2CV5A

Crystal structure of human nucleosome core particle
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alteration of the nucleosomal DNA path in the crystal structure of a human nucleosome core particle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2cv5A00
1EQZD 1F66A 2HIOB 3AZNA 4J8XD 1P3BB 3UT9D 1KX4A 3TU4C 3AZGD 3WA9A 3AZEC 3VH5W 3AZLA 5AVCB 3KUYC 3MVDD 3MGQB 4QLCD 3AFAA 5B40C 3AV1A 3REJC 5GT0A 2LY8A 5CPJA 4H9PA 2BYMA 4Z2MG 1ZLAB 2PYOA 5AV5A 1KX5A 1ID3C 2PYOB 1P3IC 4QLCB 4LD9A 5AVBD 3AZJA 1KX5C 3LJAC 5B31B 1P3FC 1N1JB 1F1EA 3KXBB 1BH9B 1TZYD 3MGPC 5CPID 5GSUC 2CWEA 4Z2MH 5AV9D 5GT3D 4UUZB 4R8PD 3UTAD 1KX3D 5B32B 4XZQD 3MNND 2BYKB 5CHLB 3A6NA 3W98D 3KUYD 3WA9B 3WAAB 3W99D 5AV9B 3X1VC 4R8PB 5AVBC 4X23A 5B24D 3REID 3REKD 4XZQB 3MNNB 4DRAA 3AZKC 4M6BA 3REJB 3W97A 3KWQB 3MGPA 3KXBC 5AV5B 2NQBA 4QLCC 3LZ1B 3REKB 1ID3B 2NQBC 5B31A 3AZJB 3NQUA 4J8VA 1AOIC 3AV1B 1U35C 2CV5C 4Z5TA 4E45A 3X1VD 4H9QB 2HUEB 1HQ3B 3LZ0A 4J8WD 4X23C 1HQ3C 5AVBA 2AROD 4WU9D 3C1CD 1KU5A 1P3MD 4XZQC 3MNNC 3W99C 5AV9C 3NQJB 3RELA 3B0DC 4WNNB 5AY8D 5B32A 5B1MA 1P3IB 3MVDA 3LELC 4H9SC 1JFIA 5B24A 3LZ1C 1BFMA 3LJAD 5JRGC 5B1MD 3LZ1A 3MGRA 1Q9CA 3W97D 2CV5B 3AZLD 3AZHA 3AV1C 3REJA 4KUDC 2BYMB 3AFAD 5E5AB 1P34D 2YFWB 1F66B 4KGCC 5DNND 5B2IA 5F99B 3C1BC 3AZLB 4Z5TD 3X1UA 3MGSB 3TU4D 3AZGC 2F8NH 4LD9D 1WWIA 3WKJB 3REHC 1TAFA 5AVBB 5JA4B 3MGRC 3VH5A 3W98C 5AV6B 5B0ZA 4ZBJC 1TZYB 5GT3A 5AV8A 1P3FB 1P3LA 5AV8C 3X1TC 5CPKB 5KDMB 3AZFC 1M18C 4YS3A 3C1BA 1P3PB 4H9PB 5F99C 3REIA 3AZKA 1P3GC 5E5AA 3B0CT 1F66C 3B0CW 5B1LC 5E5AC 5CPKD 5B31G 3WKJC 3WAAA 3REJD 4J8VC 3MGQA 1P34A 2YFVB 1R4VA 4WU9C 3X1TA 4H9RA 5B2JD 1P3GD 5AVCC 4NE6A 4J8XC 3AZJD 5B0ZB 1P3KC 5CP6C 3B6FC 4LD9C 4NFTA 3AZJC 5CP6B 3B6FB 4WU8D 5CP6A 1P3FA 3B6FA 4KUDD 4YM6B 3RELB 5B2JB 5DNMC 4R8PA 2AROB 3RELC 3AYWB 3W97C 3WKJA 5GXQB 3X1SB 3AZFB 4XUJC 3MGRD 5FUGA 4XUJB 3AV2C 4KUDB 5B1LB 3AN2D 3B6GA 3UTBB 4Z5TC 2FJ7A 5BT1D 4J8VB 3AZFD 4XZQA 3MNNA 3MGRB 1EQZB 2HIOD 1P3BD 3W96D 4CSRA 3LELD 2JSSA 3AZIA 4J8XB 1BH8A 4R8PC 5DNMA 4CAYB 5GT0D 1P3OB 4H9NA 1M1AB 4J8VD 2AROC 4WZSB 3REKA 3W96B 5B31C 4ZBJB 3LELA 4J8UA 3AFAB 1U35B 5B2JA 5B32C 1AOIB 4J8WA 3X1TB 1TAFB 4H9SA 4EO5B 1M1AD 3REHA 5AV6A 2BYKA 3AN2C 1P3AD 1U35D 3KXBD 1AOID 4YM6A 3AZKD 3AZED 5AV8D 3REHD 2FJ7B 2RVQC 5AV6D 3UTBA 3O62A 1B6WA 4JJNC 3UTAB 1P3AA 1EQZC 3C1BB 4ZUXC 3WA9D 4YS3C 3AZHB 2F8NK 1B67A 3WAAD 4X23D 4E44A 4ZUXB 5B33C 4YS3D 3AZKB 3KWQA 4H9NB 2FJ7D 5B24B 1S32C 2NQBB 2RVQD 5B0ZC 3R45B 5GT3C 4X23B 2NZDB 5AV5D 5CPJB 1P34C 4YM6C 5B40A 4CAYA 5CPKC 5CPIA 3LZ1D 3O62C 4KGCA 3X1VA 3X1VB 3LZ0D 5CPIC 5F99A 3REIC 4NE5A 5B2IB 5JRGD 1P3GB 4WU9B 4JJNB 3AZNC 1KX4C 4J8WB 1M19D 5G49A 4WU8B 4HGAB 5JA4A 1P3MB 4XUJA 4YM6D 5AY8B 1TZYC 1M19B 1P3KA 3VH6A 2PYOC 5AVCA 4CSRB 3O62B 1P3ID 3WTPA 4J8UD 3UT9B 3MGPB 3W97B 2IO5B 2CV5D 2HUEC 5B1LA 5DNMD 1ZLAD 3UTAC 4NE3A 3B6GC 4HGAC 3C1CA 3MGPD 2L5AA 1AOIA 2PYOD 4Z5TB 5B0YD 4G92C 5B33D 5B31D 3V9RB 4H9OA 5JRGA 3LZ0C 1M1AA 5GT3B 5AY8A 1KX3B 4KHAB 5B32D 4LD9B 1KX3C 1M19A 5GSUB 3WKJD 3KXBA 5B0YB 1P3LD 2F8NB 1M19C 1P3AB 3AZND 1KX4D 3MVDC 1P3AC 1P3PC 1P3MA 2NZDC 4ZUXA 4WU8A 1P3FD 3REIB 3AZEB 3W99B 4AWLC 3B6GB 4Z66D 5GSUD 3AZMA 4AWLB 5BT1C 3A6NB 2HIOA 3AZNB 1P3BA 1KX4B 3AZMC 4ZUXD 3WA9C 3AZHC 5DNNA 4YS3B 5BNVA 1ID3D 5AV6C 3AN2A 3B6GD 3VH6W 4H9QA 4Z66B 2NQBD 1ZLAC 2YFWA 1H3OA 1S32D 4H9OB 3W96A 5AV5C 1ID3A 1M18A 1WWSA 3W96C 3X1UB 3MGSA 3KWQC 5B2JC 5B0ZD 3C1CB 3NQUB 3UT9C 2YFVA 1S32A 5B33A 5B24C 5CP6D 1S32B 3B6FD 3W98A 3KUYA 5B2ID 3AFAC 3WAAC 4UUZA 4WV4B 3X1UD 3TU4A 3AYWD 5CPJC 1ULYA 4JJND 3AZEA 3AZLC 3RELD 3MGQC 5C3IC 5GXQD 3X1SD 3WTPD 3AZMB 1N1JA 3NQJA 5B1LD 5BNVB 3AYWA 3KSYA 5CPKA 1P3KD 4Z66C 4G91C 3MGSC 3AZGB 3AZFA 5B40B 5AVCD 1P3IA 3WTPB 3UT9A 3LJAB 1P3OC 3MGQD 3LJAA 3UTBD 5BNXB 3O62D 1P3OA 4QLCA 3R45A 1P3KB 4J8UB 5DNNB 3LELB 5GXQC 3X1SC 4WU9A 5B40D 5E5AD 1P34B 3C1CC 5GT0C 1F66D 4J8XA 5GT0B 1BH8B 5DNMB 1P3OD 5F99D 1HTAA 4H9RB 3A6NC 4KGCB 4EO5C 3MGSD 3TU4B 5CPIB 2FJ7C 3X1TD 5BO0B 5C3IB 3B0BA 5B33B 1A7WA 1P3GA 2F8NA 5AV9A 3WTPE 3WTPC 3B0DB 5GSUA 3UTAA 4KGCD 5KDMA 4G91B 3W98B 3KUYB 3REHB 1P3PA 3X1SA 5GXQA 4WU8C 4J8UC 1P3LB 2F8ND 1JFIB 1TZYA 5AV8B 3AZHD 5BNXA 5B32G 1M1AC 3KWQD 4DRBA 3C1BD 1P3PD 5DNNC 3AZIC 3A6ND 3AZIB 2NZDD 1ZLAA 3W99A 3AV1D 3VH5T 5CPJD 3UTBC 2IO5C 1HQ3D 3AV2B 1KX5D 3AZID 3AV2A 1P3MC 5B0YA 1U35A 1M18D 5BO0A 2HIOC 1P3BC 2CV5A 2NZDA 1BH9A 4J8WC 1HQ3A 3LZ0B 5BS7C 4G92B 3V9RA 5JRGB 5AY8C 3AV2D 4KUDA 1KX5B 5BS7A 1M18B 1KX3A 1P3LC 4KHAA 4XUJD 4JJNA 1EQZA 4WNNA 2AROA 3REKC 3AYWC 3X1UC 5G49B 3AZGA 5B1MC 3AN2B 4Z66A 2F8NG 3MVDB 3AZMD 5B1MB 5B2IC 5B0YC 3VH6T 1H3OB 5FUGB
