2CV5A

Crystal structure of human nucleosome core particle
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Alteration of the nucleosomal DNA path in the crystal structure of a human nucleosome core particle
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2cv5A00
3WKJC 3R45B 4J8WB 3AZIB 5AV8B 1P34C 3AZJA 5B32G 2CV5D 1M1AA 1P34D 3A6ND 5CHLB 3V9RA 3MGSC 3MNNA 2PYOD 1M1AC 5AVCD 1M18A 3AZJD 3MNNC 3KUYA 5B0YB 4ZUXA 3LZ0D 5CPKB 5AY8D 3MNND 5JA4A 3KUYC 3MGRD 1M18D 3UTBC 4ZUXC 5F99A 2CV5B 1KX4D 4H9QB 1P34B 5F99C 3UT9A 3REKC 4H9NA 5AVCB 4G91C 3UT9C 3AZJB 4M6BA 4DRAA 1R4VA 3LZ0B 5AY8B 3MNNB 3MGRB 1P3FA 5B40D 1M18B 3REIA 1KX4B 2FJ7A 3AN2A 4UUZB 3AV1D 3REIC 5E5AC 5JA4B 2NZDA 5B1MC 3MGPA 1P3FD 2FJ7C 3AN2C 3WAAD 3REID 4HGAC 5CPJD 1EQZA 2NZDC 3MGPC 2FJ7D 4G91B 4NE5A 4X23C 5B0ZC 3C1BA 1EQZC 1KX3C 4H9NB 5C3IC 3KXBA 5B40B 4Z66D 3WTPC 3W98D 3C1BC 1EQZD 1BFMA 3KXBC 5B31A 4J8UC 3AV1B 3KSYA 3KXBD 5B31C 1P3FB 3WAAB 4YM6D 3NQJA 4XUJA 3REIB 1U35A 3AZGA 1P3OD 2FJ7B 4AWLC 1U35C 1H3OA 5AVBA 1P3PD 3AZGC 4XUJD 4Z66B 2AROA 3W98B 4H9SA 1EQZB 5AVBC 3AZGD 3AZKA 4CAYA 2RVQD 3AZEC 4KGCA 4H9SC 3AZMD 1ZLAA 3KXBB 1P3BA 3AZKC 2HIOC 4YM6B 4KGCC 2AROD 1ZLAC 3LZ1A 3AFAA 1P3OB 5AV5C 1BH8A 1AOIA 5CPIA 1P3BD 3LZ1C 1P3PB 5B33A 4AWLB 4XUJB 1AOIC 3W97A 5CPIC 5B1LA 3AFAD 3AZGB 4JJNA 5B33C 4H9RA 1AOID 3W97C 5B1LC 2F8NK 3AZMB 4QLCA 5BO0A 2AROB 3KWQA 3W97D 4JJND 4LD9A 5FUGA 3X1SD 3RELD 4E45A 3KWQC 5GT3A 4QLCD 1P3BB 1WWSA 4LD9C 2BYMB 3AZLD 1HQ3A 4Z5TD 3R45A 4YS3A 5GT3C 3AFAB 1BH8B 1HQ3C 1AOIB 4WV4B 3AZIC 1HQ3D 3W97B 4YS3D 4JJNB 5B2ID 4H9RB 3X1SB 2IO5B 5B0YA 4QLCB 5CPKA 3AZLB 4Z5TB 5B0YC 5CP6A 3X1VD 2BYKA 5FUGB 5CPKC 5B31G 3LJAD 2CV5A 5CP6C 3A6NA 2F8NH 2CV5C 2PYOA 1HQ3B 5CP6D 5AVCA 4YS3B 3A6NC 5BNXA 5B2IB 2PYOC 5AVCC 3LZ0A 3AZJC 5AY8A 3MGRA 3LZ0C 3X1TD 5AY8C 1HTAA 3LJAB 1KX4A 1B67A 3MGRC 1M18C 4UUZA 4EO5B 1KX4C 3MGQA 5CP6B 3VH6A 2BYKB 4WU9D 1BH9A 1TAFB 4WNNA 3A6NB 4KUDD 2PYOB 4J8VA 3B6FD 3MGQD 5B40A 5BNXB 3X1TB 4J8VC 5B40C 3AV1A 1S32A 4J8VD 3REHD 3AZHA 3WAAA 3AV1C 1TZYD 4WU9B 5CPJA 3AZHC 1P3FC 3WAAC 1S32D 4KUDB 4H9PB 3B0BA 3AZHD 5CPJC 3MGQB 3B6FB 3MVDA 3WTPE 4Z66A 3W98A 1BH9B 5GSUA 3MVDC 4WNNB 1P3LA 4Z66C 3VH5A 3W98C 4J8VB 3REHB 3AV2D 3MVDD 5GT0A 4YM6A 1TZYB 3W99D 5GSUD 1P3AA 1P3OA 1P3LD 4YM6C 1S32B 1P3MD 3AZHB 1P3PA 1N1JB 1P3AC 1P3OC 4J8XD 5GT0D 5CPJB 3AZNA 1P3AD 1P3PC 4XUJC 3NQUA 3B6GD 3AZMA 3AV2B 3MVDB 2RVQC 3AZND 3AZMC 3W99B 5GSUB 3REJA 1P3LB 1P3MB 2AROC 5DNMD 4J8XB 5GT0B 2BYMA 5AV6A 3LELD 1ID3D 3REJD 1P3BC 1P3AB 3X1UA 3B6GB 3AFAC 1A7WA 3X1UC 1JFIA 5AV6D 3AZNB 3X1SA 3NQUB 3X1UD 5DNMB 3RELA 4XZQA 4JJNC 1P3IA 3RELC 2IO5C 3AZLA 3X1SC 4Z5TA 5AV9D 3LELB 1ID3B 4QLCC 3REJB 4XZQC 3AZLC 5JRGD 4Z5TC 4ZBJB 4XZQD 1P3ID 4NFTA 2CWEA 5AV6B 4NE3A 5B2JD 2HUEB 5B2IA 4CSRB 3X1UB 1P3GA 4YS3C 2LY8A 5B2IC 5GXQD 1JFIB 5AV9B 3X1VA 4WU8D 4R8PA 5B24A 3AZFD 3LJAA 3RELB 1P3GD 1KX5A 3X1VC 5G49A 4R8PC 4XZQB 1P3IB 1KU5A 3LJAC 1P3KA 1KX5C 4R8PD 5B2JB 5B24D 1F66A 4EO5C 3C1CD 1TAFA 1KX5D 1F66C 3W96D 3O62A 5GXQB 1P3KD 3TU4D 5KDMA 4WU8B 1F66D 3VH6W 3X1TA 3AZFB 1P3GB 3AYWA 3X1TC 3O62D 5DNND 3AYWC 3X1VB 4R8PB 5B24B 3C1CB 4WU9A 4Z2MG 1KX5B 3AYWD 5G49B 3WA9D 4KUDA 3W96B 4H9PA 4WU9C 3VH6T 1P3KB 2F8ND 3B6FA 2NQBD 1F66B 4KUDC 3B6FC 3MGQC 5BT1D 1M19D 3MGSA 3O62B 3WKJD 3REHA 5DNNB 5KDMB 1TZYA 5BS7A 3REHC 3AYWB 3WA9B 1TZYC 3MGSD 5BS7C 2L5AA 3VH5W 1M1AD 2F8NB 1N1JA 3UTBA 2NQBB 4H9OB 1S32C 1M19B 3REKA 3KUYD 5BNVA 3WKJB 3AV2A 3UTBD 4ZUXD 3AV2C 3W99A 3VH5T 5F99D 1P3MA 2JSSA 3MGSB 3REKD 1M1AB 4KHAA 3W99C 5GSUC 3UT9D 4J8XA 1P3LC 3V9RB 1P3MC 4J8XC 5GT0C 3B6GA 5E5AA 3KUYB 5B1MA 3UTBB 4ZUXB 3B6GC 5F99B 1B6WA 4X23A 5B0ZA 5E5AD 1F1EA 5DNMA 3REKB 5BNVB 5B1MD 3AZNC 1KX3A 3UTAA 3AN2D 3UT9B 3WTPA 5DNMC 2NZDD 3LELA 3MGPD 1ID3A 4J8UA 3UTAC 4X23D 5B0ZD 3LELC 4KHAB 1KX3D 1ID3C 3REJC 3UTAD 2F8NG 3B0DC 3WTPD 3C1BD 3B0CW 4J8UD 4ZBJC 4CSRA 4Z2MH 5E5AB 5AV6C 5B1MB 5B32A 5B31D 2HUEC 3AN2B 1WWIA 5AV9A 4HGAB 2NZDB 3MGPB 5B32C 3AZEA 4X23B 5B0ZB 1U35D 5JRGA 5AV9C 1KX3B 5B32D 5C3IB 3UTAB 4DRBA 3B0CT 2HIOA 3WTPB 5JRGC 3C1BB 5AVBD 5B2JA 4J8UB 5AV5A 1P3IC 3AZED 3B0DB 5B2JC 5B31B 3AZKD 4G92C 2HIOD 4KGCD 1ULYA 5GXQA 1ZLAD 4WU8A 5AV5D 3AZFA 1Q9CA 4NE6A 3NQJB 1U35B 5GXQC 4E44A 5B32B 3LZ1D 4WU8C 3AZFC 5CPID 1P3GC 1H3OB 5AVBB 5B33D 3C1CA 3AZEB 5JRGB 5B1LD 5B24C 3AZKB 2YFVA 3W96A 3C1CC 2HIOB 4CAYB 4KGCB 3TU4A 1ZLAB 2YFWA 4G92B 5AV5B 3W96C 3KWQD 1P3KC 3TU4C 4J8WA 3AZIA 5AV8A 3LZ1B 4LD9D 5DNNA 4J8WC 5AV8C 5GT3D 5CPIB 5B33B 3O62C 4J8WD 5DNNC 5AV8D 5B1LB 3AZID 3WA9A 2F8NA 2NQBA 5BO0B 4H9OA 3WA9C 3KWQB 2NQBC 1M19A 4LD9B 2YFVB 4WZSB 3WKJA 5B0YD 3TU4B 4H9QA 5BT1C 2YFWB 5GT3B 1P34A 1M19C 5CPKD
