5C3IB

Crystal structure of the quaternary complex of histone h3-h4 heterodimer with chaperone asf1 and the replicative helicase subunit mcm2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
LREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Histone chaperone ASF1A
publication title Structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 87
sequence length 87
chains with identical sequence F, J, N, R, V
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5c3iB00
4QLCA 4YM6A 3UTBC 5B24D 1N1JB 1P3FD 3AYWD 3AZHA 3MNNA 1S32A 1P3MC 4J8UD 5AVBA 4WU9C 1P3GA 3WTPD 1KX3D 5B40C 3W98C 5BO0B 5B1LD 3A6NB 4E44A 2AROC 3LZ0C 1P3AC 1BH9A 1P3KC 1AOID 3REJB 3KUYB 5AV6D 1P34B 3AFAB 5GXQB 5B31D 4X23C 4KUDC 1JFIA 1TZYB 4CSRA 5CPKA 4NE6A 3WAAD 5B33A 3VH6T 5F99B 2NQBD 5B0YD 3MGPA 5GT0B 3O62C 5CPJB 3WA9C 4WNNA 3C1BD 3MGQB 1U35B 1EQZC 5C3IC 5E5AB 5CPIA 3B6GA 1A7WA 5B0ZB 5CPKD 5AV8C 3B0DC 4EO5B 5DNND 4H9PB 1TAFB 4HGAB 4NFTA 3REHA 3AZKD 2FJ7C 3TU4A 1P3OD 1WWIA 1ZLAD 4KHAA 4DRAA 3X1UD 3UT9A 2HIOD 3UTBB 5AY8A 2BYKB 4QLCC 4YM6C 5JRGD 3V9RA 1P3MB 4J8VD 3AN2D 3AZHC 1S32C 4LD9D 4WU9B 2F8NH 5BNVA 2CV5D 5B2JD 5B40B 3X1VD 1P3GC 2RVQD 4J8XD 1P3KB 4G92C 1H3OA 3MGRD 4X23B 4KUDB 5B32A 2HUEC 5GT3A 3KXBD 3MVDD 4H9NB 3AZJA 5B33C 1ID3D 4E45A 3LELA 3MGPC 1M19A 3WKJD 1Q9CA 2BYMB 3AZLA 3AZMB 3B0BA 5B1MA 1P3BB 3A6ND 4XUJA 5C3IB 1EQZB 4JJNA 3C1CD 3B0DB 5AV8B 1P34D 5CPIC 3NQJB 1F66A 1KX5A 2FJ7B 3AZFB 1P3LD 3B6FC 3B6GC 3LZ1A 3REHC 5AV9C 3KSYA 3UTAC 1TZYD 1HQ3C 3VH5W 3AV1A 3AZID 3UT9C 4H9QA 1M1AA 4YM6B 3X1TA 1P3ID 4CAYB 5AY8C 2F8NA 4KGCB 5CP6A 3LJAD 5F99D 5AV5A 5KDMA 5GT0D 2PYOD 4Z66C 3RELA 3LZ1D 3X1SA 4G92B 3MGQD 1U35D 4Z5TA 4Z2MH 4ZUXA 1BH9B 5E5AD 3KWQD 5B32C 5B24A 1P3FA 3AYWA 5GT3C 3W99D 1KX4D 4J8UA 2IO5C 4ZBJC 3WTPA 3VH6W 4WU8D 1KX3A 1M18D 5B1LA 3AZJC 4AWLC 4XZQB 3MGPB 1AOIA 5AV6A 3LELC 1M19C 5B31A 4WV4B 3REKD 3AZLC 4YS3D 1P3KD 5B1MC 4XUJC 5CPIB 1BFMA 4JJNC 3B6GB 3B6FB 4H9OA 5AV9B 1KX5C 3WAAA 3UTAB 1HQ3B 2NZDB 5AVCB 3UT9B 2NQBA 3W97B 5B0YA 3AV1C 3AV2D 5AY8B 3AZGD 3C1BA 5B2IB 5CP6C 2LY8A 3MGSC 3B0CT 5BNVB 4Z66B 5DNNA 3AZKA 3AZMD 1P3BD 5BT1D 4J8WD 1P3PC 1P3OA 3NQUA 3VH6A 5DNMD 3X1UA 3X1SC 1ZLAA 4Z5TC 2HIOA 4ZUXC 3AZND 3REID 2FJ7D 5B32B 3AZFD 2YFWA 5JRGA 5B24C 5GT3B 1P3FC 3AYWC 4J8VA 3AN2A 2IO5B 4ZBJB 4LD9A 4R8PB 2CV5A 5B2JA 4J8UC 3X1VA 5GSUC 4KGCD 4J8XA 3WTPC 4H9RA 3W96C 1KX3C 5CHLB 5B1LC 5FUGA 3LELB 1M19B 1HTAA 1AOIC 5BNXB 3MGRA 5AV6C 5B1MB 5B31C 1ULYA 3KXBA 3MVDA 2JSSA 3MNNC 5BS7A 3W98B 5AVBC 2F8NK 1ID3A 2AROB 2YFVB 3LZ0B 3AV1B 1P3AB 5B32G 4H9QB 2NQBC 5B0YC 3AZED 3WKJA 2F8NB 4G91C 5BO0A 3A6NA 3C1BC 4XZQD 3MGSB 3C1CA 5KDMB 1P34A 1P3LA 5CPKC 1P3PB 5DNNC 4Z5TB 1TZYA 1P3OC 3AZIA 1ZLAC 3X1UC 3B6FD 2HIOC 1P3IA 5AV9D 3O62B 3UTAD 3WA9B 1HQ3D 5B24B 1P3FB 3AYWB 2NZDD 5AVCD 3LJAA 3R45A 5F99A 5JRGC 3W97D 4J8VC 3AN2C 3REJD 3KUYD 4J8UB 5GT0A 4LD9C 5GSUB 3AFAD 2CV5C 3WTPB 5GXQD 5B2JC 2PYOA 3W96B 3X1VC 5B1LB 5B2ID 2RVQC 3MGQA 4J8XC 1U35A 5E5AA 1AOIB 3TU4C 2F8NG 5AV6B 5JA4A 3KWQA 5B31B 4QLCB 3MGRC 1TAFA 3AZHB 3MNNB 1S32B 3KXBC 4H9OB 1KX4A 3MVDC 3W99A 2BYKA 5AVBB 1P3GB 4WU8A 5BS7C 5CPJD 1BH8A 1M18A 1ID3C 2NQBB 5B0YB 4R8PD 4G91B 5B0ZD 3WKJC 3REKA 3C1BB 4YS3A 1JFIB 1P3KA 2HUEB 1B67A 1R4VA 4CSRB 3B0CW 3WTPE 3C1CC 5CPKB 3UTBD 1P3LC 5B33B 1P3OB 2HIOB 1TZYC 5B31G 1P3MD 3AV2A 3AZIC 3AZGA 4H9NA 4WU9D 2YFWB 5B40D 1P3IC 3W98D 5JRGB 4WNNB 2AROD 3LZ0D 1P3AD 3AN2B 3LJAC 4LD9B 5B2JB 4M6BA 4X23D 3REHB 3AZMA 4UUZA 4KUDD 4J8XB 1P3BA 1F66C 2PYOC 4J8WA 3LZ1C 3TU4B 5DNMA 3MGSD 4KHAB 3AZNA 5E5AC 3MGRB 3REIA 2FJ7A 3AZFA 1M1AC 3KWQC 1P3PD 3X1TC 4Z2MG 3V9RB 3KXBB 3VH5T 5AV5C 3W99C 1KX4C 4NE5A 4CAYA 3O62D 3WA9D 4KGCA 1ID3B 4WU8C 1B6WA 3RELC 1M18C 1EQZD 4WZSB 3WKJB 5AV8D 1H3OB 5GSUD 3W96D 3REKC 4YS3C 3C1CB 4QLCD 1P3LB 4YM6D 3AZJB 1KU5A 4AWLB 3AZHD 3MNND 3AZIB 1S32D 3AZEA 3AV2C 1P3IB 5AVBD 3AZGC 3AZLB 1P3GD 1WWSA 3LJAB 3R45B 4XUJB 4XZQA 4JJNB 5G49A 4H9SA 1F66B 1KX5B 2PYOB 3LZ1B 3AZMC 1P3BC 1N1JA 3WAAC 5BT1C 4J8WC 5DNMC 3B6FA 2L5AA 3AZNC 5JA4B 3KWQB 1M1AB 5AV9A 4NE3A 3X1TB 3REIC 3AZFC 3UTAA 5B33D 1HQ3A 2NZDA 5CP6B 5AVCA 3W97A 5AV5B 3MGPD 1KX4B 3REJA 3KUYA 3W99B 3AFAA 5GXQA 4WU8B 3RELB 1M18B 1BH8B 3AZKC 