chains in the Genus database with same CATH superfamily
1EQZD 1F66A 2HIOB 3AZNA 4J8XD 1P3BB 3UT9D 1KX4A 2Y2JA 3TU4C 3AZGD 3WA9A 3AZEC 3VH5W 3AZLA 5AVCB 3KUYC 3IP4C 3MVDD 3MGQB 4QLCD 3AFAA 5B40C 2DF4C 3AV1A 3F6TA 3REJC 5GT0A 2LY8A 5CPJA 4H9PA 2BYMA 4Z2MG 1ZLAB 2PYOA 5AV5A 1KX5A 1ID3C 2PYOB 1P3IC 4QLCB 4LD9A 5AVBD 3AZJA 1KX5C 3LJAC 5B31B 1P3FC 1N1JB 1F1EA 3KXBB 1W2EA 2VQRA 1BH9B 1TZYD 3MGPC 5GSUC 5CPID 2CWEA 4Z2MH 5AV9D 5GT3D 4UUZB 4R8PD 3UTAD 1KX3D 5B32B 4XZQD 3MNND 2BYKB 4WJ3C 5CHLB 3A6NA 3W98D 3KUYD 2J8PA 3WA9B 3WAAB 2BG1A 3W99D 5AV9B 2Y2MA 3X1VC 4R8PB 5AVBC 4X23A 5B24D 3REID 3REKD 4XZQB 3MNNB 2Y2KA 2W8SA 2ZY2A 4DRAA 3AZKC 4M6BA 3REJB 3W97A 3KWQB 3MGPA 3KXBC 5AV5B 2NQBA 4QLCC 3LZ1B 3REKB 1ID3B 2NQBC 5B31A 3AZJB 3NQUA 4J8VA 1AOIC 3P5JB 3AV1B 1U35C 2CV5C 4Z5TA 4E45A 3X1VD 4H9QB 2HUEB 1HQ3B 3LZ0A 4J8WD 5AVBA 1HQ3C 4X23C 2ZY4A 2AROD 4WU9D 3C1CD 1KU5A 1P3MD 4XZQC 3MNNC 3W99C 5AV9C 2FFFB 3NQJB 3RELA 2ZM5A 3B0DC 4WNNB 5AY8D 5B32A 5B1MA 1P3IB 3MVDA 3LELC 4H9SC 1JFIA 5B24A 3LZ1C 1BFMA 3LJAD 5JRGC 5B1MD 3LZ1A 3MGRA 1Q9CA 3W97D 2CV5B 3AZLD 3AZHA 3AV1C 3REJA 4KUDC 2BYMB 3AFAD 5E5AB 1P34D 2YFWB 1F66B 4KGCC 5DNND 5B2IA 5F99B 3C1BC 3AZLB 4Z5TD 3X1UA 3MGSB 3TU4D 3AZGC 2F8NH 4LD9D 1WWIA 3WKJB 3REHC 1TAFA 5AVBB 5JA4B 3MGRC 3VH5A 3W98C 5AV6B 5B0ZA 4ZBJC 1TZYB 5GT3A 5AV8A 1P3FB 1P3LA 5AV8C 3X1TC 5CPKB 5KDMB 3AZFC 1M18C 4YS3A 3C1BA 1P3PB 4H9PB 5F99C 3REIA 3AZKA 1P3GC 5E5AA 3EG5B 3B0CT 1F66C 3B0CW 5B1LC 5E5AC 5CPKD 5B31G 3WKJC 3WAAA 3REJD 4J8VC 3MGQA 1P34A 2YFVB 1R4VA 4WU9C 3X1TA 4H9RA 5B2JD 1P3GD 5AVCC 4NE6A 3AL0C 4J8XC 3AZJD 5B0ZB 2Y2PA 2G5HC 1P3KC 5CP6C 3B6FC 4LD9C 4NFTA 3AZJC 5CP6B 3B6FB 4WU8D 5CP6A 1P3FA 3B6FA 4KUDD 4YM6B 3RELB 5B2JB 5DNMC 4R8PA 2AROB 3RELC 3AYWB 3W97C 3WKJA 5GXQB 3X1SB 3AZFB 4XUJC 3MGRD 5FUGA 4XUJB 3AV2C 4KUDB 5B1LB 3AN2D 3B6GA 3UTBB 4Z5TC 2FJ7A 5BT1D 4J8VB 3AZFD 4XZQA 3MNNA 3MGRB 1EQZB 2HIOD 1P3BD 3W96D 4CSRA 3KFUG 3LELD 2JSSA 3AZIA 4J8XB 1BH8A 4R8PC 5DNMA 4CAYB 5GT0D 1P3OB 4H9NA 2Y2QA 1M1AB 4J8VD 2AROC 4WZSB 3REKA 2Y2LA 3W96B 5B31C 4ZBJB 3LELA 4J8UA 3AFAB 1U35B 5B2JA 5B32C 1AOIB 4J8WA 3X1TB 1TAFB 4H9SA 4EO5B 1M1AD 3REHA 5AV6A 2BYKA 3AN2C 1P3AD 1PZRA 1U35D 3H0RC 3KXBD 1AOID 3H0MC 4YM6A 3AZKD 3AZED 5AV8D 3REHD 2FJ7B 2RVQC 5AV6D 3UTBA 3O62A 1B6WA 4JJNC 3UTAB 1P3AA 1EQZC 3C1BB 4ZUXC 3WA9D 4YS3C 3AZHB 2F8NK 1B67A 3WAAD 4X23D 4E44A 4ZUXB 5B33C 3EPKA 4YS3D 3AZKB 2RIQA 3KWQA 4H9NB 2FJ7D 2DQNC 5B24B 1S32C 2NQBB 2RVQD 5B0ZC 2Y2IA 3R45B 5GT3C 4X23B 2NZDB 5AV5D 5CPJB 1P34C 4YM6C 5B40A 4CAYA 2Y2OA 5CPKC 5CPIA 3LZ1D 3O62C 4KGCA 3X1VA 3X1VB 3LZ0D 5CPIC 5F99A 3REIC 4NE5A 5B2IB 5JRGD 1P3GB 4WU9B 4JJNB 3AZNC 2ZY5A 1KX4C 4J8WB 1M19D 5G49A 4WU8B 4HGAB 5JA4A 1P3MB 4XUJA 4YM6D 5AY8B 1TZYC 1M19B 1P3KA 3VH6A 2PYOC 2XD5A 5AVCA 4CSRB 3O62B 1P3ID 3WTPA 4J8UD 3UT9B 1T3UA 3MGPB 3W97B 2IO5B 2CV5D 2HUEC 5B1LA 5DNMD 1ZLAD 3UTAC 4NE3A 3B6GC 3A1KA 4HGAC 3C1CA 3MGPD 2L5AA 1AOIA 2PYOD 4Z5TB 5B0YD 4G92C 5B33D 2ZY3A 5B31D 3V9RB 4H9OA 2F2AC 5JRGA 3LZ0C 1M1AA 5GT3B 5AY8A 1KX3B 4KHAB 5B32D 4LD9B 1KX3C 1M19A 5GSUB 3WKJD 3KXBA 5B0YB 1P3LD 2F8NB 1M19C 2UWXA 1P3AB 3AZND 1KX4D 3MVDC 1P3AC 1P3PC 1P3MA 2NZDC 4ZUXA 4WU8A 1P3FD 3REIB 3AZEB 3W99B 4AWLC 3B6GB 4Z66D 5GSUD 3AZMA 4AWLB 5BT1C 3A6NB 2HIOA 3AZNB 1P3BA 1KX4B 3AZMC 4ZUXD 3WA9C 3AZHC 5DNNA 4YS3B 5BNVA 1ID3D 2XD1A 5AV6C 3AN2A 3B6GD 3VH6W 4H9QA 4Z66B 2NQBD 1ZLAC 2YFWA 1H3OA 1S32D 4H9OB 3W96A 5AV5C 1ID3A 1M18A 1WWSA 3W96C 3EPHA 3X1UB 3MGSA 3KWQC 5B2JC 5B0ZD 3C1CB 3NQUB 3EPJA 3UT9C 2YFVA 1S32A 5B33A 5B24C 5CP6D 1S32B 3B6FD 3W98A 3KUYA 5B2ID 3AFAC 3WAAC 4UUZA 4WV4B 3X1UD 3TU4A 3AYWD 5CPJC 1ULYA 4JJND 3AZEA 3AZLC 3RELD 3MGQC 5C3IC 5GXQD 3X1SD 3WTPD 3AZMB 1N1JA 3NQJA 5B1LD 5BNVB 3AYWA 3KSYA 5CPKA 1P3KD 4Z66C 3A1IA 4G91C 3MGSC 3AZGB 3AZFA 5B40B 5AVCD 1P3IA 3WTPB 3UT9A 3LJAB 1P3OC 3MGQD 3LJAA 3UTBD 5BNXB 3O62D 1P3OA 4QLCA 3R45A 1P3KB 4J8UB 5DNNB 3LELB 5GXQC 3X1SC 4WU9A 5B40D 5E5AD 1P34B 3C1CC 5GT0C 1F66D 4J8XA 5GT0B 1BH8B 5DNMB 1P3OD 5F99D 1HTAA 4H9RB 3A6NC 4KGCB 4EO5C 3MGSD 3TU4B 5CPIB 2FJ7C 4DQYB 3X1TD 5BO0B 5C3IB 3B0BA 5B33B 1A7WA 1P3GA 2F8NA 5AV9A 3WTPE 3WTPC 3B0DB 5GSUA 3UTAA 4KGCD 5KDMA 4G91B 3W98B 3KUYB 3FDDA 3REHB 1P3PA 3X1SA 5GXQA 4WU8C 1Z2CB 4J8UC 1P3LB 2F8ND 1JFIB 1TZYA 5AV8B 4UPKA 3AZHD 5BNXA 5B32G 1M1AC 3KWQD 4DRBA 3C1BD 1P3PD 5DNNC 3AZIC 3A6ND 2JCHA 3AZIB 2NZDD 1ZLAA 3W99A 3AV1D 3VH5T 5CPJD 3UTBC 2IO5C 2Y2GA 1HQ3D 3AV2B 1KX5D 3AZID 3AV2A 1P3MC 5B0YA 1U35A 1M18D 5BO0A 2HIOC 1P3BC 2CV5A 2NZDA 1BH9A 2Y2NA 4J8WC 1HQ3A 3LZ0B 5BS7C 4G92B 3V9RA 5JRGB 5AY8C 3AV2D 4KUDA 1KX5B 2JE5A 5BS7A 1M18B 1KX3A 1P3LC 4KHAA 4XUJD 3EPLA 4JJNA 1EQZA 3H0LC 4WNNA 2AROA 3REKC 3AYWC 3X1UC 2Y2HA 5G49B 5B1MC 2G5IC 4Z66A 3AZGA 3MVDB 3AN2B 3AZMD 2F8NG 5B1MB 5B2IC 5B0YC 3VH6T 1H3OB 5FUGB