chains in the Genus database with same CATH superfamily
3WKJC 3R45B 4J8WB 3AZIB 5AV8B 1P34C 3AZJA 5B32G 2CV5D 1M1AA 1P34D 2RIQA 3A6ND 5CHLB 3V9RA 3MGSC 3MNNA 2PYOD 1M1AC 5AVCD 1M18A 3AZJD 3MNNC 3KUYA 5B0YB 4ZUXA 3LZ0D 5CPKB 5AY8D 3MNND 5JA4A 3KUYC 3MGRD 1M18D 3UTBC 4ZUXC 5F99A 2CV5B 1KX4D 4H9QB 1P34B 5F99C 3UT9A 3REKC 3AL0C 2FFFB 4H9NA 5AVCB 4G91C 3UT9C 3A1IA 3AZJB 4M6BA 4DRAA 1R4VA 3LZ0B 5AY8B 3MNNB 3MGRB 1P3FA 5B40D 1M18B 3REIA 4DQYB 1KX4B 2FJ7A 3AN2A 4UUZB 3AV1D 3REIC 5E5AC 5JA4B 2NZDA 5B1MC 3MGPA 1P3FD 2FJ7C 3AN2C 3WAAD 3REID 4HGAC 5CPJD 1EQZA 2NZDC 3MGPC 2FJ7D 4G91B 4NE5A 4X23C 2G5HC 1PZRA 5B0ZC 3C1BA 1EQZC 1KX3C 4H9NB 5C3IC 3KXBA 5B40B 4Z66D 3WTPC 2XD5A 3W98D 3EPLA 3C1BC 1EQZD 1BFMA 3KXBC 5B31A 4J8UC 3AV1B 3KSYA 3KXBD 5B31C 1P3FB 3WAAB 4YM6D 3NQJA 4XUJA 3REIB 1U35A 2UWXA 3AZGA 1P3OD 2FJ7B 4AWLC 1U35C 1H3OA 5AVBA 1P3PD 3AZGC 4XUJD 4Z66B 2AROA 3W98B 4H9SA 1EQZB 5AVBC 3AZGD 3AZKA 4CAYA 2RVQD 3AZEC 4KGCA 4H9SC 3AZMD 1ZLAA 3KXBB 1P3BA 3AZKC 2HIOC 4YM6B 4KGCC 2AROD 1ZLAC 3LZ1A 3AFAA 1P3OB 5AV5C 1BH8A 1AOIA 5CPIA 1P3BD 3LZ1C 1P3PB 5B33A 4AWLB 4XUJB 1AOIC 3W97A 5CPIC 5B1LA 3AFAD 3AZGB 4JJNA 5B33C 4H9RA 1AOID 3W97C 5B1LC 2F8NK 3AZMB 4QLCA 5BO0A 2AROB 3KWQA 3W97D 4JJND 4LD9A 5FUGA 3X1SD 3RELD 4E45A 3KWQC 5GT3A 4QLCD 1P3BB 1WWSA 4LD9C 2BYMB 3AZLD 1HQ3A 4Z5TD 3R45A 4YS3A 5GT3C 3AFAB 1BH8B 1HQ3C 1AOIB 4WV4B 3AZIC 1HQ3D 3W97B 4YS3D 4JJNB 5B2ID 4H9RB 3X1SB 2IO5B 5B0YA 1W2EA 4QLCB 5CPKA 3AZLB 4Z5TB 5B0YC 5CP6A 3X1VD 2BYKA 5FUGB 5CPKC 5B31G 3LJAD 2CV5A 5CP6C 3A6NA 2F8NH 2VQRA 2CV5C 2PYOA 1HQ3B 5CP6D 5AVCA 4YS3B 3A6NC 5BNXA 5B2IB 2PYOC 5AVCC 3FDDA 3LZ0A 3AZJC 5AY8A 3MGRA 3LZ0C 3X1TD 5AY8C 1HTAA 3LJAB 1KX4A 1B67A 3MGRC 1M18C 4UUZA 4EO5B 1KX4C 3MGQA 5CP6B 3VH6A 2BYKB 4WU9D 1BH9A 1TAFB 4WNNA 3A6NB 4KUDD 2ZM5A 2PYOB 4J8VA 3B6FD 3MGQD 5B40A 5BNXB 3X1TB 2Y2IA 4J8VC 2DQNC 5B40C 3AV1A 1S32A 4J8VD 3REHD 3AZHA 3WAAA 3AV1C 1TZYD 4WU9B 5CPJA 3AZHC 1P3FC 3WAAC 1S32D 4KUDB 4H9PB 3B0BA 3AZHD 5CPJC 3MGQB 3B6FB 3MVDA 3WTPE 4Z66A 3W98A 1BH9B 5GSUA 3MVDC 4WNNB 1P3LA 4Z66C 3VH5A 3W98C 4J8VB 3REHB 3AV2D 3MVDD 3P5JB 5GT0A 4YM6A 1TZYB 1T3UA 3W99D 5GSUD 1P3AA 1P3OA 1P3LD 4YM6C 1S32B 1P3MD 3AZHB 1P3PA 1N1JB 1P3AC 1P3OC 4J8XD 5GT0D 5CPJB 3AZNA 1P3AD 1P3PC 4XUJC 3NQUA 3B6GD 3AZMA 3AV2B 3MVDB 4UPKA 2RVQC 3AZND 3AZMC 3W99B 5GSUB 3REJA 1P3LB 1P3MB 2AROC 5DNMD 4J8XB 5GT0B 2BYMA 5AV6A 3LELD 1ID3D 3REJD 1P3BC 1P3AB 3X1UA 3B6GB 3AFAC 1A7WA 3X1UC 1JFIA 5AV6D 3AZNB 3X1SA 3NQUB 3X1UD 5DNMB 3RELA 4XZQA 4JJNC 1P3IA 3RELC 2IO5C 3AZLA 3X1SC 4Z5TA 5AV9D 3LELB 2Y2GA 1ID3B 4QLCC 3REJB 4XZQC 3AZLC 5JRGD 4Z5TC 4ZBJB 4XZQD 1P3ID 4NFTA 2CWEA 5AV6B 4NE3A 5B2JD 2HUEB 5B2IA 4CSRB 3X1UB 1P3GA 4YS3C 2LY8A 5B2IC 5GXQD 1JFIB 5AV9B 2JCHA 3X1VA 4WU8D 4R8PA 5B24A 3AZFD 3LJAA 3RELB 1P3GD 1KX5A 3X1VC 1Z2CB 5G49A 4R8PC 4XZQB 1P3IB 2Y2MA 1KU5A 3LJAC 2ZY4A 2F2AC 1P3KA 1KX5C 2Y2NA 4R8PD 5B2JB 5B24D 1F66A 4EO5C 3C1CD 1TAFA 1KX5D 2Y2OA 1F66C 3W96D 3O62A 5GXQB 1P3KD 3TU4D 2ZY2A 5KDMA 4WU8B 1F66D 3VH6W 3X1TA 3AZFB 1P3GB 2W8SA 3AYWA 3X1TC 3O62D 5DNND 3AYWC 3X1VB 4R8PB 5B24B 3C1CB 4WU9A 4Z2MG 2JE5A 1KX5B 3AYWD 3F6TA 5G49B 3WA9D 4KUDA 3W96B 4H9PA 4WU9C 3VH6T 1P3KB 2F8ND 3B6FA 2NQBD 1F66B 4KUDC 3B6FC 3MGQC 5BT1D 1M19D 3MGSA 3O62B 3WKJD 3REHA 5DNNB 5KDMB 1TZYA 5BS7A 3REHC 3AYWB 3WA9B 1TZYC 2XD1A 3MGSD 5BS7C 2L5AA 3VH5W 1M1AD 2F8NB 1N1JA 3EPJA 3UTBA 2NQBB 4H9OB 1S32C 1M19B 3REKA 3KUYD 5BNVA 3WKJB 3AV2A 3UTBD 4ZUXD 3AV2C 3W99A 3VH5T 5F99D 1P3MA 3EPHA 2JSSA 3MGSB 3REKD 1M1AB 4KHAA 2G5IC 3W99C 5GSUC 3UT9D 4J8XA 1P3LC 3V9RB 1P3MC 2Y2KA 4J8XC 5GT0C 3B6GA 5E5AA 3KUYB 5B1MA 3UTBB 4ZUXB 3B6GC 2Y2LA 5F99B 1B6WA 4X23A 5B0ZA 5E5AD 1F1EA 5DNMA 3H0RC 3REKB 5BNVB 5B1MD 3AZNC 1KX3A 3UTAA 3AN2D 3UT9B 3WTPA 5DNMC 2NZDD 3LELA 3MGPD 1ID3A 4J8UA 3UTAC 4X23D 5B0ZD 3EPKA 3LELC 4KHAB 1KX3D 1ID3C 3REJC 3UTAD 2F8NG 3B0DC 3WTPD 3C1BD 3B0CW 4J8UD 4ZBJC 4CSRA 4WJ3C 4Z2MH 5E5AB 5AV6C 5B1MB 5B32A 5B31D 2HUEC 3AN2B 1WWIA 5AV9A 4HGAB 2NZDB 3MGPB 5B32C 3AZEA 4X23B 5B0ZB 3A1KA 5JRGA 1U35D 5AV9C 1KX3B 5B32D 5C3IB 3UTAB 4DRBA 3B0CT 2HIOA 3WTPB 5JRGC 3C1BB 5AVBD 5B2JA 4J8UB 5AV5A 1P3IC 3AZED 3B0DB 2Y2HA 3H0LC 2J8PA 5B31B 5B2JC 3AZKD 4G92C 2HIOD 4KGCD 1ULYA 2ZY3A 5GXQA 1ZLAD 4WU8A 5AV5D 3AZFA 1Q9CA 4NE6A 3NQJB 1U35B 5GXQC 4E44A 5B32B 3LZ1D 4WU8C 2BG1A 3AZFC 2DF4C 5CPID 1P3GC 1H3OB 2ZY5A 5AVBB 5B33D 3C1CA 3AZEB 5JRGB 5B1LD 5B24C 3AZKB 2YFVA 3W96A 3C1CC 2HIOB 4CAYB 4KGCB 2Y2QA 3TU4A 1ZLAB 2YFWA 4G92B 5AV5B 3W96C 3IP4C 3KWQD 1P3KC 3TU4C 4J8WA 3AZIA 5AV8A 3LZ1B 4LD9D 5DNNA 3H0MC 5AV8C 5GT3D 4J8WC 5CPIB 5B33B 3O62C 4J8WD 5DNNC 5AV8D 5B1LB 3AZID 3WA9A 2F8NA 2NQBA 5BO0B 2Y2PA 4H9OA 3WA9C 3KFUG 3KWQB 2NQBC 1M19A 2Y2JA 2YFVB 4LD9B 4WZSB 3WKJA 5B0YD 3TU4B 4H9QA 5BT1C 2YFWB 5GT3B 1P34A 1M19C 5CPKD 3EG5B
