2CV5A

Crystal structure of human nucleosome core particle
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alteration of the nucleosomal DNA path in the crystal structure of a human nucleosome core particle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2cv5A00
2RVQC 3VH6T 5B32G 3AYWD 1M1AD 3UT9D 2HIOA 1HQ3C 4Z2MH 1M18B 2CV5C 1KX3A 4E45A 3B0CT 4ZUXD 1N1JA 1P3FD 5GXQD 1P3BD 1KX5C 3RELC 5KDMB 4M6BA 4J8WB 3REIC 3B6FC 5AVBB 5B2ID 1M19D 1P3MB 5CPKA 5B32B 4UUZA 3REJA 5B2IC 5CHLB 5G49B 3B6FD 3MGRB 4H9QA 3MGPA 1BFMA 5AVBC 3LZ1C 4H9SC 4YS3A 3C1CB 4KHAA 3B6GA 3KUYA 3REHD 5E5AD 5AV5C 4X23A 3AZLD 2CV5D 4R8PA 5B1LB 3AZGB 4ZUXA 3REHB 3UT9C 1M1AB 1P3OB 1F66B 3AN2C 4H9RB 3LZ1B 2HIOD 5B24A 3WAAD 1B67A 5BNVB 5CPIB 2AROD 2FJ7A 4AWLC 4WV4B 1P3AD 4LD9C 3WAAB 5AV9A 1U35A 1P3LB 4HGAC 4WU9A 4WNNA 3X1SB 4LD9D 3AZEA 5AY8D 4J8WC 5B31C 4YM6C 5JRGD 3RELA 3AZKC 4KUDC 3AFAD 1P3KA 5JRGB 4J8XC 3W97A 3AV2A 3O62B 4J8UD 3AZGC 2NZDA 5AY8A 2F8NG 4NE3A 3UTAC 1JFIB 1TAFB 4Z66A 3A6NB 3W99B 1U35D 5AVCC 5B0YB 4QLCC 4H9PB 3UTAD 2F8NB 5AVCB 3R45A 5B33B 3AV1C 4CAYA 3KXBB 5B24D 4KGCC 2YFWB 5BS7C 1TAFA 4Z66B 3AZIA 1M19C 3AFAC 3AZKD 5CP6B 3MGSA 5GT3D 2IO5B 2CV5A 4Z5TA 4J8UA 2NZDD 4QLCA 2CWEA 1KX5D 4KUDB 5BNXA 1WWSA 3X1SD 1P3BC 5CP6D 3REKD 5CPJB 3MGQA 3WTPE 4J8VB 4XZQD 3AZEB 2IO5C 4WU9B 3MGQB 5CPJA 4NE5A 5AV9B 1A7WA 3A6ND 4Z5TB 3LJAA 1ZLAD 4H9RA 3AV2C 2YFWA 3AZIB 4DRBA 1P3FA 4ZUXB 3WKJA 5JA4A 3MGPC 5B1LA 1P3KC 4R8PD 5B33A 4J8XB 4H9PA 5DNND 3REJC 3W98B 3VH6A 3B6GD 3LELD 4YS3D 4H9QB 5B2IB 1JFIA 3REID 1B6WA 5G49A 5B1MD 3W96B 5CPKB 4EO5B 1P3LC 3C1BB 4CSRA 5B1MB 3W96D 3O62C 3MGSC 1BH8A 2YFVB 3AN2B 3LELA 3W97C 4XZQC 1HTAA 2HIOB 4G91B 1ID3B 5CPID 5BNVA 3REKC 3AZEC 3VH6W 1P3MD 1F66A 5B32D 2PYOA 4H9OA 1HQ3A 3W98D 5B31B 3MNND 4X23B 3KXBC 2LY8A 3KUYB 2JSSA 4NFTA 3C1CA 4KGCD 3AV1D 3AZNC 2FJ7C 1M18D 5E5AC 2BYMB 3X1TD 4NE6A 1P3MA 3REIA 2NQBD 3UTBB 3AZMA 5GT0C 3X1UA 5KDMA 3X1VA 1Q9CA 3WA9B 3LJAD 1ZLAA 1AOIB 5AV8B 5GXQB 5B2JA 3KXBD 3AYWA 3B6FB 4YM6D 1S32D 1P3OD 1M18A 1KX3B 5DNMC 3TU4B 5GT3B 5B32C 3C1CD 4KGCA 3TU4C 5GSUB 1H3OA 1P3AC 4XUJB 5DNMD 1TZYD 5B2JC 4H9NA 3LZ0A 3MGRD 4JJNA 3AZJC 3W97D 2HUEC 3WKJC 2HIOC 3MVDD 1TZYA 2RVQD 5B0YD 5GT3A 5AV5B 1P3PB 3WTPC 3LJAC 5E5AB 3X1TB 1F1EA 5GT0B 3AZLC 3VH5T 5GSUC 1P3AB 3B6FA 5AV5D 1KX5A 3AZNA 1P3IA 1P3LD 3W99C 4JJNC 4WU8D 3AZHD 3AZKA 5B1MC 3WA9D 3X1UB 2AROB 3VH5A 1KX3C 5B31G 2AROA 5BO0B 2FJ7D 4HGAB 3AZMC 3NQJA 1P3ID 3AZMD 3UTAA 3B0CW 4XZQB 5B33C 1P3KD 1P3GA 5C3IC 1TZYB 3WTPB 4ZUXC 3LZ0B 4Z5TD 5B31A 4ZBJC 2PYOB 3KWQA 1H3OB 1P3PD 5B0YC 3AYWC 2PYOC 1BH9A 5AV6D 2PYOD 4WU9D 4LD9A 1TZYC 5B2JD 5AV6A 1S32A 4WU8B 1ULYA 3MGQC 1P34A 3W96C 5B40B 3KWQD 2BYKA 5B2JB 3AN2A 5GXQA 1AOIA 1KX4D 1ZLAB 5B0ZB 3X1VB 3AZMB 3REKA 2NQBA 5BS7A 3AZIC 4H9SA 4YS3C 3MVDA 1P34C 3W96A 3V9RA 5DNNC 1WWIA 3KUYD 3REJD 2F8NK 4G92B 5B2IA 5F99C 1EQZA 3NQUB 4EO5C 3W99D 5F99D 3W98A 5AV9D 3AZHA 4J8UC 3AZGD 4J8XD 1M19A 1HQ3B 4H9OB 3A6NC 3WKJB 1F66D 3LJAB 1P3GC 3WKJD 1P3BA 3MGRC 3AZJD 3MNNB 3AZLA 1ID3A 5B40C 3AZFA 1KX4B 4YM6B 5FUGB 5B0ZD 4WZSB 4Z66C 3LELB 3AFAA 5B0ZC 1BH8B 2YFVA 5CP6C 5CPIC 3AV1B 3VH5W 3B0DC 3AV1A 1P3OC 3WAAC 5B1MA 4CSRB 3AFAB 2F8NH 5AV8C 3C1BA 4YM6A 3AZFB 4KUDA 4QLCB 3MNNA 3AZLB 2CV5B 5CP6A 3MGSB 5F99B 3AZFD 5CPJC 5B1LC 5AV9C 4QLCD 5AVBD 4J8XA 5B33D 3R45B 5BT1C 4XUJC 4X23D 3AZHB 2F8NA 3UTBD 5JA4B 4G92C 1P3FB 3LELC 3W99A 1EQZB 3A6NA 4X23C 5AY8B 5F99A 1EQZC 4R8PC 3B0DB 3O62A 4DRAA 5B31D 2NZDB 2L5AA 3W98C 5AY8C 4J8WD 3MVDB 4G91C 5CPKD 5CPJD 3REKB 3AV2D 1P3FC 1ZLAC 3RELB 5B0ZA 4WNNB 3X1SA 4J8VA 1M1AC 1U35B 3AN2D 5B40A 5FUGA 3MGSD 1P3PC 5BNXB 1KX4A 1S32B 3O62D 4J8UB 2FJ7B 1P3BB 2HUEB 3B0BA 5B24B 3LZ1A 1BH9B 3C1CC 1P3OA 5CPKC 3LZ1D 3KXBA 1M19B 4CAYB 2F8ND 1EQZD 5AVCA 3WTPA 3B6GB 3X1VD 5B0YA 1F66C 4YS3B 1AOIC 3NQUA 3B6GC 1P3GB 3MGPB 3UTBC 3LZ0D 3MGRA 1ID3C 4XZQA 4XUJD 5BT1D 3AV2B 3W97B 3UTAB 4UUZB 3V9RB 3MGPD 5JRGA 3REJB 5AVCD 3RELD 3AZHC 3WA9C 2NQBC 3X1TC 5B1LD 2NQBB 1P3KB 5BO0A 3AZFC 4J8WA 1M18C 3KUYC 1P34D 3AZKB 3WTPD 3AZID 5C3IB 3C1BC 5AV8D 1P3LA 3AZNB 1N1JB 2BYKB 3MVDC 5JRGC 1P34B 3WAAA 1P3AA 4WU8A 3X1UD 5GT0A 4ZBJB 5AV6B 1P3PA 1KX4C 4J8VD 4LD9B 5CPIA 5AV5A 3TU4D 1P3MC 3KWQC 4Z66D 3MGQD 4J8VC 3X1SC 3REHA 1M1AA 5B40D 3KWQB 4XUJA 5DNMA 4R8PB 3AZGA 2NZDC 2AROC 1S32C 5GT3C 4E44A 1P3GD 5AV6C 4KGCB 3C1BD 4KHAB 3TU4A 5B24C 4Z5TC 5GT0D 3AYWB 3REHC 3UT9B 5B32A 5AV8A 1U35C 3NQJB 3WA9A 5DNNB 3AZJB 5AVBA 1KU5A 1R4VA 3LZ0C 3AZJA 3AZND 1ID3D 4Z2MG 5DNNA 3UTBA 1P3IC 3REIB 1AOID 3X1VC 1P3IB 2BYMA 3UT9A 1KX5B 4KUDD 1KX3D 3MNNC 3X1TA 5E5AA 4JJND 4WU8C 3KSYA 5GXQC 4AWLB 3AZED 5GSUD 4H9NB 4JJNB 5DNMB 1HQ3D 5GSUA 3X1UC 4WU9C