chains in the Genus database with same CATH topology
1EQZD 1F66A 2HIOB 3AZNA 4J8XD 1P3BB 3UT9D 1KX4A 2Y2JA 3TU4C 3AZGD 3WA9A 3AZEC 3VH5W 3AZLA 5AVCB 3KUYC 3IP4C 3MVDD 3MGQB 4QLCD 3AFAA 5B40C 2DF4C 3AV1A 3F6TA 3REJC 5GT0A 2LY8A 5CPJA 4H9PA 2BYMA 4Z2MG 1ZLAB 2PYOA 5AV5A 1KX5A 1ID3C 2PYOB 1P3IC 4QLCB 4LD9A 5AVBD 3AZJA 1KX5C 3LJAC 5B31B 1P3FC 1N1JB 1F1EA 3KXBB 1W2EA 2VQRA 1BH9B 1TZYD 3MGPC 5GSUC 5CPID 2CWEA 4Z2MH 5AV9D 5GT3D 4UUZB 4R8PD 3UTAD 1KX3D 5B32B 4XZQD 3MNND 2BYKB 4WJ3C 5CHLB 3A6NA 3W98D 3KUYD 2J8PA 3WA9B 3WAAB 2BG1A 3W99D 5AV9B 2Y2MA 3X1VC 4R8PB 5AVBC 4X23A 5B24D 3REID 3REKD 4XZQB 3MNNB 2Y2KA 2W8SA 2ZY2A 4DRAA 3AZKC 4M6BA 3REJB 3W97A 3KWQB 3MGPA 3KXBC 5AV5B 2NQBA 4QLCC 3LZ1B 3REKB 1ID3B 2NQBC 5B31A 3AZJB 3NQUA 4J8VA 1AOIC 3P5JB 3AV1B 1U35C 2CV5C 4Z5TA 4E45A 3X1VD 4H9QB 2HUEB 1HQ3B 3LZ0A 4J8WD 5AVBA 1HQ3C 4X23C 2ZY4A 2AROD 4WU9D 3C1CD 1KU5A 1P3MD 4XZQC 3MNNC 3W99C 5AV9C 2FFFB 3NQJB 3RELA 2ZM5A 3B0DC 4WNNB 5AY8D 5B32A 5B1MA 1P3IB 3MVDA 3LELC 4H9SC 1JFIA 5B24A 3LZ1C 1BFMA 3LJAD 5JRGC 5B1MD 3LZ1A 3MGRA 1Q9CA 3W97D 2CV5B 3AZLD 3AZHA 3AV1C 3REJA 4KUDC 2BYMB 3AFAD 5E5AB 1P34D 2YFWB 1F66B 4KGCC 5DNND 5B2IA 5F99B 3C1BC 3AZLB 4Z5TD 3X1UA 3MGSB 3TU4D 3AZGC 2F8NH 4LD9D 1WWIA 3WKJB 3REHC 1TAFA 5AVBB 5JA4B 3MGRC 3VH5A 3W98C 5AV6B 5B0ZA 4ZBJC 1TZYB 5GT3A 5AV8A 1P3FB 1P3LA 5AV8C 3X1TC 5CPKB 5KDMB 3AZFC 1M18C 4YS3A 3C1BA 1P3PB 4H9PB 5F99C 3REIA 3AZKA 1P3GC 5E5AA 3EG5B 3B0CT 1F66C 3B0CW 5B1LC 5E5AC 5CPKD 5B31G 3WKJC 3WAAA 3REJD 4J8VC 3MGQA 1P34A 2YFVB 1R4VA 4WU9C 3X1TA 4H9RA 5B2JD 1P3GD 5AVCC 4NE6A 3AL0C 4J8XC 3AZJD 5B0ZB 2Y2PA 2G5HC 1P3KC 5CP6C 3B6FC 4LD9C 4NFTA 3AZJC 5CP6B 3B6FB 4WU8D 5CP6A 1P3FA 3B6FA 4KUDD 4YM6B 3RELB 5B2JB 5DNMC 4R8PA 2AROB 3RELC 3AYWB 3W97C 3WKJA 5GXQB 3X1SB 3AZFB 4XUJC 3MGRD 5FUGA 4XUJB 3AV2C 4KUDB 5B1LB 3AN2D 3B6GA 3UTBB 4Z5TC 2FJ7A 5BT1D 4J8VB 3AZFD 4XZQA 3MNNA 3MGRB 1EQZB 2HIOD 1P3BD 3W96D 4CSRA 3KFUG 3LELD 2JSSA 3AZIA 4J8XB 1BH8A 4R8PC 5DNMA 4CAYB 5GT0D 1P3OB 4H9NA 2Y2QA 1M1AB 4J8VD 2AROC 4WZSB 3REKA 2Y2LA 3W96B 5B31C 4ZBJB 3LELA 4J8UA 3AFAB 1U35B 5B2JA 5B32C 1AOIB 4J8WA 3X1TB 1TAFB 4H9SA 4EO5B 1M1AD 3REHA 5AV6A 2BYKA 3AN2C 1P3AD 1PZRA 1U35D 3H0RC 3KXBD 1AOID 3H0MC 4YM6A 3AZKD 3AZED 5AV8D 3REHD 2FJ7B 2RVQC 5AV6D 3UTBA 3O62A 1B6WA 4JJNC 3UTAB 1P3AA 1EQZC 3C1BB 4ZUXC 3WA9D 4YS3C 3AZHB 2F8NK 1B67A 3WAAD 4X23D 4E44A 4ZUXB 5B33C 3EPKA 4YS3D 3AZKB 2RIQA 3KWQA 4H9NB 2FJ7D 2DQNC 5B24B 1S32C 2NQBB 2RVQD 5B0ZC 2Y2IA 3R45B 5GT3C 4X23B 2NZDB 5AV5D 5CPJB 1P34C 4YM6C 5B40A 4CAYA 2Y2OA 5CPKC 5CPIA 3LZ1D 3O62C 4KGCA 3X1VA 3X1VB 3LZ0D 5CPIC 5F99A 3REIC 4NE5A 5B2IB 5JRGD 1P3GB 4WU9B 4JJNB 3AZNC 2ZY5A 1KX4C 4J8WB 1M19D 5G49A 4WU8B 4HGAB 5JA4A 1P3MB 4XUJA 4YM6D 5AY8B 1TZYC 1M19B 1P3KA 3VH6A 2PYOC 2XD5A 5AVCA 4CSRB 3O62B 1P3ID 3WTPA 4J8UD 3UT9B 1T3UA 3MGPB 3W97B 2IO5B 2CV5D 2HUEC 5B1LA 5DNMD 1ZLAD 3UTAC 4NE3A 3B6GC 3A1KA 4HGAC 3C1CA 3MGPD 2L5AA 1AOIA 2PYOD 4Z5TB 5B0YD 4G92C 5B33D 2ZY3A 5B31D 3V9RB 4H9OA 2F2AC 5JRGA 3LZ0C 1M1AA 5GT3B 5AY8A 1KX3B 4KHAB 5B32D 4LD9B 1KX3C 1M19A 5GSUB 3WKJD 3KXBA 5B0YB 1P3LD 2F8NB 1M19C 2UWXA 1P3AB 3AZND 1KX4D 3MVDC 1P3AC 1P3PC 1P3MA 2NZDC 4ZUXA 4WU8A 1P3FD 3REIB 3AZEB 3W99B 4AWLC 3B6GB 4Z66D 5GSUD 3AZMA 4AWLB 5BT1C 3A6NB 2HIOA 3AZNB 1P3BA 1KX4B 3AZMC 4ZUXD 3WA9C 3AZHC 5DNNA 4YS3B 5BNVA 1ID3D 2XD1A 5AV6C 3AN2A 3B6GD 3VH6W 4H9QA 4Z66B 2NQBD 1ZLAC 2YFWA 1H3OA 1S32D 4H9OB 3W96A 5AV5C 1ID3A 1M18A 1WWSA 3W96C 3EPHA 3X1UB 3MGSA 3KWQC 5B2JC 5B0ZD 3C1CB 3NQUB 3EPJA 3UT9C 2YFVA 1S32A 5B33A 5B24C 5CP6D 1S32B 3B6FD 3W98A 3KUYA 5B2ID 3AFAC 3WAAC 4UUZA 4WV4B 3X1UD 3TU4A 3AYWD 5CPJC 1ULYA 4JJND 3AZEA 3AZLC 3RELD 3MGQC 5C3IC 5GXQD 3X1SD 3WTPD 3AZMB 1N1JA 3NQJA 5B1LD 5BNVB 3AYWA 3KSYA 5CPKA 1P3KD 