chains in the Genus database with same CATH topology
3WKJC 3R45B 4J8WB 3AZIB 5AV8B 1P34C 3AZJA 5B32G 2CV5D 1M1AA 1P34D 2RIQA 3A6ND 5CHLB 3V9RA 3MGSC 3MNNA 2PYOD 1M1AC 5AVCD 1M18A 3AZJD 3MNNC 3KUYA 5B0YB 4ZUXA 3LZ0D 5CPKB 5AY8D 3MNND 5JA4A 3KUYC 3MGRD 1M18D 3UTBC 4ZUXC 5F99A 2CV5B 1KX4D 4H9QB 1P34B 5F99C 3UT9A 3REKC 3AL0C 2FFFB 4H9NA 5AVCB 4G91C 3UT9C 3A1IA 3AZJB 4M6BA 4DRAA 1R4VA 3LZ0B 5AY8B 3MNNB 3MGRB 1P3FA 5B40D 1M18B 3REIA 4DQYB 1KX4B 2FJ7A 3AN2A 4UUZB 3AV1D 3REIC 5E5AC 5JA4B 2NZDA 5B1MC 3MGPA 1P3FD 2FJ7C 3AN2C 3WAAD 3REID 4HGAC 5CPJD 1EQZA 2NZDC 3MGPC 2FJ7D 4G91B 4NE5A 4X23C 2G5HC 1PZRA 5B0ZC 3C1BA 1EQZC 1KX3C 4H9NB 5C3IC 3KXBA 5B40B 4Z66D 3WTPC 2XD5A 3W98D 3EPLA 3C1BC 1EQZD 1BFMA 3KXBC 5B31A 4J8UC 3AV1B 3KSYA 3KXBD 5B31C 1P3FB 3WAAB 4YM6D 3NQJA 4XUJA 3REIB 1U35A 2UWXA 3AZGA 1P3OD 2FJ7B 4AWLC 1U35C 1H3OA 5AVBA 1P3PD 3AZGC 4XUJD 4Z66B 2AROA 3W98B 4H9SA 1EQZB 5AVBC 3AZGD 3AZKA 4CAYA 2RVQD 3AZEC 4KGCA 4H9SC 3AZMD 1ZLAA 3KXBB 1P3BA 3AZKC 2HIOC 4YM6B 4KGCC 2AROD 1ZLAC 3LZ1A 3AFAA 1P3OB 5AV5C 1BH8A 1AOIA 5CPIA 1P3BD 3LZ1C 1P3PB 5B33A 4AWLB 4XUJB 1AOIC 3W97A 5CPIC 5B1LA 3AFAD 3AZGB 4JJNA 5B33C 4H9RA 1AOID 3W97C 5B1LC 2F8NK 3AZMB 4QLCA 5BO0A 2AROB 3KWQA 3W97D 4JJND 4LD9A 5FUGA 3X1SD 3RELD 4E45A 3KWQC 5GT3A 4QLCD 1P3BB 1WWSA 4LD9C 2BYMB 3AZLD 1HQ3A 4Z5TD 3R45A 4YS3A 5GT3C 3AFAB 1BH8B 1HQ3C 1AOIB 4WV4B 3AZIC 1HQ3D 3W97B 4YS3D 4JJNB 5B2ID 4H9RB 3X1SB 2IO5B 5B0YA 1W2EA 4QLCB 5CPKA 3AZLB 4Z5TB 5B0YC 5CP6A 3X1VD 2BYKA 5FUGB 5CPKC 5B31G 3LJAD 2CV5A 5CP6C 3A6NA 2F8NH 2VQRA 2CV5C 2PYOA 1HQ3B 5CP6D 5AVCA 4YS3B 3A6NC 5BNXA 5B2IB 2PYOC 5AVCC 3FDDA 3LZ0A 3AZJC 5AY8A 3MGRA 3LZ0C 3X1TD 5AY8C 1HTAA 3LJAB 1KX4A 1B67A 3MGRC 1M18C 4UUZA 4EO5B 1KX4C 3MGQA 5CP6B 3VH6A 2BYKB 4WU9D 1BH9A 1TAFB 4WNNA 3A6NB 4KUDD 2ZM5A 2PYOB 4J8VA 3B6FD 3MGQD 5B40A 5BNXB 3X1TB 2Y2IA 4J8VC 2DQNC 5B40C 3AV1A 1S32A 4J8VD 3REHD 3AZHA 3WAAA 3AV1C 1TZYD 4WU9B 5CPJA 3AZHC 1P3FC 3WAAC 1S32D 4KUDB 4H9PB 3B0BA 3AZHD 5CPJC 3MGQB 3B6FB 3MVDA 3WTPE 4Z66A 3W98A 1BH9B 5GSUA 3MVDC 4WNNB 1P3LA 4Z66C 3VH5A 3W98C 4J8VB 3REHB 3AV2D 3MVDD 3P5JB 5GT0A 4YM6A 1TZYB 1T3UA 3W99D 5GSUD 1P3AA 1P3OA 1P3LD 4YM6C 1S32B 1P3MD 3AZHB 1P3PA 1N1JB 1P3AC 1P3OC 4J8XD 5GT0D 5CPJB 3AZNA 1P3AD 1P3PC 4XUJC 3NQUA 3B6GD 3AZMA 3AV2B 3MVDB 4UPKA 2RVQC 3AZND 3AZMC 3W99B 5GSUB 3REJA 1P3LB 1P3MB 2AROC 5DNMD 4J8XB 5GT0B 2BYMA 5AV6A 3LELD 1ID3D 3REJD 1P3BC 1P3AB 3X1UA 3B6GB 3AFAC 1A7WA 3X1UC 1JFIA 5AV6D 3AZNB 3X1SA 3NQUB 3X1UD 5DNMB 3RELA 4XZQA 4JJNC 1P3IA 3RELC 2IO5C 3AZLA 3X1SC 4Z5TA 5AV9D 3LELB 2Y2GA 1ID3B 4QLCC 3REJB 4XZQC 3AZLC 5JRGD 4Z5TC 4ZBJB 4XZQD 1P3ID 4NFTA 2CWEA 5AV6B 4NE3A 5B2JD 2HUEB 5B2IA 4CSRB 3X1UB 1P3GA 4YS3C 2LY8A 5B2IC 5GXQD 1JFIB 5AV9B 2JCHA 3X1VA 4WU8D 4R8PA 5B24A 3AZFD 3LJAA 3RELB 1P3GD 1KX5A 3X1VC 1Z2CB 5G49A 4R8PC 4XZQB 1P3IB 2Y2MA 1KU5A 3LJAC 2ZY4A 2F2AC 1P3KA 1KX5C 2Y2NA 4R8PD 5B2JB 5B24D 1F66A 4EO5C 3C1CD 1TAFA 1KX5D 2Y2OA 1F66C 3W96D 3O62A 5GXQB 1P3KD 3TU4D 2ZY2A 5KDMA 4WU8B 1F66D 3VH6W 3X1TA 3AZFB 1P3GB 2W8SA 3AYWA 3X1TC 3O62D 5DNND 3AYWC 3X1VB 4R8PB 5B24B 3C1CB 4WU9A 4Z2MG 2JE5A 1KX5B 3AYWD 3F6TA 5G49B 3WA9D 4KUDA 3W96B 4H9PA 4WU9C 3VH6T 1P3KB 2F8ND 3B6FA 2NQBD 1F66B 4KUDC 3B6FC 3MGQC 5BT1D 1M19D 3MGSA 3O62B 3WKJD 3REHA 5DNNB 5KDMB 1TZYA 5BS7A 3REHC 3AYWB 3WA9B 1TZYC 2XD1A 3MGSD 5BS7C 2L5AA 3VH5W 1M1AD 2F8NB 1N1JA 3EPJA 3UTBA 2NQBB 4H9OB 1S32C 1M19B 3REKA 3KUYD 5BNVA 3WKJB 3AV2A 3UTBD 4ZUXD 3AV2C 3W99A 3VH5T 5F99D 1P3MA 3EPHA 2JSSA 3MGSB 3REKD 1M1AB 4KHAA 2G5IC 3W99C 5GSUC 3UT9D 4J8XA 1P3LC 3V9RB 1P3MC 2Y2KA 4J8XC 5GT0C 3B6GA 5E5AA 3KUYB 5B1MA 3UTBB 4ZUXB 3B6GC 2Y2LA 5F99B 1B6WA 4X23A 5B0ZA 5E5AD 1F1EA 5DNMA 3H0RC 3REKB 5BNVB 5B1MD 3AZNC 1KX3A 3UTAA 3AN2D 3UT9B 3WTPA 