4KGCC 5B2IA 2CWEA 3X1SB 4ZUXB 5CPID 3B6GD 4Z66A 1F1EA 3REHD 3REKB 4YS3B 3TU4D 3UT9D 5AY8D 1KX3B 5CPJA 3AV2B 4R8PA 3AZGB 5B0ZA 4Z66D 3AZEC 4H9PA 4XZQC 5BNXA 3UTBA 4UUZB 5B32D 4H9SC 3WAAB 4J8WB 5DNMB 5GT3D 3AZNB 1P3MA 3REIB 4WU9A 5B40A 3W98A 3AZJD 2AROA 2YFVA 3LZ0A 1P3AA 2NZDC 5AVCC 3A6NC 3W97C 3LELD 1M19D 3REJC 4X23A 3KUYC 3AZLD 5DNNB 3AZKB 3AFAC 1P34C 4KUDA 5GXQC 5B1MD 4XUJD 3NQUB 1ZLAB 5B2IC 3X1UB 3MGSA 4DRBA 4JJND 1F66D 1KX5D 1P3PA 3AV1D 4J8VB 1M1AD 5F99C 2CV5B 3X1TD 2BYMA 3O62A 3WA9A 5GT0C 3X1VB 2F8ND 4H9RB 5CP6D 5CPJC 1EQZA 5FUGB 3MGQC 5AV5D 1U35C 3AZEB 5AV8A 4R8PC 5GSUA 3NQJA 3W96A 5B0ZC 3RELD 4EO5C 4HGAC 3X1SD 4Z5TD 4ZUXD 3VH5A 3MVDB 5G49B
chains in the Genus database with same CATH superfamily
4QLCA 4YM6A 3UTBC 5B24D 1N1JB 1P3FD 3AYWD 3AZHA 3MNNA 1S32A 1P3MC 4J8UD 5AVBA 4WU9C 1P3GA 1Z2CB 2ZY2A 3WTPD 1KX3D 5B40C 3W98C 5BO0B 2Y2QA 5B1LD 3A6NB 4E44A 2AROC 3LZ0C 1P3AC 1BH9A 1P3KC 3H0RC 3REJB 3KUYB 1AOID 5AV6D 1P34B 2RIQA 3AFAB 5GXQB 5B31D 4X23C 2Y2LA 4KUDC 1JFIA 1TZYB 4CSRA 5CPKA 4NE6A 3WAAD 5B33A 3VH6T 3EG5B 5F99B 2NQBD 5B0YD 3MGPA 5GT0B 3O62C 5CPJB 3WA9C 4WNNA 3C1BD 3MGQB 3EPKA 2UWXA 1U35B 1EQZC 5C3IC 5E5AB 5CPIA 3B6GA 1A7WA 5B0ZB 5CPKD 5AV8C 3B0DC 4EO5B 5DNND 4H9PB 1TAFB 4HGAB 4NFTA 3REHA 3AZKD 2FJ7C 3TU4A 1P3OD 1WWIA 1ZLAD 4KHAA 4DRAA 3X1UD 3UT9A 2HIOD 3UTBB 5AY8A 2BYKB 4QLCC 4YM6C 2ZY4A 5JRGD 2G5HC 3V9RA 1P3MB 4J8VD 3AN2D 3AZHC 1S32C 4LD9D 4WU9B 2F8NH 5BNVA 2CV5D 5B2JD 5B40B 3X1VD 1P3GC 2RVQD 4J8XD 1P3KB 4G92C 1H3OA 3MGRD 4X23B 2ZM5A 2JCHA 4KUDB 5B32A 2HUEC 5GT3A 3KXBD 3MVDD 4H9NB 3AZJA 5B33C 1ID3D 4E45A 2ZY5A 3LELA 3MGPC 1M19A 3WKJD 1Q9CA 2BYMB 3AZLA 3AZMB 3B0BA 5B1MA 1P3BB 3A6ND 4XUJA 5C3IB 1EQZB 4JJNA 3C1CD 3B0DB 5AV8B 1P34D 5CPIC 3NQJB 1F66A 1KX5A 2FJ7B 3AZFB 1P3LD 3B6FC 3B6GC 3LZ1A 3REHC 5AV9C 3KSYA 3UTAC 1TZYD 1HQ3C 3VH5W 3AV1A 3AZID 3UT9C 4H9QA 1M1AA 4YM6B 3X1TA 1P3ID 4CAYB 5AY8C 2F8NA 4KGCB 5CP6A 3LJAD 5F99D 5AV5A 5KDMA 5GT0D 2PYOD 4Z66C 3RELA 3LZ1D 3X1SA 4G92B 3MGQD 1U35D 4Z5TA 4Z2MH 4ZUXA 1BH9B 5E5AD 3KWQD 5B32C 5B24A 1P3FA 3AYWA 2JE5A 5GT3C 3W99D 1KX4D 4J8UA 2IO5C 4ZBJC 3WTPA 3VH6W 4WU8D 1KX3A 1M18D 5B1LA 3AZJC 2FFFB 4AWLC 4XZQB 3MGPB 1AOIA 5AV6A 3LELC 1M19C 5B31A 4WV4B 3REKD 3AZLC 4YS3D 1P3KD 5B1MC 4XUJC 5CPIB 1BFMA 4JJNC 3B6GB 3B6FB 4H9OA 5AV9B 1KX5C 3WAAA 3UTAB 1HQ3B 2NZDB 5AVCB 3UT9B 2NQBA 3W97B 5B0YA 3AV1C 3AV2D 5AY8B 3AZGD 3KFUG 3FDDA 2DQNC 3C1BA 5B2IB 5CP6C 3F6TA 2LY8A 3MGSC 3B0CT 5BNVB 4Z66B 5DNNA 3AZKA 3AZMD 1P3BD 5BT1D 4J8WD 1P3PC 1P3OA 3NQUA 3VH6A 5DNMD 3X1UA 3X1SC 1ZLAA 4Z5TC 2HIOA 4ZUXC 3AZND 3REID 2FJ7D 5B32B 3AZFD 2YFWA 5JRGA 5B24C 5GT3B 1P3FC 3AYWC 4J8VA 3AN2A 2IO5B 4ZBJB 4LD9A 4R8PB 2CV5A 5B2JA 4J8UC 3X1VA 5GSUC 4KGCD 4J8XA 3WTPC 4H9RA 3W96C 1KX3C 5CHLB 5B1LC 5FUGA 4UPKA 3LELB 1M19B 1HTAA 1AOIC 5BNXB 3MGRA 5AV6C 5B1MB 5B31C 1ULYA 3KXBA 3MVDA 2JSSA 3MNNC 5BS7A 3W98B 5AVBC 3H0MC 2F8NK 1ID3A 2AROB 2YFVB 3LZ0B 3AV1B 1P3AB 5B32G 4H9QB 2NQBC 5B0YC 3AZED 3WKJA 2F8NB 2Y2GA 4G91C 5BO0A 3A6NA 3C1BC 4XZQD 3MGSB 3C1CA 5KDMB 1P34A 1P3LA 4WJ3C 5CPKC 1P3PB 5DNNC 4Z5TB 1TZYA 2Y2IA 1P3OC 3AZIA 1ZLAC 3X1UC 3B6FD 2HIOC 1P3IA 5AV9D 3O62B 3UTAD 3WA9B 1HQ3D 5B24B 1P3FB 3AYWB 2NZDD 5AVCD 3LJAA 2F2AC 3R45A 5F99A 5JRGC 3W97D 3AL0C 3H0LC 4J8VC 3AN2C 2ZY3A 3KUYD 4J8UB 3REJD 5GT0A 4LD9C 5GSUB 3AFAD 2CV5C 3WTPB 5GXQD 5B2JC 2PYOA 3W96B 3X1VC 5B1LB 5B2ID 2RVQC 3MGQA 4J8XC 1U35A 3A1KA 5E5AA 1AOIB 3TU4C 2F8NG 5AV6B 5JA4A 3KWQA 5B31B 4QLCB 3MGRC 1TAFA 1PZRA 3AZHB 3MNNB 1S32B 4DQYB 3KXBC 4H9OB 1KX4A 3MVDC 3W99A 2BYKA 2J8PA 5AVBB 1P3GB 4WU8A 5BS7C 5CPJD 1BH8A 1M18A 1ID3C 2NQBB 5B0YB 4R8PD 4G91B 5B0ZD 3WKJC 3REKA 3C1BB 4YS3A 1JFIB 1P3KA 2HUEB 1B67A 1R4VA 4CSRB 3B0CW 3WTPE 3C1CC 5CPKB 3UTBD 1P3LC 5B33B 1P3OB 2HIOB 1TZYC 5B31G 1P3MD 3AV2A 3AZIC 3AZGA 4H9NA 4WU9D 2XD5A 2YFWB 5B40D 1P3IC 3W98D 5JRGB 4WNNB 2AROD 3LZ0D 1P3AD 3AN2B 3LJAC 4LD9B 5B2JB 4M6BA 4X23D 3REHB 3AZMA 4UUZA 4KUDD 4J8XB 1P3BA 1F66C 2PYOC 4J8WA 3LZ1C 3TU4B 5DNMA 3MGSD 4KHAB 3AZNA 5E5AC 3MGRB 3REIA 2FJ7A 3AZFA 1M1AC 3KWQC 1P3PD 3X1TC 4Z2MG 3V9RB 3KXBB 3VH5T 2Y2HA 5AV5C 3W99C 1KX4C 2VQRA 4NE5A 4CAYA 3O62D 3WA9D 4KGCA 1ID3B 4WU8C 1B6WA 3RELC 1M18C 1EQZD 4WZSB 