4Z66C 3A1IA 4G91C 3MGSC 3AZGB 3AZFA 5B40B 5AVCD 1P3IA 3WTPB 3UT9A 3LJAB 1P3OC 3MGQD 3LJAA 3UTBD 5BNXB 3O62D 1P3OA 4QLCA 3R45A 1P3KB 4J8UB 5DNNB 3LELB 5GXQC 3X1SC 4WU9A 5B40D 5E5AD 1P34B 3C1CC 5GT0C 1F66D 4J8XA 5GT0B 1BH8B 5DNMB 1P3OD 5F99D 1HTAA 4H9RB 3A6NC 4KGCB 4EO5C 3MGSD 3TU4B 5CPIB 2FJ7C 4DQYB 3X1TD 5BO0B 5C3IB 3B0BA 5B33B 1A7WA 1P3GA 2F8NA 5AV9A 3WTPE 3WTPC 3B0DB 5GSUA 3UTAA 4KGCD 5KDMA 4G91B 3W98B 3KUYB 3FDDA 3REHB 1P3PA 3X1SA 5GXQA 4WU8C 1Z2CB 4J8UC 1P3LB 2F8ND 1JFIB 1TZYA 5AV8B 4UPKA 3AZHD 5BNXA 5B32G 1M1AC 3KWQD 4DRBA 3C1BD 1P3PD 5DNNC 3AZIC 3A6ND 2JCHA 3AZIB 2NZDD 1ZLAA 3W99A 3AV1D 3VH5T 5CPJD 3UTBC 2IO5C 2Y2GA 1HQ3D 3AV2B 1KX5D 3AZID 3AV2A 1P3MC 5B0YA 1U35A 1M18D 5BO0A 2HIOC 1P3BC 2CV5A 2NZDA 1BH9A 2Y2NA 4J8WC 1HQ3A 3LZ0B 5BS7C 4G92B 3V9RA 5JRGB 5AY8C 3AV2D 4KUDA 1KX5B 2JE5A 5BS7A 1M18B 1KX3A 1P3LC 4KHAA 4XUJD 3EPLA 4JJNA 1EQZA 3H0LC 4WNNA 2AROA 3REKC 3AYWC 3X1UC 2Y2HA 5G49B 5B1MC 2G5IC 4Z66A 3AZGA 3MVDB 3AN2B 3AZMD 2F8NG 5B1MB 5B2IC 5B0YC 3VH6T 1H3OB 5FUGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQZ D;  1F66 A;  2HIO B;  3AZN A;  4J8X D;  1P3B B;  3UT9 D;  1KX4 A;  3TU4 C;  3AZG D;  3WA9 A;  3AZE C;  3VH5 W;  3AZL A;  5AVC B;  3KUY C;  3MVD D;  3MGQ B;  4QLC D;  3AFA A;  5B40 C;  3AV1 A;  3REJ C;  5GT0 A;  2LY8 A;  5CPJ A;  4H9P A;  2BYM A;  4Z2M G;  1ZLA B;  2PYO A;  5AV5 A;  1KX5 A;  1ID3 C;  2PYO B;  1P3I C;  4QLC B;  4LD9 A;  5AVB D;  3AZJ A;  1KX5 C;  3LJA C;  5B31 B;  1P3F C;  1N1J B;  1F1E A;  3KXB B;  1BH9 B;  1TZY D;  3MGP C;  5CPI D;  5GSU C;  2CWE A;  4Z2M H;  5AV9 D;  5GT3 D;  4UUZ B;  4R8P D;  3UTA D;  1KX3 D;  5B32 B;  4XZQ D;  3MNN D;  2BYK B;  5CHL B;  3A6N A;  3W98 D;  3KUY D;  3WA9 B;  3WAA B;  3W99 D;  5AV9 B;  3X1V C;  4R8P B;  5AVB C;  4X23 A;  5B24 D;  3REI D;  3REK D;  4XZQ B;  3MNN B;  4DRA A;  3AZK C;  4M6B A;  3REJ B;  3W97 A;  3KWQ B;  3MGP A;  3KXB C;  5AV5 B;  2NQB A;  4QLC C;  3LZ1 B;  3REK B;  1ID3 B;  2NQB C;  5B31 A;  3AZJ B;  3NQU A;  4J8V A;  1AOI C;  3AV1 B;  1U35 C;  2CV5 C;  4Z5T A;  4E45 A;  3X1V D;  4H9Q B;  2HUE B;  1HQ3 B;  3LZ0 A;  4J8W D;  4X23 C;  1HQ3 C;  5AVB A;  2ARO D;  4WU9 D;  3C1C D;  1KU5 A;  1P3M D;  4XZQ C;  3MNN C;  3W99 C;  5AV9 C;  3NQJ B;  3REL A;  3B0D C;  4WNN B;  5AY8 D;  5B32 A;  5B1M A;  1P3I B;  3MVD A;  3LEL C;  4H9S C;  1JFI A;  5B24 A;  3LZ1 C;  1BFM A;  3LJA D;  5JRG C;  5B1M D;  3LZ1 A;  3MGR A;  1Q9C A;  3W97 D;  2CV5 B;  3AZL D;  3AZH A;  3AV1 C;  3REJ A;  4KUD C;  2BYM B;  3AFA D;  5E5A B;  1P34 D;  2YFW B;  1F66 B;  4KGC C;  5DNN D;  5B2I A;  5F99 B;  3C1B C;  3AZL B;  4Z5T D;  3X1U A;  3MGS B;  3TU4 D;  3AZG C;  2F8N H;  4LD9 D;  1WWI A;  3WKJ B;  3REH C;  1TAF A;  5AVB B;  5JA4 B;  3MGR C;  3VH5 A;  3W98 C;  5AV6 B;  5B0Z A;  4ZBJ C;  1TZY B;  5GT3 A;  5AV8 A;  1P3F B;  1P3L A;  5AV8 C;  3X1T C;  5CPK B;  5KDM B;  3AZF C;  1M18 C;  4YS3 A;  3C1B A;  1P3P B;  4H9P B;  5F99 C;  3REI A;  3AZK A;  1P3G C;  5E5A A;  3B0C T;  1F66 C;  3B0C W;  5B1L C;  5E5A C;  5CPK D;  5B31 G;  3WKJ C;  3WAA A;  3REJ D;  4J8V C;  3MGQ A;  1P34 A;  2YFV B;  1R4V A;  4WU9 C;  3X1T A;  4H9R A;  5B2J D;  1P3G D;  5AVC C;  4NE6 A;  4J8X C;  3AZJ D;  5B0Z B;  1P3K C;  5CP6 C;  3B6F C;  4LD9 C;  4NFT A;  3AZJ C;  5CP6 B;  3B6F B;  4WU8 D;  5CP6 A;  1P3F A;  3B6F A;  4KUD D;  4YM6 B;  3REL B;  5B2J B;  5DNM C;  4R8P A;  2ARO B;  3REL C;  3AYW B;  3W97 C;  3WKJ A;  5GXQ B;  3X1S B;  3AZF B;  4XUJ C;  3MGR D;  5FUG A;  4XUJ B;  3AV2 C;  4KUD B;  5B1L B;  3AN2 D;  3B6G A;  3UTB B;  4Z5T C;  2FJ7 A;  5BT1 D;  4J8V B;  3AZF D;  4XZQ A;  3MNN A;  3MGR B;  1EQZ B;  2HIO D;  1P3B D;  3W96 D;  4CSR A;  3LEL D;  2JSS A;  3AZI A;  4J8X B;  1BH8 A;  4R8P C;  5DNM A;  4CAY B;  5GT0 D;  1P3O B;  4H9N A;  1M1A B;  4J8V D;  2ARO C;  4WZS B;  3REK A;  3W96 B;  5B31 C;  4ZBJ B;  3LEL A;  4J8U A;  3AFA B;  1U35 B;  5B2J A;  5B32 C;  1AOI B;  4J8W A;  3X1T B;  1TAF B;  4H9S A;  4EO5 B;  1M1A D;  3REH A;  5AV6 A;  2BYK A;  3AN2 C;  1P3A D;  1U35 D;  3KXB D;  1AOI D;  4YM6 A;  3AZK D;  3AZE D;  5AV8 D;  3REH D;  2FJ7 B;  2RVQ C;  5AV6 D;  3UTB A;  3O62 A;  1B6W A;  4JJN C;  3UTA B;  1P3A A;  1EQZ C;  3C1B B;  4ZUX C;  3WA9 D;  4YS3 C;  3AZH B;  2F8N K;  1B67 A;  3WAA D;  4X23 D;  4E44 A;  4ZUX B;  5B33 C;  4YS3 D;  3AZK B;  3KWQ A;  4H9N B;  2FJ7 D;  5B24 B;  1S32 C;  