5DNMC 2NZDD 3LELA 3MGPD 1ID3A 4J8UA 3UTAC 4X23D 5B0ZD 3EPKA 3LELC 4KHAB 1KX3D 1ID3C 3REJC 3UTAD 2F8NG 3B0DC 3WTPD 3C1BD 3B0CW 4J8UD 4ZBJC 4CSRA 4WJ3C 4Z2MH 5E5AB 5AV6C 5B1MB 5B32A 5B31D 2HUEC 3AN2B 1WWIA 5AV9A 4HGAB 2NZDB 3MGPB 5B32C 3AZEA 4X23B 5B0ZB 3A1KA 5JRGA 1U35D 5AV9C 1KX3B 5B32D 5C3IB 3UTAB 4DRBA 3B0CT 2HIOA 3WTPB 5JRGC 3C1BB 5AVBD 5B2JA 4J8UB 5AV5A 1P3IC 3AZED 3B0DB 2Y2HA 3H0LC 2J8PA 5B31B 5B2JC 3AZKD 4G92C 2HIOD 4KGCD 1ULYA 2ZY3A 5GXQA 1ZLAD 4WU8A 5AV5D 3AZFA 1Q9CA 4NE6A 3NQJB 1U35B 5GXQC 4E44A 5B32B 3LZ1D 4WU8C 2BG1A 3AZFC 2DF4C 5CPID 1P3GC 1H3OB 2ZY5A 5AVBB 5B33D 3C1CA 3AZEB 5JRGB 5B1LD 5B24C 3AZKB 2YFVA 3W96A 3C1CC 2HIOB 4CAYB 4KGCB 2Y2QA 3TU4A 1ZLAB 2YFWA 4G92B 5AV5B 3W96C 3IP4C 3KWQD 1P3KC 3TU4C 4J8WA 3AZIA 5AV8A 3LZ1B 4LD9D 5DNNA 3H0MC 5AV8C 5GT3D 4J8WC 5CPIB 5B33B 3O62C 4J8WD 5DNNC 5AV8D 5B1LB 3AZID 3WA9A 2F8NA 2NQBA 5BO0B 2Y2PA 4H9OA 3WA9C 3KFUG 3KWQB 2NQBC 1M19A 2Y2JA 2YFVB 4LD9B 4WZSB 3WKJA 5B0YD 3TU4B 4H9QA 5BT1C 2YFWB 5GT3B 1P34A 1M19C 5CPKD 3EG5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ C;  3R45 B;  4J8W B;  3AZI B;  5AV8 B;  1P34 C;  3AZJ A;  5B32 G;  2CV5 D;  1M1A A;  1P34 D;  3A6N D;  5CHL B;  3V9R A;  3MGS C;  3MNN A;  2PYO D;  1M1A C;  5AVC D;  1M18 A;  3AZJ D;  3MNN C;  3KUY A;  5B0Y B;  4ZUX A;  3LZ0 D;  5CPK B;  5AY8 D;  3MNN D;  5JA4 A;  3KUY C;  3MGR D;  1M18 D;  3UTB C;  4ZUX C;  5F99 A;  2CV5 B;  1KX4 D;  4H9Q B;  1P34 B;  5F99 C;  3UT9 A;  3REK C;  4H9N A;  5AVC B;  4G91 C;  3UT9 C;  3AZJ B;  4M6B A;  4DRA A;  1R4V A;  3LZ0 B;  5AY8 B;  3MNN B;  3MGR B;  1P3F A;  5B40 D;  1M18 B;  3REI A;  1KX4 B;  2FJ7 A;  3AN2 A;  4UUZ B;  3AV1 D;  3REI C;  5E5A C;  5JA4 B;  2NZD A;  5B1M C;  3MGP A;  1P3F D;  2FJ7 C;  3AN2 C;  3WAA D;  3REI D;  4HGA C;  5CPJ D;  1EQZ A;  2NZD C;  3MGP C;  2FJ7 D;  4G91 B;  4NE5 A;  4X23 C;  5B0Z C;  3C1B A;  1EQZ C;  1KX3 C;  4H9N B;  5C3I C;  3KXB A;  5B40 B;  4Z66 D;  3WTP C;  3W98 D;  3C1B C;  1EQZ D;  1BFM A;  3KXB C;  5B31 A;  4J8U C;  3AV1 B;  3KSY A;  3KXB D;  5B31 C;  1P3F B;  3WAA B;  4YM6 D;  3NQJ A;  4XUJ A;  3REI B;  1U35 A;  3AZG A;  1P3O D;  2FJ7 B;  4AWL C;  1U35 C;  1H3O A;  5AVB A;  1P3P D;  3AZG C;  4XUJ D;  4Z66 B;  2ARO A;  3W98 B;  4H9S A;  1EQZ B;  5AVB C;  3AZG D;  3AZK A;  4CAY A;  2RVQ D;  3AZE C;  4KGC A;  4H9S C;  3AZM D;  1ZLA A;  3KXB B;  1P3B A;  3AZK C;  2HIO C;  4YM6 B;  4KGC C;  2ARO D;  1ZLA C;  3LZ1 A;  3AFA A;  1P3O B;  5AV5 C;  1BH8 A;  1AOI A;  5CPI A;  1P3B D;  3LZ1 C;  1P3P B;  5B33 A;  4AWL B;  4XUJ B;  1AOI C;  3W97 A;  5CPI C;  5B1L A;  3AFA D;  3AZG B;  4JJN A;  5B33 C;  4H9R A;  1AOI D;  3W97 C;  5B1L C;  2F8N K;  3AZM B;  4QLC A;  5BO0 A;  2ARO B;  3KWQ A;  3W97 D;  4JJN D;  4LD9 A;  5FUG A;  3X1S D;  3REL D;  4E45 A;  3KWQ C;  5GT3 A;  4QLC D;  1P3B B;  1WWS A;  4LD9 C;  2BYM B;  3AZL D;  1HQ3 A;  4Z5T D;  3R45 A;  4YS3 A;  5GT3 C;  3AFA B;  1BH8 B;  1HQ3 C;  1AOI B;  4WV4 B;  3AZI C;  1HQ3 D;  3W97 B;  4YS3 D;  4JJN B;  5B2I D;  4H9R B;  3X1S B;  2IO5 B;  5B0Y A;  4QLC B;  5CPK A;  3AZL B;  4Z5T B;  5B0Y C;  5CP6 A;  3X1V D;  2BYK A;  5FUG B;  5CPK C;  5B31 G;  3LJA D;  2CV5 A;  5CP6 C;  3A6N A;  2F8N H;  2CV5 C;  2PYO A;  1HQ3 B;  5CP6 D;  5AVC A;  4YS3 B;  3A6N C;  5BNX A;  5B2I B;  2PYO C;  5AVC C;  3LZ0 A;  3AZJ C;  5AY8 A;  3MGR A;  3LZ0 C;  3X1T D;  5AY8 C;  1HTA A;  3LJA B;  1KX4 A;  1B67 A;  3MGR C;  1M18 C;  4UUZ A;  4EO5 B;  1KX4 C;  3MGQ A;  5CP6 B;  3VH6 A;  2BYK B;  4WU9 D;  1BH9 A;  1TAF B;  4WNN A;  3A6N B;  4KUD D;  2PYO B;  4J8V A;  3B6F D;  3MGQ D;  5B40 A;  5BNX B;  3X1T B;  4J8V C;  5B40 C;  3AV1 A;  1S32 A;  4J8V D;  3REH D;  3AZH A;  3WAA A;  3AV1 C;  1TZY D;  4WU9 B;  5CPJ A;  3AZH C;  1P3F C;  3WAA C;  1S32 D;  4KUD B;  4H9P B;  3B0B A;  3AZH D;  5CPJ C;  3MGQ B;  3B6F B;  3MVD A;  3WTP E;  4Z66 A;  3W98 A;  1BH9 B;  5GSU A;  3MVD C;  4WNN B;  1P3L A;  4Z66 C;  3VH5 A;  3W98 C;  4J8V B;  3REH B;  3AV2 D;  3MVD D;  5GT0 A;  4YM6 A;  1TZY B;  3W99 D;  5GSU D;  1P3A A;  1P3O A;  1P3L D;  4YM6 C;  1S32 B;  1P3M D;  3AZH B;  1P3P A;  1N1J B;  1P3A C;  1P3O C;  4J8X D;  5GT0 D;  5CPJ B;  3AZN A;  1P3A D;  1P3P C;  4XUJ C;  3NQU A;  3B6G D;  3AZM A;  3AV2 B;  3MVD B;  2RVQ C;  3AZN D;  3AZM C;  3W99 B;  5GSU B;  3REJ A;  1P3L B;  1P3M B;  2ARO C;  5DNM D;  4J8X B;  5GT0 B;  2BYM A;  