chains in the Genus database with same CATH superfamily
2RVQC 3VH6T 5B32G 3AYWD 1M1AD 3UT9D 2HIOA 1HQ3C 4Z2MH 1M18B 2CV5C 1KX3A 4E45A 2DF4C 3B0CT 4ZUXD 1N1JA 1P3FD 5GXQD 1P3BD 1KX5C 3RELC 5KDMB 4M6BA 4J8WB 2G5HC 3REIC 5AVBB 3B6FC 5B2ID 1M19D 1P3MB 5CPKA 5B32B 4UUZA 3REJA 5B2IC 5CHLB 5G49B 3B6FD 2Y2OA 3MGRB 4H9QA 3MGPA 1BFMA 5AVBC 3LZ1C 4H9SC 4YS3A 3C1CB 4KHAA 3B6GA 3KUYA 3REHD 5E5AD 5AV5C 4X23A 3AZLD 2CV5D 4R8PA 5B1LB 3AZGB 1T3UA 4ZUXA 3REHB 3UT9C 1M1AB 1P3OB 1F66B 3AN2C 4H9RB 5B24A 2HIOD 3LZ1B 3WAAD 1B67A 5BNVB 5CPIB 2AROD 2FJ7A 4AWLC 4WV4B 1P3AD 4LD9C 3WAAB 5AV9A 2Y2MA 1U35A 1P3LB 4HGAC 4WU9A 4WNNA 3X1SB 4LD9D 3AZEA 5AY8D 4J8WC 5B31C 3KFUG 4YM6C 5JRGD 3RELA 3AZKC 4KUDC 3AFAD 1P3KA 5JRGB 4J8XC 3W97A 3AV2A 3O62B 2ZY2A 4J8UD 3AZGC 2NZDA 1PZRA 5AY8A 4NE3A 2F8NG 4WJ3C 2F2AC 3UTAC 1JFIB 1TAFB 4Z66A 3A6NB 2Y2GA 3W99B 1U35D 5AVCC 2UWXA 5B0YB 4QLCC 4H9PB 3UTAD 2F8NB 5AVCB 3R45A 5B33B 3AV1C 4CAYA 3KXBB 3EPLA 5B24D 4KGCC 2YFWB 5BS7C 1TAFA 4Z66B 3AZIA 1M19C 3AFAC 3AZKD 5CP6B 3MGSA 5GT3D 2IO5B 2CV5A 4Z5TA 2FFFB 4J8UA 2NZDD 4QLCA 2CWEA 1KX5D 4KUDB 5BNXA 1WWSA 3X1SD 1P3BC 5CP6D 3REKD 5CPJB 3MGQA 3WTPE 4J8VB 4XZQD 3AZEB 2IO5C 4WU9B 3MGQB 5CPJA 4NE5A 2ZY5A 5AV9B 2ZY3A 1A7WA 3A6ND 4Z5TB 3LJAA 1ZLAD 4H9RA 3AV2C 2Y2LA 2YFWA 3AZIB 4DRBA 1P3FA 4ZUXB 3WKJA 5JA4A 3MGPC 5B1LA 1P3KC 4R8PD 5B33A 4J8XB 4H9PA 2J8PA 5DNND 3REJC 3W98B 3VH6A 3B6GD 3H0RC 3LELD 4YS3D 4H9QB 5B2IB 1JFIA 2DQNC 3REID 1B6WA 5G49A 1W2EA 5B1MD 3W96B 5CPKB 4EO5B 1P3LC 3C1BB 4CSRA 5B1MB 3W96D 3O62C 3MGSC 1BH8A 2YFVB 3AN2B 3LELA 3W97C 4XZQC 1HTAA 2HIOB 4G91B 2Y2IA 1ID3B 5CPID 5BNVA 3REKC 3AZEC 3VH6W 1P3MD 1F66A 5B32D 2PYOA 4H9OA 1HQ3A 3W98D 5B31B 3MNND 4X23B 3KXBC 2LY8A 3KUYB 2G5IC 2JSSA 4NFTA 3C1CA 4KGCD 2RIQA 3AV1D 3AZNC 2FJ7C 1M18D 5E5AC 2BYMB 3X1TD 4NE6A 1P3MA 3REIA 2NQBD 3UTBB 3AZMA 5GT0C 3X1UA 5KDMA 3X1VA 1Q9CA 3WA9B 3LJAD 1ZLAA 1AOIB 5AV8B 5GXQB 5B2JA 3KXBD 3A1IA 3AYWA 3B6FB 4YM6D 1S32D 1P3OD 1M18A 1KX3B 5DNMC 2XD5A 3TU4B 5GT3B 5B32C 3C1CD 4KGCA 3TU4C 2Y2KA 5GSUB 1H3OA 1P3AC 4XUJB 5DNMD 1TZYD 5B2JC 4H9NA 3LZ0A 3MGRD 4JJNA 3AZJC 3W97D 2HUEC 3WKJC 2HIOC 3MVDD 1TZYA 2RVQD 5B0YD 5GT3A 5AV5B 1P3PB 3WTPC 3LJAC 5E5AB 3X1TB 1F1EA 5GT0B 3AZLC 3VH5T 5GSUC 1P3AB 3B6FA 5AV5D 1KX5A 3AZNA 1P3IA 2JCHA 1P3LD 3W99C 4JJNC 4WU8D 3AZHD 3AZKA 5B1MC 3WA9D 3X1UB 2AROB 3VH5A 1KX3C 5B31G 2AROA 5BO0B 2FJ7D 4HGAB 3AZMC 3NQJA 1P3ID 3AZMD 2VQRA 3UTAA 3B0CW 4XZQB 5B33C 1P3KD 1P3GA 2ZY4A 5C3IC 1TZYB 2Y2HA 3WTPB 4ZUXC 3LZ0B 4Z5TD 5B31A 4ZBJC 2PYOB 3KWQA 1H3OB 2W8SA 1P3PD 5B0YC 3AYWC 2PYOC 1BH9A 5AV6D 2PYOD 4WU9D 4LD9A 1TZYC 5B2JD 2Y2JA 5AV6A 1S32A 4WU8B 1ULYA 3MGQC 1P34A 3W96C 5B40B 3KWQD 2BYKA 5B2JB 3A1KA 3AN2A 5GXQA 1AOIA 1KX4D 1ZLAB 5B0ZB 3X1VB 3AZMB 3REKA 2NQBA 5BS7A 3AZIC 4H9SA 4YS3C 3MVDA 1P34C 3W96A 3V9RA 5DNNC 1WWIA 3KUYD 3REJD 2F8NK 4G92B 5B2IA 5F99C 2ZM5A 3NQUB 1EQZA 4EO5C 3W99D 5F99D 3W98A 5AV9D 3AZHA 4J8UC 3AZGD 4J8XD 1M19A 1HQ3B 4H9OB 3A6NC 3WKJB 1F66D 3LJAB 1P3GC 3WKJD 1P3BA 3MGRC 3AZJD 3MNNB 3AZLA 1ID3A 2JE5A 5B40C 3F6TA 3AZFA 1KX4B 4YM6B 5FUGB 5B0ZD 4WZSB 4Z66C 3LELB 3AFAA 5B0ZC 1BH8B 2Y2PA 2YFVA 2XD1A 5CPIC 5CP6C 3AV1B 3VH5W 3B0DC 3AV1A 1P3OC 1Z2CB 3WAAC 5B1MA 4CSRB 3AFAB 2F8NH 4UPKA 5AV8C 3C1BA 4YM6A 3AZFB 4KUDA 4QLCB 3MNNA 3AZLB 2CV5B 5CP6A 3MGSB 5F99B 3AZFD 5CPJC 5B1LC 5AV9C 4QLCD 5AVBD 4J8XA 5B33D 3R45B 5BT1C 4XUJC 4X23D 3FDDA 3AZHB 2F8NA 3UTBD 5JA4B 4G92C 1P3FB 3LELC 3W99A 4DQYB 1EQZB 3A6NA 4X23C 5AY8B 5F99A 1EQZC 4R8PC 3B0DB 3O62A 4DRAA 5B31D 2NZDB 2L5AA 3W98C 5AY8C 3EG5B 4J8WD 3MVDB 4G91C 5CPKD 5CPJD 3EPJA 3REKB 3AV2D 1P3FC 1ZLAC 3RELB 5B0ZA 4WNNB 3X1SA 4J8VA 1M1AC 1U35B 3AN2D 5B40A 5FUGA 3MGSD 1P3PC 5BNXB 1KX4A 1S32B 3H0LC 3O62D 4J8UB 2FJ7B 1P3BB 2HUEB 3B0BA 5B24B 3LZ1A 1BH9B 3C1CC 1P3OA 5CPKC 3LZ1D 3KXBA 1M19B 4CAYB 2F8ND 1EQZD 5AVCA 3WTPA 3B6GB 3X1VD 5B0YA 1F66C 4YS3B 1AOIC 3NQUA 3B6GC 1P3GB 3MGPB 3UTBC 3LZ0D 3MGRA 1ID3C 4XZQA 4XUJD 5BT1D 3AV2B 3W97B 3UTAB 4UUZB 3V9RB 3MGPD 5JRGA 3EPKA 5AVCD 3REJB 3RELD 3AZHC 3WA9C 2NQBC 3X1TC 5B1LD 2NQBB 1P3KB 5BO0A 3AZFC 4J8WA 1M18C 3KUYC 2Y2NA 1P34D 3AZKB 2Y2QA 3WTPD 3AZID 5C3IB 3C1BC 5AV8D 3P5JB 1P3LA 3AZNB 1N1JB 2BYKB 3MVDC 5JRGC 1P34B 3WAAA 1P3AA 4WU8A 3X1UD 5GT0A 4ZBJB 5AV6B 1P3PA 1KX4C 4J8VD 4LD9B 5CPIA 5AV5A 3TU4D 1P3MC 3KWQC 4Z66D 3H0MC 3MGQD 3IP4C 4J8VC 3X1SC 3REHA 1M1AA 5B40D 3KWQB 4XUJA 5DNMA 4R8PB 3AZGA 2NZDC 2AROC 1S32C 5GT3C 4E44A 1P3GD 5AV6C 4KGCB 3C1BD 4KHAB 3TU4A 2BG1A 5B24C 4Z5TC 5GT0D 3AYWB 3REHC 3UT9B 5B32A 5AV8A 1U35C 3NQJB 3WA9A 3EPHA 5DNNB 3AZJB 5AVBA 1KU5A 1R4VA 3LZ0C 3AZJA 3AZND 1ID3D 4Z2MG 5DNNA 3UTBA 1P3IC 3REIB 1AOID 3X1VC 1P3IB 2BYMA 3UT9A 1KX5B 4KUDD 1KX3D 3MNNC 3AL0C 3X1TA 5E5AA 4JJND 4WU8C 3KSYA 5GXQC 4AWLB 3AZED 5GSUD 4H9NB 4JJNB 5DNMB 1HQ3D 5GSUA 3X1UC 4WU9C