2NQB B;  2RVQ D;  5B0Z C;  3R45 B;  5GT3 C;  4X23 B;  2NZD B;  5AV5 D;  5CPJ B;  1P34 C;  4YM6 C;  5B40 A;  4CAY A;  5CPK C;  5CPI A;  3LZ1 D;  3O62 C;  4KGC A;  3X1V A;  3X1V B;  3LZ0 D;  5CPI C;  5F99 A;  3REI C;  4NE5 A;  5B2I B;  5JRG D;  1P3G B;  4WU9 B;  4JJN B;  3AZN C;  1KX4 C;  4J8W B;  1M19 D;  5G49 A;  4WU8 B;  4HGA B;  5JA4 A;  1P3M B;  4XUJ A;  4YM6 D;  5AY8 B;  1TZY C;  1M19 B;  1P3K A;  3VH6 A;  2PYO C;  5AVC A;  4CSR B;  3O62 B;  1P3I D;  3WTP A;  4J8U D;  3UT9 B;  3MGP B;  3W97 B;  2IO5 B;  2CV5 D;  2HUE C;  5B1L A;  5DNM D;  1ZLA D;  3UTA C;  4NE3 A;  3B6G C;  4HGA C;  3C1C A;  3MGP D;  2L5A A;  1AOI A;  2PYO D;  4Z5T B;  5B0Y D;  4G92 C;  5B33 D;  5B31 D;  3V9R B;  4H9O A;  5JRG A;  3LZ0 C;  1M1A A;  5GT3 B;  5AY8 A;  1KX3 B;  4KHA B;  5B32 D;  4LD9 B;  1KX3 C;  1M19 A;  5GSU B;  3WKJ D;  3KXB A;  5B0Y B;  1P3L D;  2F8N B;  1M19 C;  1P3A B;  3AZN D;  1KX4 D;  3MVD C;  1P3A C;  1P3P C;  1P3M A;  2NZD C;  4ZUX A;  4WU8 A;  1P3F D;  3REI B;  3AZE B;  3W99 B;  4AWL C;  3B6G B;  4Z66 D;  5GSU D;  3AZM A;  4AWL B;  5BT1 C;  3A6N B;  2HIO A;  3AZN B;  1P3B A;  1KX4 B;  3AZM C;  4ZUX D;  3WA9 C;  3AZH C;  5DNN A;  4YS3 B;  5BNV A;  1ID3 D;  5AV6 C;  3AN2 A;  3B6G D;  3VH6 W;  4H9Q A;  4Z66 B;  2NQB D;  1ZLA C;  2YFW A;  1H3O A;  1S32 D;  4H9O B;  3W96 A;  5AV5 C;  1ID3 A;  1M18 A;  1WWS A;  3W96 C;  3X1U B;  3MGS A;  3KWQ C;  5B2J C;  5B0Z D;  3C1C B;  3NQU B;  3UT9 C;  2YFV A;  1S32 A;  5B33 A;  5B24 C;  5CP6 D;  1S32 B;  3B6F D;  3W98 A;  3KUY A;  5B2I D;  3AFA C;  3WAA C;  4UUZ A;  4WV4 B;  3X1U D;  3TU4 A;  3AYW D;  5CPJ C;  1ULY A;  4JJN D;  3AZE A;  3AZL C;  3REL D;  3MGQ C;  5C3I C;  5GXQ D;  3X1S D;  3WTP D;  3AZM B;  1N1J A;  3NQJ A;  5B1L D;  5BNV B;  3AYW A;  3KSY A;  5CPK A;  1P3K D;  4Z66 C;  4G91 C;  3MGS C;  3AZG B;  3AZF A;  5B40 B;  5AVC D;  1P3I A;  3WTP B;  3UT9 A;  3LJA B;  1P3O C;  3MGQ D;  3LJA A;  3UTB D;  5BNX B;  3O62 D;  1P3O A;  4QLC A;  3R45 A;  1P3K B;  4J8U B;  5DNN B;  3LEL B;  5GXQ C;  3X1S C;  4WU9 A;  5B40 D;  5E5A D;  1P34 B;  3C1C C;  5GT0 C;  1F66 D;  4J8X A;  5GT0 B;  1BH8 B;  5DNM B;  1P3O D;  5F99 D;  1HTA A;  4H9R B;  3A6N C;  4KGC B;  4EO5 C;  3MGS D;  3TU4 B;  5CPI B;  2FJ7 C;  3X1T D;  5BO0 B;  5C3I B;  3B0B A;  5B33 B;  1A7W A;  1P3G A;  2F8N A;  5AV9 A;  3WTP E;  3WTP C;  3B0D B;  5GSU A;  3UTA A;  4KGC D;  5KDM A;  4G91 B;  3W98 B;  3KUY B;  3REH B;  1P3P A;  3X1S A;  5GXQ A;  4WU8 C;  4J8U C;  1P3L B;  2F8N D;  1JFI B;  1TZY A;  5AV8 B;  3AZH D;  5BNX A;  5B32 G;  1M1A C;  3KWQ D;  4DRB A;  3C1B D;  1P3P D;  5DNN C;  3AZI C;  3A6N D;  3AZI B;  2NZD D;  1ZLA A;  3W99 A;  3AV1 D;  3VH5 T;  5CPJ D;  3UTB C;  2IO5 C;  1HQ3 D;  3AV2 B;  1KX5 D;  3AZI D;  3AV2 A;  1P3M C;  5B0Y A;  1U35 A;  1M18 D;  5BO0 A;  2HIO C;  1P3B C;  2CV5 A;  2NZD A;  1BH9 A;  4J8W C;  1HQ3 A;  3LZ0 B;  5BS7 C;  4G92 B;  3V9R A;  5JRG B;  5AY8 C;  3AV2 D;  4KUD A;  1KX5 B;  5BS7 A;  1M18 B;  1KX3 A;  1P3L C;  4KHA A;  4XUJ D;  4JJN A;  1EQZ A;  4WNN A;  2ARO A;  3REK C;  3AYW C;  3X1U C;  5G49 B;  3AZG A;  5B1M C;  3AN2 B;  4Z66 A;  2F8N G;  3MVD B;  3AZM D;  5B1M B;  5B2I C;  5B0Y C;  3VH6 T;  1H3O B;  5FUG B; 
#chains in the Genus database with same CATH topology
 1EQZ D;  1F66 A;  2HIO B;  3AZN A;  4J8X D;  1P3B B;  3UT9 D;  1KX4 A;  2Y2J A;  3TU4 C;  3AZG D;  3WA9 A;  3AZE C;  3VH5 W;  3AZL A;  5AVC B;  3KUY C;  3IP4 C;  3MVD D;  3MGQ B;  4QLC D;  3AFA A;  5B40 C;  2DF4 C;  3AV1 A;  3F6T A;  3REJ C;  5GT0 A;  2LY8 A;  5CPJ A;  4H9P A;  2BYM A;  4Z2M G;  1ZLA B;  2PYO A;  5AV5 A;  1KX5 A;  1ID3 C;  2PYO B;  1P3I C;  4QLC B;  4LD9 A;  5AVB D;  3AZJ A;  1KX5 C;  3LJA C;  5B31 B;  1P3F C;  1N1J B;  1F1E A;  3KXB B;  1W2E A;  2VQR A;  1BH9 B;  1TZY D;  3MGP C;  5GSU C;  5CPI D;  2CWE A;  4Z2M H;  5AV9 D;  5GT3 D;  4UUZ B;  4R8P D;  3UTA D;  1KX3 D;  5B32 B;  4XZQ D;  3MNN D;  2BYK B;  4WJ3 C;  5CHL B;  3A6N A;  3W98 D;  3KUY D;  2J8P A;  3WA9 B;  3WAA B;  2BG1 A;  3W99 D;  5AV9 B;  2Y2M A;  3X1V C;  4R8P B;  5AVB C;  4X23 A;  5B24 D;  3REI D;  3REK D;  4XZQ B;  3MNN B;  2Y2K A;  2W8S A;  2ZY2 A;  4DRA A;  3AZK C;  4M6B A;  3REJ B;  3W97 A;  3KWQ B;  3MGP A;  3KXB C;  5AV5 B;  2NQB A;  4QLC C;  3LZ1 B;  3REK B;  1ID3 B;  2NQB C;  5B31 A;  3AZJ B;  3NQU A;  4J8V A;  1AOI C;  3P5J B;  