5AV6 A;  3LEL D;  1ID3 D;  3REJ D;  1P3B C;  1P3A B;  3X1U A;  3B6G B;  3AFA C;  1A7W A;  3X1U C;  1JFI A;  5AV6 D;  3AZN B;  3X1S A;  3NQU B;  3X1U D;  5DNM B;  3REL A;  4XZQ A;  4JJN C;  1P3I A;  3REL C;  2IO5 C;  3AZL A;  3X1S C;  4Z5T A;  5AV9 D;  3LEL B;  1ID3 B;  4QLC C;  3REJ B;  4XZQ C;  3AZL C;  5JRG D;  4Z5T C;  4ZBJ B;  4XZQ D;  1P3I D;  4NFT A;  2CWE A;  5AV6 B;  4NE3 A;  5B2J D;  2HUE B;  5B2I A;  4CSR B;  3X1U B;  1P3G A;  4YS3 C;  2LY8 A;  5B2I C;  5GXQ D;  1JFI B;  5AV9 B;  3X1V A;  4WU8 D;  4R8P A;  5B24 A;  3AZF D;  3LJA A;  3REL B;  1P3G D;  1KX5 A;  3X1V C;  5G49 A;  4R8P C;  4XZQ B;  1P3I B;  1KU5 A;  3LJA C;  1P3K A;  1KX5 C;  4R8P D;  5B2J B;  5B24 D;  1F66 A;  4EO5 C;  3C1C D;  1TAF A;  1KX5 D;  1F66 C;  3W96 D;  3O62 A;  5GXQ B;  1P3K D;  3TU4 D;  5KDM A;  4WU8 B;  1F66 D;  3VH6 W;  3X1T A;  3AZF B;  1P3G B;  3AYW A;  3X1T C;  3O62 D;  5DNN D;  3AYW C;  3X1V B;  4R8P B;  5B24 B;  3C1C B;  4WU9 A;  4Z2M G;  1KX5 B;  3AYW D;  5G49 B;  3WA9 D;  4KUD A;  3W96 B;  4H9P A;  4WU9 C;  3VH6 T;  1P3K B;  2F8N D;  3B6F A;  2NQB D;  1F66 B;  4KUD C;  3B6F C;  3MGQ C;  5BT1 D;  1M19 D;  3MGS A;  3O62 B;  3WKJ D;  3REH A;  5DNN B;  5KDM B;  1TZY A;  5BS7 A;  3REH C;  3AYW B;  3WA9 B;  1TZY C;  3MGS D;  5BS7 C;  2L5A A;  3VH5 W;  1M1A D;  2F8N B;  1N1J A;  3UTB A;  2NQB B;  4H9O B;  1S32 C;  1M19 B;  3REK A;  3KUY D;  5BNV A;  3WKJ B;  3AV2 A;  3UTB D;  4ZUX D;  3AV2 C;  3W99 A;  3VH5 T;  5F99 D;  1P3M A;  2JSS A;  3MGS B;  3REK D;  1M1A B;  4KHA A;  3W99 C;  5GSU C;  3UT9 D;  4J8X A;  1P3L C;  3V9R B;  1P3M C;  4J8X C;  5GT0 C;  3B6G A;  5E5A A;  3KUY B;  5B1M A;  3UTB B;  4ZUX B;  3B6G C;  5F99 B;  1B6W A;  4X23 A;  5B0Z A;  5E5A D;  1F1E A;  5DNM A;  3REK B;  5BNV B;  5B1M D;  3AZN C;  1KX3 A;  3UTA A;  3AN2 D;  3UT9 B;  3WTP A;  5DNM C;  2NZD D;  3LEL A;  3MGP D;  1ID3 A;  4J8U A;  3UTA C;  4X23 D;  5B0Z D;  3LEL C;  4KHA B;  1KX3 D;  1ID3 C;  3REJ C;  3UTA D;  2F8N G;  3B0D C;  3WTP D;  3C1B D;  3B0C W;  4J8U D;  4ZBJ C;  4CSR A;  4Z2M H;  5E5A B;  5AV6 C;  5B1M B;  5B32 A;  5B31 D;  2HUE C;  3AN2 B;  1WWI A;  5AV9 A;  4HGA B;  2NZD B;  3MGP B;  5B32 C;  3AZE A;  4X23 B;  5B0Z B;  1U35 D;  5JRG A;  5AV9 C;  1KX3 B;  5B32 D;  5C3I B;  3UTA B;  4DRB A;  3B0C T;  2HIO A;  3WTP B;  5JRG C;  3C1B B;  5AVB D;  5B2J A;  4J8U B;  5AV5 A;  1P3I C;  3AZE D;  3B0D B;  5B2J C;  5B31 B;  3AZK D;  4G92 C;  2HIO D;  4KGC D;  1ULY A;  5GXQ A;  1ZLA D;  4WU8 A;  5AV5 D;  3AZF A;  1Q9C A;  4NE6 A;  3NQJ B;  1U35 B;  5GXQ C;  4E44 A;  5B32 B;  3LZ1 D;  4WU8 C;  3AZF C;  5CPI D;  1P3G C;  1H3O B;  5AVB B;  5B33 D;  3C1C A;  3AZE B;  5JRG B;  5B1L D;  5B24 C;  3AZK B;  2YFV A;  3W96 A;  3C1C C;  2HIO B;  4CAY B;  4KGC B;  3TU4 A;  1ZLA B;  2YFW A;  4G92 B;  5AV5 B;  3W96 C;  3KWQ D;  1P3K C;  3TU4 C;  4J8W A;  3AZI A;  5AV8 A;  3LZ1 B;  4LD9 D;  5DNN A;  4J8W C;  5AV8 C;  5GT3 D;  5CPI B;  5B33 B;  3O62 C;  4J8W D;  5DNN C;  5AV8 D;  5B1L B;  3AZI D;  3WA9 A;  2F8N A;  2NQB A;  5BO0 B;  4H9O A;  3WA9 C;  3KWQ B;  2NQB C;  1M19 A;  4LD9 B;  2YFV B;  4WZS B;  3WKJ A;  5B0Y D;  3TU4 B;  4H9Q A;  5BT1 C;  2YFW B;  5GT3 B;  1P34 A;  1M19 C;  5CPK D; 
#chains in the Genus database with same CATH topology
 3WKJ C;  3R45 B;  4J8W B;  3AZI B;  5AV8 B;  1P34 C;  3AZJ A;  5B32 G;  2CV5 D;  1M1A A;  1P34 D;  2RIQ A;  3A6N D;  5CHL B;  3V9R A;  3MGS C;  3MNN A;  2PYO D;  1M1A C;  5AVC D;  1M18 A;  3AZJ D;  3MNN C;  3KUY A;  5B0Y B;  4ZUX A;  3LZ0 D;  5CPK B;  5AY8 D;  3MNN D;  5JA4 A;  3KUY C;  3MGR D;  1M18 D;  3UTB C;  4ZUX C;  5F99 A;  2CV5 B;  1KX4 D;  4H9Q B;  1P34 B;  5F99 C;  3UT9 A;  3REK C;  3AL0 C;  2FFF B;  4H9N A;  5AVC B;  4G91 C;  3UT9 C;  3A1I A;  3AZJ B;  4M6B A;  4DRA A;  1R4V A;  3LZ0 B;  5AY8 B;  3MNN B;  3MGR B;  1P3F A;  5B40 D;  1M18 B;  3REI A;  4DQY B;  1KX4 B;  2FJ7 A;  3AN2 A;  4UUZ B;  3AV1 D;  3REI C;  5E5A C;  5JA4 B;  2NZD A;  5B1M C;  3MGP A;  1P3F D;  2FJ7 C;  3AN2 C;  3WAA D;  3REI D;  4HGA C;  5CPJ D;  1EQZ A;  2NZD C;  3MGP C;  2FJ7 D;  4G91 B;  4NE5 A;  4X23 C;  2G5H C;  1PZR A;  5B0Z C;  3C1B A;  1EQZ C;  1KX3 C;  4H9N B;  5C3I C;  3KXB A;  5B40 B;  4Z66 D;  3WTP C;  2XD5 A;  3W98 D;  3EPL A;  3C1B C;  1EQZ D;  1BFM A;  3KXB C;  5B31 A;  4J8U C;  3AV1 B;  3KSY A;  3KXB D;  5B31 C;  1P3F B;  3WAA