2CV5A

Crystal structure of human nucleosome core particle
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
publication title Alteration of the nucleosomal DNA path in the crystal structure of a human nucleosome core particle
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2cv5A00
3RELA 2F8NA 3LELB 1P3PC 1P3GB 4XUJB 3O62C 3AZJD 5B0YB 3AV1B 3KUYC 5CPID 3KXBD 4Z66C 4LD9D 4Z5TD 3WTPB 3B6GD 5DNND 2AROB 3B6FD 4EO5C 3AZJA 1P3IA 5GSUC 5BNVA 2HIOC 3VH5A 3MGSA 5B1MA 5CPIA 3KXBA 3UTBD 2YFWB 3AFAC 5B2ID 4J8XC 3WA9A 5C3IB 3C1BD 3B6GA 5DNNA 5GT3A 3LZ0B 4J8UC 3AN2A 3X1TC 3A6ND 1P3OD 1P3PB 3AZHD 4XZQD 5GXQD 3O62B 5AVCB 3UTBA 5JA4A 5B2IA 2PYOA 3VH6A 3RELC 4Z66B 1TAFB 2NZDC 3A6NA 1P3OA 3AZHA 5GXQA 2BYKA 3AZFB 1S32B 5BO0A 3X1SA 4YS3D 5BT1D 3C1CB 1BH9A 4J8UB 3AZJC 3MVDD 5AV9D 4H9OA 3X1TB 2LY8A 1P3MD 4JJND 3LJAD 4H9QB 5CPIC 1KX3D 3KXBC 3AYWD 4QLCD 4LD9C 5B32G 4Z5TC 1ID3B 5DNNC 3B6GC 3MVDA 1M19D 5AV9A 4JJNA 3LJAA 3REHD 3AYWA 3UTBC 5B2IC 3C1BC 3TU4D 4H9NA 3A6NC 5B1LD 5AV8A 1P3OC 1N1JA 3AZHC 4XZQC 1HTAA 5GXQC 3REHA 3AZND 3AZED 3AZJB 1P3IB 3MGSB 5B1MB 3X1VD 4WU8D 3AZGA 5CPJD 1ULYA 3AZID 4KUDA 2YFVA 3WA9B 1M18D 3B6GB 5DNNB 4H9PA 5GT3B 3AN2B 3MNNB 3AZNA 2L5AA 3AZEA 4ZUXA 1HQ3D 4YS3C 3AV2D 4WU8A 3UTBB 3AZIA 5CPJA 5JA4B 5B2IB 5BT1C 2PYOB 1M18A 2BYMA 3MVDC 5AV9C 3A6NB 1P3MC 4JJNC 3LJAC 1P3OB 1KX3C 1HQ3A 3AYWC 3WAAD 2BYKB 4QLCC 3B0DC 3AV2A 4H9RA 1KX4B 5BO0B 3X1SB 5DNMB 3AZMB 5AV6D 1M19C 3REIB 3W98B 1BH9B 3REHC 5B24D 4HGAC 4H9OB 3WAAA 3TU4C 3KUYA 4R8PD 5AV6A 2NQBD 3AZNC 3AZEC 5B24A 3MVDB 5AV9B 4JJNB 5GSUA 3X1VC 3AYWB 4WU8C 3AZIC 5CPJC 4J8WD 3B0DB 5B31D 1P3FD 1WWSA 1M18C 4R8PA 4KHAA 3AFAA 4H9NB 2NQBA 5AV8B 1F66D 1N1JB 1HQ3C 3UTAD 1B6WA 2F8NG 3AV2C 4J8WA 3WKJD 3AZGB 4KUDB 4NE5A 1JFIA 2NZDA 4H9PB 4NE6A 3UTAA 3WAAC 1B67A 4ZUXB 3AZIB 1M1AD 5AV6C 1M18B 2BYMB 5B24C 1AOID 2RVQD 5B33D 1HQ3B 4Z2MH 3AV2B 4R8PC 4LD9A 4H9RB 1M1AA 3NQUA 4CSRA 4Z5TA 2NQBC 4YM6D 3WAAB 4J8WC 5B31C 1P3FC 3KUYB 4UUZA 4E45A 3C1BA 3MGPD 4KGCD 5B40D 1F66C 1F1EA 5AV6B 5AVBD 3UTAC 1KX5D 3W97D 5B24B 4XZQA 4EO5B 5GT0D 3WKJC 5GSUB 5JRGD 2HIOB 4X23D 3MGPA 4R8PB 4KGCA 4KHAB 5FUGA 5B40A 3AFAB 4J8XB 1P3KD 5CHLB 5AVBA 3MGRD 1ZLAD 2NQBB 1KX5A 5GT0A 1P3LD 5CP6D 5JRGA 1M1AC 4YS3A 4X23A 1ZLAA 1P3KA 3RELB 1AOIC 3V9RA 2F8NB 2RVQC 1P34D 1JFIB 5CPKD 3UT9D 2NZDB 1Q9CA 5B33C 1P3MA 3UTAB 1U35D 5CP6A 1KX3A 4QLCA 4H9SC 1P34A 1M19A 5CPKA 3UT9A 4YM6C 5AV5D 5BNVB 5CPIB 3KXBB 3TU4A 3MGPC 4KGCC 4LD9B 5B40C 1M1AB 3NQUB 4CSRB 4Z5TB 5B1LA 5AVBC 4DRBA 1KX5C 4G91C 5GT0C 4CAYA 1KU5A 4DRAA 5JRGC 4ZBJC 2CV5D 3X1VA 4X23C 3WTPE 1P3AD 1ZLAC 3B6FC 4UUZB 1P3KC 3MGRC 3C1BB 3LELD 1P3LC 5CP6C 5B0YD 4XZQB 3AZHB 4AWLC 5GXQB 3X1UD 1P3AA 2FJ7D 4G92C 2CWEA 3MGPB 1P34C 4KGCB 5B40B 5BS7A 3WTPD 3UT9C 5B0ZD 5CPKC 5AVBB 1KX5B 1U35C 3W99D 5GT0B 4WNNA 3X1UA 5JRGB 4ZBJB 5AY8D 4YS3B 2FJ7A 4X23B 5B1LC 1ZLAB 3LZ0D 5B0ZA 1P3KB 3V9RB 5AV5C 3W99A 1WWIA 4E44A 1P3MB 3LJAB 5CP6B 1KX3B 3LZ1D 2F8NK 5AVCD 5AY8A 4QLCB 3NQJA 4M6BA 5E5AD 1P34B 1M19B 4NE3A 5CPKB 3REHB 3AZFD 1S32D 2CV5C 2HUEC 4HGAB 3LZ1A 1P3AC 3AZKD 5B31A 1P3FA 3TU4B 3LELC 2YFVB 5BS7C 5E5AA 5B1LB 3C1CD 1F66A 5B0YC 2IO5C 3X1UC 3AZEB 3AZNB 4CAYB 5B2JD 3AZKA 3WKJA 2FJ7C 3X1VB 4WU8B 5CPJB 3WTPC 1ID3D 5B0ZC 3C1CA 3W99C 5B2JA 5AY8C 2HUEB 1P3AB 1EQZD 3LZ0C 1AOIA 3REJD 1P3ID 2IO5B 5B33A 3LZ1C 5AVCC 4WNNB 3X1UB 3MGSD 5B1MD 1BFMA 1EQZA 3KWQD 3WA9D 5E5AC 3B0BA 3VH5W 2FJ7B 3B0CW 3AZLD 4H9SA 5GT3D 5B0ZB 3AN2D 3REJA 3MNND 3AZFC 1S32C 1R4VA 4YM6A 3W99B 3R45A 3AZKC 2F8NH 1TZYD 5AY8B 3KWQA 2PYOD 3AZLA 3NQJB 3C1CC 3W96D 5F99D 3MNNA 3REKD 3VH6W 3W97A 1H3OA 5G49A 5B2JC 1TZYA 3LZ1B 4WU9D 1P3BD 4J8WB 1KX4D 1ID3C 5B31B 1P3FB 3X1SD 5DNMD 3AZMD 3B6FA 3W96A 5F99A 5E5AB 3MGRA 3REKA 3REID 3W98D 1F66B 1P3LA 4WU9A 1P3BA 3AZKB 1KX4A 1EQZC 3WKJB 5DNMA 3AZMA 4J8VD 3REJC 3REIA 3W98A 1P3IC 5B32D 1U35A 3VH5T 3B0CT 5B1MC 3MGSC 5B2JB 3KWQC 3WA9C 3AZLC 4J8VA 5GT3C 3AN2C 3MNNC 3W97C 5AV8D 1AOIB 1BH8A 5B32A 1TZYC 5AV5A 5B33B 5KDMA 3VH6T 2PYOC 5BNXA 2JSSA 3MGQD 3AZGD 3W96C 1EQZB 5F99C 4KUDD 3REKC 1P3GD 3REJB 4XUJD 3AV1D 4ZUXD 4YM6B 4WU9C 3R45B 1P3BC 1KX4C 2CV5A 3X1SC 5DNMC 3MGQA 3AZMC 3KWQB 3KSYA 3REIC 3AZLB 3LELA 3W98C 5FUGB 2AROD 1P3GA 4XUJA 3W97B 1H3OB 5B0YA 3AV1A 4G91B 5G49B 1TZYB 4J8VC 3WTPA 3B6FB 3W96B 2AROA 5F99B 3MGRB 3REKB 5B32C 1P3PD 3O62D 1P3LB 4AWLB 4WU9B 2YFWA 3KUYD 1P3BB 4Z66D 5AV8C 3LZ0A 1A7WA 5B31G 4G92B 1P3PA 3UT9B 3O62A 1U35B 5GSUD 4Z2MG 5AVCA 3MGQC 3AZGC 2HIOD 4KUDC 4Z66A 4J8VB 3AFAD 1TAFA 4J8XD 1P3GC 4NFTA 4XUJC 4J8UD 3AV1C 4ZUXC 3X1TD 1BH8B 3AZFA 1S32A 5B32B 5AV5B 2HIOA 5KDMB 5BNXB 2AROC 4J8XA 3RELD 2F8ND 4J8UA 2NZDD 3X1TA 4H9QA 2CV5B 4WZSB 5C3IC 3MGQB 4WV4B 1ID3A