2Y2NA 3WKJB 5AV8D 1H3OB 5GSUD 3W96D 3REKC 4YS3C 3C1CB 4QLCD 1P3LB 4YM6D 3AZJB 1KU5A 4AWLB 3AZHD 3MNND 3AZIB 1S32D 3AZEA 3AV2C 1P3IB 5AVBD 3AZGC 3AZLB 1P3GD 1WWSA 3LJAB 3R45B 4XUJB 4XZQA 4JJNB 5G49A 4H9SA 1F66B 1KX5B 2PYOB 2G5IC 3LZ1B 3AZMC 1P3BC 1N1JA 3WAAC 5BT1C 4J8WC 5DNMC 3B6FA 2L5AA 3AZNC 5JA4B 3KWQB 1M1AB 5AV9A 4NE3A 3X1TB 3REIC 3AZFC 3UTAA 5B33D 1HQ3A 2NZDA 5CP6B 5AVCA 3W97A 2W8SA 5AV5B 3MGPD 1KX4B 3REJA 3KUYA 3W99B 3AFAA 3EPLA 5GXQA 4WU8B 3RELB 1M18B 1BH8B 3AZKC 4KGCC 5B2IA 2CWEA 3X1SB 4ZUXB 5CPID 3B6GD 4Z66A 1F1EA 3REHD 3REKB 1T3UA 4YS3B 2XD1A 2Y2MA 3TU4D 3UT9D 5AY8D 1KX3B 5CPJA 3AV2B 4R8PA 3AZGB 5B0ZA 4Z66D 3AZEC 4H9PA 3P5JB 3IP4C 4XZQC 5BNXA 2Y2KA 3UTBA 4UUZB 5B32D 4H9SC 3WAAB 4J8WB 3EPHA 5DNMB 5GT3D 3AZNB 1P3MA 3REIB 4WU9A 5B40A 3W98A 3AZJD 2AROA 2YFVA 3LZ0A 1P3AA 2NZDC 5AVCC 2BG1A 2Y2PA 3A6NC 3W97C 3LELD 1M19D 3REJC 4X23A 3KUYC 3AZLD 5DNNB 3AZKB 2Y2OA 3AFAC 1P34C 5GXQC 5B1MD 4KUDA 2Y2JA 3A1IA 4XUJD 3NQUB 1ZLAB 5B2IC 3X1UB 3MGSA 4DRBA 4JJND 1F66D 1KX5D 1P3PA 1W2EA 3AV1D 4J8VB 1M1AD 5F99C 2CV5B 3X1TD 2BYMA 3O62A 3WA9A 5GT0C 3X1VB 2F8ND 4H9RB 5CP6D 5CPJC 1EQZA 5FUGB 3MGQC 5AV5D 1U35C 3AZEB 5AV8A 4R8PC 5GSUA 3NQJA 3W96A 5B0ZC 3RELD 4EO5C 4HGAC 3X1SD 4Z5TD 2DF4C 4ZUXD 3EPJA 3VH5A 3MVDB 5G49B
chains in the Genus database with same CATH topology
4QLCA 4YM6A 3UTBC 5B24D 1N1JB 1P3FD 3AYWD 3AZHA 3MNNA 1S32A 1P3MC 4J8UD 5AVBA 4WU9C 1P3GA 1Z2CB 2ZY2A 3WTPD 1KX3D 5B40C 3W98C 5BO0B 2Y2QA 5B1LD 3A6NB 4E44A 2AROC 3LZ0C 1P3AC 1BH9A 1P3KC 3H0RC 3REJB 3KUYB 1AOID 5AV6D 1P34B 2RIQA 3AFAB 5GXQB 5B31D 4X23C 2Y2LA 4KUDC 1JFIA 1TZYB 4CSRA 5CPKA 4NE6A 3WAAD 5B33A 3VH6T 3EG5B 5F99B 2NQBD 5B0YD 3MGPA 5GT0B 3O62C 5CPJB 3WA9C 4WNNA 3C1BD 3MGQB 3EPKA 2UWXA 1U35B 1EQZC 5C3IC 5E5AB 5CPIA 3B6GA 1A7WA 5B0ZB 5CPKD 5AV8C 3B0DC 4EO5B 5DNND 4H9PB 1TAFB 4HGAB 4NFTA 3REHA 3AZKD 2FJ7C 3TU4A 1P3OD 1WWIA 1ZLAD 4KHAA 4DRAA 3X1UD 3UT9A 2HIOD 3UTBB 5AY8A 2BYKB 4QLCC 4YM6C 2ZY4A 5JRGD 2G5HC 3V9RA 1P3MB 4J8VD 3AN2D 3AZHC 1S32C 4LD9D 4WU9B 2F8NH 5BNVA 2CV5D 5B2JD 5B40B 3X1VD 1P3GC 2RVQD 4J8XD 1P3KB 4G92C 1H3OA 3MGRD 4X23B 2ZM5A 2JCHA 4KUDB 5B32A 2HUEC 5GT3A 3KXBD 3MVDD 4H9NB 3AZJA 5B33C 1ID3D 4E45A 2ZY5A 3LELA 3MGPC 1M19A 3WKJD 1Q9CA 2BYMB 3AZLA 3AZMB 3B0BA 5B1MA 1P3BB 3A6ND 4XUJA 5C3IB 1EQZB 4JJNA 3C1CD 3B0DB 5AV8B 1P34D 5CPIC 3NQJB 1F66A 1KX5A 2FJ7B 3AZFB 1P3LD 3B6FC 3B6GC 3LZ1A 3REHC 5AV9C 3KSYA 3UTAC 1TZYD 1HQ3C 3VH5W 3AV1A 3AZID 3UT9C 4H9QA 1M1AA 4YM6B 3X1TA 1P3ID 4CAYB 5AY8C 2F8NA 4KGCB 5CP6A 3LJAD 5F99D 5AV5A 5KDMA 5GT0D 2PYOD 4Z66C 3RELA 3LZ1D 3X1SA 4G92B 3MGQD 1U35D 4Z5TA 4Z2MH 4ZUXA 1BH9B 5E5AD 3KWQD 5B32C 5B24A 1P3FA 3AYWA 2JE5A 5GT3C 3W99D 1KX4D 4J8UA 2IO5C 4ZBJC 3WTPA 3VH6W 4WU8D 1KX3A 1M18D 5B1LA 3AZJC 2FFFB 4AWLC 4XZQB 3MGPB 1AOIA 5AV6A 3LELC 1M19C 5B31A 4WV4B 3REKD 3AZLC 4YS3D 1P3KD 5B1MC 4XUJC 5CPIB 1BFMA 4JJNC 3B6GB 3B6FB 4H9OA 5AV9B 1KX5C 3WAAA 3UTAB 1HQ3B 2NZDB 5AVCB 3UT9B 2NQBA 3W97B 5B0YA 3AV1C 3AV2D 5AY8B 3AZGD 3KFUG 3FDDA 2DQNC 3C1BA 5B2IB 5CP6C 3F6TA 2LY8A 3MGSC 3B0CT 5BNVB 4Z66B 5DNNA 3AZKA 3AZMD 1P3BD 5BT1D 4J8WD 1P3PC 1P3OA 3NQUA 3VH6A 5DNMD 3X1UA 3X1SC 1ZLAA 4Z5TC 2HIOA 4ZUXC 3AZND 3REID 2FJ7D 5B32B 3AZFD 2YFWA 5JRGA 5B24C 5GT3B 1P3FC 3AYWC 4J8VA 3AN2A 2IO5B 4ZBJB 4LD9A 4R8PB 2CV5A 5B2JA 4J8UC 3X1VA 5GSUC 4KGCD 4J8XA 3WTPC 4H9RA 3W96C 1KX3C 5CHLB 5B1LC 5FUGA 4UPKA 3LELB 1M19B 1HTAA 1AOIC 5BNXB 3MGRA 5AV6C 5B1MB 5B31C 1ULYA 3KXBA 3MVDA 2JSSA 3MNNC 5BS7A 3W98B 5AVBC 3H0MC 2F8NK 1ID3A 2AROB 2YFVB 3LZ0B 3AV1B 1P3AB 5B32G 4H9QB 2NQBC 5B0YC 3AZED 3WKJA 2F8NB 2Y2GA 4G91C 5BO0A 3A6NA 3C1BC 4XZQD 3MGSB 3C1CA 5KDMB 1P34A 1P3LA 4WJ3C 5CPKC 1P3PB 5DNNC 4Z5TB 1TZYA 2Y2IA 1P3OC 3AZIA 1ZLAC 3X1UC 3B6FD 2HIOC 1P3IA 5AV9D 3O62B 3UTAD 3WA9B 1HQ3D 5B24B 1P3FB 3AYWB 2NZDD 5AVCD 3LJAA 2F2AC 3R45A 5F99A 5JRGC 3W97D 3AL0C 3H0LC 4J8VC 3AN2C 2ZY3A 3KUYD 4J8UB 3REJD 5GT0A 4LD9C 5GSUB 3AFAD 2CV5C 3WTPB 5GXQD 5B2JC 2PYOA 3W96B 3X1VC 5B1LB 5B2ID 2RVQC 3MGQA 4J8XC 1U35A 3A1KA 5E5AA 1AOIB 3TU4C 2F8NG 5AV6B 5JA4A 3KWQA 5B31B 4QLCB 3MGRC 1TAFA 1PZRA 3AZHB 3MNNB 1S32B 4DQYB 3KXBC 4H9OB 1KX4A 3MVDC 3W99A 2BYKA 2J8PA 5AVBB 1P3GB 4WU8A 5BS7C 5CPJD 1BH8A 1M18A 1ID3C 