B;  4YM6 D;  3NQJ A;  4XUJ A;  3REI B;  1U35 A;  2UWX A;  3AZG A;  1P3O D;  2FJ7 B;  4AWL C;  1U35 C;  1H3O A;  5AVB A;  1P3P D;  3AZG C;  4XUJ D;  4Z66 B;  2ARO A;  3W98 B;  4H9S A;  1EQZ B;  5AVB C;  3AZG D;  3AZK A;  4CAY A;  2RVQ D;  3AZE C;  4KGC A;  4H9S C;  3AZM D;  1ZLA A;  3KXB B;  1P3B A;  3AZK C;  2HIO C;  4YM6 B;  4KGC C;  2ARO D;  1ZLA C;  3LZ1 A;  3AFA A;  1P3O B;  5AV5 C;  1BH8 A;  1AOI A;  5CPI A;  1P3B D;  3LZ1 C;  1P3P B;  5B33 A;  4AWL B;  4XUJ B;  1AOI C;  3W97 A;  5CPI C;  5B1L A;  3AFA D;  3AZG B;  4JJN A;  5B33 C;  4H9R A;  1AOI D;  3W97 C;  5B1L C;  2F8N K;  3AZM B;  4QLC A;  5BO0 A;  2ARO B;  3KWQ A;  3W97 D;  4JJN D;  4LD9 A;  5FUG A;  3X1S D;  3REL D;  4E45 A;  3KWQ C;  5GT3 A;  4QLC D;  1P3B B;  1WWS A;  4LD9 C;  2BYM B;  3AZL D;  1HQ3 A;  4Z5T D;  3R45 A;  4YS3 A;  5GT3 C;  3AFA B;  1BH8 B;  1HQ3 C;  1AOI B;  4WV4 B;  3AZI C;  1HQ3 D;  3W97 B;  4YS3 D;  4JJN B;  5B2I D;  4H9R B;  3X1S B;  2IO5 B;  5B0Y A;  1W2E A;  4QLC B;  5CPK A;  3AZL B;  4Z5T B;  5B0Y C;  5CP6 A;  3X1V D;  2BYK A;  5FUG B;  5CPK C;  5B31 G;  3LJA D;  2CV5 A;  5CP6 C;  3A6N A;  2F8N H;  2VQR A;  2CV5 C;  2PYO A;  1HQ3 B;  5CP6 D;  5AVC A;  4YS3 B;  3A6N C;  5BNX A;  5B2I B;  2PYO C;  5AVC C;  3FDD A;  3LZ0 A;  3AZJ C;  5AY8 A;  3MGR A;  3LZ0 C;  3X1T D;  5AY8 C;  1HTA A;  3LJA B;  1KX4 A;  1B67 A;  3MGR C;  1M18 C;  4UUZ A;  4EO5 B;  1KX4 C;  3MGQ A;  5CP6 B;  3VH6 A;  2BYK B;  4WU9 D;  1BH9 A;  1TAF B;  4WNN A;  3A6N B;  4KUD D;  2ZM5 A;  2PYO B;  4J8V A;  3B6F D;  3MGQ D;  5B40 A;  5BNX B;  3X1T B;  2Y2I A;  4J8V C;  2DQN C;  5B40 C;  3AV1 A;  1S32 A;  4J8V D;  3REH D;  3AZH A;  3WAA A;  3AV1 C;  1TZY D;  4WU9 B;  5CPJ A;  3AZH C;  1P3F C;  3WAA C;  1S32 D;  4KUD B;  4H9P B;  3B0B A;  3AZH D;  5CPJ C;  3MGQ B;  3B6F B;  3MVD A;  3WTP E;  4Z66 A;  3W98 A;  1BH9 B;  5GSU A;  3MVD C;  4WNN B;  1P3L A;  4Z66 C;  3VH5 A;  3W98 C;  4J8V B;  3REH B;  3AV2 D;  3MVD D;  3P5J B;  5GT0 A;  4YM6 A;  1TZY B;  1T3U A;  3W99 D;  5GSU D;  1P3A A;  1P3O A;  1P3L D;  4YM6 C;  1S32 B;  1P3M D;  3AZH B;  1P3P A;  1N1J B;  1P3A C;  1P3O C;  4J8X D;  5GT0 D;  5CPJ B;  3AZN A;  1P3A D;  1P3P C;  4XUJ C;  3NQU A;  3B6G D;  3AZM A;  3AV2 B;  3MVD B;  4UPK A;  2RVQ C;  3AZN D;  3AZM C;  3W99 B;  5GSU B;  3REJ A;  1P3L B;  1P3M B;  2ARO C;  5DNM D;  4J8X B;  5GT0 B;  2BYM A;  5AV6 A;  3LEL D;  1ID3 D;  3REJ D;  1P3B C;  1P3A B;  3X1U A;  3B6G B;  3AFA C;  1A7W A;  3X1U C;  1JFI A;  5AV6 D;  3AZN B;  3X1S A;  3NQU B;  3X1U D;  5DNM B;  3REL A;  4XZQ A;  4JJN C;  1P3I A;  3REL C;  2IO5 C;  3AZL A;  3X1S C;  4Z5T A;  5AV9 D;  3LEL B;  2Y2G A;  1ID3 B;  4QLC C;  3REJ B;  4XZQ C;  3AZL C;  5JRG D;  4Z5T C;  4ZBJ B;  4XZQ D;  1P3I D;  4NFT A;  2CWE A;  5AV6 B;  4NE3 A;  5B2J D;  2HUE B;  5B2I A;  4CSR B;  3X1U B;  1P3G A;  4YS3 C;  2LY8 A;  5B2I C;  5GXQ D;  1JFI B;  5AV9 B;  2JCH A;  3X1V A;  4WU8 D;  4R8P A;  5B24 A;  3AZF D;  3LJA A;  3REL B;  1P3G D;  1KX5 A;  3X1V C;  1Z2C B;  5G49 A;  4R8P C;  4XZQ B;  1P3I B;  2Y2M A;  1KU5 A;  3LJA C;  2ZY4 A;  2F2A C;  1P3K A;  1KX5 C;  2Y2N A;  4R8P D;  5B2J B;  5B24 D;  1F66 A;  4EO5 C;  3C1C D;  1TAF A;  1KX5 D;  2Y2O A;  1F66 C;  3W96 D;  3O62 A;  5GXQ B;  1P3K D;  3TU4 D;  2ZY2 A;  5KDM A;  4WU8 B;  1F66 D;  3VH6 W;  3X1T A;  3AZF B;  1P3G B;  2W8S A;  3AYW A;  3X1T C;  3O62 D;  5DNN D;  3AYW C;  3X1V B;  4R8P B;  5B24 B;  3C1C B;  4WU9 A;  4Z2M G;  2JE5 A;  1KX5 B;  3AYW D;  3F6T A;  5G49 B;  3WA9 D;  4KUD A;  3W96 B;  4H9P A;  4WU9 C;  3VH6 T;  1P3K B;  2F8N D;  3B6F A;  2NQB D;  1F66 B;  4KUD C;  3B6F C;  3MGQ C;  5BT1 D;  1M19 D;  3MGS A;  3O62 B;  3WKJ D;  3REH A;  5DNN B;  5KDM B;  1TZY A;  5BS7 A;  3REH C;  3AYW B;  3WA9 B;  1TZY C;  2XD1 A;  3MGS D;  5BS7 C;  2L5A A;  3VH5 W;  1M1A D;  2F8N B;  1N1J A;  3EPJ A;  3UTB A;  2NQB B;  4H9O B;  1S32 C;  1M19 B;  3REK A;  3KUY D;  5BNV A;  3WKJ B;  3AV2 A;  3UTB D;  4ZUX D;  3AV2 C;  3W99 A;  3VH5 T;  5F99 D;  1P3M A;  3EPH A;  2JSS A;  3MGS B;  3REK D;  1M1A B;  4KHA A;  2G5I C;  3W99 C;  5GSU C;  3UT9 D;  4J8X A;  1P3L C;  3V9R B;  1P3M C;  2Y2K A;  4J8X C;  5GT0 C;  3B6G A;  5E5A A;  3KUY B;  5B1M A;  3UTB B;  4ZUX B;  3B6G C;  2Y2L A;  5F99 B;  1B6W A;  4X23 A;  5B0Z A;  5E5A D;  1F1E A;  5DNM A;  3H0R C;  3REK B;  5BNV B;  5B1M D;  3AZN C;  