chains in the Genus database with same CATH superfamily
3RELA 2F8NA 3LELB 1P3PC 1P3GB 4XUJB 3O62C 2VQRA 5B0YB 3AZJD 2Y2KA 3AV1B 3KUYC 2ZY3A 5CPID 3KXBD 4Z66C 4LD9D 3H0RC 4Z5TD 3WTPB 3B6GD 5DNND 2AROB 3B6FD 4EO5C 3AZJA 1P3IA 2DQNC 5GSUC 5BNVA 2HIOC 3VH5A 3MGSA 5B1MA 5CPIA 3KXBA 3UTBD 2YFWB 3AFAC 5B2ID 4J8XC 3WA9A 5C3IB 2Y2QA 3C1BD 3B6GA 5DNNA 5GT3A 3LZ0B 4J8UC 3AN2A 3X1TC 3A6ND 1P3OD 1P3PB 3AZHD 4XZQD 5GXQD 3O62B 5AVCB 3UTBA 5JA4A 5B2IA 2PYOA 3VH6A 3RELC 4Z66B 1TAFB 2NZDC 3A6NA 1P3OA 3AZHA 5GXQA 2BYKA 3AZFB 1S32B 3EPKA 1PZRA 2UWXA 5BO0A 3X1SA 4YS3D 5BT1D 3C1CB 1BH9A 4J8UB 3AZJC 3MVDD 5AV9D 4H9OA 3X1TB 2LY8A 1P3MD 4JJND 3LJAD 4H9QB 5CPIC 1KX3D 3KXBC 3AYWD 4QLCD 4LD9C 5B32G 4Z5TC 1ID3B 5DNNC 3B6GC 1W2EA 3MVDA 1M19D 5AV9A 4JJNA 3LJAA 3REHD 3AYWA 3UTBC 5B2IC 3C1BC 3TU4D 4H9NA 3A6NC 5B1LD 5AV8A 1P3OC 1N1JA 3AZHC 4XZQC 1HTAA 5GXQC 3REHA 3AZND 3AZED 3AZJB 1P3IB 3MGSB 5B1MB 3X1VD 4WU8D 3F6TA 5CPJD 1ULYA 3AZGA 3AZID 2YFVA 3WA9B 4KUDA 1M18D 3B6GB 5DNNB 4H9PA 5GT3B 4DQYB 3AN2B 3MNNB 3AZNA 2L5AA 3AZEA 4ZUXA 2FFFB 1HQ3D 4YS3C 3AV2D 4WU8A 3UTBB 3AZIA 5CPJA 5JA4B 5B2IB 5BT1C 2PYOB 1M18A 2BYMA 3P5JB 3MVDC 5AV9C 3A6NB 1P3MC 4JJNC 3LJAC 1P3OB 1KX3C 1HQ3A 3AYWC 3WAAD 2BYKB 4QLCC 3B0DC 3AV2A 4H9RA 1KX4B 2G5IC 2ZY2A 5BO0B 3X1SB 5DNMB 1Z2CB 3AZMB 5AV6D 1M19C 3REIB 3W98B 1BH9B 3REHC 5B24D 4HGAC 4H9OB 3WAAA 3H0MC 2Y2IA 3TU4C 3KUYA 1T3UA 3A1KA 4R8PD 5AV6A 2NQBD 3AZNC 3AZEC 5B24A 3MVDB 5AV9B 4WJ3C 4JJNB 5GSUA 3X1VC 3AYWB 4WU8C 3AZIC 5CPJC 4J8WD 3B0DB 2JCHA 5B31D 1WWSA 1P3FD 1M18C 4R8PA 4KHAA 3AFAA 4H9NB 2NQBA 5AV8B 1F66D 1N1JB 1HQ3C 3UTAD 1B6WA 2F8NG 3AV2C 4J8WA 3WKJD 3AZGB 4KUDB 4NE5A 1JFIA 2NZDA 4H9PB 4NE6A 3UTAA 3WAAC 1B67A 4ZUXB 2ZY4A 3A1IA 3AZIB 1M1AD 5AV6C 1M18B 2BYMB 5B24C 1AOID 2RVQD 5B33D 1HQ3B 4Z2MH 3AV2B 4R8PC 4LD9A 4H9RB 1M1AA 3NQUA 4CSRA 4Z5TA 2NQBC 4YM6D 3WAAB 4J8WC 5B31C 1P3FC 3KUYB 3H0LC 4UUZA 4E45A 3C1BA 3MGPD 4KGCD 5B40D 1F66C 1F1EA 5AV6B 5AVBD 3UTAC 1KX5D 3W97D 5B24B 4XZQA 2Y2MA 4EO5B 5GT0D 3WKJC 5GSUB 5JRGD 2HIOB 4X23D 3MGPA 4R8PB 4KGCA 4KHAB 5FUGA 5B40A 3AFAB 4J8XB 1P3KD 5CHLB 5AVBA 3MGRD 1ZLAD 2NQBB 1KX5A 5GT0A 1P3LD 5CP6D 5JRGA 1M1AC 4YS3A 4X23A 1ZLAA 1P3KA 3RELB 2Y2NA 1AOIC 3V9RA 2F8NB 2RVQC 1P34D 1JFIB 5CPKD 3UT9D 2NZDB 1Q9CA 2Y2JA 5B33C 3UTAB 1P3MA 1U35D 5CP6A 1KX3A 3KFUG 4QLCA 4H9SC 1P34A 1M19A 5CPKA 3UT9A 4YM6C 2XD1A 5AV5D 5BNVB 5CPIB 3KXBB 3TU4A 3MGPC 4KGCC 4LD9B 5B40C 1M1AB 3NQUB 4CSRB 2Y2LA 5B1LA 4Z5TB 5AVBC 4DRBA 1KX5C 4G91C 5GT0C 2F2AC 4CAYA 1KU5A 4DRAA 5JRGC 4ZBJC 2CV5D 3X1VA 4X23C 3WTPE 1P3AD 1ZLAC 3B6FC 4UUZB 1P3KC 3MGRC 3C1BB 3LELD 1P3LC 5CP6C 5B0YD 4XZQB 3AZHB 4AWLC 5GXQB 3X1UD 1P3AA 2FJ7D 4G92C 2CWEA 3MGPB 1P34C 4KGCB 5B40B 5BS7A 3WTPD 3UT9C 5B0ZD 5CPKC 5AVBB 1KX5B 1U35C 3W99D 5GT0B 4WNNA 3X1UA 2XD5A 5JRGB 4ZBJB 5AY8D 4YS3B 2FJ7A 4X23B 5B1LC 1ZLAB 3LZ0D 5B0ZA 1P3KB 3V9RB 5AV5C 3W99A 1WWIA 4E44A 1P3MB 3LJAB 3EPLA 5CP6B 2W8SA 1KX3B 3LZ1D 2F8NK 5AVCD 5AY8A 4QLCB 3NQJA 4M6BA 5E5AD 2J8PA 1P34B 1M19B 4NE3A 5CPKB 3REHB 3AZFD 1S32D 2CV5C 2HUEC 4HGAB 3LZ1A 1P3AC 3AZKD 5B31A 1P3FA 3TU4B 3LELC 2YFVB 5BS7C 5E5AA 5B1LB 3C1CD 1F66A 5B0YC 2IO5C 2G5HC 3X1UC 3AZEB 3AZNB 4CAYB 5B2JD 3AZKA 3WKJA 2FJ7C 3X1VB 4WU8B 5CPJB 3WTPC 1ID3D 5B0ZC 2JE5A 3C1CA 3W99C 5B2JA 5AY8C 2HUEB 1P3AB 1EQZD 3LZ0C 2DF4C 1AOIA 3REJD 1P3ID 2IO5B 5B33A 3LZ1C 5AVCC 4WNNB 3X1UB 3MGSD 5B1MD 1BFMA 1EQZA 3KWQD 3WA9D 5E5AC 3B0BA 3VH5W 2FJ7B 3B0CW 3AZLD 4H9SA 5GT3D 5B0ZB 3AN2D 3REJA 3MNND 3AZFC 1S32C 1R4VA 4YM6A 3W99B 3R45A 3AZKC 2F8NH 1TZYD 5AY8B 3KWQA 2PYOD 3AZLA 2Y2HA 3NQJB 3C1CC 3W96D 5F99D 3MNNA 3REKD 3VH6W 3W97A 1H3OA 5G49A 5B2JC 1TZYA 3LZ1B 4WU9D 1P3BD 4J8WB 1KX4D 1ID3C 5B31B 1P3FB 3X1SD 5DNMD 3AZMD 3B6FA 3W96A 3EG5B 5F99A 5E5AB 3MGRA 3REKA 3REID 3W98D 1F66B 1P3LA 2Y2PA 4WU9A 1P3BA 3AZKB 1KX4A 1EQZC 3WKJB 3AL0C 5DNMA 3AZMA 4J8VD 3REJC 3REIA 3W98A 1P3IC 5B32D 1U35A 3VH5T 3B0CT 5B1MC 3MGSC 5B2JB 3KWQC 2ZM5A 3WA9C 3AZLC 4J8VA 5GT3C 3AN2C 3MNNC 3W97C 5AV8D 1AOIB 1BH8A 5B32A 1TZYC 5AV5A 5B33B 5KDMA 3VH6T 2PYOC 5BNXA 3EPHA 2JSSA 3MGQD 3IP4C 3AZGD 3W96C 1EQZB 5F99C 4KUDD 3REKC 1P3GD 3REJB 