chains in the Genus database with same CATH topology
2RVQC 3VH6T 5B32G 3AYWD 1M1AD 3UT9D 2HIOA 1HQ3C 4Z2MH 1M18B 2CV5C 1KX3A 4E45A 2DF4C 3B0CT 4ZUXD 1N1JA 1P3FD 5GXQD 1P3BD 1KX5C 3RELC 5KDMB 4M6BA 4J8WB 2G5HC 3REIC 5AVBB 3B6FC 5B2ID 1M19D 1P3MB 5CPKA 5B32B 4UUZA 3REJA 5B2IC 5CHLB 5G49B 3B6FD 2Y2OA 3MGRB 4H9QA 3MGPA 1BFMA 5AVBC 3LZ1C 4H9SC 4YS3A 3C1CB 4KHAA 3B6GA 3KUYA 3REHD 5E5AD 5AV5C 4X23A 3AZLD 2CV5D 4R8PA 5B1LB 3AZGB 1T3UA 4ZUXA 3REHB 3UT9C 1M1AB 1P3OB 1F66B 3AN2C 4H9RB 5B24A 2HIOD 3LZ1B 3WAAD 1B67A 5BNVB 5CPIB 2AROD 2FJ7A 4AWLC 4WV4B 1P3AD 4LD9C 3WAAB 5AV9A 2Y2MA 1U35A 1P3LB 4HGAC 4WU9A 4WNNA 3X1SB 4LD9D 3AZEA 5AY8D 4J8WC 5B31C 3KFUG 4YM6C 5JRGD 3RELA 3AZKC 4KUDC 3AFAD 1P3KA 5JRGB 4J8XC 3W97A 3AV2A 3O62B 2ZY2A 4J8UD 3AZGC 2NZDA 1PZRA 5AY8A 4NE3A 2F8NG 4WJ3C 2F2AC 3UTAC 1JFIB 1TAFB 4Z66A 3A6NB 2Y2GA 3W99B 1U35D 5AVCC 2UWXA 5B0YB 4QLCC 4H9PB 3UTAD 2F8NB 5AVCB 3R45A 5B33B 3AV1C 4CAYA 3KXBB 3EPLA 5B24D 4KGCC 2YFWB 5BS7C 1TAFA 4Z66B 3AZIA 1M19C 3AFAC 3AZKD 5CP6B 3MGSA 5GT3D 2IO5B 2CV5A 4Z5TA 2FFFB 4J8UA 2NZDD 4QLCA 2CWEA 1KX5D 4KUDB 5BNXA 1WWSA 3X1SD 1P3BC 5CP6D 3REKD 5CPJB 3MGQA 3WTPE 4J8VB 4XZQD 3AZEB 2IO5C 4WU9B 3MGQB 5CPJA 4NE5A 2ZY5A 5AV9B 2ZY3A 1A7WA 3A6ND 4Z5TB 3LJAA 1ZLAD 4H9RA 3AV2C 2Y2LA 2YFWA 3AZIB 4DRBA 1P3FA 4ZUXB 3WKJA 5JA4A 3MGPC 5B1LA 1P3KC 4R8PD 5B33A 4J8XB 4H9PA 2J8PA 5DNND 3REJC 3W98B 3VH6A 3B6GD 3H0RC 3LELD 4YS3D 4H9QB 5B2IB 1JFIA 2DQNC 3REID 1B6WA 5G49A 1W2EA 5B1MD 3W96B 5CPKB 4EO5B 1P3LC 3C1BB 4CSRA 5B1MB 3W96D 3O62C 3MGSC 1BH8A 2YFVB 3AN2B 3LELA 3W97C 4XZQC 1HTAA 2HIOB 4G91B 2Y2IA 1ID3B 5CPID 5BNVA 3REKC 3AZEC 3VH6W 1P3MD 1F66A 5B32D 2PYOA 4H9OA 1HQ3A 3W98D 5B31B 3MNND 4X23B 3KXBC 2LY8A 3KUYB 2G5IC 2JSSA 4NFTA 3C1CA 4KGCD 2RIQA 3AV1D 3AZNC 2FJ7C 1M18D 5E5AC 2BYMB 3X1TD 4NE6A 1P3MA 3REIA 2NQBD 3UTBB 3AZMA 5GT0C 3X1UA 5KDMA 3X1VA 1Q9CA 3WA9B 3LJAD 1ZLAA 1AOIB 5AV8B 5GXQB 5B2JA 3KXBD 3A1IA 3AYWA 3B6FB 4YM6D 1S32D 1P3OD 1M18A 1KX3B 5DNMC 2XD5A 3TU4B 5GT3B 5B32C 3C1CD 4KGCA 3TU4C 2Y2KA 5GSUB 1H3OA 1P3AC 4XUJB 5DNMD 1TZYD 5B2JC 4H9NA 3LZ0A 3MGRD 4JJNA 3AZJC 3W97D 2HUEC 3WKJC 2HIOC 3MVDD 1TZYA 2RVQD 5B0YD 5GT3A 5AV5B 1P3PB 3WTPC 3LJAC 5E5AB 3X1TB 1F1EA 5GT0B 3AZLC 3VH5T 5GSUC 1P3AB 3B6FA 5AV5D 1KX5A 3AZNA 1P3IA 2JCHA 1P3LD 3W99C 4JJNC 4WU8D 3AZHD 3AZKA 5B1MC 3WA9D 3X1UB 2AROB 3VH5A 1KX3C 5B31G 2AROA 5BO0B 2FJ7D 4HGAB 3AZMC 3NQJA 1P3ID 3AZMD 2VQRA 3UTAA 3B0CW 4XZQB 5B33C 1P3KD 1P3GA 2ZY4A 5C3IC 1TZYB 2Y2HA 3WTPB 4ZUXC 3LZ0B 4Z5TD 5B31A 4ZBJC 2PYOB 3KWQA 1H3OB 2W8SA 1P3PD 5B0YC 3AYWC 2PYOC 1BH9A 5AV6D 2PYOD 4WU9D 4LD9A 1TZYC 5B2JD 2Y2JA 5AV6A 1S32A 4WU8B 1ULYA 3MGQC 1P34A 3W96C 5B40B 3KWQD 2BYKA 5B2JB 3A1KA 3AN2A 5GXQA 1AOIA 1KX4D 1ZLAB 5B0ZB 3X1VB 3AZMB 3REKA 2NQBA 5BS7A 3AZIC 4H9SA 4YS3C 3MVDA 1P34C 3W96A 3V9RA 5DNNC 1WWIA 3KUYD 3REJD 2F8NK 4G92B 5B2IA 5F99C 2ZM5A 3NQUB 1EQZA 4EO5C 3W99D 5F99D 3W98A 5AV9D 3AZHA 4J8UC 3AZGD 4J8XD 1M19A 1HQ3B 4H9OB 3A6NC 3WKJB 1F66D 3LJAB 1P3GC 3WKJD 1P3BA 3MGRC 3AZJD 3MNNB 3AZLA 1ID3A 2JE5A 5B40C 3F6TA 3AZFA 1KX4B 4YM6B 5FUGB 5B0ZD 4WZSB 4Z66C 3LELB 3AFAA 5B0ZC 1BH8B 2Y2PA 2YFVA 2XD1A 5CPIC 5CP6C 3AV1B 3VH5W 3B0DC 3AV1A 1P3OC 1Z2CB 3WAAC 5B1MA 4CSRB 3AFAB 2F8NH 4UPKA 5AV8C 3C1BA 4YM6A 3AZFB 4KUDA 4QLCB 3MNNA 3AZLB 2CV5B 5CP6A 3MGSB 5F99B 3AZFD 5CPJC 5B1LC 5AV9C 4QLCD 5AVBD 4J8XA 5B33D 3R45B 5BT1C 4XUJC 4X23D 3FDDA 3AZHB 2F8NA 3UTBD 5JA4B 4G92C 1P3FB 3LELC 3W99A 4DQYB 1EQZB 3A6NA 4X23C 5AY8B 5F99A 1EQZC 4R8PC 3B0DB 3O62A 4DRAA 5B31D 2NZDB 2L5AA 3W98C 5AY8C 3EG5B 4J8WD 3MVDB 4G91C 5CPKD 5CPJD 3EPJA 3REKB 3AV2D 1P3FC 1ZLAC 3RELB 5B0ZA 4WNNB 3X1SA 4J8VA 1M1AC 1U35B 3AN2D 5B40A 5FUGA 3MGSD 1P3PC 5BNXB 1KX4A 1S32B 3H0LC 3O62D 4J8UB 2FJ7B 1P3BB 2HUEB 3B0BA 5B24B 