1KX3 A;  3UTA A;  3AN2 D;  3UT9 B;  3WTP A;  5DNM C;  2NZD D;  3LEL A;  3MGP D;  1ID3 A;  4J8U A;  3UTA C;  4X23 D;  5B0Z D;  3EPK A;  3LEL C;  4KHA B;  1KX3 D;  1ID3 C;  3REJ C;  3UTA D;  2F8N G;  3B0D C;  3WTP D;  3C1B D;  3B0C W;  4J8U D;  4ZBJ C;  4CSR A;  4WJ3 C;  4Z2M H;  5E5A B;  5AV6 C;  5B1M B;  5B32 A;  5B31 D;  2HUE C;  3AN2 B;  1WWI A;  5AV9 A;  4HGA B;  2NZD B;  3MGP B;  5B32 C;  3AZE A;  4X23 B;  5B0Z B;  3A1K A;  5JRG A;  1U35 D;  5AV9 C;  1KX3 B;  5B32 D;  5C3I B;  3UTA B;  4DRB A;  3B0C T;  2HIO A;  3WTP B;  5JRG C;  3C1B B;  5AVB D;  5B2J A;  4J8U B;  5AV5 A;  1P3I C;  3AZE D;  3B0D B;  2Y2H A;  3H0L C;  2J8P A;  5B31 B;  5B2J C;  3AZK D;  4G92 C;  2HIO D;  4KGC D;  1ULY A;  2ZY3 A;  5GXQ A;  1ZLA D;  4WU8 A;  5AV5 D;  3AZF A;  1Q9C A;  4NE6 A;  3NQJ B;  1U35 B;  5GXQ C;  4E44 A;  5B32 B;  3LZ1 D;  4WU8 C;  2BG1 A;  3AZF C;  2DF4 C;  5CPI D;  1P3G C;  1H3O B;  2ZY5 A;  5AVB B;  5B33 D;  3C1C A;  3AZE B;  5JRG B;  5B1L D;  5B24 C;  3AZK B;  2YFV A;  3W96 A;  3C1C C;  2HIO B;  4CAY B;  4KGC B;  2Y2Q A;  3TU4 A;  1ZLA B;  2YFW A;  4G92 B;  5AV5 B;  3W96 C;  3IP4 C;  3KWQ D;  1P3K C;  3TU4 C;  4J8W A;  3AZI A;  5AV8 A;  3LZ1 B;  4LD9 D;  5DNN A;  3H0M C;  5AV8 C;  5GT3 D;  4J8W C;  5CPI B;  5B33 B;  3O62 C;  4J8W D;  5DNN C;  5AV8 D;  5B1L B;  3AZI D;  3WA9 A;  2F8N A;  2NQB A;  5BO0 B;  2Y2P A;  4H9O A;  3WA9 C;  3KFU G;  3KWQ B;  2NQB C;  1M19 A;  2Y2J A;  2YFV B;  4LD9 B;  4WZS B;  3WKJ A;  5B0Y D;  3TU4 B;  4H9Q A;  5BT1 C;  2YFW B;  5GT3 B;  1P34 A;  1M19 C;  5CPK D;  3EG5 B; 
#chains in the Genus database with same CATH homology
 3WKJ C;  3R45 B;  4J8W B;  3AZI B;  5AV8 B;  1P34 C;  3AZJ A;  5B32 G;  2CV5 D;  1M1A A;  1P34 D;  2RIQ A;  3A6N D;  5CHL B;  3V9R A;  3MGS C;  3MNN A;  2PYO D;  1M1A C;  5AVC D;  1M18 A;  3AZJ D;  3MNN C;  3KUY A;  5B0Y B;  4ZUX A;  3LZ0 D;  5CPK B;  5AY8 D;  3MNN D;  5JA4 A;  3KUY C;  3MGR D;  1M18 D;  3UTB C;  4ZUX C;  5F99 A;  2CV5 B;  1KX4 D;  4H9Q B;  1P34 B;  5F99 C;  3UT9 A;  3REK C;  3AL0 C;  2FFF B;  4H9N A;  5AVC B;  4G91 C;  3UT9 C;  3A1I A;  3AZJ B;  4M6B A;  4DRA A;  1R4V A;  3LZ0 B;  5AY8 B;  3MNN B;  3MGR B;  1P3F A;  5B40 D;  1M18 B;  3REI A;  4DQY B;  1KX4 B;  2FJ7 A;  3AN2 A;  4UUZ B;  3AV1 D;  3REI C;  5E5A C;  5JA4 B;  2NZD A;  5B1M C;  3MGP A;  1P3F D;  2FJ7 C;  3AN2 C;  3WAA D;  3REI D;  4HGA C;  5CPJ D;  1EQZ A;  2NZD C;  3MGP C;  2FJ7 D;  4G91 B;  4NE5 A;  4X23 C;  2G5H C;  1PZR A;  5B0Z C;  3C1B A;  1EQZ C;  1KX3 C;  4H9N B;  5C3I C;  3KXB A;  5B40 B;  4Z66 D;  3WTP C;  2XD5 A;  3W98 D;  3EPL A;  3C1B C;  1EQZ D;  1BFM A;  3KXB C;  5B31 A;  4J8U C;  3AV1 B;  3KSY A;  3KXB D;  5B31 C;  1P3F B;  3WAA B;  4YM6 D;  3NQJ A;  4XUJ A;  3REI B;  1U35 A;  2UWX A;  3AZG A;  1P3O D;  2FJ7 B;  4AWL C;  1U35 C;  1H3O A;  5AVB A;  1P3P D;  3AZG C;  4XUJ D;  4Z66 B;  2ARO A;  3W98 B;  4H9S A;  1EQZ B;  5AVB C;  3AZG D;  3AZK A;  4CAY A;  2RVQ D;  3AZE C;  4KGC A;  4H9S C;  3AZM D;  1ZLA A;  3KXB B;  1P3B A;  3AZK C;  2HIO C;  4YM6 B;  4KGC C;  2ARO D;  1ZLA C;  3LZ1 A;  3AFA A;  1P3O B;  5AV5 C;  1BH8 A;  1AOI A;  5CPI A;  1P3B D;  3LZ1 C;  1P3P B;  5B33 A;  4AWL B;  4XUJ B;  1AOI C;  3W97 A;  5CPI C;  5B1L A;  3AFA D;  3AZG B;  4JJN A;  5B33 C;  4H9R A;  1AOI D;  3W97 C;  5B1L C;  2F8N K;  3AZM B;  4QLC A;  5BO0 A;  2ARO B;  3KWQ A;  3W97 D;  4JJN D;  4LD9 A;  5FUG A;  3X1S D;  3REL D;  4E45 A;  3KWQ C;  5GT3 A;  4QLC D;  1P3B B;  1WWS A;  4LD9 C;  2BYM B;  3AZL D;  1HQ3 A;  4Z5T D;  3R45 A;  4YS3 A;  5GT3 C;  3AFA B;  1BH8 B;  1HQ3 C;  1AOI B;  4WV4 B;  3AZI C;  1HQ3 D;  3W97 B;  4YS3 D;  4JJN B;  5B2I D;  4H9R B;  3X1S B;  2IO5 B;  5B0Y A;  1W2E A;  4QLC B;  5CPK A;  3AZL B;  4Z5T B;  5B0Y C;  5CP6 A;  3X1V D;  2BYK A;  5FUG B;  5CPK C;  5B31 G;  3LJA D;  2CV5 A;  5CP6 C;  3A6N A;  2F8N H;  2VQR A;  2CV5 C;  2PYO A;  1HQ3 B;  5CP6 D;  5AVC A;  4YS3 B;  3A6N C;  5BNX A;  5B2I B;  2PYO C;  5AVC C;  3FDD A;  3LZ0 A;  3AZJ C;  5AY8 A;  3MGR A;  3LZ0 C;  3X1T D;  5AY8 C;  1HTA A;  3LJA B;  1KX4 A;  1B67 A;  3MGR C;  1M18 C;  4UUZ A;  4EO5 B;  1KX4 C;  3MGQ A;  5CP6 B;  3VH6 A;  2BYK B;  4WU9 D;  1BH9 A;  1TAF B;  4WNN A;  3A6N B;  4KUD D;  2ZM5 A;  2PYO B;  4J8V A;  3B6F D;  3MGQ D;  5B40 A;  5BNX B;  3X1T B;  2Y2I A;  4J8V C;  2DQN C;  5B40 C;  3AV1 A;  