4XUJD 3AV1D 4ZUXD 4YM6B 3FDDA 4WU9C 3R45B 1P3BC 1KX4C 2CV5A 3X1SC 5DNMC 3MGQA 3AZMC 3KWQB 3KSYA 3REIC 3AZLB 3LELA 2RIQA 3W98C 5FUGB 2AROD 1P3GA 4XUJA 3W97B 1H3OB 5B0YA 3AV1A 4G91B 5G49B 1TZYB 4J8VC 3EPJA 3WTPA 3B6FB 3W96B 2AROA 5F99B 3MGRB 3REKB 5B32C 1P3PD 2Y2GA 3O62D 1P3LB 4AWLB 4WU9B 2YFWA 3KUYD 1P3BB 4Z66D 5AV8C 3LZ0A 1A7WA 5B31G 4G92B 1P3PA 3UT9B 3O62A 1U35B 5GSUD 4Z2MG 5AVCA 3MGQC 3AZGC 2HIOD 4KUDC 4Z66A 4J8VB 3AFAD 1TAFA 2ZY5A 4J8XD 1P3GC 4NFTA 2Y2OA 4XUJC 4J8UD 3AV1C 4ZUXC 3X1TD 1BH8B 3AZFA 1S32A 5B32B 5AV5B 2HIOA 5KDMB 5BNXB 2AROC 4J8XA 4UPKA 3RELD 2F8ND 4J8UA 2NZDD 3X1TA 2BG1A 4H9QA 2CV5B 4WZSB 5C3IC 3MGQB 4WV4B 1ID3A
chains in the Genus database with same CATH topology
3RELA 2F8NA 3LELB 1P3PC 1P3GB 4XUJB 3O62C 2VQRA 5B0YB 3AZJD 2Y2KA 3AV1B 3KUYC 2ZY3A 5CPID 3KXBD 4Z66C 4LD9D 3H0RC 4Z5TD 3WTPB 3B6GD 5DNND 2AROB 3B6FD 4EO5C 3AZJA 1P3IA 2DQNC 5GSUC 5BNVA 2HIOC 3VH5A 3MGSA 5B1MA 5CPIA 3KXBA 3UTBD 2YFWB 3AFAC 5B2ID 4J8XC 3WA9A 5C3IB 2Y2QA 3C1BD 3B6GA 5DNNA 5GT3A 3LZ0B 4J8UC 3AN2A 3X1TC 3A6ND 1P3OD 1P3PB 3AZHD 4XZQD 5GXQD 3O62B 5AVCB 3UTBA 5JA4A 5B2IA 2PYOA 3VH6A 3RELC 4Z66B 1TAFB 2NZDC 3A6NA 1P3OA 3AZHA 5GXQA 2BYKA 3AZFB 1S32B 3EPKA 1PZRA 2UWXA 5BO0A 3X1SA 4YS3D 5BT1D 3C1CB 1BH9A 4J8UB 3AZJC 3MVDD 5AV9D 4H9OA 3X1TB 2LY8A 1P3MD 4JJND 3LJAD 4H9QB 5CPIC 1KX3D 3KXBC 3AYWD 4QLCD 4LD9C 5B32G 4Z5TC 1ID3B 5DNNC 3B6GC 1W2EA 3MVDA 1M19D 5AV9A 4JJNA 3LJAA 3REHD 3AYWA 3UTBC 5B2IC 3C1BC 3TU4D 4H9NA 3A6NC 5B1LD 5AV8A 1P3OC 1N1JA 3AZHC 4XZQC 1HTAA 5GXQC 3REHA 3AZND 3AZED 3AZJB 1P3IB 3MGSB 5B1MB 3X1VD 4WU8D 3F6TA 5CPJD 1ULYA 3AZGA 3AZID 2YFVA 3WA9B 4KUDA 1M18D 3B6GB 5DNNB 4H9PA 5GT3B 4DQYB 3AN2B 3MNNB 3AZNA 2L5AA 3AZEA 4ZUXA 2FFFB 1HQ3D 4YS3C 3AV2D 4WU8A 3UTBB 3AZIA 5CPJA 5JA4B 5B2IB 5BT1C 2PYOB 1M18A 2BYMA 3P5JB 3MVDC 5AV9C 3A6NB 1P3MC 4JJNC 3LJAC 1P3OB 1KX3C 1HQ3A 3AYWC 3WAAD 2BYKB 4QLCC 3B0DC 3AV2A 4H9RA 1KX4B 2G5IC 2ZY2A 5BO0B 3X1SB 5DNMB 1Z2CB 3AZMB 5AV6D 1M19C 3REIB 3W98B 1BH9B 3REHC 5B24D 4HGAC 4H9OB 3WAAA 3H0MC 2Y2IA 3TU4C 3KUYA 1T3UA 3A1KA 4R8PD 5AV6A 2NQBD 3AZNC 3AZEC 5B24A 3MVDB 5AV9B 4WJ3C 4JJNB 5GSUA 3X1VC 3AYWB 4WU8C 3AZIC 5CPJC 4J8WD 3B0DB 2JCHA 5B31D 1WWSA 1P3FD 1M18C 4R8PA 4KHAA 3AFAA 4H9NB 2NQBA 5AV8B 1F66D 1N1JB 1HQ3C 3UTAD 1B6WA 2F8NG 3AV2C 4J8WA 3WKJD 3AZGB 4KUDB 4NE5A 1JFIA 2NZDA 4H9PB 4NE6A 3UTAA 3WAAC 1B67A 4ZUXB 2ZY4A 3A1IA 3AZIB 1M1AD 5AV6C 1M18B 2BYMB 5B24C 1AOID 2RVQD 5B33D 1HQ3B 4Z2MH 3AV2B 4R8PC 4LD9A 4H9RB 1M1AA 3NQUA 4CSRA 4Z5TA 2NQBC 4YM6D 3WAAB 4J8WC 5B31C 1P3FC 3KUYB 3H0LC 4UUZA 4E45A 3C1BA 3MGPD 4KGCD 5B40D 1F66C 1F1EA 5AV6B 5AVBD 3UTAC 1KX5D 3W97D 5B24B 4XZQA 2Y2MA 4EO5B 5GT0D 3WKJC 5GSUB 5JRGD 2HIOB 4X23D 3MGPA 4R8PB 4KGCA 4KHAB 5FUGA 5B40A 3AFAB 4J8XB 1P3KD 5CHLB 5AVBA 3MGRD 1ZLAD 2NQBB 1KX5A 5GT0A 1P3LD 5CP6D 5JRGA 1M1AC 4YS3A 4X23A 1ZLAA 1P3KA 3RELB 2Y2NA 1AOIC 3V9RA 2F8NB 2RVQC 1P34D 1JFIB 5CPKD 3UT9D 2NZDB 1Q9CA 2Y2JA 5B33C 3UTAB 1P3MA 1U35D 5CP6A 1KX3A 3KFUG 4QLCA 4H9SC 1P34A 1M19A 5CPKA 3UT9A 4YM6C 2XD1A 5AV5D 5BNVB 5CPIB 3KXBB 3TU4A 3MGPC 4KGCC 4LD9B 5B40C 1M1AB 3NQUB 4CSRB 2Y2LA 5B1LA 4Z5TB 5AVBC 4DRBA 1KX5C 4G91C 5GT0C 2F2AC 4CAYA 1KU5A 4DRAA 5JRGC 4ZBJC 2CV5D 3X1VA 4X23C 3WTPE 1P3AD 1ZLAC 3B6FC 4UUZB 1P3KC 3MGRC 3C1BB 3LELD 1P3LC 5CP6C 5B0YD 4XZQB 3AZHB 4AWLC 5GXQB 3X1UD 1P3AA 2FJ7D 4G92C 2CWEA 3MGPB 1P34C 4KGCB 5B40B 5BS7A 3WTPD 3UT9C 5B0ZD 5CPKC 5AVBB 1KX5B 1U35C 3W99D 5GT0B 4WNNA 3X1UA 2XD5A 5JRGB 4ZBJB 5AY8D 4YS3B 2FJ7A 4X23B 5B1LC 1ZLAB 3LZ0D 5B0ZA 1P3KB 3V9RB 5AV5C 3W99A 1WWIA 4E44A 1P3MB 3LJAB 3EPLA 5CP6B 2W8SA 1KX3B 3LZ1D 2F8NK 5AVCD 5AY8A 4QLCB 3NQJA 4M6BA 5E5AD 2J8PA 1P34B 1M19B 4NE3A 5CPKB 3REHB 3AZFD 1S32D 2CV5C 2HUEC 4HGAB 3LZ1A 1P3AC 3AZKD 5B31A 1P3FA 3TU4B 3LELC 2YFVB 5BS7C 5E5AA 5B1LB 3C1CD 1F66A 5B0YC 2IO5C 2G5HC 3X1UC 3AZEB 3AZNB 4CAYB 5B2JD 3AZKA 3WKJA 2FJ7C 3X1VB 4WU8B 5CPJB 3WTPC 1ID3D 5B0ZC 2JE5A 3C1CA 3W99C 5B2JA 5AY8C 2HUEB 1P3AB 1EQZD 3LZ0C 2DF4C 1AOIA 3REJD 1P3ID 2IO5B 5B33A 3LZ1C 5AVCC 4WNNB 3X1UB 3MGSD 5B1MD 1BFMA 1EQZA 3KWQD 3WA9D 5E5AC 3B0BA 3VH5W 2FJ7B 3B0CW 3AZLD 4H9SA 5GT3D 5B0ZB 3AN2D 3REJA 3MNND 3AZFC 1S32C 1R4VA 4YM6A 3W99B 3R45A 3AZKC 2F8NH 1TZYD 5AY8B 3KWQA 2PYOD 3AZLA 2Y2HA 3NQJB 3C1CC 3W96D 5F99D 3MNNA 3REKD 3VH6W 3W97A 1H3OA 5G49A 5B2JC 1TZYA 3LZ1B 4WU9D 1P3BD 4J8WB 1KX4D 1ID3C 5B31B 1P3FB 3X1SD 5DNMD 3AZMD 3B6FA 3W96A 3EG5B 5F99A 5E5AB 