2NQBB 5B0YB 4R8PD 4G91B 5B0ZD 3WKJC 3REKA 3C1BB 4YS3A 1JFIB 1P3KA 2HUEB 1B67A 1R4VA 4CSRB 3B0CW 3WTPE 3C1CC 5CPKB 3UTBD 1P3LC 5B33B 1P3OB 2HIOB 1TZYC 5B31G 1P3MD 3AV2A 3AZIC 3AZGA 4H9NA 4WU9D 2XD5A 2YFWB 5B40D 1P3IC 3W98D 5JRGB 4WNNB 2AROD 3LZ0D 1P3AD 3AN2B 3LJAC 4LD9B 5B2JB 4M6BA 4X23D 3REHB 3AZMA 4UUZA 4KUDD 4J8XB 1P3BA 1F66C 2PYOC 4J8WA 3LZ1C 3TU4B 5DNMA 3MGSD 4KHAB 3AZNA 5E5AC 3MGRB 3REIA 2FJ7A 3AZFA 1M1AC 3KWQC 1P3PD 3X1TC 4Z2MG 3V9RB 3KXBB 3VH5T 2Y2HA 5AV5C 3W99C 1KX4C 2VQRA 4NE5A 4CAYA 3O62D 3WA9D 4KGCA 1ID3B 4WU8C 1B6WA 3RELC 1M18C 1EQZD 4WZSB 2Y2NA 3WKJB 5AV8D 1H3OB 5GSUD 3W96D 3REKC 4YS3C 3C1CB 4QLCD 1P3LB 4YM6D 3AZJB 1KU5A 4AWLB 3AZHD 3MNND 3AZIB 1S32D 3AZEA 3AV2C 1P3IB 5AVBD 3AZGC 3AZLB 1P3GD 1WWSA 3LJAB 3R45B 4XUJB 4XZQA 4JJNB 5G49A 4H9SA 1F66B 1KX5B 2PYOB 2G5IC 3LZ1B 3AZMC 1P3BC 1N1JA 3WAAC 5BT1C 4J8WC 5DNMC 3B6FA 2L5AA 3AZNC 5JA4B 3KWQB 1M1AB 5AV9A 4NE3A 3X1TB 3REIC 3AZFC 3UTAA 5B33D 1HQ3A 2NZDA 5CP6B 5AVCA 3W97A 2W8SA 5AV5B 3MGPD 1KX4B 3REJA 3KUYA 3W99B 3AFAA 3EPLA 5GXQA 4WU8B 3RELB 1M18B 1BH8B 3AZKC 4KGCC 5B2IA 2CWEA 3X1SB 4ZUXB 5CPID 3B6GD 4Z66A 1F1EA 3REHD 3REKB 1T3UA 4YS3B 2XD1A 2Y2MA 3TU4D 3UT9D 5AY8D 1KX3B 5CPJA 3AV2B 4R8PA 3AZGB 5B0ZA 4Z66D 3AZEC 4H9PA 3P5JB 3IP4C 4XZQC 5BNXA 2Y2KA 3UTBA 4UUZB 5B32D 4H9SC 3WAAB 4J8WB 3EPHA 5DNMB 5GT3D 3AZNB 1P3MA 3REIB 4WU9A 5B40A 3W98A 3AZJD 2AROA 2YFVA 3LZ0A 1P3AA 2NZDC 5AVCC 2BG1A 2Y2PA 3A6NC 3W97C 3LELD 1M19D 3REJC 4X23A 3KUYC 3AZLD 5DNNB 3AZKB 2Y2OA 3AFAC 1P34C 5GXQC 5B1MD 4KUDA 2Y2JA 3A1IA 4XUJD 3NQUB 1ZLAB 5B2IC 3X1UB 3MGSA 4DRBA 4JJND 1F66D 1KX5D 1P3PA 1W2EA 3AV1D 4J8VB 1M1AD 5F99C 2CV5B 3X1TD 2BYMA 3O62A 3WA9A 5GT0C 3X1VB 2F8ND 4H9RB 5CP6D 5CPJC 1EQZA 5FUGB 3MGQC 5AV5D 1U35C 3AZEB 5AV8A 4R8PC 5GSUA 3NQJA 3W96A 5B0ZC 3RELD 4EO5C 4HGAC 3X1SD 4Z5TD 2DF4C 4ZUXD 3EPJA 3VH5A 3MVDB 5G49B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QLC A;  4YM6 A;  3UTB C;  5B24 D;  1N1J B;  1P3F D;  3AYW D;  3AZH A;  3MNN A;  1S32 A;  1P3M C;  4J8U D;  5AVB A;  4WU9 C;  1P3G A;  3WTP D;  1KX3 D;  5B40 C;  3W98 C;  5BO0 B;  5B1L D;  3A6N B;  4E44 A;  2ARO C;  3LZ0 C;  1P3A C;  1BH9 A;  1P3K C;  1AOI D;  3REJ B;  3KUY B;  5AV6 D;  1P34 B;  3AFA B;  5GXQ B;  5B31 D;  4X23 C;  4KUD C;  1JFI A;  1TZY B;  4CSR A;  5CPK A;  4NE6 A;  3WAA D;  5B33 A;  3VH6 T;  5F99 B;  2NQB D;  5B0Y D;  3MGP A;  5GT0 B;  3O62 C;  5CPJ B;  3WA9 C;  4WNN A;  3C1B D;  3MGQ B;  1U35 B;  1EQZ C;  5C3I C;  5E5A B;  5CPI A;  3B6G A;  1A7W A;  5B0Z B;  5CPK D;  5AV8 C;  3B0D C;  4EO5 B;  5DNN D;  4H9P B;  1TAF B;  4HGA B;  4NFT A;  3REH A;  3AZK D;  2FJ7 C;  3TU4 A;  1P3O D;  1WWI A;  1ZLA D;  4KHA A;  4DRA A;  3X1U D;  3UT9 A;  2HIO D;  3UTB B;  5AY8 A;  2BYK B;  4QLC C;  4YM6 C;  5JRG D;  3V9R A;  1P3M B;  4J8V D;  3AN2 D;  3AZH C;  1S32 C;  4LD9 D;  4WU9 B;  2F8N H;  5BNV A;  2CV5 D;  5B2J D;  5B40 B;  3X1V D;  1P3G C;  2RVQ D;  4J8X D;  1P3K B;  4G92 C;  1H3O A;  3MGR D;  4X23 B;  4KUD B;  5B32 A;  2HUE C;  5GT3 A;  3KXB D;  3MVD D;  4H9N B;  3AZJ A;  5B33 C;  1ID3 D;  4E45 A;  3LEL A;  3MGP C;  1M19 A;  3WKJ D;  1Q9C A;  2BYM B;  3AZL A;  3AZM B;  3B0B A;  5B1M A;  1P3B B;  3A6N D;  4XUJ A;  5C3I B;  1EQZ B;  4JJN A;  3C1C D;  3B0D B;  5AV8 B;  1P34 D;  5CPI C;  3NQJ B;  1F66 A;  1KX5 A;  2FJ7 B;  3AZF B;  1P3L D;  3B6F C;  3B6G C;  3LZ1 A;  3REH C;  5AV9 C;  3KSY A;  3UTA C;  1TZY D;  1HQ3 C;  3VH5 W;  3AV1 A;  3AZI D;  3UT9 C;  4H9Q A;  1M1A A;  4YM6 B;  3X1T A;  1P3I D;  4CAY B;  5AY8 C;  2F8N A;  4KGC B;  5CP6 A;  3LJA D;  5F99 D;  5AV5 A;  5KDM A;  5GT0 D;  2PYO D;  4Z66 C;  3REL A;  3LZ1 D;  3X1S A;  4G92 B;  3MGQ D;  1U35 D;  4Z5T A;  4Z2M H;  4ZUX A;  1BH9 B;  5E5A D;  3KWQ D;  5B32 C;  5B24 A;  1P3F A;  3AYW A;  5GT3 C;  3W99 D;  1KX4 D;  4J8U A;  2IO5 C;  4ZBJ C;  3WTP A;  3VH6 W;  4WU8 D;  1KX3 A;  1M18 D;  5B1L A;  3AZJ C;  4AWL C;  4XZQ B;  3MGP B;  1AOI A;  5AV6 A;  3LEL C;  1M19 C;  5B31 A;  4WV4 B;  3REK D;  3AZL C;  4YS3 D;  1P3K D;  5B1M C;  4XUJ C;  5CPI B;  1BFM A;  4JJN C;  3B6G B;  3B6F B;  4H9O A;  5AV9 B;  1KX5 C;  3WAA A;  3UTA B;  1HQ3 B;  2NZD B;  5AVC B;  3UT9 B;  2NQB A;  