3AV1 B;  1U35 C;  2CV5 C;  4Z5T A;  4E45 A;  3X1V D;  4H9Q B;  2HUE B;  1HQ3 B;  3LZ0 A;  4J8W D;  5AVB A;  1HQ3 C;  4X23 C;  2ZY4 A;  2ARO D;  4WU9 D;  3C1C D;  1KU5 A;  1P3M D;  4XZQ C;  3MNN C;  3W99 C;  5AV9 C;  2FFF B;  3NQJ B;  3REL A;  2ZM5 A;  3B0D C;  4WNN B;  5AY8 D;  5B32 A;  5B1M A;  1P3I B;  3MVD A;  3LEL C;  4H9S C;  1JFI A;  5B24 A;  3LZ1 C;  1BFM A;  3LJA D;  5JRG C;  5B1M D;  3LZ1 A;  3MGR A;  1Q9C A;  3W97 D;  2CV5 B;  3AZL D;  3AZH A;  3AV1 C;  3REJ A;  4KUD C;  2BYM B;  3AFA D;  5E5A B;  1P34 D;  2YFW B;  1F66 B;  4KGC C;  5DNN D;  5B2I A;  5F99 B;  3C1B C;  3AZL B;  4Z5T D;  3X1U A;  3MGS B;  3TU4 D;  3AZG C;  2F8N H;  4LD9 D;  1WWI A;  3WKJ B;  3REH C;  1TAF A;  5AVB B;  5JA4 B;  3MGR C;  3VH5 A;  3W98 C;  5AV6 B;  5B0Z A;  4ZBJ C;  1TZY B;  5GT3 A;  5AV8 A;  1P3F B;  1P3L A;  5AV8 C;  3X1T C;  5CPK B;  5KDM B;  3AZF C;  1M18 C;  4YS3 A;  3C1B A;  1P3P B;  4H9P B;  5F99 C;  3REI A;  3AZK A;  1P3G C;  5E5A A;  3EG5 B;  3B0C T;  1F66 C;  3B0C W;  5B1L C;  5E5A C;  5CPK D;  5B31 G;  3WKJ C;  3WAA A;  3REJ D;  4J8V C;  3MGQ A;  1P34 A;  2YFV B;  1R4V A;  4WU9 C;  3X1T A;  4H9R A;  5B2J D;  1P3G D;  5AVC C;  4NE6 A;  3AL0 C;  4J8X C;  3AZJ D;  5B0Z B;  2Y2P A;  2G5H C;  1P3K C;  5CP6 C;  3B6F C;  4LD9 C;  4NFT A;  3AZJ C;  5CP6 B;  3B6F B;  4WU8 D;  5CP6 A;  1P3F A;  3B6F A;  4KUD D;  4YM6 B;  3REL B;  5B2J B;  5DNM C;  4R8P A;  2ARO B;  3REL C;  3AYW B;  3W97 C;  3WKJ A;  5GXQ B;  3X1S B;  3AZF B;  4XUJ C;  3MGR D;  5FUG A;  4XUJ B;  3AV2 C;  4KUD B;  5B1L B;  3AN2 D;  3B6G A;  3UTB B;  4Z5T C;  2FJ7 A;  5BT1 D;  4J8V B;  3AZF D;  4XZQ A;  3MNN A;  3MGR B;  1EQZ B;  2HIO D;  1P3B D;  3W96 D;  4CSR A;  3KFU G;  3LEL D;  2JSS A;  3AZI A;  4J8X B;  1BH8 A;  4R8P C;  5DNM A;  4CAY B;  5GT0 D;  1P3O B;  4H9N A;  2Y2Q A;  1M1A B;  4J8V D;  2ARO C;  4WZS B;  3REK A;  2Y2L A;  3W96 B;  5B31 C;  4ZBJ B;  3LEL A;  4J8U A;  3AFA B;  1U35 B;  5B2J A;  5B32 C;  1AOI B;  4J8W A;  3X1T B;  1TAF B;  4H9S A;  4EO5 B;  1M1A D;  3REH A;  5AV6 A;  2BYK A;  3AN2 C;  1P3A D;  1PZR A;  1U35 D;  3H0R C;  3KXB D;  1AOI D;  3H0M C;  4YM6 A;  3AZK D;  3AZE D;  5AV8 D;  3REH D;  2FJ7 B;  2RVQ C;  5AV6 D;  3UTB A;  3O62 A;  1B6W A;  4JJN C;  3UTA B;  1P3A A;  1EQZ C;  3C1B B;  4ZUX C;  3WA9 D;  4YS3 C;  3AZH B;  2F8N K;  1B67 A;  3WAA D;  4X23 D;  4E44 A;  4ZUX B;  5B33 C;  3EPK A;  4YS3 D;  3AZK B;  2RIQ A;  3KWQ A;  4H9N B;  2FJ7 D;  2DQN C;  5B24 B;  1S32 C;  2NQB B;  2RVQ D;  5B0Z C;  2Y2I A;  3R45 B;  5GT3 C;  4X23 B;  2NZD B;  5AV5 D;  5CPJ B;  1P34 C;  4YM6 C;  5B40 A;  4CAY A;  2Y2O A;  5CPK C;  5CPI A;  3LZ1 D;  3O62 C;  4KGC A;  3X1V A;  3X1V B;  3LZ0 D;  5CPI C;  5F99 A;  3REI C;  4NE5 A;  5B2I B;  5JRG D;  1P3G B;  4WU9 B;  4JJN B;  3AZN C;  2ZY5 A;  1KX4 C;  4J8W B;  1M19 D;  5G49 A;  4WU8 B;  4HGA B;  5JA4 A;  1P3M B;  4XUJ A;  4YM6 D;  5AY8 B;  1TZY C;  1M19 B;  1P3K A;  3VH6 A;  2PYO C;  2XD5 A;  5AVC A;  4CSR B;  3O62 B;  1P3I D;  3WTP A;  4J8U D;  3UT9 B;  1T3U A;  3MGP B;  3W97 B;  2IO5 B;  2CV5 D;  2HUE C;  5B1L A;  5DNM D;  1ZLA D;  3UTA C;  4NE3 A;  3B6G C;  3A1K A;  4HGA C;  3C1C A;  3MGP D;  2L5A A;  1AOI A;  2PYO D;  4Z5T B;  5B0Y D;  4G92 C;  5B33 D;  2ZY3 A;  5B31 D;  3V9R B;  4H9O A;  2F2A C;  5JRG A;  3LZ0 C;  1M1A A;  5GT3 B;  5AY8 A;  1KX3 B;  4KHA B;  5B32 D;  4LD9 B;  1KX3 C;  1M19 A;  5GSU B;  3WKJ D;  3KXB A;  5B0Y B;  1P3L D;  2F8N B;  1M19 C;  2UWX A;  1P3A B;  3AZN D;  1KX4 D;  3MVD C;  1P3A C;  1P3P C;  1P3M A;  2NZD C;  4ZUX A;  4WU8 A;  1P3F D;  3REI B;  3AZE B;  3W99 B;  4AWL C;  3B6G B;  4Z66 D;  5GSU D;  3AZM A;  4AWL B;  5BT1 C;  3A6N B;  2HIO A;  3AZN B;  1P3B A;  1KX4 B;  3AZM C;  4ZUX D;  3WA9 C;  3AZH C;  5DNN A;  4YS3 B;  5BNV A;  1ID3 D;  2XD1 A;  5AV6 C;  3AN2 A;  3B6G D;  3VH6 W;  4H9Q A;  4Z66 B;  2NQB D;  1ZLA C;  2YFW A;  1H3O A;  1S32 D;  4H9O B;  3W96 A;  5AV5 C;  1ID3 A;  1M18 A;  1WWS A;  3W96 C;  3EPH A;  3X1U B;  3MGS A;  3KWQ C;  5B2J C;  5B0Z D;  3C1C B;  3NQU B;  3EPJ A;  3UT9 C;  2YFV A;  1S32 A;  5B33 A;  5B24 C;  5CP6 D;  1S32 B;  3B6F D;  3W98 A;  3KUY A;  5B2I D;  3AFA C;  3WAA C;  4UUZ A;  4WV4 B;  3X1U D;  3TU4 A;  3AYW D;  5CPJ C;  1ULY A;  4JJN D;  3AZE A;  3AZL C;  3REL D;  3MGQ C;  5C3I C;  5GXQ D;  3X1S D;  3WTP D;  3AZM B;  1N1J A;  3NQJ A;  5B1L