3MGRA 3REKA 3REID 3W98D 1F66B 1P3LA 2Y2PA 4WU9A 1P3BA 3AZKB 1KX4A 1EQZC 3WKJB 3AL0C 5DNMA 3AZMA 4J8VD 3REJC 3REIA 3W98A 1P3IC 5B32D 1U35A 3VH5T 3B0CT 5B1MC 3MGSC 5B2JB 3KWQC 2ZM5A 3WA9C 3AZLC 4J8VA 5GT3C 3AN2C 3MNNC 3W97C 5AV8D 1AOIB 1BH8A 5B32A 1TZYC 5AV5A 5B33B 5KDMA 3VH6T 2PYOC 5BNXA 3EPHA 2JSSA 3MGQD 3IP4C 3AZGD 3W96C 1EQZB 5F99C 4KUDD 3REKC 1P3GD 3REJB 4XUJD 3AV1D 4ZUXD 4YM6B 3FDDA 4WU9C 3R45B 1P3BC 1KX4C 2CV5A 3X1SC 5DNMC 3MGQA 3AZMC 3KWQB 3KSYA 3REIC 3AZLB 3LELA 2RIQA 3W98C 5FUGB 2AROD 1P3GA 4XUJA 3W97B 1H3OB 5B0YA 3AV1A 4G91B 5G49B 1TZYB 4J8VC 3EPJA 3WTPA 3B6FB 3W96B 2AROA 5F99B 3MGRB 3REKB 5B32C 1P3PD 2Y2GA 3O62D 1P3LB 4AWLB 4WU9B 2YFWA 3KUYD 1P3BB 4Z66D 5AV8C 3LZ0A 1A7WA 5B31G 4G92B 1P3PA 3UT9B 3O62A 1U35B 5GSUD 4Z2MG 5AVCA 3MGQC 3AZGC 2HIOD 4KUDC 4Z66A 4J8VB 3AFAD 1TAFA 2ZY5A 4J8XD 1P3GC 4NFTA 2Y2OA 4XUJC 4J8UD 3AV1C 4ZUXC 3X1TD 1BH8B 3AZFA 1S32A 5B32B 5AV5B 2HIOA 5KDMB 5BNXB 2AROC 4J8XA 4UPKA 3RELD 2F8ND 4J8UA 2NZDD 3X1TA 2BG1A 4H9QA 2CV5B 4WZSB 5C3IC 3MGQB 4WV4B 1ID3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REL A;  2F8N A;  3LEL B;  1P3P C;  1P3G B;  4XUJ B;  3O62 C;  3AZJ D;  5B0Y B;  3AV1 B;  3KUY C;  5CPI D;  3KXB D;  4Z66 C;  4LD9 D;  4Z5T D;  3WTP B;  3B6G D;  5DNN D;  2ARO B;  3B6F D;  4EO5 C;  3AZJ A;  1P3I A;  5GSU C;  5BNV A;  2HIO C;  3VH5 A;  3MGS A;  5B1M A;  5CPI A;  3KXB A;  3UTB D;  2YFW B;  3AFA C;  5B2I D;  4J8X C;  3WA9 A;  5C3I B;  3C1B D;  3B6G A;  5DNN A;  5GT3 A;  3LZ0 B;  4J8U C;  3AN2 A;  3X1T C;  3A6N D;  1P3O D;  1P3P B;  3AZH D;  4XZQ D;  5GXQ D;  3O62 B;  5AVC B;  3UTB A;  5JA4 A;  5B2I A;  2PYO A;  3VH6 A;  3REL C;  4Z66 B;  1TAF B;  2NZD C;  3A6N A;  1P3O A;  3AZH A;  5GXQ A;  2BYK A;  3AZF B;  1S32 B;  5BO0 A;  3X1S A;  4YS3 D;  5BT1 D;  3C1C B;  1BH9 A;  4J8U B;  3AZJ C;  3MVD D;  5AV9 D;  4H9O A;  3X1T B;  2LY8 A;  1P3M D;  4JJN D;  3LJA D;  4H9Q B;  5CPI C;  1KX3 D;  3KXB C;  3AYW D;  4QLC D;  4LD9 C;  5B32 G;  4Z5T C;  1ID3 B;  5DNN C;  3B6G C;  3MVD A;  1M19 D;  5AV9 A;  4JJN A;  3LJA A;  3REH D;  3AYW A;  3UTB C;  5B2I C;  3C1B C;  3TU4 D;  4H9N A;  3A6N C;  5B1L D;  5AV8 A;  1P3O C;  1N1J A;  3AZH C;  4XZQ C;  1HTA A;  5GXQ C;  3REH A;  3AZN D;  3AZE D;  3AZJ B;  1P3I B;  3MGS B;  5B1M B;  3X1V D;  4WU8 D;  3AZG A;  5CPJ D;  1ULY A;  3AZI D;  4KUD A;  2YFV A;  3WA9 B;  1M18 D;  3B6G B;  5DNN B;  4H9P A;  5GT3 B;  3AN2 B;  3MNN B;  3AZN A;  2L5A A;  3AZE A;  4ZUX A;  1HQ3 D;  4YS3 C;  3AV2 D;  4WU8 A;  3UTB B;  3AZI A;  5CPJ A;  5JA4 B;  5B2I B;  5BT1 C;  2PYO B;  1M18 A;  2BYM A;  3MVD C;  5AV9 C;  3A6N B;  1P3M C;  4JJN C;  3LJA C;  1P3O B;  1KX3 C;  1HQ3 A;  3AYW C;  3WAA D;  2BYK B;  4QLC C;  3B0D C;  3AV2 A;  4H9R A;  1KX4 B;  5BO0 B;  3X1S B;  5DNM B;  3AZM B;  5AV6 D;  1M19 C;  3REI B;  3W98 B;  1BH9 B;  3REH C;  5B24 D;  4HGA C;  4H9O B;  3WAA A;  3TU4 C;  3KUY A;  4R8P D;  5AV6 A;  2NQB D;  3AZN C;  3AZE C;  5B24 A;  3MVD B;  5AV9 B;  4JJN B;  5GSU A;  3X1V C;  3AYW B;  4WU8 C;  3AZI C;  5CPJ C;  4J8W D;  3B0D B;  5B31 D;  1P3F D;  1WWS A;  1M18 C;  4R8P A;  4KHA A;  3AFA A;  4H9N B;  2NQB A;  5AV8 B;  1F66 D;  1N1J B;  1HQ3 C;  3UTA D;  1B6W A;  2F8N G;  3AV2 C;  4J8W A;  3WKJ D;  3AZG B;  4KUD B;  4NE5 A;  1JFI A;  2NZD A;  4H9P B;  4NE6 A;  3UTA A;  3WAA C;  1B67 A;  4ZUX B;  3AZI B;  1M1A D;  5AV6 C;  1M18 B;  2BYM B;  5B24 C;  1AOI D;  2RVQ D;  5B33 D;  1HQ3 B;  4Z2M H;  3AV2 B;  4R8P C;  4LD9 A;  4H9R B;  1M1A A;  3NQU A;  4CSR A;  4Z5T A;  2NQB C;  4YM6 D;  3WAA B;  4J8W C;  5B31 C;  1P3F C;  3KUY B;  4UUZ A;  4E45 A;  3C1B A;  3MGP D;  4KGC D;  5B40 D;  1F66 C;  1F1E A;  5AV6 B;  5AVB D;  3UTA C;  1KX5 D;  3W97 D;  5B24 B;  4XZQ A;  4EO5 B;  5GT0 D;  3WKJ C;  5GSU B;  5JRG D;  2HIO B;  4X23 D;  3MGP A;  4R8P B;  4KGC A;  4KHA B;  5FUG A;  5B40 A;  3AFA B;  4J8X B;  1P3K D;  5CHL B;  5AVB A;  3MGR D;  1ZLA D;  2NQB B;  1KX5 A;  5GT0 A;  1P3L D;  5CP6 D;  5JRG A;  1M1A C;  4YS3 A;  4X23 A;  1ZLA A;  1P3K A;  3REL B;  1AOI C;  3V9R A;  2F8N B;  2RVQ C;  1P34 D;  1JFI B;  5CPK D;  3UT9 D;  2NZD B;  1Q9C A;  5B33 C;  1P3M A;  3UTA B;  1U35 D;  5CP6 A;  1KX3 A;  4QLC A;  4H9S C;  1P34 A;  1M19 A;  5CPK A;  3UT9 A;  4YM6 C;  5AV5 D;  5BNV B;  5CPI B;  3KXB B;  3TU4 A;  3MGP C;  4KGC C;  4LD9 B;  5B40 C;  1M1A B;  3NQU B;  4CSR B;  4Z5T B;  5B1L