3W97 B;  5B0Y A;  3AV1 C;  3AV2 D;  5AY8 B;  3AZG D;  3C1B A;  5B2I B;  5CP6 C;  2LY8 A;  3MGS C;  3B0C T;  5BNV B;  4Z66 B;  5DNN A;  3AZK A;  3AZM D;  1P3B D;  5BT1 D;  4J8W D;  1P3P C;  1P3O A;  3NQU A;  3VH6 A;  5DNM D;  3X1U A;  3X1S C;  1ZLA A;  4Z5T C;  2HIO A;  4ZUX C;  3AZN D;  3REI D;  2FJ7 D;  5B32 B;  3AZF D;  2YFW A;  5JRG A;  5B24 C;  5GT3 B;  1P3F C;  3AYW C;  4J8V A;  3AN2 A;  2IO5 B;  4ZBJ B;  4LD9 A;  4R8P B;  2CV5 A;  5B2J A;  4J8U C;  3X1V A;  5GSU C;  4KGC D;  4J8X A;  3WTP C;  4H9R A;  3W96 C;  1KX3 C;  5CHL B;  5B1L C;  5FUG A;  3LEL B;  1M19 B;  1HTA A;  1AOI C;  5BNX B;  3MGR A;  5AV6 C;  5B1M B;  5B31 C;  1ULY A;  3KXB A;  3MVD A;  2JSS A;  3MNN C;  5BS7 A;  3W98 B;  5AVB C;  2F8N K;  1ID3 A;  2ARO B;  2YFV B;  3LZ0 B;  3AV1 B;  1P3A B;  5B32 G;  4H9Q B;  2NQB C;  5B0Y C;  3AZE D;  3WKJ A;  2F8N B;  4G91 C;  5BO0 A;  3A6N A;  3C1B C;  4XZQ D;  3MGS B;  3C1C A;  5KDM B;  1P34 A;  1P3L A;  5CPK C;  1P3P B;  5DNN C;  4Z5T B;  1TZY A;  1P3O C;  3AZI A;  1ZLA C;  3X1U C;  3B6F D;  2HIO C;  1P3I A;  5AV9 D;  3O62 B;  3UTA D;  3WA9 B;  1HQ3 D;  5B24 B;  1P3F B;  3AYW B;  2NZD D;  5AVC D;  3LJA A;  3R45 A;  5F99 A;  5JRG C;  3W97 D;  4J8V C;  3AN2 C;  3REJ D;  3KUY D;  4J8U B;  5GT0 A;  4LD9 C;  5GSU B;  3AFA D;  2CV5 C;  3WTP B;  5GXQ D;  5B2J C;  2PYO A;  3W96 B;  3X1V C;  5B1L B;  5B2I D;  2RVQ C;  3MGQ A;  4J8X C;  1U35 A;  5E5A A;  1AOI B;  3TU4 C;  2F8N G;  5AV6 B;  5JA4 A;  3KWQ A;  5B31 B;  4QLC B;  3MGR C;  1TAF A;  3AZH B;  3MNN B;  1S32 B;  3KXB C;  4H9O B;  1KX4 A;  3MVD C;  3W99 A;  2BYK A;  5AVB B;  1P3G B;  4WU8 A;  5BS7 C;  5CPJ D;  1BH8 A;  1M18 A;  1ID3 C;  2NQB B;  5B0Y B;  4R8P D;  4G91 B;  5B0Z D;  3WKJ C;  3REK A;  3C1B B;  4YS3 A;  1JFI B;  1P3K A;  2HUE B;  1B67 A;  1R4V A;  4CSR B;  3B0C W;  3WTP E;  3C1C C;  5CPK B;  3UTB D;  1P3L C;  5B33 B;  1P3O B;  2HIO B;  1TZY C;  5B31 G;  1P3M D;  3AV2 A;  3AZI C;  3AZG A;  4H9N A;  4WU9 D;  2YFW B;  5B40 D;  1P3I C;  3W98 D;  5JRG B;  4WNN B;  2ARO D;  3LZ0 D;  1P3A D;  3AN2 B;  3LJA C;  4LD9 B;  5B2J B;  4M6B A;  4X23 D;  3REH B;  3AZM A;  4UUZ A;  4KUD D;  4J8X B;  1P3B A;  1F66 C;  2PYO C;  4J8W A;  3LZ1 C;  3TU4 B;  5DNM A;  3MGS D;  4KHA B;  3AZN A;  5E5A C;  3MGR B;  3REI A;  2FJ7 A;  3AZF A;  1M1A C;  3KWQ C;  1P3P D;  3X1T C;  4Z2M G;  3V9R B;  3KXB B;  3VH5 T;  5AV5 C;  3W99 C;  1KX4 C;  4NE5 A;  4CAY A;  3O62 D;  3WA9 D;  4KGC A;  1ID3 B;  4WU8 C;  1B6W A;  3REL C;  1M18 C;  1EQZ D;  4WZS B;  3WKJ B;  5AV8 D;  1H3O B;  5GSU D;  3W96 D;  3REK C;  4YS3 C;  3C1C B;  4QLC D;  1P3L B;  4YM6 D;  3AZJ B;  1KU5 A;  4AWL B;  3AZH D;  3MNN D;  3AZI B;  1S32 D;  3AZE A;  3AV2 C;  1P3I B;  5AVB D;  3AZG C;  3AZL B;  1P3G D;  1WWS A;  3LJA B;  3R45 B;  4XUJ B;  4XZQ A;  4JJN B;  5G49 A;  4H9S A;  1F66 B;  1KX5 B;  2PYO B;  3LZ1 B;  3AZM C;  1P3B C;  1N1J A;  3WAA C;  5BT1 C;  4J8W C;  5DNM C;  3B6F A;  2L5A A;  3AZN C;  5JA4 B;  3KWQ B;  1M1A B;  5AV9 A;  4NE3 A;  3X1T B;  3REI C;  3AZF C;  3UTA A;  5B33 D;  1HQ3 A;  2NZD A;  5CP6 B;  5AVC A;  3W97 A;  5AV5 B;  3MGP D;  1KX4 B;  3REJ A;  3KUY A;  3W99 B;  3AFA A;  5GXQ A;  4WU8 B;  3REL B;  1M18 B;  1BH8 B;  3AZK C;  4KGC C;  5B2I A;  2CWE A;  3X1S B;  4ZUX B;  5CPI D;  3B6G D;  4Z66 A;  1F1E A;  3REH D;  3REK B;  4YS3 B;  3TU4 D;  3UT9 D;  5AY8 D;  1KX3 B;  5CPJ A;  3AV2 B;  4R8P A;  3AZG B;  5B0Z A;  4Z66 D;  3AZE C;  4H9P A;  4XZQ C;  5BNX A;  3UTB A;  4UUZ B;  5B32 D;  4H9S C;  3WAA B;  4J8W B;  5DNM B;  5GT3 D;  3AZN B;  1P3M A;  3REI B;  4WU9 A;  5B40 A;  3W98 A;  3AZJ D;  2ARO A;  2YFV A;  3LZ0 A;  1P3A A;  2NZD C;  5AVC C;  3A6N C;  3W97 C;  3LEL D;  1M19 D;  3REJ C;  4X23 A;  3KUY C;  3AZL D;  5DNN B;  3AZK B;  3AFA C;  1P34 C;  4KUD A;  5GXQ C;  5B1M D;  4XUJ D;  3NQU B;  1ZLA B;  5B2I C;  3X1U B;  3MGS A;  4DRB A;  4JJN D;  1F66 D;  1KX5 D;  1P3P A;  3AV1 D;  4J8V B;  1M1A D;  5F99 C;  2CV5 B;  3X1T D;  2BYM A;  3O62 A;  3WA9 A;  5GT0 C;  3X1V B;  2F8N D;  4H9R B;  5CP6 D;  5CPJ C;  1EQZ A;  5FUG B;  3MGQ C;  5AV5 D;  1U35 C;  3AZE B;  5AV8 A;  4R8P C;  5GSU A;  3NQJ A;  3W96 A;  5B0Z C;  3REL D;  4EO5 C;  4HGA C;  3X1S D;  4Z5T D;  4ZUX D;  3VH5 A;  3MVD B;  5G49 B; 