3LZ1A 1BH9B 3C1CC 1P3OA 5CPKC 3LZ1D 3KXBA 1M19B 4CAYB 2F8ND 1EQZD 5AVCA 3WTPA 3B6GB 3X1VD 5B0YA 1F66C 4YS3B 1AOIC 3NQUA 3B6GC 1P3GB 3MGPB 3UTBC 3LZ0D 3MGRA 1ID3C 4XZQA 4XUJD 5BT1D 3AV2B 3W97B 3UTAB 4UUZB 3V9RB 3MGPD 5JRGA 3EPKA 5AVCD 3REJB 3RELD 3AZHC 3WA9C 2NQBC 3X1TC 5B1LD 2NQBB 1P3KB 5BO0A 3AZFC 4J8WA 1M18C 3KUYC 2Y2NA 1P34D 3AZKB 2Y2QA 3WTPD 3AZID 5C3IB 3C1BC 5AV8D 3P5JB 1P3LA 3AZNB 1N1JB 2BYKB 3MVDC 5JRGC 1P34B 3WAAA 1P3AA 4WU8A 3X1UD 5GT0A 4ZBJB 5AV6B 1P3PA 1KX4C 4J8VD 4LD9B 5CPIA 5AV5A 3TU4D 1P3MC 3KWQC 4Z66D 3H0MC 3MGQD 3IP4C 4J8VC 3X1SC 3REHA 1M1AA 5B40D 3KWQB 4XUJA 5DNMA 4R8PB 3AZGA 2NZDC 2AROC 1S32C 5GT3C 4E44A 1P3GD 5AV6C 4KGCB 3C1BD 4KHAB 3TU4A 2BG1A 5B24C 4Z5TC 5GT0D 3AYWB 3REHC 3UT9B 5B32A 5AV8A 1U35C 3NQJB 3WA9A 3EPHA 5DNNB 3AZJB 5AVBA 1KU5A 1R4VA 3LZ0C 3AZJA 3AZND 1ID3D 4Z2MG 5DNNA 3UTBA 1P3IC 3REIB 1AOID 3X1VC 1P3IB 2BYMA 3UT9A 1KX5B 4KUDD 1KX3D 3MNNC 3AL0C 3X1TA 5E5AA 4JJND 4WU8C 3KSYA 5GXQC 4AWLB 3AZED 5GSUD 4H9NB 4JJNB 5DNMB 1HQ3D 5GSUA 3X1UC 4WU9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RVQ C;  3VH6 T;  5B32 G;  3AYW D;  1M1A D;  3UT9 D;  2HIO A;  1HQ3 C;  4Z2M H;  1M18 B;  2CV5 C;  1KX3 A;  4E45 A;  3B0C T;  4ZUX D;  1N1J A;  1P3F D;  5GXQ D;  1P3B D;  1KX5 C;  3REL C;  5KDM B;  4M6B A;  4J8W B;  3REI C;  3B6F C;  5AVB B;  5B2I D;  1M19 D;  1P3M B;  5CPK A;  5B32 B;  4UUZ A;  3REJ A;  5B2I C;  5CHL B;  5G49 B;  3B6F D;  3MGR B;  4H9Q A;  3MGP A;  1BFM A;  5AVB C;  3LZ1 C;  4H9S C;  4YS3 A;  3C1C B;  4KHA A;  3B6G A;  3KUY A;  3REH D;  5E5A D;  5AV5 C;  4X23 A;  3AZL D;  2CV5 D;  4R8P A;  5B1L B;  3AZG B;  4ZUX A;  3REH B;  3UT9 C;  1M1A B;  1P3O B;  1F66 B;  3AN2 C;  4H9R B;  3LZ1 B;  2HIO D;  5B24 A;  3WAA D;  1B67 A;  5BNV B;  5CPI B;  2ARO D;  2FJ7 A;  4AWL C;  4WV4 B;  1P3A D;  4LD9 C;  3WAA B;  5AV9 A;  1U35 A;  1P3L B;  4HGA C;  4WU9 A;  4WNN A;  3X1S B;  4LD9 D;  3AZE A;  5AY8 D;  4J8W C;  5B31 C;  4YM6 C;  5JRG D;  3REL A;  3AZK C;  4KUD C;  3AFA D;  1P3K A;  5JRG B;  4J8X C;  3W97 A;  3AV2 A;  3O62 B;  4J8U D;  3AZG C;  2NZD A;  5AY8 A;  2F8N G;  4NE3 A;  3UTA C;  1JFI B;  1TAF B;  4Z66 A;  3A6N B;  3W99 B;  1U35 D;  5AVC C;  5B0Y B;  4QLC C;  4H9P B;  3UTA D;  2F8N B;  5AVC B;  3R45 A;  5B33 B;  3AV1 C;  4CAY A;  3KXB B;  5B24 D;  4KGC C;  2YFW B;  5BS7 C;  1TAF A;  4Z66 B;  3AZI A;  1M19 C;  3AFA C;  3AZK D;  5CP6 B;  3MGS A;  5GT3 D;  2IO5 B;  2CV5 A;  4Z5T A;  4J8U A;  2NZD D;  4QLC A;  2CWE A;  1KX5 D;  4KUD B;  5BNX A;  1WWS A;  3X1S D;  1P3B C;  5CP6 D;  3REK D;  5CPJ B;  3MGQ A;  3WTP E;  4J8V B;  4XZQ D;  3AZE B;  2IO5 C;  4WU9 B;  3MGQ B;  5CPJ A;  4NE5 A;  5AV9 B;  1A7W A;  3A6N D;  4Z5T B;  3LJA A;  1ZLA D;  4H9R A;  3AV2 C;  2YFW A;  3AZI B;  4DRB A;  1P3F A;  4ZUX B;  3WKJ A;  5JA4 A;  3MGP C;  5B1L A;  1P3K C;  4R8P D;  5B33 A;  4J8X B;  4H9P A;  5DNN D;  3REJ C;  3W98 B;  3VH6 A;  3B6G D;  3LEL D;  4YS3 D;  4H9Q B;  5B2I B;  1JFI A;  3REI D;  1B6W A;  5G49 A;  5B1M D;  3W96 B;  5CPK B;  4EO5 B;  1P3L C;  3C1B B;  4CSR A;  5B1M B;  3W96 D;  3O62 C;  3MGS C;  1BH8 A;  2YFV B;  3AN2 B;  3LEL A;  3W97 C;  4XZQ C;  1HTA A;  2HIO B;  4G91 B;  1ID3 B;  5CPI D;  5BNV A;  3REK C;  3AZE C;  3VH6 W;  1P3M D;  1F66 A;  5B32 D;  2PYO A;  4H9O A;  1HQ3 A;  3W98 D;  5B31 B;  3MNN D;  4X23 B;  3KXB C;  2LY8 A;  3KUY B;  2JSS A;  4NFT A;  3C1C A;  4KGC D;  3AV1 D;  3AZN C;  2FJ7 C;  1M18 D;  5E5A C;  2BYM B;  3X1T D;  4NE6 A;  1P3M A;  3REI A;  2NQB D;  3UTB B;  3AZM A;  5GT0 C;  3X1U A;  5KDM A;  3X1V A;  1Q9C A;  3WA9 B;  3LJA D;  1ZLA A;  1AOI B;  5AV8 B;  5GXQ B;  5B2J A;  3KXB D;  3AYW A;  3B6F B;  4YM6 D;  1S32 D;  1P3O D;  1M18 A;  1KX3 B;  5DNM C;  3TU4 B;  5GT3 B;  5B32 C;  3C1C D;  4KGC A;  3TU4 C;  5GSU B;  1H3O A;  1P3A C;  4XUJ B;  5DNM D;  1TZY D;  5B2J C;  4H9N A;  3LZ0 A;  3MGR D;  4JJN A;  3AZJ C;  3W97 D;  2HUE C;  3WKJ C;  2HIO C;  3MVD D;  1TZY A;  2RVQ D;  5B0Y D;  5GT3 A;  5AV5 B;  1P3P B;  3WTP C;  3LJA C;  5E5A B;  3X1T B;  1F1E A;  5GT0 B;  3AZL C;  3VH5 T;  5GSU C;  1P3A B;  3B6F A;  5AV5 D;  1KX5 A;  3AZN A;  1P3I A;  1P3L D;  3W99 C;  4JJN C;  4WU8 D;  3AZH D;  3AZK A;  5B1M C;  3WA9 D;  3X1U B;  2ARO B;  3VH5 A;  1KX3 C;  5B31 G;  2ARO A;  5BO0 B;  2FJ7 D;  4HGA B;  3AZM C;  3NQJ A;  1P3I D;  3AZM D;  3UTA A;  3B0C W;  4XZQ B;  5B33 C;  1P3K D;  