D;  5BNV B;  3AYW A;  3KSY A;  5CPK A;  1P3K D;  4Z66 C;  3A1I A;  4G91 C;  3MGS C;  3AZG B;  3AZF A;  5B40 B;  5AVC D;  1P3I A;  3WTP B;  3UT9 A;  3LJA B;  1P3O C;  3MGQ D;  3LJA A;  3UTB D;  5BNX B;  3O62 D;  1P3O A;  4QLC A;  3R45 A;  1P3K B;  4J8U B;  5DNN B;  3LEL B;  5GXQ C;  3X1S C;  4WU9 A;  5B40 D;  5E5A D;  1P34 B;  3C1C C;  5GT0 C;  1F66 D;  4J8X A;  5GT0 B;  1BH8 B;  5DNM B;  1P3O D;  5F99 D;  1HTA A;  4H9R B;  3A6N C;  4KGC B;  4EO5 C;  3MGS D;  3TU4 B;  5CPI B;  2FJ7 C;  4DQY B;  3X1T D;  5BO0 B;  5C3I B;  3B0B A;  5B33 B;  1A7W A;  1P3G A;  2F8N A;  5AV9 A;  3WTP E;  3WTP C;  3B0D B;  5GSU A;  3UTA A;  4KGC D;  5KDM A;  4G91 B;  3W98 B;  3KUY B;  3FDD A;  3REH B;  1P3P A;  3X1S A;  5GXQ A;  4WU8 C;  1Z2C B;  4J8U C;  1P3L B;  2F8N D;  1JFI B;  1TZY A;  5AV8 B;  4UPK A;  3AZH D;  5BNX A;  5B32 G;  1M1A C;  3KWQ D;  4DRB A;  3C1B D;  1P3P D;  5DNN C;  3AZI C;  3A6N D;  2JCH A;  3AZI B;  2NZD D;  1ZLA A;  3W99 A;  3AV1 D;  3VH5 T;  5CPJ D;  3UTB C;  2IO5 C;  2Y2G A;  1HQ3 D;  3AV2 B;  1KX5 D;  3AZI D;  3AV2 A;  1P3M C;  5B0Y A;  1U35 A;  1M18 D;  5BO0 A;  2HIO C;  1P3B C;  2CV5 A;  2NZD A;  1BH9 A;  2Y2N A;  4J8W C;  1HQ3 A;  3LZ0 B;  5BS7 C;  4G92 B;  3V9R A;  5JRG B;  5AY8 C;  3AV2 D;  4KUD A;  1KX5 B;  2JE5 A;  5BS7 A;  1M18 B;  1KX3 A;  1P3L C;  4KHA A;  4XUJ D;  3EPL A;  4JJN A;  1EQZ A;  3H0L C;  4WNN A;  2ARO A;  3REK C;  3AYW C;  3X1U C;  2Y2H A;  5G49 B;  5B1M C;  2G5I C;  4Z66 A;  3AZG A;  3MVD B;  3AN2 B;  3AZM D;  2F8N G;  5B1M B;  5B2I C;  5B0Y C;  3VH6 T;  1H3O B;  5FUG B; 
#chains in the Genus database with same CATH homology
 1EQZ D;  1F66 A;  2HIO B;  3AZN A;  4J8X D;  1P3B B;  3UT9 D;  1KX4 A;  2Y2J A;  3TU4 C;  3AZG D;  3WA9 A;  3AZE C;  3VH5 W;  3AZL A;  5AVC B;  3KUY C;  3IP4 C;  3MVD D;  3MGQ B;  4QLC D;  3AFA A;  5B40 C;  2DF4 C;  3AV1 A;  3F6T A;  3REJ C;  5GT0 A;  2LY8 A;  5CPJ A;  4H9P A;  2BYM A;  4Z2M G;  1ZLA B;  2PYO A;  5AV5 A;  1KX5 A;  1ID3 C;  2PYO B;  1P3I C;  4QLC B;  4LD9 A;  5AVB D;  3AZJ A;  1KX5 C;  3LJA C;  5B31 B;  1P3F C;  1N1J B;  1F1E A;  3KXB B;  1W2E A;  2VQR A;  1BH9 B;  1TZY D;  3MGP C;  5GSU C;  5CPI D;  2CWE A;  4Z2M H;  5AV9 D;  5GT3 D;  4UUZ B;  4R8P D;  3UTA D;  1KX3 D;  5B32 B;  4XZQ D;  3MNN D;  2BYK B;  4WJ3 C;  5CHL B;  3A6N A;  3W98 D;  3KUY D;  2J8P A;  3WA9 B;  3WAA B;  2BG1 A;  3W99 D;  5AV9 B;  2Y2M A;  3X1V C;  4R8P B;  5AVB C;  4X23 A;  5B24 D;  3REI D;  3REK D;  4XZQ B;  3MNN B;  2Y2K A;  2W8S A;  2ZY2 A;  4DRA A;  3AZK C;  4M6B A;  3REJ B;  3W97 A;  3KWQ B;  3MGP A;  3KXB C;  5AV5 B;  2NQB A;  4QLC C;  3LZ1 B;  3REK B;  1ID3 B;  2NQB C;  5B31 A;  3AZJ B;  3NQU A;  4J8V A;  1AOI C;  3P5J B;  3AV1 B;  1U35 C;  2CV5 C;  4Z5T A;  4E45 A;  3X1V D;  4H9Q B;  2HUE B;  1HQ3 B;  3LZ0 A;  4J8W D;  5AVB A;  1HQ3 C;  4X23 C;  2ZY4 A;  2ARO D;  4WU9 D;  3C1C D;  1KU5 A;  1P3M D;  4XZQ C;  3MNN C;  3W99 C;  5AV9 C;  2FFF B;  3NQJ B;  3REL A;  2ZM5 A;  3B0D C;  4WNN B;  5AY8 D;  5B32 A;  5B1M A;  1P3I B;  3MVD A;  3LEL C;  4H9S C;  1JFI A;  5B24 A;  3LZ1 C;  1BFM A;  3LJA D;  5JRG C;  5B1M D;  3LZ1 A;  3MGR A;  1Q9C A;  3W97 D;  2CV5 B;  3AZL D;  3AZH A;  3AV1 C;  3REJ A;  4KUD C;  2BYM B;  3AFA D;  5E5A B;  1P34 D;  2YFW B;  1F66 B;  4KGC C;  5DNN D;  5B2I A;  5F99 B;  3C1B C;  3AZL B;  4Z5T D;  3X1U A;  3MGS B;  3TU4 D;  3AZG C;  2F8N H;  4LD9 D;  1WWI A;  3WKJ B;  3REH C;  1TAF A;  5AVB B;  5JA4 B;  3MGR C;  3VH5 A;  3W98 C;  5AV6 B;  5B0Z A;  4ZBJ C;  1TZY B;  5GT3 A;  5AV8 A;  1P3F B;  1P3L A;  5AV8 C;  3X1T C;  5CPK B;  5KDM B;  3AZF C;  1M18 C;  4YS3 A;  3C1B A;  1P3P B;  4H9P B;  5F99 C;  3REI A;  3AZK A;  1P3G C;  5E5A A;  3EG5 B;  3B0C T;  1F66 C;  3B0C W;  5B1L C;  5E5A C;  5CPK D;  5B31 G;  3WKJ C;  3WAA A;  3REJ D;  4J8V C;  3MGQ A;  1P34 A;  2YFV B;  1R4V A;  4WU9 C;  3X1T A;  4H9R A;  5B2J D;  1P3G D;  5AVC C;  4NE6 A;  3AL0 C;  4J8X C;  3AZJ D;  5B0Z B;  2Y2P A;  2G5H C;  1P3K C;  5CP6 C;  3B6F C;  4LD9 C;  4NFT A;  3AZJ C;  5CP6 B;  3B6F B;  4WU8 D;  5CP6 A;  1P3F A;  3B6F A;  4KUD D;  4YM6 B;  3REL B;  5B2J B;  5DNM C;  4R8P A;  2ARO B;  3REL C;  3AYW B;  3W97 C;  3WKJ A;  5GXQ B;  3X1S B;  3AZF B;  4XUJ C;  3MGR D;  5FUG A;  4XUJ B;  3AV2 C;  4KUD B;  5B1L B;  3AN2 D;  3B6G A;  3UTB B;  4Z5T C;  2FJ7 A;  5BT1 D;  4J8V B;  3AZF D;  