A;  5AVB C;  4DRB A;  1KX5 C;  4G91 C;  5GT0 C;  4CAY A;  1KU5 A;  4DRA A;  5JRG C;  4ZBJ C;  2CV5 D;  3X1V A;  4X23 C;  3WTP E;  1P3A D;  1ZLA C;  3B6F C;  4UUZ B;  1P3K C;  3MGR C;  3C1B B;  3LEL D;  1P3L C;  5CP6 C;  5B0Y D;  4XZQ B;  3AZH B;  4AWL C;  5GXQ B;  3X1U D;  1P3A A;  2FJ7 D;  4G92 C;  2CWE A;  3MGP B;  1P34 C;  4KGC B;  5B40 B;  5BS7 A;  3WTP D;  3UT9 C;  5B0Z D;  5CPK C;  5AVB B;  1KX5 B;  1U35 C;  3W99 D;  5GT0 B;  4WNN A;  3X1U A;  5JRG B;  4ZBJ B;  5AY8 D;  4YS3 B;  2FJ7 A;  4X23 B;  5B1L C;  1ZLA B;  3LZ0 D;  5B0Z A;  1P3K B;  3V9R B;  5AV5 C;  3W99 A;  1WWI A;  4E44 A;  1P3M B;  3LJA B;  5CP6 B;  1KX3 B;  3LZ1 D;  2F8N K;  5AVC D;  5AY8 A;  4QLC B;  3NQJ A;  4M6B A;  5E5A D;  1P34 B;  1M19 B;  4NE3 A;  5CPK B;  3REH B;  3AZF D;  1S32 D;  2CV5 C;  2HUE C;  4HGA B;  3LZ1 A;  1P3A C;  3AZK D;  5B31 A;  1P3F A;  3TU4 B;  3LEL C;  2YFV B;  5BS7 C;  5E5A A;  5B1L B;  3C1C D;  1F66 A;  5B0Y C;  2IO5 C;  3X1U C;  3AZE B;  3AZN B;  4CAY B;  5B2J D;  3AZK A;  3WKJ A;  2FJ7 C;  3X1V B;  4WU8 B;  5CPJ B;  3WTP C;  1ID3 D;  5B0Z C;  3C1C A;  3W99 C;  5B2J A;  5AY8 C;  2HUE B;  1P3A B;  1EQZ D;  3LZ0 C;  1AOI A;  3REJ D;  1P3I D;  2IO5 B;  5B33 A;  3LZ1 C;  5AVC C;  4WNN B;  3X1U B;  3MGS D;  5B1M D;  1BFM A;  1EQZ A;  3KWQ D;  3WA9 D;  5E5A C;  3B0B A;  3VH5 W;  2FJ7 B;  3B0C W;  3AZL D;  4H9S A;  5GT3 D;  5B0Z B;  3AN2 D;  3REJ A;  3MNN D;  3AZF C;  1S32 C;  1R4V A;  4YM6 A;  3W99 B;  3R45 A;  3AZK C;  2F8N H;  1TZY D;  5AY8 B;  3KWQ A;  2PYO D;  3AZL A;  3NQJ B;  3C1C C;  3W96 D;  5F99 D;  3MNN A;  3REK D;  3VH6 W;  3W97 A;  1H3O A;  5G49 A;  5B2J C;  1TZY A;  3LZ1 B;  4WU9 D;  1P3B D;  4J8W B;  1KX4 D;  1ID3 C;  5B31 B;  1P3F B;  3X1S D;  5DNM D;  3AZM D;  3B6F A;  3W96 A;  5F99 A;  5E5A B;  3MGR A;  3REK A;  3REI D;  3W98 D;  1F66 B;  1P3L A;  4WU9 A;  1P3B A;  3AZK B;  1KX4 A;  1EQZ C;  3WKJ B;  5DNM A;  3AZM A;  4J8V D;  3REJ C;  3REI A;  3W98 A;  1P3I C;  5B32 D;  1U35 A;  3VH5 T;  3B0C T;  5B1M C;  3MGS C;  5B2J B;  3KWQ C;  3WA9 C;  3AZL C;  4J8V A;  5GT3 C;  3AN2 C;  3MNN C;  3W97 C;  5AV8 D;  1AOI B;  1BH8 A;  5B32 A;  1TZY C;  5AV5 A;  5B33 B;  5KDM A;  3VH6 T;  2PYO C;  5BNX A;  2JSS A;  3MGQ D;  3AZG D;  3W96 C;  1EQZ B;  5F99 C;  4KUD D;  3REK C;  1P3G D;  3REJ B;  4XUJ D;  3AV1 D;  4ZUX D;  4YM6 B;  4WU9 C;  3R45 B;  1P3B C;  1KX4 C;  2CV5 A;  3X1S C;  5DNM C;  3MGQ A;  3AZM C;  3KWQ B;  3KSY A;  3REI C;  3AZL B;  3LEL A;  3W98 C;  5FUG B;  2ARO D;  1P3G A;  4XUJ A;  3W97 B;  1H3O B;  5B0Y A;  3AV1 A;  4G91 B;  5G49 B;  1TZY B;  4J8V C;  3WTP A;  3B6F B;  3W96 B;  2ARO A;  5F99 B;  3MGR B;  3REK B;  5B32 C;  1P3P D;  3O62 D;  1P3L B;  4AWL B;  4WU9 B;  2YFW A;  3KUY D;  1P3B B;  4Z66 D;  5AV8 C;  3LZ0 A;  1A7W A;  5B31 G;  4G92 B;  1P3P A;  3UT9 B;  3O62 A;  1U35 B;  5GSU D;  4Z2M G;  5AVC A;  3MGQ C;  3AZG C;  2HIO D;  4KUD C;  4Z66 A;  4J8V B;  3AFA D;  1TAF A;  4J8X D;  1P3G C;  4NFT A;  4XUJ C;  4J8U D;  3AV1 C;  4ZUX C;  3X1T D;  1BH8 B;  3AZF A;  1S32 A;  5B32 B;  5AV5 B;  2HIO A;  5KDM B;  5BNX B;  2ARO C;  4J8X A;  3REL D;  2F8N D;  4J8U A;  2NZD D;  3X1T A;  4H9Q A;  2CV5 B;  4WZS B;  5C3I C;  3MGQ B;  4WV4 B;  1ID3 A; 
#chains in the Genus database with same CATH topology
 3REL A;  2F8N A;  3LEL B;  1P3P C;  1P3G B;  4XUJ B;  3O62 C;  2VQR A;  5B0Y B;  3AZJ D;  2Y2K A;  3AV1 B;  3KUY C;  2ZY3 A;  5CPI D;  3KXB D;  4Z66 C;  4LD9 D;  3H0R C;  4Z5T D;  3WTP B;  3B6G D;  5DNN D;  2ARO B;  3B6F D;  4EO5 C;  3AZJ A;  1P3I A;  2DQN C;  5GSU C;  5BNV A;  2HIO C;  3VH5 A;  3MGS A;  5B1M A;  5CPI A;  3KXB A;  3UTB D;  2YFW B;  3AFA C;  5B2I D;  4J8X C;  3WA9 A;  5C3I B;  2Y2Q A;  3C1B D;  3B6G A;  5DNN A;  5GT3 A;  3LZ0 B;  4J8U C;  3AN2 A;  3X1T C;  3A6N D;  1P3O D;  1P3P B;  3AZH D;  4XZQ D;  5GXQ D;  3O62 B;  5AVC B;  3UTB A;  5JA4 A;  5B2I A;  2PYO A;  3VH6 A;  3REL C;  4Z66 B;  1TAF B;  2NZD C;  3A6N A;  1P3O A;  3AZH A;  5GXQ A;  2BYK A;  3AZF B;  1S32 B;  3EPK A;  1PZR A;  2UWX A;  5BO0 A;  3X1S A;  4YS3 D;  5BT1 D;  3C1C B;  1BH9 A;  4J8U B;  3AZJ C;  3MVD D;  5AV9 D;  4H9O A;  3X1T B;  2LY8 A;  1P3M D;  4JJN D;  3LJA D;  4H9Q B;  5CPI C;  1KX3 D;  3KXB C;  3AYW D;  4QLC D;  4LD9 C;  5B32 G;  4Z5T C;  1ID3 B;  5DNN C;  3B6G C;  1W2E A;  3MVD A;  1M19 D;  5AV9 A;  4JJN A;  3LJA A;  3REH