1P3G A;  5C3I C;  1TZY B;  3WTP B;  4ZUX C;  3LZ0 B;  4Z5T D;  5B31 A;  4ZBJ C;  2PYO B;  3KWQ A;  1H3O B;  1P3P D;  5B0Y C;  3AYW C;  2PYO C;  1BH9 A;  5AV6 D;  2PYO D;  4WU9 D;  4LD9 A;  1TZY C;  5B2J D;  5AV6 A;  1S32 A;  4WU8 B;  1ULY A;  3MGQ C;  1P34 A;  3W96 C;  5B40 B;  3KWQ D;  2BYK A;  5B2J B;  3AN2 A;  5GXQ A;  1AOI A;  1KX4 D;  1ZLA B;  5B0Z B;  3X1V B;  3AZM B;  3REK A;  2NQB A;  5BS7 A;  3AZI C;  4H9S A;  4YS3 C;  3MVD A;  1P34 C;  3W96 A;  3V9R A;  5DNN C;  1WWI A;  3KUY D;  3REJ D;  2F8N K;  4G92 B;  5B2I A;  5F99 C;  1EQZ A;  3NQU B;  4EO5 C;  3W99 D;  5F99 D;  3W98 A;  5AV9 D;  3AZH A;  4J8U C;  3AZG D;  4J8X D;  1M19 A;  1HQ3 B;  4H9O B;  3A6N C;  3WKJ B;  1F66 D;  3LJA B;  1P3G C;  3WKJ D;  1P3B A;  3MGR C;  3AZJ D;  3MNN B;  3AZL A;  1ID3 A;  5B40 C;  3AZF A;  1KX4 B;  4YM6 B;  5FUG B;  5B0Z D;  4WZS B;  4Z66 C;  3LEL B;  3AFA A;  5B0Z C;  1BH8 B;  2YFV A;  5CP6 C;  5CPI C;  3AV1 B;  3VH5 W;  3B0D C;  3AV1 A;  1P3O C;  3WAA C;  5B1M A;  4CSR B;  3AFA B;  2F8N H;  5AV8 C;  3C1B A;  4YM6 A;  3AZF B;  4KUD A;  4QLC B;  3MNN A;  3AZL B;  2CV5 B;  5CP6 A;  3MGS B;  5F99 B;  3AZF D;  5CPJ C;  5B1L C;  5AV9 C;  4QLC D;  5AVB D;  4J8X A;  5B33 D;  3R45 B;  5BT1 C;  4XUJ C;  4X23 D;  3AZH B;  2F8N A;  3UTB D;  5JA4 B;  4G92 C;  1P3F B;  3LEL C;  3W99 A;  1EQZ B;  3A6N A;  4X23 C;  5AY8 B;  5F99 A;  1EQZ C;  4R8P C;  3B0D B;  3O62 A;  4DRA A;  5B31 D;  2NZD B;  2L5A A;  3W98 C;  5AY8 C;  4J8W D;  3MVD B;  4G91 C;  5CPK D;  5CPJ D;  3REK B;  3AV2 D;  1P3F C;  1ZLA C;  3REL B;  5B0Z A;  4WNN B;  3X1S A;  4J8V A;  1M1A C;  1U35 B;  3AN2 D;  5B40 A;  5FUG A;  3MGS D;  1P3P C;  5BNX B;  1KX4 A;  1S32 B;  3O62 D;  4J8U B;  2FJ7 B;  1P3B B;  2HUE B;  3B0B A;  5B24 B;  3LZ1 A;  1BH9 B;  3C1C C;  1P3O A;  5CPK C;  3LZ1 D;  3KXB A;  1M19 B;  4CAY B;  2F8N D;  1EQZ D;  5AVC A;  3WTP A;  3B6G B;  3X1V D;  5B0Y A;  1F66 C;  4YS3 B;  1AOI C;  3NQU A;  3B6G C;  1P3G B;  3MGP B;  3UTB C;  3LZ0 D;  3MGR A;  1ID3 C;  4XZQ A;  4XUJ D;  5BT1 D;  3AV2 B;  3W97 B;  3UTA B;  4UUZ B;  3V9R B;  3MGP D;  5JRG A;  3REJ B;  5AVC D;  3REL D;  3AZH C;  3WA9 C;  2NQB C;  3X1T C;  5B1L D;  2NQB B;  1P3K B;  5BO0 A;  3AZF C;  4J8W A;  1M18 C;  3KUY C;  1P34 D;  3AZK B;  3WTP D;  3AZI D;  5C3I B;  3C1B C;  5AV8 D;  1P3L A;  3AZN B;  1N1J B;  2BYK B;  3MVD C;  5JRG C;  1P34 B;  3WAA A;  1P3A A;  4WU8 A;  3X1U D;  5GT0 A;  4ZBJ B;  5AV6 B;  1P3P A;  1KX4 C;  4J8V D;  4LD9 B;  5CPI A;  5AV5 A;  3TU4 D;  1P3M C;  3KWQ C;  4Z66 D;  3MGQ D;  4J8V C;  3X1S C;  3REH A;  1M1A A;  5B40 D;  3KWQ B;  4XUJ A;  5DNM A;  4R8P B;  3AZG A;  2NZD C;  2ARO C;  1S32 C;  5GT3 C;  4E44 A;  1P3G D;  5AV6 C;  4KGC B;  3C1B D;  4KHA B;  3TU4 A;  5B24 C;  4Z5T C;  5GT0 D;  3AYW B;  3REH C;  3UT9 B;  5B32 A;  5AV8 A;  1U35 C;  3NQJ B;  3WA9 A;  5DNN B;  3AZJ B;  5AVB A;  1KU5 A;  1R4V A;  3LZ0 C;  3AZJ A;  3AZN D;  1ID3 D;  4Z2M G;  5DNN A;  3UTB A;  1P3I C;  3REI B;  1AOI D;  3X1V C;  1P3I B;  2BYM A;  3UT9 A;  1KX5 B;  4KUD D;  1KX3 D;  3MNN C;  3X1T A;  5E5A A;  4JJN D;  4WU8 C;  3KSY A;  5GXQ C;  4AWL B;  3AZE D;  5GSU D;  4H9N B;  4JJN B;  5DNM B;  1HQ3 D;  5GSU A;  3X1U C;  4WU9 C; 
#chains in the Genus database with same CATH topology
 2RVQ C;  3VH6 T;  5B32 G;  3AYW D;  1M1A D;  3UT9 D;  2HIO A;  1HQ3 C;  4Z2M H;  1M18 B;  2CV5 C;  1KX3 A;  4E45 A;  2DF4 C;  3B0C T;  4ZUX D;  1N1J A;  1P3F D;  5GXQ D;  1P3B D;  1KX5 C;  3REL C;  5KDM B;  4M6B A;  4J8W B;  2G5H C;  3REI C;  5AVB B;  3B6F C;  5B2I D;  1M19 D;  1P3M B;  5CPK A;  5B32 B;  4UUZ A;  3REJ A;  5B2I C;  5CHL B;  5G49 B;  3B6F D;  2Y2O A;  3MGR B;  4H9Q A;  3MGP A;  1BFM A;  5AVB C;  3LZ1 C;  4H9S C;  4YS3 A;  3C1C B;  4KHA A;  3B6G A;  3KUY A;  3REH D;  5E5A D;  5AV5 C;  4X23 A;  3AZL D;  2CV5 D;  4R8P A;  5B1L B;  3AZG B;  1T3U A;  4ZUX A;  3REH B;  3UT9 C;  1M1A B;  1P3O B;  1F66 B;  3AN2 C;  4H9R B;  5B24 A;  2HIO D;  3LZ1 B;  3WAA D;  1B67 A;  5BNV B;  5CPI B;  2ARO D;  2FJ7 A;  4AWL C;  4WV4 B;  1P3A D;  4LD9 C;  3WAA B;  5AV9 A;  2Y2M A;  1U35 A;  1P3L B;  4HGA C;  4WU9 A;  4WNN A;  3X1S B;  4LD9 D;  3AZE A;  5AY8 D;  4J8W C;  5B31 C;  3KFU G;  4YM6 C;  5JRG D;  3REL A;  3AZK C;  4KUD C;  3AFA D;  1P3K A;  5JRG B;  4J8X C;  3W97 A;  3AV2 A;  3O62 B;  2ZY2 A;  4J8U D;  3AZG C;  2NZD A;  