#chains in the Genus database with same CATH topology
 4QLC A;  4YM6 A;  3UTB C;  5B24 D;  1N1J B;  1P3F D;  3AYW D;  3AZH A;  3MNN A;  1S32 A;  1P3M C;  4J8U D;  5AVB A;  4WU9 C;  1P3G A;  1Z2C B;  2ZY2 A;  3WTP D;  1KX3 D;  5B40 C;  3W98 C;  5BO0 B;  2Y2Q A;  5B1L D;  3A6N B;  4E44 A;  2ARO C;  3LZ0 C;  1P3A C;  1BH9 A;  1P3K C;  3H0R C;  3REJ B;  3KUY B;  1AOI D;  5AV6 D;  1P34 B;  2RIQ A;  3AFA B;  5GXQ B;  5B31 D;  4X23 C;  2Y2L A;  4KUD C;  1JFI A;  1TZY B;  4CSR A;  5CPK A;  4NE6 A;  3WAA D;  5B33 A;  3VH6 T;  3EG5 B;  5F99 B;  2NQB D;  5B0Y D;  3MGP A;  5GT0 B;  3O62 C;  5CPJ B;  3WA9 C;  4WNN A;  3C1B D;  3MGQ B;  3EPK A;  2UWX A;  1U35 B;  1EQZ C;  5C3I C;  5E5A B;  5CPI A;  3B6G A;  1A7W A;  5B0Z B;  5CPK D;  5AV8 C;  3B0D C;  4EO5 B;  5DNN D;  4H9P B;  1TAF B;  4HGA B;  4NFT A;  3REH A;  3AZK D;  2FJ7 C;  3TU4 A;  1P3O D;  1WWI A;  1ZLA D;  4KHA A;  4DRA A;  3X1U D;  3UT9 A;  2HIO D;  3UTB B;  5AY8 A;  2BYK B;  4QLC C;  4YM6 C;  2ZY4 A;  5JRG D;  2G5H C;  3V9R A;  1P3M B;  4J8V D;  3AN2 D;  3AZH C;  1S32 C;  4LD9 D;  4WU9 B;  2F8N H;  5BNV A;  2CV5 D;  5B2J D;  5B40 B;  3X1V D;  1P3G C;  2RVQ D;  4J8X D;  1P3K B;  4G92 C;  1H3O A;  3MGR D;  4X23 B;  2ZM5 A;  2JCH A;  4KUD B;  5B32 A;  2HUE C;  5GT3 A;  3KXB D;  3MVD D;  4H9N B;  3AZJ A;  5B33 C;  1ID3 D;  4E45 A;  2ZY5 A;  3LEL A;  3MGP C;  1M19 A;  3WKJ D;  1Q9C A;  2BYM B;  3AZL A;  3AZM B;  3B0B A;  5B1M A;  1P3B B;  3A6N D;  4XUJ A;  5C3I B;  1EQZ B;  4JJN A;  3C1C D;  3B0D B;  5AV8 B;  1P34 D;  5CPI C;  3NQJ B;  1F66 A;  1KX5 A;  2FJ7 B;  3AZF B;  1P3L D;  3B6F C;  3B6G C;  3LZ1 A;  3REH C;  5AV9 C;  3KSY A;  3UTA C;  1TZY D;  1HQ3 C;  3VH5 W;  3AV1 A;  3AZI D;  3UT9 C;  4H9Q A;  1M1A A;  4YM6 B;  3X1T A;  1P3I D;  4CAY B;  5AY8 C;  2F8N A;  4KGC B;  5CP6 A;  3LJA D;  5F99 D;  5AV5 A;  5KDM A;  5GT0 D;  2PYO D;  4Z66 C;  3REL A;  3LZ1 D;  3X1S A;  4G92 B;  3MGQ D;  1U35 D;  4Z5T A;  4Z2M H;  4ZUX A;  1BH9 B;  5E5A D;  3KWQ D;  5B32 C;  5B24 A;  1P3F A;  3AYW A;  2JE5 A;  5GT3 C;  3W99 D;  1KX4 D;  4J8U A;  2IO5 C;  4ZBJ C;  3WTP A;  3VH6 W;  4WU8 D;  1KX3 A;  1M18 D;  5B1L A;  3AZJ C;  2FFF B;  4AWL C;  4XZQ B;  3MGP B;  1AOI A;  5AV6 A;  3LEL C;  1M19 C;  5B31 A;  4WV4 B;  3REK D;  3AZL C;  4YS3 D;  1P3K D;  5B1M C;  4XUJ C;  5CPI B;  1BFM A;  4JJN C;  3B6G B;  3B6F B;  4H9O A;  5AV9 B;  1KX5 C;  3WAA A;  3UTA B;  1HQ3 B;  2NZD B;  5AVC B;  3UT9 B;  2NQB A;  3W97 B;  5B0Y A;  3AV1 C;  3AV2 D;  5AY8 B;  3AZG D;  3KFU G;  3FDD A;  2DQN C;  3C1B A;  5B2I B;  5CP6 C;  3F6T A;  2LY8 A;  3MGS C;  3B0C T;  5BNV B;  4Z66 B;  5DNN A;  3AZK A;  3AZM D;  1P3B D;  5BT1 D;  4J8W D;  1P3P C;  1P3O A;  3NQU A;  3VH6 A;  5DNM D;  3X1U A;  3X1S C;  1ZLA A;  4Z5T C;  2HIO A;  4ZUX C;  3AZN D;  3REI D;  2FJ7 D;  5B32 B;  3AZF D;  2YFW A;  5JRG A;  5B24 C;  5GT3 B;  1P3F C;  3AYW C;  4J8V A;  3AN2 A;  2IO5 B;  4ZBJ B;  4LD9 A;  4R8P B;  2CV5 A;  5B2J A;  4J8U C;  3X1V A;  5GSU C;  4KGC D;  4J8X A;  3WTP C;  4H9R A;  3W96 C;  1KX3 C;  5CHL B;  5B1L C;  5FUG A;  4UPK A;  3LEL B;  1M19 B;  1HTA A;  1AOI C;  5BNX B;  3MGR A;  5AV6 C;  5B1M B;  5B31 C;  1ULY A;  3KXB A;  3MVD A;  2JSS A;  3MNN C;  5BS7 A;  3W98 B;  5AVB C;  3H0M C;  2F8N K;  1ID3 A;  2ARO B;  2YFV B;  3LZ0 B;  3AV1 B;  1P3A B;  5B32 G;  4H9Q B;  2NQB C;  5B0Y C;  3AZE D;  3WKJ A;  2F8N B;  2Y2G A;  4G91 C;  5BO0 A;  3A6N A;  3C1B C;  4XZQ D;  3MGS B;  3C1C A;  5KDM B;  1P34 A;  1P3L A;  4WJ3 C;  5CPK C;  1P3P B;  5DNN C;  4Z5T B;  1TZY A;  2Y2I A;  1P3O C;  3AZI A;  1ZLA C;  3X1U C;  3B6F D;  2HIO C;  1P3I A;  5AV9 D;  3O62 B;  3UTA D;  3WA9 B;  1HQ3 D;  5B24 B;  1P3F B;  3AYW B;  2NZD D;  5AVC D;  3LJA A;  2F2A C;  3R45 A;  5F99 A;  5JRG C;  3W97 D;  3AL0 C;  3H0L C;  4J8V C;  3AN2 C;  2ZY3 A;  3KUY D;  4J8U B;  3REJ D;  5GT0 A;  4LD9 C;  5GSU B;  3AFA D;  2CV5 C;  3WTP B;  5GXQ D;  5B2J C;  2PYO A;  3W96 B;  3X1V C;  5B1L B;  5B2I D;  2RVQ C;  3MGQ A;  4J8X C;  1U35 A;  3A1K A;  5E5A A;  1AOI B;  3TU4 C;  2F8N G;  5AV6 