D;  3AYW A;  3UTB C;  5B2I C;  3C1B C;  3TU4 D;  4H9N A;  3A6N C;  5B1L D;  5AV8 A;  1P3O C;  1N1J A;  3AZH C;  4XZQ C;  1HTA A;  5GXQ C;  3REH A;  3AZN D;  3AZE D;  3AZJ B;  1P3I B;  3MGS B;  5B1M B;  3X1V D;  4WU8 D;  3F6T A;  5CPJ D;  1ULY A;  3AZG A;  3AZI D;  2YFV A;  3WA9 B;  4KUD A;  1M18 D;  3B6G B;  5DNN B;  4H9P A;  5GT3 B;  4DQY B;  3AN2 B;  3MNN B;  3AZN A;  2L5A A;  3AZE A;  4ZUX A;  2FFF B;  1HQ3 D;  4YS3 C;  3AV2 D;  4WU8 A;  3UTB B;  3AZI A;  5CPJ A;  5JA4 B;  5B2I B;  5BT1 C;  2PYO B;  1M18 A;  2BYM A;  3P5J B;  3MVD C;  5AV9 C;  3A6N B;  1P3M C;  4JJN C;  3LJA C;  1P3O B;  1KX3 C;  1HQ3 A;  3AYW C;  3WAA D;  2BYK B;  4QLC C;  3B0D C;  3AV2 A;  4H9R A;  1KX4 B;  2G5I C;  2ZY2 A;  5BO0 B;  3X1S B;  5DNM B;  1Z2C B;  3AZM B;  5AV6 D;  1M19 C;  3REI B;  3W98 B;  1BH9 B;  3REH C;  5B24 D;  4HGA C;  4H9O B;  3WAA A;  3H0M C;  2Y2I A;  3TU4 C;  3KUY A;  1T3U A;  3A1K A;  4R8P D;  5AV6 A;  2NQB D;  3AZN C;  3AZE C;  5B24 A;  3MVD B;  5AV9 B;  4WJ3 C;  4JJN B;  5GSU A;  3X1V C;  3AYW B;  4WU8 C;  3AZI C;  5CPJ C;  4J8W D;  3B0D B;  2JCH A;  5B31 D;  1WWS A;  1P3F D;  1M18 C;  4R8P A;  4KHA A;  3AFA A;  4H9N B;  2NQB A;  5AV8 B;  1F66 D;  1N1J B;  1HQ3 C;  3UTA D;  1B6W A;  2F8N G;  3AV2 C;  4J8W A;  3WKJ D;  3AZG B;  4KUD B;  4NE5 A;  1JFI A;  2NZD A;  4H9P B;  4NE6 A;  3UTA A;  3WAA C;  1B67 A;  4ZUX B;  2ZY4 A;  3A1I A;  3AZI B;  1M1A D;  5AV6 C;  1M18 B;  2BYM B;  5B24 C;  1AOI D;  2RVQ D;  5B33 D;  1HQ3 B;  4Z2M H;  3AV2 B;  4R8P C;  4LD9 A;  4H9R B;  1M1A A;  3NQU A;  4CSR A;  4Z5T A;  2NQB C;  4YM6 D;  3WAA B;  4J8W C;  5B31 C;  1P3F C;  3KUY B;  3H0L C;  4UUZ A;  4E45 A;  3C1B A;  3MGP D;  4KGC D;  5B40 D;  1F66 C;  1F1E A;  5AV6 B;  5AVB D;  3UTA C;  1KX5 D;  3W97 D;  5B24 B;  4XZQ A;  2Y2M A;  4EO5 B;  5GT0 D;  3WKJ C;  5GSU B;  5JRG D;  2HIO B;  4X23 D;  3MGP A;  4R8P B;  4KGC A;  4KHA B;  5FUG A;  5B40 A;  3AFA B;  4J8X B;  1P3K D;  5CHL B;  5AVB A;  3MGR D;  1ZLA D;  2NQB B;  1KX5 A;  5GT0 A;  1P3L D;  5CP6 D;  5JRG A;  1M1A C;  4YS3 A;  4X23 A;  1ZLA A;  1P3K A;  3REL B;  2Y2N A;  1AOI C;  3V9R A;  2F8N B;  2RVQ C;  1P34 D;  1JFI B;  5CPK D;  3UT9 D;  2NZD B;  1Q9C A;  2Y2J A;  5B33 C;  3UTA B;  1P3M A;  1U35 D;  5CP6 A;  1KX3 A;  3KFU G;  4QLC A;  4H9S C;  1P34 A;  1M19 A;  5CPK A;  3UT9 A;  4YM6 C;  2XD1 A;  5AV5 D;  5BNV B;  5CPI B;  3KXB B;  3TU4 A;  3MGP C;  4KGC C;  4LD9 B;  5B40 C;  1M1A B;  3NQU B;  4CSR B;  2Y2L A;  5B1L A;  4Z5T B;  5AVB C;  4DRB A;  1KX5 C;  4G91 C;  5GT0 C;  2F2A C;  4CAY A;  1KU5 A;  4DRA A;  5JRG C;  4ZBJ C;  2CV5 D;  3X1V A;  4X23 C;  3WTP E;  1P3A D;  1ZLA C;  3B6F C;  4UUZ B;  1P3K C;  3MGR C;  3C1B B;  3LEL D;  1P3L C;  5CP6 C;  5B0Y D;  4XZQ B;  3AZH B;  4AWL C;  5GXQ B;  3X1U D;  1P3A A;  2FJ7 D;  4G92 C;  2CWE A;  3MGP B;  1P34 C;  4KGC B;  5B40 B;  5BS7 A;  3WTP D;  3UT9 C;  5B0Z D;  5CPK C;  5AVB B;  1KX5 B;  1U35 C;  3W99 D;  5GT0 B;  4WNN A;  3X1U A;  2XD5 A;  5JRG B;  4ZBJ B;  5AY8 D;  4YS3 B;  2FJ7 A;  4X23 B;  5B1L C;  1ZLA B;  3LZ0 D;  5B0Z A;  1P3K B;  3V9R B;  5AV5 C;  3W99 A;  1WWI A;  4E44 A;  1P3M B;  3LJA B;  3EPL A;  5CP6 B;  2W8S A;  1KX3 B;  3LZ1 D;  2F8N K;  5AVC D;  5AY8 A;  4QLC B;  3NQJ A;  4M6B A;  5E5A D;  2J8P A;  1P34 B;  1M19 B;  4NE3 A;  5CPK B;  3REH B;  3AZF D;  1S32 D;  2CV5 C;  2HUE C;  4HGA B;  3LZ1 A;  1P3A C;  3AZK D;  5B31 A;  1P3F A;  3TU4 B;  3LEL C;  2YFV B;  5BS7 C;  5E5A A;  5B1L B;  3C1C D;  1F66 A;  5B0Y C;  2IO5 C;  2G5H C;  3X1U C;  3AZE B;  3AZN B;  4CAY B;  5B2J D;  3AZK A;  3WKJ A;  2FJ7 C;  3X1V B;  4WU8 B;  5CPJ B;  3WTP C;  1ID3 D;  5B0Z C;  2JE5 A;  3C1C A;  3W99 C;  5B2J A;  5AY8 C;  2HUE B;  1P3A B;  1EQZ D;  3LZ0 C;  2DF4 C;  1AOI A;  3REJ D;  1P3I D;  2IO5 B;  5B33 A;  3LZ1 C;  5AVC C;  4WNN B;  3X1U B;  3MGS D;  5B1M D;  1BFM A;  1EQZ A;  3KWQ D;  3WA9 D;  5E5A C;  3B0B A;  3VH5 W;  2FJ7 B;  3B0C W;  3AZL D;  4H9S A;  5GT3 D;  5B0Z B;  3AN2 D;  3REJ A;  3MNN D;  3AZF C;  1S32 C;  1R4V A;  4YM6 A;  3W99 B;  3R45 A;  3AZK C;  2F8N H;  1TZY D;  5AY8 B;  3KWQ A;  2PYO D;  3AZL A;  2Y2H A;  3NQJ B;  3C1C C;  3W96 D;  5F99 D;  3MNN A;  3REK D;  3VH6 W;  3W97 A;  1H3O A;  5G49 A;  5B2J C;  1TZY A;  3LZ1 B;  4WU9 D;  1P3B D;  4J8W B;  1KX4 D;  1ID3 C;  5B31 B;  1P3F B;  3X1S D;  5DNM D;  3AZM D;  3B6F A;  