1PZR A;  5AY8 A;  4NE3 A;  2F8N G;  4WJ3 C;  2F2A C;  3UTA C;  1JFI B;  1TAF B;  4Z66 A;  3A6N B;  2Y2G A;  3W99 B;  1U35 D;  5AVC C;  2UWX A;  5B0Y B;  4QLC C;  4H9P B;  3UTA D;  2F8N B;  5AVC B;  3R45 A;  5B33 B;  3AV1 C;  4CAY A;  3KXB B;  3EPL A;  5B24 D;  4KGC C;  2YFW B;  5BS7 C;  1TAF A;  4Z66 B;  3AZI A;  1M19 C;  3AFA C;  3AZK D;  5CP6 B;  3MGS A;  5GT3 D;  2IO5 B;  2CV5 A;  4Z5T A;  2FFF B;  4J8U A;  2NZD D;  4QLC A;  2CWE A;  1KX5 D;  4KUD B;  5BNX A;  1WWS A;  3X1S D;  1P3B C;  5CP6 D;  3REK D;  5CPJ B;  3MGQ A;  3WTP E;  4J8V B;  4XZQ D;  3AZE B;  2IO5 C;  4WU9 B;  3MGQ B;  5CPJ A;  4NE5 A;  2ZY5 A;  5AV9 B;  2ZY3 A;  1A7W A;  3A6N D;  4Z5T B;  3LJA A;  1ZLA D;  4H9R A;  3AV2 C;  2Y2L A;  2YFW A;  3AZI B;  4DRB A;  1P3F A;  4ZUX B;  3WKJ A;  5JA4 A;  3MGP C;  5B1L A;  1P3K C;  4R8P D;  5B33 A;  4J8X B;  4H9P A;  2J8P A;  5DNN D;  3REJ C;  3W98 B;  3VH6 A;  3B6G D;  3H0R C;  3LEL D;  4YS3 D;  4H9Q B;  5B2I B;  1JFI A;  2DQN C;  3REI D;  1B6W A;  5G49 A;  1W2E A;  5B1M D;  3W96 B;  5CPK B;  4EO5 B;  1P3L C;  3C1B B;  4CSR A;  5B1M B;  3W96 D;  3O62 C;  3MGS C;  1BH8 A;  2YFV B;  3AN2 B;  3LEL A;  3W97 C;  4XZQ C;  1HTA A;  2HIO B;  4G91 B;  2Y2I A;  1ID3 B;  5CPI D;  5BNV A;  3REK C;  3AZE C;  3VH6 W;  1P3M D;  1F66 A;  5B32 D;  2PYO A;  4H9O A;  1HQ3 A;  3W98 D;  5B31 B;  3MNN D;  4X23 B;  3KXB C;  2LY8 A;  3KUY B;  2G5I C;  2JSS A;  4NFT A;  3C1C A;  4KGC D;  2RIQ A;  3AV1 D;  3AZN C;  2FJ7 C;  1M18 D;  5E5A C;  2BYM B;  3X1T D;  4NE6 A;  1P3M A;  3REI A;  2NQB D;  3UTB B;  3AZM A;  5GT0 C;  3X1U A;  5KDM A;  3X1V A;  1Q9C A;  3WA9 B;  3LJA D;  1ZLA A;  1AOI B;  5AV8 B;  5GXQ B;  5B2J A;  3KXB D;  3A1I A;  3AYW A;  3B6F B;  4YM6 D;  1S32 D;  1P3O D;  1M18 A;  1KX3 B;  5DNM C;  2XD5 A;  3TU4 B;  5GT3 B;  5B32 C;  3C1C D;  4KGC A;  3TU4 C;  2Y2K A;  5GSU B;  1H3O A;  1P3A C;  4XUJ B;  5DNM D;  1TZY D;  5B2J C;  4H9N A;  3LZ0 A;  3MGR D;  4JJN A;  3AZJ C;  3W97 D;  2HUE C;  3WKJ C;  2HIO C;  3MVD D;  1TZY A;  2RVQ D;  5B0Y D;  5GT3 A;  5AV5 B;  1P3P B;  3WTP C;  3LJA C;  5E5A B;  3X1T B;  1F1E A;  5GT0 B;  3AZL C;  3VH5 T;  5GSU C;  1P3A B;  3B6F A;  5AV5 D;  1KX5 A;  3AZN A;  1P3I A;  2JCH A;  1P3L D;  3W99 C;  4JJN C;  4WU8 D;  3AZH D;  3AZK A;  5B1M C;  3WA9 D;  3X1U B;  2ARO B;  3VH5 A;  1KX3 C;  5B31 G;  2ARO A;  5BO0 B;  2FJ7 D;  4HGA B;  3AZM C;  3NQJ A;  1P3I D;  3AZM D;  2VQR A;  3UTA A;  3B0C W;  4XZQ B;  5B33 C;  1P3K D;  1P3G A;  2ZY4 A;  5C3I C;  1TZY B;  2Y2H A;  3WTP B;  4ZUX C;  3LZ0 B;  4Z5T D;  5B31 A;  4ZBJ C;  2PYO B;  3KWQ A;  1H3O B;  2W8S A;  1P3P D;  5B0Y C;  3AYW C;  2PYO C;  1BH9 A;  5AV6 D;  2PYO D;  4WU9 D;  4LD9 A;  1TZY C;  5B2J D;  2Y2J A;  5AV6 A;  1S32 A;  4WU8 B;  1ULY A;  3MGQ C;  1P34 A;  3W96 C;  5B40 B;  3KWQ D;  2BYK A;  5B2J B;  3A1K A;  3AN2 A;  5GXQ A;  1AOI A;  1KX4 D;  1ZLA B;  5B0Z B;  3X1V B;  3AZM B;  3REK A;  2NQB A;  5BS7 A;  3AZI C;  4H9S A;  4YS3 C;  3MVD A;  1P34 C;  3W96 A;  3V9R A;  5DNN C;  1WWI A;  3KUY D;  3REJ D;  2F8N K;  4G92 B;  5B2I A;  5F99 C;  2ZM5 A;  3NQU B;  1EQZ A;  4EO5 C;  3W99 D;  5F99 D;  3W98 A;  5AV9 D;  3AZH A;  4J8U C;  3AZG D;  4J8X D;  1M19 A;  1HQ3 B;  4H9O B;  3A6N C;  3WKJ B;  1F66 D;  3LJA B;  1P3G C;  3WKJ D;  1P3B A;  3MGR C;  3AZJ D;  3MNN B;  3AZL A;  1ID3 A;  2JE5 A;  5B40 C;  3F6T A;  3AZF A;  1KX4 B;  4YM6 B;  5FUG B;  5B0Z D;  4WZS B;  4Z66 C;  3LEL B;  3AFA A;  5B0Z C;  1BH8 B;  2Y2P A;  2YFV A;  2XD1 A;  5CPI C;  5CP6 C;  3AV1 B;  3VH5 W;  3B0D C;  3AV1 A;  1P3O C;  1Z2C B;  3WAA C;  5B1M A;  4CSR B;  3AFA B;  2F8N H;  4UPK A;  5AV8 C;  3C1B A;  4YM6 A;  3AZF B;  4KUD A;  4QLC B;  3MNN A;  3AZL B;  2CV5 B;  5CP6 A;  3MGS B;  5F99 B;  3AZF D;  5CPJ C;  5B1L C;  5AV9 C;  4QLC D;  5AVB D;  4J8X A;  5B33 D;  3R45 B;  5BT1 C;  4XUJ C;  4X23 D;  3FDD A;  3AZH B;  2F8N A;  3UTB D;  5JA4 B;  4G92 C;  1P3F B;  3LEL C;  3W99 A;  4DQY B;  1EQZ B;  3A6N A;  4X23 C;  5AY8 B;  5F99 A;  1EQZ C;  4R8P C;  3B0D B;  3O62 A;  4DRA A;  5B31 D;  2NZD B;  2L5A A;  3W98 C;  5AY8 C;  3EG5 B;  4J8W D;  3MVD B;  4G91 C;  5CPK D;  5CPJ D;  3EPJ A;  3REK B;  3AV2 D;  1P3F C;  1ZLA C;  3REL B;  5B0Z A;  4WNN B;  3X1S A;  4J8V A;  1M1A C;  1U35 B;  3AN2 D;  5B40 A;  5FUG A;  3MGS D;  1P3P C;  5BNX B;  1KX4 A;  1S32 B;  3H0L C;  3O62 D;  4J8U