B;  5JA4 A;  3KWQ A;  5B31 B;  4QLC B;  3MGR C;  1TAF A;  1PZR A;  3AZH B;  3MNN B;  1S32 B;  4DQY B;  3KXB C;  4H9O B;  1KX4 A;  3MVD C;  3W99 A;  2BYK A;  2J8P A;  5AVB B;  1P3G B;  4WU8 A;  5BS7 C;  5CPJ D;  1BH8 A;  1M18 A;  1ID3 C;  2NQB B;  5B0Y B;  4R8P D;  4G91 B;  5B0Z D;  3WKJ C;  3REK A;  3C1B B;  4YS3 A;  1JFI B;  1P3K A;  2HUE B;  1B67 A;  1R4V A;  4CSR B;  3B0C W;  3WTP E;  3C1C C;  5CPK B;  3UTB D;  1P3L C;  5B33 B;  1P3O B;  2HIO B;  1TZY C;  5B31 G;  1P3M D;  3AV2 A;  3AZI C;  3AZG A;  4H9N A;  4WU9 D;  2XD5 A;  2YFW B;  5B40 D;  1P3I C;  3W98 D;  5JRG B;  4WNN B;  2ARO D;  3LZ0 D;  1P3A D;  3AN2 B;  3LJA C;  4LD9 B;  5B2J B;  4M6B A;  4X23 D;  3REH B;  3AZM A;  4UUZ A;  4KUD D;  4J8X B;  1P3B A;  1F66 C;  2PYO C;  4J8W A;  3LZ1 C;  3TU4 B;  5DNM A;  3MGS D;  4KHA B;  3AZN A;  5E5A C;  3MGR B;  3REI A;  2FJ7 A;  3AZF A;  1M1A C;  3KWQ C;  1P3P D;  3X1T C;  4Z2M G;  3V9R B;  3KXB B;  3VH5 T;  2Y2H A;  5AV5 C;  3W99 C;  1KX4 C;  2VQR A;  4NE5 A;  4CAY A;  3O62 D;  3WA9 D;  4KGC A;  1ID3 B;  4WU8 C;  1B6W A;  3REL C;  1M18 C;  1EQZ D;  4WZS B;  2Y2N A;  3WKJ B;  5AV8 D;  1H3O B;  5GSU D;  3W96 D;  3REK C;  4YS3 C;  3C1C B;  4QLC D;  1P3L B;  4YM6 D;  3AZJ B;  1KU5 A;  4AWL B;  3AZH D;  3MNN D;  3AZI B;  1S32 D;  3AZE A;  3AV2 C;  1P3I B;  5AVB D;  3AZG C;  3AZL B;  1P3G D;  1WWS A;  3LJA B;  3R45 B;  4XUJ B;  4XZQ A;  4JJN B;  5G49 A;  4H9S A;  1F66 B;  1KX5 B;  2PYO B;  2G5I C;  3LZ1 B;  3AZM C;  1P3B C;  1N1J A;  3WAA C;  5BT1 C;  4J8W C;  5DNM C;  3B6F A;  2L5A A;  3AZN C;  5JA4 B;  3KWQ B;  1M1A B;  5AV9 A;  4NE3 A;  3X1T B;  3REI C;  3AZF C;  3UTA A;  5B33 D;  1HQ3 A;  2NZD A;  5CP6 B;  5AVC A;  3W97 A;  2W8S A;  5AV5 B;  3MGP D;  1KX4 B;  3REJ A;  3KUY A;  3W99 B;  3AFA A;  3EPL A;  5GXQ A;  4WU8 B;  3REL B;  1M18 B;  1BH8 B;  3AZK C;  4KGC C;  5B2I A;  2CWE A;  3X1S B;  4ZUX B;  5CPI D;  3B6G D;  4Z66 A;  1F1E A;  3REH D;  3REK B;  1T3U A;  4YS3 B;  2XD1 A;  2Y2M A;  3TU4 D;  3UT9 D;  5AY8 D;  1KX3 B;  5CPJ A;  3AV2 B;  4R8P A;  3AZG B;  5B0Z A;  4Z66 D;  3AZE C;  4H9P A;  3P5J B;  3IP4 C;  4XZQ C;  5BNX A;  2Y2K A;  3UTB A;  4UUZ B;  5B32 D;  4H9S C;  3WAA B;  4J8W B;  3EPH A;  5DNM B;  5GT3 D;  3AZN B;  1P3M A;  3REI B;  4WU9 A;  5B40 A;  3W98 A;  3AZJ D;  2ARO A;  2YFV A;  3LZ0 A;  1P3A A;  2NZD C;  5AVC C;  2BG1 A;  2Y2P A;  3A6N C;  3W97 C;  3LEL D;  1M19 D;  3REJ C;  4X23 A;  3KUY C;  3AZL D;  5DNN B;  3AZK B;  2Y2O A;  3AFA C;  1P34 C;  5GXQ C;  5B1M D;  4KUD A;  2Y2J A;  3A1I A;  4XUJ D;  3NQU B;  1ZLA B;  5B2I C;  3X1U B;  3MGS A;  4DRB A;  4JJN D;  1F66 D;  1KX5 D;  1P3P A;  1W2E A;  3AV1 D;  4J8V B;  1M1A D;  5F99 C;  2CV5 B;  3X1T D;  2BYM A;  3O62 A;  3WA9 A;  5GT0 C;  3X1V B;  2F8N D;  4H9R B;  5CP6 D;  5CPJ C;  1EQZ A;  5FUG B;  3MGQ C;  5AV5 D;  1U35 C;  3AZE B;  5AV8 A;  4R8P C;  5GSU A;  3NQJ A;  3W96 A;  5B0Z C;  3REL D;  4EO5 C;  4HGA C;  3X1S D;  4Z5T D;  2DF4 C;  4ZUX D;  3EPJ A;  3VH5 A;  3MVD B;  5G49 B; 
#chains in the Genus database with same CATH homology
 4QLC A;  4YM6 A;  3UTB C;  5B24 D;  1N1J B;  1P3F D;  3AYW D;  3AZH A;  3MNN A;  1S32 A;  1P3M C;  4J8U D;  5AVB A;  4WU9 C;  1P3G A;  1Z2C B;  2ZY2 A;  3WTP D;  1KX3 D;  5B40 C;  3W98 C;  5BO0 B;  2Y2Q A;  5B1L D;  3A6N B;  4E44 A;  2ARO C;  3LZ0 C;  1P3A C;  1BH9 A;  1P3K C;  3H0R C;  3REJ B;  3KUY B;  1AOI D;  5AV6 D;  1P34 B;  2RIQ A;  3AFA B;  5GXQ B;  5B31 D;  4X23 C;  2Y2L A;  4KUD C;  1JFI A;  1TZY B;  4CSR A;  5CPK A;  4NE6 A;  3WAA D;  5B33 A;  3VH6 T;  3EG5 B;  5F99 B;  2NQB D;  5B0Y D;  3MGP A;  5GT0 B;  3O62 C;  5CPJ B;  3WA9 C;  4WNN A;  3C1B D;  3MGQ B;  3EPK A;  2UWX A;  1U35 B;  1EQZ C;  5C3I C;  5E5A B;  5CPI A;  3B6G A;  1A7W A;  5B0Z B;  5CPK D;  5AV8 C;  3B0D C;  4EO5 B;  5DNN D;  4H9P B;  1TAF B;  4HGA B;  4NFT A;  3REH A;  3AZK D;  2FJ7 C;  3TU4 A;  1P3O D;  1WWI A;  1ZLA D;  4KHA A;  4DRA A;  3X1U D;  3UT9 A;  2HIO D;  3UTB B;  5AY8 A;  2BYK B;  4QLC C;  4YM6 C;  2ZY4 A;  5JRG D;  2G5H C;  3V9R A;  1P3M B;  4J8V D;  3AN2 D;  3AZH C;  1S32 C;  4LD9 D;  4WU9 B;  2F8N H;  5BNV A;  2CV5 D;  5B2J D;  