4XZQ A;  3MNN A;  3MGR B;  1EQZ B;  2HIO D;  1P3B D;  3W96 D;  4CSR A;  3KFU G;  3LEL D;  2JSS A;  3AZI A;  4J8X B;  1BH8 A;  4R8P C;  5DNM A;  4CAY B;  5GT0 D;  1P3O B;  4H9N A;  2Y2Q A;  1M1A B;  4J8V D;  2ARO C;  4WZS B;  3REK A;  2Y2L A;  3W96 B;  5B31 C;  4ZBJ B;  3LEL A;  4J8U A;  3AFA B;  1U35 B;  5B2J A;  5B32 C;  1AOI B;  4J8W A;  3X1T B;  1TAF B;  4H9S A;  4EO5 B;  1M1A D;  3REH A;  5AV6 A;  2BYK A;  3AN2 C;  1P3A D;  1PZR A;  1U35 D;  3H0R C;  3KXB D;  1AOI D;  3H0M C;  4YM6 A;  3AZK D;  3AZE D;  5AV8 D;  3REH D;  2FJ7 B;  2RVQ C;  5AV6 D;  3UTB A;  3O62 A;  1B6W A;  4JJN C;  3UTA B;  1P3A A;  1EQZ C;  3C1B B;  4ZUX C;  3WA9 D;  4YS3 C;  3AZH B;  2F8N K;  1B67 A;  3WAA D;  4X23 D;  4E44 A;  4ZUX B;  5B33 C;  3EPK A;  4YS3 D;  3AZK B;  2RIQ A;  3KWQ A;  4H9N B;  2FJ7 D;  2DQN C;  5B24 B;  1S32 C;  2NQB B;  2RVQ D;  5B0Z C;  2Y2I A;  3R45 B;  5GT3 C;  4X23 B;  2NZD B;  5AV5 D;  5CPJ B;  1P34 C;  4YM6 C;  5B40 A;  4CAY A;  2Y2O A;  5CPK C;  5CPI A;  3LZ1 D;  3O62 C;  4KGC A;  3X1V A;  3X1V B;  3LZ0 D;  5CPI C;  5F99 A;  3REI C;  4NE5 A;  5B2I B;  5JRG D;  1P3G B;  4WU9 B;  4JJN B;  3AZN C;  2ZY5 A;  1KX4 C;  4J8W B;  1M19 D;  5G49 A;  4WU8 B;  4HGA B;  5JA4 A;  1P3M B;  4XUJ A;  4YM6 D;  5AY8 B;  1TZY C;  1M19 B;  1P3K A;  3VH6 A;  2PYO C;  2XD5 A;  5AVC A;  4CSR B;  3O62 B;  1P3I D;  3WTP A;  4J8U D;  3UT9 B;  1T3U A;  3MGP B;  3W97 B;  2IO5 B;  2CV5 D;  2HUE C;  5B1L A;  5DNM D;  1ZLA D;  3UTA C;  4NE3 A;  3B6G C;  3A1K A;  4HGA C;  3C1C A;  3MGP D;  2L5A A;  1AOI A;  2PYO D;  4Z5T B;  5B0Y D;  4G92 C;  5B33 D;  2ZY3 A;  5B31 D;  3V9R B;  4H9O A;  2F2A C;  5JRG A;  3LZ0 C;  1M1A A;  5GT3 B;  5AY8 A;  1KX3 B;  4KHA B;  5B32 D;  4LD9 B;  1KX3 C;  1M19 A;  5GSU B;  3WKJ D;  3KXB A;  5B0Y B;  1P3L D;  2F8N B;  1M19 C;  2UWX A;  1P3A B;  3AZN D;  1KX4 D;  3MVD C;  1P3A C;  1P3P C;  1P3M A;  2NZD C;  4ZUX A;  4WU8 A;  1P3F D;  3REI B;  3AZE B;  3W99 B;  4AWL C;  3B6G B;  4Z66 D;  5GSU D;  3AZM A;  4AWL B;  5BT1 C;  3A6N B;  2HIO A;  3AZN B;  1P3B A;  1KX4 B;  3AZM C;  4ZUX D;  3WA9 C;  3AZH C;  5DNN A;  4YS3 B;  5BNV A;  1ID3 D;  2XD1 A;  5AV6 C;  3AN2 A;  3B6G D;  3VH6 W;  4H9Q A;  4Z66 B;  2NQB D;  1ZLA C;  2YFW A;  1H3O A;  1S32 D;  4H9O B;  3W96 A;  5AV5 C;  1ID3 A;  1M18 A;  1WWS A;  3W96 C;  3EPH A;  3X1U B;  3MGS A;  3KWQ C;  5B2J C;  5B0Z D;  3C1C B;  3NQU B;  3EPJ A;  3UT9 C;  2YFV A;  1S32 A;  5B33 A;  5B24 C;  5CP6 D;  1S32 B;  3B6F D;  3W98 A;  3KUY A;  5B2I D;  3AFA C;  3WAA C;  4UUZ A;  4WV4 B;  3X1U D;  3TU4 A;  3AYW D;  5CPJ C;  1ULY A;  4JJN D;  3AZE A;  3AZL C;  3REL D;  3MGQ C;  5C3I C;  5GXQ D;  3X1S D;  3WTP D;  3AZM B;  1N1J A;  3NQJ A;  5B1L D;  5BNV B;  3AYW A;  3KSY A;  5CPK A;  1P3K D;  4Z66 C;  3A1I A;  4G91 C;  3MGS C;  3AZG B;  3AZF A;  5B40 B;  5AVC D;  1P3I A;  3WTP B;  3UT9 A;  3LJA B;  1P3O C;  3MGQ D;  3LJA A;  3UTB D;  5BNX B;  3O62 D;  1P3O A;  4QLC A;  3R45 A;  1P3K B;  4J8U B;  5DNN B;  3LEL B;  5GXQ C;  3X1S C;  4WU9 A;  5B40 D;  5E5A D;  1P34 B;  3C1C C;  5GT0 C;  1F66 D;  4J8X A;  5GT0 B;  1BH8 B;  5DNM B;  1P3O D;  5F99 D;  1HTA A;  4H9R B;  3A6N C;  4KGC B;  4EO5 C;  3MGS D;  3TU4 B;  5CPI B;  2FJ7 C;  4DQY B;  3X1T D;  5BO0 B;  5C3I B;  3B0B A;  5B33 B;  1A7W A;  1P3G A;  2F8N A;  5AV9 A;  3WTP E;  3WTP C;  3B0D B;  5GSU A;  3UTA A;  4KGC D;  5KDM A;  4G91 B;  3W98 B;  3KUY B;  3FDD A;  3REH B;  1P3P A;  3X1S A;  5GXQ A;  4WU8 C;  1Z2C B;  4J8U C;  1P3L B;  2F8N D;  1JFI B;  1TZY A;  5AV8 B;  4UPK A;  3AZH D;  5BNX A;  5B32 G;  1M1A C;  3KWQ D;  4DRB A;  3C1B D;  1P3P D;  5DNN C;  3AZI C;  3A6N D;  2JCH A;  3AZI B;  2NZD D;  1ZLA A;  3W99 A;  3AV1 D;  3VH5 T;  5CPJ D;  3UTB C;  2IO5 C;  2Y2G A;  1HQ3 D;  3AV2 B;  1KX5 D;  3AZI D;  3AV2 A;  1P3M C;  5B0Y A;  1U35 A;  1M18 D;  5BO0 A;  2HIO C;  1P3B C;  2CV5 A;  2NZD A;  1BH9 A;  2Y2N A;  4J8W C;  1HQ3 A;  3LZ0 B;  5BS7 C;  4G92 B;  3V9R A;  5JRG B;  5AY8 C;  3AV2 D;  4KUD A;  1KX5 B;  2JE5 A;  5BS7 A;  1M18 B;  1KX3 A;  1P3L C;  4KHA A;  4XUJ D;  3EPL A;  4JJN A;  1EQZ A;  3H0L C;  4WNN A;  2ARO A;  3REK C;  3AYW C;  3X1U C;  2Y2H A;  5G49 B;  5B1M C;  2G5I C;  4Z66 A;  3AZG A;  3MVD B;  3AN2 B;  3AZM D;  2F8N G;  5B1M B;  5B2I C;  5B0Y C;  3VH6 T;  1H3O B;  5FUG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...