B;  2FJ7 B;  1P3B B;  2HUE B;  3B0B A;  5B24 B;  3LZ1 A;  1BH9 B;  3C1C C;  1P3O A;  5CPK C;  3LZ1 D;  3KXB A;  1M19 B;  4CAY B;  2F8N D;  1EQZ D;  5AVC A;  3WTP A;  3B6G B;  3X1V D;  5B0Y A;  1F66 C;  4YS3 B;  1AOI C;  3NQU A;  3B6G C;  1P3G B;  3MGP B;  3UTB C;  3LZ0 D;  3MGR A;  1ID3 C;  4XZQ A;  4XUJ D;  5BT1 D;  3AV2 B;  3W97 B;  3UTA B;  4UUZ B;  3V9R B;  3MGP D;  5JRG A;  3EPK A;  5AVC D;  3REJ B;  3REL D;  3AZH C;  3WA9 C;  2NQB C;  3X1T C;  5B1L D;  2NQB B;  1P3K B;  5BO0 A;  3AZF C;  4J8W A;  1M18 C;  3KUY C;  2Y2N A;  1P34 D;  3AZK B;  2Y2Q A;  3WTP D;  3AZI D;  5C3I B;  3C1B C;  5AV8 D;  3P5J B;  1P3L A;  3AZN B;  1N1J B;  2BYK B;  3MVD C;  5JRG C;  1P34 B;  3WAA A;  1P3A A;  4WU8 A;  3X1U D;  5GT0 A;  4ZBJ B;  5AV6 B;  1P3P A;  1KX4 C;  4J8V D;  4LD9 B;  5CPI A;  5AV5 A;  3TU4 D;  1P3M C;  3KWQ C;  4Z66 D;  3H0M C;  3MGQ D;  3IP4 C;  4J8V C;  3X1S C;  3REH A;  1M1A A;  5B40 D;  3KWQ B;  4XUJ A;  5DNM A;  4R8P B;  3AZG A;  2NZD C;  2ARO C;  1S32 C;  5GT3 C;  4E44 A;  1P3G D;  5AV6 C;  4KGC B;  3C1B D;  4KHA B;  3TU4 A;  2BG1 A;  5B24 C;  4Z5T C;  5GT0 D;  3AYW B;  3REH C;  3UT9 B;  5B32 A;  5AV8 A;  1U35 C;  3NQJ B;  3WA9 A;  3EPH A;  5DNN B;  3AZJ B;  5AVB A;  1KU5 A;  1R4V A;  3LZ0 C;  3AZJ A;  3AZN D;  1ID3 D;  4Z2M G;  5DNN A;  3UTB A;  1P3I C;  3REI B;  1AOI D;  3X1V C;  1P3I B;  2BYM A;  3UT9 A;  1KX5 B;  4KUD D;  1KX3 D;  3MNN C;  3AL0 C;  3X1T A;  5E5A A;  4JJN D;  4WU8 C;  3KSY A;  5GXQ C;  4AWL B;  3AZE D;  5GSU D;  4H9N B;  4JJN B;  5DNM B;  1HQ3 D;  5GSU A;  3X1U C;  4WU9 C; 
#chains in the Genus database with same CATH homology
 2RVQ C;  3VH6 T;  5B32 G;  3AYW D;  1M1A D;  3UT9 D;  2HIO A;  1HQ3 C;  4Z2M H;  1M18 B;  2CV5 C;  1KX3 A;  4E45 A;  2DF4 C;  3B0C T;  4ZUX D;  1N1J A;  1P3F D;  5GXQ D;  1P3B D;  1KX5 C;  3REL C;  5KDM B;  4M6B A;  4J8W B;  2G5H C;  3REI C;  5AVB B;  3B6F C;  5B2I D;  1M19 D;  1P3M B;  5CPK A;  5B32 B;  4UUZ A;  3REJ A;  5B2I C;  5CHL B;  5G49 B;  3B6F D;  2Y2O A;  3MGR B;  4H9Q A;  3MGP A;  1BFM A;  5AVB C;  3LZ1 C;  4H9S C;  4YS3 A;  3C1C B;  4KHA A;  3B6G A;  3KUY A;  3REH D;  5E5A D;  5AV5 C;  4X23 A;  3AZL D;  2CV5 D;  4R8P A;  5B1L B;  3AZG B;  1T3U A;  4ZUX A;  3REH B;  3UT9 C;  1M1A B;  1P3O B;  1F66 B;  3AN2 C;  4H9R B;  5B24 A;  2HIO D;  3LZ1 B;  3WAA D;  1B67 A;  5BNV B;  5CPI B;  2ARO D;  2FJ7 A;  4AWL C;  4WV4 B;  1P3A D;  4LD9 C;  3WAA B;  5AV9 A;  2Y2M A;  1U35 A;  1P3L B;  4HGA C;  4WU9 A;  4WNN A;  3X1S B;  4LD9 D;  3AZE A;  5AY8 D;  4J8W C;  5B31 C;  3KFU G;  4YM6 C;  5JRG D;  3REL A;  3AZK C;  4KUD C;  3AFA D;  1P3K A;  5JRG B;  4J8X C;  3W97 A;  3AV2 A;  3O62 B;  2ZY2 A;  4J8U D;  3AZG C;  2NZD A;  1PZR A;  5AY8 A;  4NE3 A;  2F8N G;  4WJ3 C;  2F2A C;  3UTA C;  1JFI B;  1TAF B;  4Z66 A;  3A6N B;  2Y2G A;  3W99 B;  1U35 D;  5AVC C;  2UWX A;  5B0Y B;  4QLC C;  4H9P B;  3UTA D;  2F8N B;  5AVC B;  3R45 A;  5B33 B;  3AV1 C;  4CAY A;  3KXB B;  3EPL A;  5B24 D;  4KGC C;  2YFW B;  5BS7 C;  1TAF A;  4Z66 B;  3AZI A;  1M19 C;  3AFA C;  3AZK D;  5CP6 B;  3MGS A;  5GT3 D;  2IO5 B;  2CV5 A;  4Z5T A;  2FFF B;  4J8U A;  2NZD D;  4QLC A;  2CWE A;  1KX5 D;  4KUD B;  5BNX A;  1WWS A;  3X1S D;  1P3B C;  5CP6 D;  3REK D;  5CPJ B;  3MGQ A;  3WTP E;  4J8V B;  4XZQ D;  3AZE B;  2IO5 C;  4WU9 B;  3MGQ B;  5CPJ A;  4NE5 A;  2ZY5 A;  5AV9 B;  2ZY3 A;  1A7W A;  3A6N D;  4Z5T B;  3LJA A;  1ZLA D;  4H9R A;  3AV2 C;  2Y2L A;  2YFW A;  3AZI B;  4DRB A;  1P3F A;  4ZUX B;  3WKJ A;  5JA4 A;  3MGP C;  5B1L A;  1P3K C;  4R8P D;  5B33 A;  4J8X B;  4H9P A;  2J8P A;  5DNN D;  3REJ C;  3W98 B;  3VH6 A;  3B6G D;  3H0R C;  3LEL D;  4YS3 D;  4H9Q B;  5B2I B;  1JFI A;  2DQN C;  3REI D;  1B6W A;  5G49 A;  1W2E A;  5B1M D;  3W96 B;  5CPK B;  4EO5 B;  1P3L C;  3C1B B;  4CSR A;  5B1M B;  3W96 D;  3O62 C;  3MGS C;  1BH8 A;  2YFV B;  3AN2 B;  3LEL A;  3W97 C;  4XZQ C;  1HTA A;  2HIO B;  4G91 B;  2Y2I A;  1ID3 B;  5CPI D;  5BNV A;  3REK C;  3AZE C;  3VH6 W;  1P3M D;  1F66 A;  5B32 D;  2PYO A;  4H9O A;  1HQ3 A;  3W98 D;  5B31 B;  3MNN D;  4X23 B;  3KXB C;  2LY8 A;  3KUY B;  2G5I C;  2JSS A;  4NFT A;  3C1C A;  4KGC D;  2RIQ A;  3AV1 D;  3AZN C;  2FJ7 C;  1M18 D;  5E5A C;  2BYM B;  3X1T D;  4NE6 A;  1P3M A;  3REI A;  2NQB D;  3UTB B;  3AZM A;  5GT0 C;  3X1U A;  5KDM A;  3X1V A;  1Q9C A;  3WA9 B;  