1S32 A;  4J8V D;  3REH D;  3AZH A;  3WAA A;  3AV1 C;  1TZY D;  4WU9 B;  5CPJ A;  3AZH C;  1P3F C;  3WAA C;  1S32 D;  4KUD B;  4H9P B;  3B0B A;  3AZH D;  5CPJ C;  3MGQ B;  3B6F B;  3MVD A;  3WTP E;  4Z66 A;  3W98 A;  1BH9 B;  5GSU A;  3MVD C;  4WNN B;  1P3L A;  4Z66 C;  3VH5 A;  3W98 C;  4J8V B;  3REH B;  3AV2 D;  3MVD D;  3P5J B;  5GT0 A;  4YM6 A;  1TZY B;  1T3U A;  3W99 D;  5GSU D;  1P3A A;  1P3O A;  1P3L D;  4YM6 C;  1S32 B;  1P3M D;  3AZH B;  1P3P A;  1N1J B;  1P3A C;  1P3O C;  4J8X D;  5GT0 D;  5CPJ B;  3AZN A;  1P3A D;  1P3P C;  4XUJ C;  3NQU A;  3B6G D;  3AZM A;  3AV2 B;  3MVD B;  4UPK A;  2RVQ C;  3AZN D;  3AZM C;  3W99 B;  5GSU B;  3REJ A;  1P3L B;  1P3M B;  2ARO C;  5DNM D;  4J8X B;  5GT0 B;  2BYM A;  5AV6 A;  3LEL D;  1ID3 D;  3REJ D;  1P3B C;  1P3A B;  3X1U A;  3B6G B;  3AFA C;  1A7W A;  3X1U C;  1JFI A;  5AV6 D;  3AZN B;  3X1S A;  3NQU B;  3X1U D;  5DNM B;  3REL A;  4XZQ A;  4JJN C;  1P3I A;  3REL C;  2IO5 C;  3AZL A;  3X1S C;  4Z5T A;  5AV9 D;  3LEL B;  2Y2G A;  1ID3 B;  4QLC C;  3REJ B;  4XZQ C;  3AZL C;  5JRG D;  4Z5T C;  4ZBJ B;  4XZQ D;  1P3I D;  4NFT A;  2CWE A;  5AV6 B;  4NE3 A;  5B2J D;  2HUE B;  5B2I A;  4CSR B;  3X1U B;  1P3G A;  4YS3 C;  2LY8 A;  5B2I C;  5GXQ D;  1JFI B;  5AV9 B;  2JCH A;  3X1V A;  4WU8 D;  4R8P A;  5B24 A;  3AZF D;  3LJA A;  3REL B;  1P3G D;  1KX5 A;  3X1V C;  1Z2C B;  5G49 A;  4R8P C;  4XZQ B;  1P3I B;  2Y2M A;  1KU5 A;  3LJA C;  2ZY4 A;  2F2A C;  1P3K A;  1KX5 C;  2Y2N A;  4R8P D;  5B2J B;  5B24 D;  1F66 A;  4EO5 C;  3C1C D;  1TAF A;  1KX5 D;  2Y2O A;  1F66 C;  3W96 D;  3O62 A;  5GXQ B;  1P3K D;  3TU4 D;  2ZY2 A;  5KDM A;  4WU8 B;  1F66 D;  3VH6 W;  3X1T A;  3AZF B;  1P3G B;  2W8S A;  3AYW A;  3X1T C;  3O62 D;  5DNN D;  3AYW C;  3X1V B;  4R8P B;  5B24 B;  3C1C B;  4WU9 A;  4Z2M G;  2JE5 A;  1KX5 B;  3AYW D;  3F6T A;  5G49 B;  3WA9 D;  4KUD A;  3W96 B;  4H9P A;  4WU9 C;  3VH6 T;  1P3K B;  2F8N D;  3B6F A;  2NQB D;  1F66 B;  4KUD C;  3B6F C;  3MGQ C;  5BT1 D;  1M19 D;  3MGS A;  3O62 B;  3WKJ D;  3REH A;  5DNN B;  5KDM B;  1TZY A;  5BS7 A;  3REH C;  3AYW B;  3WA9 B;  1TZY C;  2XD1 A;  3MGS D;  5BS7 C;  2L5A A;  3VH5 W;  1M1A D;  2F8N B;  1N1J A;  3EPJ A;  3UTB A;  2NQB B;  4H9O B;  1S32 C;  1M19 B;  3REK A;  3KUY D;  5BNV A;  3WKJ B;  3AV2 A;  3UTB D;  4ZUX D;  3AV2 C;  3W99 A;  3VH5 T;  5F99 D;  1P3M A;  3EPH A;  2JSS A;  3MGS B;  3REK D;  1M1A B;  4KHA A;  2G5I C;  3W99 C;  5GSU C;  3UT9 D;  4J8X A;  1P3L C;  3V9R B;  1P3M C;  2Y2K A;  4J8X C;  5GT0 C;  3B6G A;  5E5A A;  3KUY B;  5B1M A;  3UTB B;  4ZUX B;  3B6G C;  2Y2L A;  5F99 B;  1B6W A;  4X23 A;  5B0Z A;  5E5A D;  1F1E A;  5DNM A;  3H0R C;  3REK B;  5BNV B;  5B1M D;  3AZN C;  1KX3 A;  3UTA A;  3AN2 D;  3UT9 B;  3WTP A;  5DNM C;  2NZD D;  3LEL A;  3MGP D;  1ID3 A;  4J8U A;  3UTA C;  4X23 D;  5B0Z D;  3EPK A;  3LEL C;  4KHA B;  1KX3 D;  1ID3 C;  3REJ C;  3UTA D;  2F8N G;  3B0D C;  3WTP D;  3C1B D;  3B0C W;  4J8U D;  4ZBJ C;  4CSR A;  4WJ3 C;  4Z2M H;  5E5A B;  5AV6 C;  5B1M B;  5B32 A;  5B31 D;  2HUE C;  3AN2 B;  1WWI A;  5AV9 A;  4HGA B;  2NZD B;  3MGP B;  5B32 C;  3AZE A;  4X23 B;  5B0Z B;  3A1K A;  5JRG A;  1U35 D;  5AV9 C;  1KX3 B;  5B32 D;  5C3I B;  3UTA B;  4DRB A;  3B0C T;  2HIO A;  3WTP B;  5JRG C;  3C1B B;  5AVB D;  5B2J A;  4J8U B;  5AV5 A;  1P3I C;  3AZE D;  3B0D B;  2Y2H A;  3H0L C;  2J8P A;  5B31 B;  5B2J C;  3AZK D;  4G92 C;  2HIO D;  4KGC D;  1ULY A;  2ZY3 A;  5GXQ A;  1ZLA D;  4WU8 A;  5AV5 D;  3AZF A;  1Q9C A;  4NE6 A;  3NQJ B;  1U35 B;  5GXQ C;  4E44 A;  5B32 B;  3LZ1 D;  4WU8 C;  2BG1 A;  3AZF C;  2DF4 C;  5CPI D;  1P3G C;  1H3O B;  2ZY5 A;  5AVB B;  5B33 D;  3C1C A;  3AZE B;  5JRG B;  5B1L D;  5B24 C;  3AZK B;  2YFV A;  3W96 A;  3C1C C;  2HIO B;  4CAY B;  4KGC B;  2Y2Q A;  3TU4 A;  1ZLA B;  2YFW A;  4G92 B;  5AV5 B;  3W96 C;  3IP4 C;  3KWQ D;  1P3K C;  3TU4 C;  4J8W A;  3AZI A;  5AV8 A;  3LZ1 B;  4LD9 D;  5DNN A;  3H0M C;  5AV8 C;  5GT3 D;  4J8W C;  5CPI B;  5B33 B;  3O62 C;  4J8W D;  5DNN C;  5AV8 D;  5B1L B;  3AZI D;  3WA9 A;  2F8N A;  2NQB A;  5BO0 B;  2Y2P A;  4H9O A;  3WA9 C;  3KFU G;  3KWQ B;  2NQB C;  1M19 A;  2Y2J A;  2YFV B;  4LD9 B;  4WZS B;  3WKJ A;  5B0Y D;  3TU4 B;  4H9Q A;  5BT1 C;  2YFW B;  5GT3 B;  1P34 A;  1M19 C;  5CPK D;  3EG5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...