3W96 A;  3EG5 B;  5F99 A;  5E5A B;  3MGR A;  3REK A;  3REI D;  3W98 D;  1F66 B;  1P3L A;  2Y2P A;  4WU9 A;  1P3B A;  3AZK B;  1KX4 A;  1EQZ C;  3WKJ B;  3AL0 C;  5DNM A;  3AZM A;  4J8V D;  3REJ C;  3REI A;  3W98 A;  1P3I C;  5B32 D;  1U35 A;  3VH5 T;  3B0C T;  5B1M C;  3MGS C;  5B2J B;  3KWQ C;  2ZM5 A;  3WA9 C;  3AZL C;  4J8V A;  5GT3 C;  3AN2 C;  3MNN C;  3W97 C;  5AV8 D;  1AOI B;  1BH8 A;  5B32 A;  1TZY C;  5AV5 A;  5B33 B;  5KDM A;  3VH6 T;  2PYO C;  5BNX A;  3EPH A;  2JSS A;  3MGQ D;  3IP4 C;  3AZG D;  3W96 C;  1EQZ B;  5F99 C;  4KUD D;  3REK C;  1P3G D;  3REJ B;  4XUJ D;  3AV1 D;  4ZUX D;  4YM6 B;  3FDD A;  4WU9 C;  3R45 B;  1P3B C;  1KX4 C;  2CV5 A;  3X1S C;  5DNM C;  3MGQ A;  3AZM C;  3KWQ B;  3KSY A;  3REI C;  3AZL B;  3LEL A;  2RIQ A;  3W98 C;  5FUG B;  2ARO D;  1P3G A;  4XUJ A;  3W97 B;  1H3O B;  5B0Y A;  3AV1 A;  4G91 B;  5G49 B;  1TZY B;  4J8V C;  3EPJ A;  3WTP A;  3B6F B;  3W96 B;  2ARO A;  5F99 B;  3MGR B;  3REK B;  5B32 C;  1P3P D;  2Y2G A;  3O62 D;  1P3L B;  4AWL B;  4WU9 B;  2YFW A;  3KUY D;  1P3B B;  4Z66 D;  5AV8 C;  3LZ0 A;  1A7W A;  5B31 G;  4G92 B;  1P3P A;  3UT9 B;  3O62 A;  1U35 B;  5GSU D;  4Z2M G;  5AVC A;  3MGQ C;  3AZG C;  2HIO D;  4KUD C;  4Z66 A;  4J8V B;  3AFA D;  1TAF A;  2ZY5 A;  4J8X D;  1P3G C;  4NFT A;  2Y2O A;  4XUJ C;  4J8U D;  3AV1 C;  4ZUX C;  3X1T D;  1BH8 B;  3AZF A;  1S32 A;  5B32 B;  5AV5 B;  2HIO A;  5KDM B;  5BNX B;  2ARO C;  4J8X A;  4UPK A;  3REL D;  2F8N D;  4J8U A;  2NZD D;  3X1T A;  2BG1 A;  4H9Q A;  2CV5 B;  4WZS B;  5C3I C;  3MGQ B;  4WV4 B;  1ID3 A; 
#chains in the Genus database with same CATH homology
 3REL A;  2F8N A;  3LEL B;  1P3P C;  1P3G B;  4XUJ B;  3O62 C;  2VQR A;  5B0Y B;  3AZJ D;  2Y2K A;  3AV1 B;  3KUY C;  2ZY3 A;  5CPI D;  3KXB D;  4Z66 C;  4LD9 D;  3H0R C;  4Z5T D;  3WTP B;  3B6G D;  5DNN D;  2ARO B;  3B6F D;  4EO5 C;  3AZJ A;  1P3I A;  2DQN C;  5GSU C;  5BNV A;  2HIO C;  3VH5 A;  3MGS A;  5B1M A;  5CPI A;  3KXB A;  3UTB D;  2YFW B;  3AFA C;  5B2I D;  4J8X C;  3WA9 A;  5C3I B;  2Y2Q A;  3C1B D;  3B6G A;  5DNN A;  5GT3 A;  3LZ0 B;  4J8U C;  3AN2 A;  3X1T C;  3A6N D;  1P3O D;  1P3P B;  3AZH D;  4XZQ D;  5GXQ D;  3O62 B;  5AVC B;  3UTB A;  5JA4 A;  5B2I A;  2PYO A;  3VH6 A;  3REL C;  4Z66 B;  1TAF B;  2NZD C;  3A6N A;  1P3O A;  3AZH A;  5GXQ A;  2BYK A;  3AZF B;  1S32 B;  3EPK A;  1PZR A;  2UWX A;  5BO0 A;  3X1S A;  4YS3 D;  5BT1 D;  3C1C B;  1BH9 A;  4J8U B;  3AZJ C;  3MVD D;  5AV9 D;  4H9O A;  3X1T B;  2LY8 A;  1P3M D;  4JJN D;  3LJA D;  4H9Q B;  5CPI C;  1KX3 D;  3KXB C;  3AYW D;  4QLC D;  4LD9 C;  5B32 G;  4Z5T C;  1ID3 B;  5DNN C;  3B6G C;  1W2E A;  3MVD A;  1M19 D;  5AV9 A;  4JJN A;  3LJA A;  3REH D;  3AYW A;  3UTB C;  5B2I C;  3C1B C;  3TU4 D;  4H9N A;  3A6N C;  5B1L D;  5AV8 A;  1P3O C;  1N1J A;  3AZH C;  4XZQ C;  1HTA A;  5GXQ C;  3REH A;  3AZN D;  3AZE D;  3AZJ B;  1P3I B;  3MGS B;  5B1M B;  3X1V D;  4WU8 D;  3F6T A;  5CPJ D;  1ULY A;  3AZG A;  3AZI D;  2YFV A;  3WA9 B;  4KUD A;  1M18 D;  3B6G B;  5DNN B;  4H9P A;  5GT3 B;  4DQY B;  3AN2 B;  3MNN B;  3AZN A;  2L5A A;  3AZE A;  4ZUX A;  2FFF B;  1HQ3 D;  4YS3 C;  3AV2 D;  4WU8 A;  3UTB B;  3AZI A;  5CPJ A;  5JA4 B;  5B2I B;  5BT1 C;  2PYO B;  1M18 A;  2BYM A;  3P5J B;  3MVD C;  5AV9 C;  3A6N B;  1P3M C;  4JJN C;  3LJA C;  1P3O B;  1KX3 C;  1HQ3 A;  3AYW C;  3WAA D;  2BYK B;  4QLC C;  3B0D C;  3AV2 A;  4H9R A;  1KX4 B;  2G5I C;  2ZY2 A;  5BO0 B;  3X1S B;  5DNM B;  1Z2C B;  3AZM B;  5AV6 D;  1M19 C;  3REI B;  3W98 B;  1BH9 B;  3REH C;  5B24 D;  4HGA C;  4H9O B;  3WAA A;  3H0M C;  2Y2I A;  3TU4 C;  3KUY A;  1T3U A;  3A1K A;  4R8P D;  5AV6 A;  2NQB D;  3AZN C;  3AZE C;  5B24 A;  3MVD B;  5AV9 B;  4WJ3 C;  4JJN B;  5GSU A;  3X1V C;  3AYW B;  4WU8 C;  3AZI C;  5CPJ C;  4J8W D;  3B0D B;  2JCH A;  5B31 D;  1WWS A;  1P3F D;  1M18 C;  4R8P A;  4KHA A;  3AFA A;  4H9N B;  2NQB A;  5AV8 B;  1F66 D;  1N1J B;  1HQ3 C;  3UTA D;  1B6W A;  2F8N G;  3AV2 C;  4J8W A;  3WKJ D;  3AZG B;  4KUD B;  4NE5 A;  1JFI A;  2NZD A;  4H9P B;  4NE6 A;  3UTA A;  3WAA C;  1B67 A;  4ZUX B;  2ZY4 A;  3A1I A;  3AZI B;  1M1A D;  5AV6 C;  1M18 B;  2BYM B;  5B24 C;  1AOI D;  2RVQ D;  5B33 D;  1HQ3 B;  4Z2M H;  3AV2 B;  4R8P C;  4LD9 A;  4H9R B;  1M1A A;  3NQU A;  4CSR A;  4Z5T A;  2NQB C;  4YM6 D;  3WAA B;  4J8W C;  5B31 C;  1P3F C;  