3LJA D;  1ZLA A;  1AOI B;  5AV8 B;  5GXQ B;  5B2J A;  3KXB D;  3A1I A;  3AYW A;  3B6F B;  4YM6 D;  1S32 D;  1P3O D;  1M18 A;  1KX3 B;  5DNM C;  2XD5 A;  3TU4 B;  5GT3 B;  5B32 C;  3C1C D;  4KGC A;  3TU4 C;  2Y2K A;  5GSU B;  1H3O A;  1P3A C;  4XUJ B;  5DNM D;  1TZY D;  5B2J C;  4H9N A;  3LZ0 A;  3MGR D;  4JJN A;  3AZJ C;  3W97 D;  2HUE C;  3WKJ C;  2HIO C;  3MVD D;  1TZY A;  2RVQ D;  5B0Y D;  5GT3 A;  5AV5 B;  1P3P B;  3WTP C;  3LJA C;  5E5A B;  3X1T B;  1F1E A;  5GT0 B;  3AZL C;  3VH5 T;  5GSU C;  1P3A B;  3B6F A;  5AV5 D;  1KX5 A;  3AZN A;  1P3I A;  2JCH A;  1P3L D;  3W99 C;  4JJN C;  4WU8 D;  3AZH D;  3AZK A;  5B1M C;  3WA9 D;  3X1U B;  2ARO B;  3VH5 A;  1KX3 C;  5B31 G;  2ARO A;  5BO0 B;  2FJ7 D;  4HGA B;  3AZM C;  3NQJ A;  1P3I D;  3AZM D;  2VQR A;  3UTA A;  3B0C W;  4XZQ B;  5B33 C;  1P3K D;  1P3G A;  2ZY4 A;  5C3I C;  1TZY B;  2Y2H A;  3WTP B;  4ZUX C;  3LZ0 B;  4Z5T D;  5B31 A;  4ZBJ C;  2PYO B;  3KWQ A;  1H3O B;  2W8S A;  1P3P D;  5B0Y C;  3AYW C;  2PYO C;  1BH9 A;  5AV6 D;  2PYO D;  4WU9 D;  4LD9 A;  1TZY C;  5B2J D;  2Y2J A;  5AV6 A;  1S32 A;  4WU8 B;  1ULY A;  3MGQ C;  1P34 A;  3W96 C;  5B40 B;  3KWQ D;  2BYK A;  5B2J B;  3A1K A;  3AN2 A;  5GXQ A;  1AOI A;  1KX4 D;  1ZLA B;  5B0Z B;  3X1V B;  3AZM B;  3REK A;  2NQB A;  5BS7 A;  3AZI C;  4H9S A;  4YS3 C;  3MVD A;  1P34 C;  3W96 A;  3V9R A;  5DNN C;  1WWI A;  3KUY D;  3REJ D;  2F8N K;  4G92 B;  5B2I A;  5F99 C;  2ZM5 A;  3NQU B;  1EQZ A;  4EO5 C;  3W99 D;  5F99 D;  3W98 A;  5AV9 D;  3AZH A;  4J8U C;  3AZG D;  4J8X D;  1M19 A;  1HQ3 B;  4H9O B;  3A6N C;  3WKJ B;  1F66 D;  3LJA B;  1P3G C;  3WKJ D;  1P3B A;  3MGR C;  3AZJ D;  3MNN B;  3AZL A;  1ID3 A;  2JE5 A;  5B40 C;  3F6T A;  3AZF A;  1KX4 B;  4YM6 B;  5FUG B;  5B0Z D;  4WZS B;  4Z66 C;  3LEL B;  3AFA A;  5B0Z C;  1BH8 B;  2Y2P A;  2YFV A;  2XD1 A;  5CPI C;  5CP6 C;  3AV1 B;  3VH5 W;  3B0D C;  3AV1 A;  1P3O C;  1Z2C B;  3WAA C;  5B1M A;  4CSR B;  3AFA B;  2F8N H;  4UPK A;  5AV8 C;  3C1B A;  4YM6 A;  3AZF B;  4KUD A;  4QLC B;  3MNN A;  3AZL B;  2CV5 B;  5CP6 A;  3MGS B;  5F99 B;  3AZF D;  5CPJ C;  5B1L C;  5AV9 C;  4QLC D;  5AVB D;  4J8X A;  5B33 D;  3R45 B;  5BT1 C;  4XUJ C;  4X23 D;  3FDD A;  3AZH B;  2F8N A;  3UTB D;  5JA4 B;  4G92 C;  1P3F B;  3LEL C;  3W99 A;  4DQY B;  1EQZ B;  3A6N A;  4X23 C;  5AY8 B;  5F99 A;  1EQZ C;  4R8P C;  3B0D B;  3O62 A;  4DRA A;  5B31 D;  2NZD B;  2L5A A;  3W98 C;  5AY8 C;  3EG5 B;  4J8W D;  3MVD B;  4G91 C;  5CPK D;  5CPJ D;  3EPJ A;  3REK B;  3AV2 D;  1P3F C;  1ZLA C;  3REL B;  5B0Z A;  4WNN B;  3X1S A;  4J8V A;  1M1A C;  1U35 B;  3AN2 D;  5B40 A;  5FUG A;  3MGS D;  1P3P C;  5BNX B;  1KX4 A;  1S32 B;  3H0L C;  3O62 D;  4J8U B;  2FJ7 B;  1P3B B;  2HUE B;  3B0B A;  5B24 B;  3LZ1 A;  1BH9 B;  3C1C C;  1P3O A;  5CPK C;  3LZ1 D;  3KXB A;  1M19 B;  4CAY B;  2F8N D;  1EQZ D;  5AVC A;  3WTP A;  3B6G B;  3X1V D;  5B0Y A;  1F66 C;  4YS3 B;  1AOI C;  3NQU A;  3B6G C;  1P3G B;  3MGP B;  3UTB C;  3LZ0 D;  3MGR A;  1ID3 C;  4XZQ A;  4XUJ D;  5BT1 D;  3AV2 B;  3W97 B;  3UTA B;  4UUZ B;  3V9R B;  3MGP D;  5JRG A;  3EPK A;  5AVC D;  3REJ B;  3REL D;  3AZH C;  3WA9 C;  2NQB C;  3X1T C;  5B1L D;  2NQB B;  1P3K B;  5BO0 A;  3AZF C;  4J8W A;  1M18 C;  3KUY C;  2Y2N A;  1P34 D;  3AZK B;  2Y2Q A;  3WTP D;  3AZI D;  5C3I B;  3C1B C;  5AV8 D;  3P5J B;  1P3L A;  3AZN B;  1N1J B;  2BYK B;  3MVD C;  5JRG C;  1P34 B;  3WAA A;  1P3A A;  4WU8 A;  3X1U D;  5GT0 A;  4ZBJ B;  5AV6 B;  1P3P A;  1KX4 C;  4J8V D;  4LD9 B;  5CPI A;  5AV5 A;  3TU4 D;  1P3M C;  3KWQ C;  4Z66 D;  3H0M C;  3MGQ D;  3IP4 C;  4J8V C;  3X1S C;  3REH A;  1M1A A;  5B40 D;  3KWQ B;  4XUJ A;  5DNM A;  4R8P B;  3AZG A;  2NZD C;  2ARO C;  1S32 C;  5GT3 C;  4E44 A;  1P3G D;  5AV6 C;  4KGC B;  3C1B D;  4KHA B;  3TU4 A;  2BG1 A;  5B24 C;  4Z5T C;  5GT0 D;  3AYW B;  3REH C;  3UT9 B;  5B32 A;  5AV8 A;  1U35 C;  3NQJ B;  3WA9 A;  3EPH A;  5DNN B;  3AZJ B;  5AVB A;  1KU5 A;  1R4V A;  3LZ0 C;  3AZJ A;  3AZN D;  1ID3 D;  4Z2M G;  5DNN A;  3UTB A;  1P3I C;  3REI B;  1AOI D;  3X1V C;  1P3I B;  2BYM A;  3UT9 A;  1KX5 B;  4KUD D;  1KX3 D;  3MNN C;  3AL0 C;  3X1T A;  5E5A A;  4JJN D;  4WU8 C;  3KSY A;  5GXQ C;  4AWL B;  3AZE D;  5GSU D;  4H9N B;  4JJN B;  5DNM B;  1HQ3 D;  5GSU A;  3X1U C;  4WU9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...