1M1A A;  1BH8 B;  3VH5 A;  4J8X A;  3AZG A;  2LY8 A;  3NQJ A;  3REK B;  1HQ3 C;  1U35 B;  5B2J D;  3X1V D;  5CP6 B;  1W2E A;  1WWS A;  3H0R C;  1P3M B;  3W97 D;  1EQZ D;  4XUJ C;  3REI C;  3AN2 B;  5AV5 B;  5B0Z A;  5G49 B;  3LZ0 A;  3REH C;  1F66 B;  3UTA B;  4DRA A;  3TU4 B;  1P3L A;  2Y2J A;  5GT0 A;  3B0C W;  1PZR A;  5BNX B;  5GSU B;  5B24 D;  3AZI D;  1P3P B;  1BH8 A;  1AOI B;  1P3B D;  3REK A;  2NQB D;  3REL D;  3KFU G;  3X1S B;  1U35 A;  5BO0 B;  4Z66 D;  5CP6 A;  3X1T D;  5GXQ D;  3KUY D;  4LD9 C;  1P3M A;  3EPJ A;  3KWQ D;  4J8V B;  2CV5 D;  3AN2 A;  4ZUX B;  3MGQ D;  5B40 B;  1P3A C;  4H9S C;  3AZK D;  5G49 A;  2HIO D;  1F66 A;  4KGC D;  2JE5 A;  3UTA A;  3TU4 A;  3REJ B;  3W96 D;  3B6F B;  5BNX A;  5GSU A;  1P3P A;  4Z2M G;  3LZ1 C;  1KX5 C;  3MVD C;  1ZLA C;  1TZY B;  3WKJ C;  3O62 C;  3WTP C;  3X1S A;  2ZY4 A;  3B0D C;  5BO0 A;  3AZE D;  3MGP D;  5B33 D;  5AV9 C;  2VQR A;  5AV8 B;  3AZN B;  4J8V A;  4NE5 A;  3X1U D;  3LEL C;  3REH B;  3MNN C;  4QLC B;  4WU9 C;  4ZUX A;  5B40 A;  2DF4 C;  2ARO B;  4WU8 D;  4WJ3 C;  3B6G D;  2JSS A;  3AV2 C;  3REJ A;  1KX3 B;  5BS7 C;  4XZQ C;  2F8N G;  4G92 C;  1TAF B;  1P3O C;  2ZM5 A;  3C1B C;  5CPK D;  3AZJ C;  1JFI A;  4XUJ A;  4YS3 D;  3REI A;  3F6T A;  3AZH B;  5AV8 A;  2Y2P A;  3AZN A;  1P3A B;  2ZY2 A;  3EPK A;  3REH A;  4QLC A;  2ARO A;  5E5A D;  4J8U D;  3WA9 D;  4E44 A;  5CPI D;  1R4V A;  3LZ1 B;  4KUD D;  3AFA B;  1KX3 A;  2G5H C;  3KXB D;  1TAF A;  3B0D B;  1P3K C;  1KX4 C;  3AZM D;  4Z5T C;  3AZF D;  3C1C B;  4Z2M H;  1P3I C;  5AV9 B;  4YM6 D;  3AYW C;  1ID3 D;  4JJN B;  5AVB C;  4R8P D;  2HUE B;  4WNN B;  3MNN B;  3W99 B;  1P3A A;  1S32 D;  3W98 C;  5BT1 C;  3AV2 B;  4H9N B;  4M6B A;  5F99 C;  4X23 D;  3UTB C;  5B32 C;  4NE3 A;  2NZD D;  1BH9 B;  3LZ1 A;  3MVD A;  1ZLA A;  1P3O B;  1M18 D;  3AFA A;  3C1B B;  3WKJ A;  5AVC C;  3AZJ B;  2PYO D;  5DNM D;  3WTP E;  3WAA B;  4J8W B;  1N1J B;  1P3F B;  5AV9 A;  2F8N H;  4JJN A;  5B2J C;  3X1V C;  4WNN A;  3MNN A;  3W99 A;  3MGR D;  1M19 D;  3W97 C;  5JRG B;  3P5J B;  3AV2 A;  1EQZ C;  4H9N A;  1M1A D;  2YFV B;  4J8X D;  5BS7 A;  1BH9 A;  4XZQ A;  3AZG D;  1P3O A;  4G91 C;  3C1B A;  1P3K B;  5B1M B;  3AZJ A;  5B24 C;  5B0Z B;  5DNN B;  3LJA D;  3AZI C;  3AYW B;  3WAA A;  4J8W A;  5AVB B;  3B0B A;  1N1J A;  1P3B C;  1P3F A;  5GT0 B;  2NQB C;  4NFT A;  4ZBJ C;  5CPJ B;  5B2I D;  4Z66 C;  1B67 A;  3X1T C;  5GXQ C;  3KUY C;  1P3G D;  5B32 B;  3KWQ C;  1P3L D;  5JRG A;  2CV5 C;  5GT3 D;  2YFV A;  3MGQ C;  2JCH A;  5AVC B;  2HIO C;  4KGC C;  5B31 B;  1P3K A;  1KX4 A;  5B1M A;  3W96 C;  5DNN A;  1P3I A;  1F1E A;  3AYW A;  5AY8 D;  2F8N K;  5AVB A;  2FJ7 B;  1P3M D;  2J8P A;  5C3I C;  2Y2K A;  5CPJ A;  5AV5 D;  3AZE C;  3MGP C;  3H0L C;  3W98 A;  1F66 D;  3KSY A;  5B32 A;  3UTA D;  3TU4 D;  4UUZ B;  3X1U C;  5GSU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...