3KUY B;  3H0L C;  4UUZ A;  4E45 A;  3C1B A;  3MGP D;  4KGC D;  5B40 D;  1F66 C;  1F1E A;  5AV6 B;  5AVB D;  3UTA C;  1KX5 D;  3W97 D;  5B24 B;  4XZQ A;  2Y2M A;  4EO5 B;  5GT0 D;  3WKJ C;  5GSU B;  5JRG D;  2HIO B;  4X23 D;  3MGP A;  4R8P B;  4KGC A;  4KHA B;  5FUG A;  5B40 A;  3AFA B;  4J8X B;  1P3K D;  5CHL B;  5AVB A;  3MGR D;  1ZLA D;  2NQB B;  1KX5 A;  5GT0 A;  1P3L D;  5CP6 D;  5JRG A;  1M1A C;  4YS3 A;  4X23 A;  1ZLA A;  1P3K A;  3REL B;  2Y2N A;  1AOI C;  3V9R A;  2F8N B;  2RVQ C;  1P34 D;  1JFI B;  5CPK D;  3UT9 D;  2NZD B;  1Q9C A;  2Y2J A;  5B33 C;  3UTA B;  1P3M A;  1U35 D;  5CP6 A;  1KX3 A;  3KFU G;  4QLC A;  4H9S C;  1P34 A;  1M19 A;  5CPK A;  3UT9 A;  4YM6 C;  2XD1 A;  5AV5 D;  5BNV B;  5CPI B;  3KXB B;  3TU4 A;  3MGP C;  4KGC C;  4LD9 B;  5B40 C;  1M1A B;  3NQU B;  4CSR B;  2Y2L A;  5B1L A;  4Z5T B;  5AVB C;  4DRB A;  1KX5 C;  4G91 C;  5GT0 C;  2F2A C;  4CAY A;  1KU5 A;  4DRA A;  5JRG C;  4ZBJ C;  2CV5 D;  3X1V A;  4X23 C;  3WTP E;  1P3A D;  1ZLA C;  3B6F C;  4UUZ B;  1P3K C;  3MGR C;  3C1B B;  3LEL D;  1P3L C;  5CP6 C;  5B0Y D;  4XZQ B;  3AZH B;  4AWL C;  5GXQ B;  3X1U D;  1P3A A;  2FJ7 D;  4G92 C;  2CWE A;  3MGP B;  1P34 C;  4KGC B;  5B40 B;  5BS7 A;  3WTP D;  3UT9 C;  5B0Z D;  5CPK C;  5AVB B;  1KX5 B;  1U35 C;  3W99 D;  5GT0 B;  4WNN A;  3X1U A;  2XD5 A;  5JRG B;  4ZBJ B;  5AY8 D;  4YS3 B;  2FJ7 A;  4X23 B;  5B1L C;  1ZLA B;  3LZ0 D;  5B0Z A;  1P3K B;  3V9R B;  5AV5 C;  3W99 A;  1WWI A;  4E44 A;  1P3M B;  3LJA B;  3EPL A;  5CP6 B;  2W8S A;  1KX3 B;  3LZ1 D;  2F8N K;  5AVC D;  5AY8 A;  4QLC B;  3NQJ A;  4M6B A;  5E5A D;  2J8P A;  1P34 B;  1M19 B;  4NE3 A;  5CPK B;  3REH B;  3AZF D;  1S32 D;  2CV5 C;  2HUE C;  4HGA B;  3LZ1 A;  1P3A C;  3AZK D;  5B31 A;  1P3F A;  3TU4 B;  3LEL C;  2YFV B;  5BS7 C;  5E5A A;  5B1L B;  3C1C D;  1F66 A;  5B0Y C;  2IO5 C;  2G5H C;  3X1U C;  3AZE B;  3AZN B;  4CAY B;  5B2J D;  3AZK A;  3WKJ A;  2FJ7 C;  3X1V B;  4WU8 B;  5CPJ B;  3WTP C;  1ID3 D;  5B0Z C;  2JE5 A;  3C1C A;  3W99 C;  5B2J A;  5AY8 C;  2HUE B;  1P3A B;  1EQZ D;  3LZ0 C;  2DF4 C;  1AOI A;  3REJ D;  1P3I D;  2IO5 B;  5B33 A;  3LZ1 C;  5AVC C;  4WNN B;  3X1U B;  3MGS D;  5B1M D;  1BFM A;  1EQZ A;  3KWQ D;  3WA9 D;  5E5A C;  3B0B A;  3VH5 W;  2FJ7 B;  3B0C W;  3AZL D;  4H9S A;  5GT3 D;  5B0Z B;  3AN2 D;  3REJ A;  3MNN D;  3AZF C;  1S32 C;  1R4V A;  4YM6 A;  3W99 B;  3R45 A;  3AZK C;  2F8N H;  1TZY D;  5AY8 B;  3KWQ A;  2PYO D;  3AZL A;  2Y2H A;  3NQJ B;  3C1C C;  3W96 D;  5F99 D;  3MNN A;  3REK D;  3VH6 W;  3W97 A;  1H3O A;  5G49 A;  5B2J C;  1TZY A;  3LZ1 B;  4WU9 D;  1P3B D;  4J8W B;  1KX4 D;  1ID3 C;  5B31 B;  1P3F B;  3X1S D;  5DNM D;  3AZM D;  3B6F A;  3W96 A;  3EG5 B;  5F99 A;  5E5A B;  3MGR A;  3REK A;  3REI D;  3W98 D;  1F66 B;  1P3L A;  2Y2P A;  4WU9 A;  1P3B A;  3AZK B;  1KX4 A;  1EQZ C;  3WKJ B;  3AL0 C;  5DNM A;  3AZM A;  4J8V D;  3REJ C;  3REI A;  3W98 A;  1P3I C;  5B32 D;  1U35 A;  3VH5 T;  3B0C T;  5B1M C;  3MGS C;  5B2J B;  3KWQ C;  2ZM5 A;  3WA9 C;  3AZL C;  4J8V A;  5GT3 C;  3AN2 C;  3MNN C;  3W97 C;  5AV8 D;  1AOI B;  1BH8 A;  5B32 A;  1TZY C;  5AV5 A;  5B33 B;  5KDM A;  3VH6 T;  2PYO C;  5BNX A;  3EPH A;  2JSS A;  3MGQ D;  3IP4 C;  3AZG D;  3W96 C;  1EQZ B;  5F99 C;  4KUD D;  3REK C;  1P3G D;  3REJ B;  4XUJ D;  3AV1 D;  4ZUX D;  4YM6 B;  3FDD A;  4WU9 C;  3R45 B;  1P3B C;  1KX4 C;  2CV5 A;  3X1S C;  5DNM C;  3MGQ A;  3AZM C;  3KWQ B;  3KSY A;  3REI C;  3AZL B;  3LEL A;  2RIQ A;  3W98 C;  5FUG B;  2ARO D;  1P3G A;  4XUJ A;  3W97 B;  1H3O B;  5B0Y A;  3AV1 A;  4G91 B;  5G49 B;  1TZY B;  4J8V C;  3EPJ A;  3WTP A;  3B6F B;  3W96 B;  2ARO A;  5F99 B;  3MGR B;  3REK B;  5B32 C;  1P3P D;  2Y2G A;  3O62 D;  1P3L B;  4AWL B;  4WU9 B;  2YFW A;  3KUY D;  1P3B B;  4Z66 D;  5AV8 C;  3LZ0 A;  1A7W A;  5B31 G;  4G92 B;  1P3P A;  3UT9 B;  3O62 A;  1U35 B;  5GSU D;  4Z2M G;  5AVC A;  3MGQ C;  3AZG C;  2HIO D;  4KUD C;  4Z66 A;  4J8V B;  3AFA D;  1TAF A;  2ZY5 A;  4J8X D;  1P3G C;  4NFT A;  2Y2O A;  4XUJ C;  4J8U D;  3AV1 C;  4ZUX C;  3X1T D;  1BH8 B;  3AZF A;  1S32 A;  5B32 B;  5AV5 B;  2HIO A;  5KDM B;  5BNX B;  2ARO C;  4J8X A;  4UPK A;  3REL D;  2F8N D;  4J8U A;  2NZD D;  3X1T A;  2BG1 A;  4H9Q A;  2CV5 B;  4WZS B;  5C3I C;  3MGQ B;  4WV4 B;  1ID3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...