5B40 B;  3X1V D;  1P3G C;  2RVQ D;  4J8X D;  1P3K B;  4G92 C;  1H3O A;  3MGR D;  4X23 B;  2ZM5 A;  2JCH A;  4KUD B;  5B32 A;  2HUE C;  5GT3 A;  3KXB D;  3MVD D;  4H9N B;  3AZJ A;  5B33 C;  1ID3 D;  4E45 A;  2ZY5 A;  3LEL A;  3MGP C;  1M19 A;  3WKJ D;  1Q9C A;  2BYM B;  3AZL A;  3AZM B;  3B0B A;  5B1M A;  1P3B B;  3A6N D;  4XUJ A;  5C3I B;  1EQZ B;  4JJN A;  3C1C D;  3B0D B;  5AV8 B;  1P34 D;  5CPI C;  3NQJ B;  1F66 A;  1KX5 A;  2FJ7 B;  3AZF B;  1P3L D;  3B6F C;  3B6G C;  3LZ1 A;  3REH C;  5AV9 C;  3KSY A;  3UTA C;  1TZY D;  1HQ3 C;  3VH5 W;  3AV1 A;  3AZI D;  3UT9 C;  4H9Q A;  1M1A A;  4YM6 B;  3X1T A;  1P3I D;  4CAY B;  5AY8 C;  2F8N A;  4KGC B;  5CP6 A;  3LJA D;  5F99 D;  5AV5 A;  5KDM A;  5GT0 D;  2PYO D;  4Z66 C;  3REL A;  3LZ1 D;  3X1S A;  4G92 B;  3MGQ D;  1U35 D;  4Z5T A;  4Z2M H;  4ZUX A;  1BH9 B;  5E5A D;  3KWQ D;  5B32 C;  5B24 A;  1P3F A;  3AYW A;  2JE5 A;  5GT3 C;  3W99 D;  1KX4 D;  4J8U A;  2IO5 C;  4ZBJ C;  3WTP A;  3VH6 W;  4WU8 D;  1KX3 A;  1M18 D;  5B1L A;  3AZJ C;  2FFF B;  4AWL C;  4XZQ B;  3MGP B;  1AOI A;  5AV6 A;  3LEL C;  1M19 C;  5B31 A;  4WV4 B;  3REK D;  3AZL C;  4YS3 D;  1P3K D;  5B1M C;  4XUJ C;  5CPI B;  1BFM A;  4JJN C;  3B6G B;  3B6F B;  4H9O A;  5AV9 B;  1KX5 C;  3WAA A;  3UTA B;  1HQ3 B;  2NZD B;  5AVC B;  3UT9 B;  2NQB A;  3W97 B;  5B0Y A;  3AV1 C;  3AV2 D;  5AY8 B;  3AZG D;  3KFU G;  3FDD A;  2DQN C;  3C1B A;  5B2I B;  5CP6 C;  3F6T A;  2LY8 A;  3MGS C;  3B0C T;  5BNV B;  4Z66 B;  5DNN A;  3AZK A;  3AZM D;  1P3B D;  5BT1 D;  4J8W D;  1P3P C;  1P3O A;  3NQU A;  3VH6 A;  5DNM D;  3X1U A;  3X1S C;  1ZLA A;  4Z5T C;  2HIO A;  4ZUX C;  3AZN D;  3REI D;  2FJ7 D;  5B32 B;  3AZF D;  2YFW A;  5JRG A;  5B24 C;  5GT3 B;  1P3F C;  3AYW C;  4J8V A;  3AN2 A;  2IO5 B;  4ZBJ B;  4LD9 A;  4R8P B;  2CV5 A;  5B2J A;  4J8U C;  3X1V A;  5GSU C;  4KGC D;  4J8X A;  3WTP C;  4H9R A;  3W96 C;  1KX3 C;  5CHL B;  5B1L C;  5FUG A;  4UPK A;  3LEL B;  1M19 B;  1HTA A;  1AOI C;  5BNX B;  3MGR A;  5AV6 C;  5B1M B;  5B31 C;  1ULY A;  3KXB A;  3MVD A;  2JSS A;  3MNN C;  5BS7 A;  3W98 B;  5AVB C;  3H0M C;  2F8N K;  1ID3 A;  2ARO B;  2YFV B;  3LZ0 B;  3AV1 B;  1P3A B;  5B32 G;  4H9Q B;  2NQB C;  5B0Y C;  3AZE D;  3WKJ A;  2F8N B;  2Y2G A;  4G91 C;  5BO0 A;  3A6N A;  3C1B C;  4XZQ D;  3MGS B;  3C1C A;  5KDM B;  1P34 A;  1P3L A;  4WJ3 C;  5CPK C;  1P3P B;  5DNN C;  4Z5T B;  1TZY A;  2Y2I A;  1P3O C;  3AZI A;  1ZLA C;  3X1U C;  3B6F D;  2HIO C;  1P3I A;  5AV9 D;  3O62 B;  3UTA D;  3WA9 B;  1HQ3 D;  5B24 B;  1P3F B;  3AYW B;  2NZD D;  5AVC D;  3LJA A;  2F2A C;  3R45 A;  5F99 A;  5JRG C;  3W97 D;  3AL0 C;  3H0L C;  4J8V C;  3AN2 C;  2ZY3 A;  3KUY D;  4J8U B;  3REJ D;  5GT0 A;  4LD9 C;  5GSU B;  3AFA D;  2CV5 C;  3WTP B;  5GXQ D;  5B2J C;  2PYO A;  3W96 B;  3X1V C;  5B1L B;  5B2I D;  2RVQ C;  3MGQ A;  4J8X C;  1U35 A;  3A1K A;  5E5A A;  1AOI B;  3TU4 C;  2F8N G;  5AV6 B;  5JA4 A;  3KWQ A;  5B31 B;  4QLC B;  3MGR C;  1TAF A;  1PZR A;  3AZH B;  3MNN B;  1S32 B;  4DQY B;  3KXB C;  4H9O B;  1KX4 A;  3MVD C;  3W99 A;  2BYK A;  2J8P A;  5AVB B;  1P3G B;  4WU8 A;  5BS7 C;  5CPJ D;  1BH8 A;  1M18 A;  1ID3 C;  2NQB B;  5B0Y B;  4R8P D;  4G91 B;  5B0Z D;  3WKJ C;  3REK A;  3C1B B;  4YS3 A;  1JFI B;  1P3K A;  2HUE B;  1B67 A;  1R4V A;  4CSR B;  3B0C W;  3WTP E;  3C1C C;  5CPK B;  3UTB D;  1P3L C;  5B33 B;  1P3O B;  2HIO B;  1TZY C;  5B31 G;  1P3M D;  3AV2 A;  3AZI C;  3AZG A;  4H9N A;  4WU9 D;  2XD5 A;  2YFW B;  5B40 D;  1P3I C;  3W98 D;  5JRG B;  4WNN B;  2ARO D;  3LZ0 D;  1P3A D;  3AN2 B;  3LJA C;  4LD9 B;  5B2J B;  4M6B A;  4X23 D;  3REH B;  3AZM A;  4UUZ A;  4KUD D;  4J8X B;  1P3B A;  1F66 C;  2PYO C;  4J8W A;  3LZ1 C;  3TU4 B;  5DNM A;  3MGS D;  4KHA B;  3AZN A;  5E5A C;  3MGR B;  3REI A;  2FJ7 A;  3AZF A;  1M1A C;  3KWQ C;  1P3P D;  3X1T C;  4Z2M G;  3V9R B;  3KXB B;  3VH5 T;  2Y2H A;  5AV5 C;  3W99 C;  1KX4 C;  2VQR A;  4NE5 A;  4CAY A;  3O62 D;  3WA9 D;  4KGC A;  1ID3 B;  4WU8 C;  1B6W A;  3REL C;  1M18 C;  1EQZ D;  4WZS B;  2Y2N A;  3WKJ B;  5AV8 D;  1H3O B;  5GSU D;  3W96 D;  3REK C;  4YS3 C;  3C1C B;  4QLC D;  1P3L B;  4YM6 D;  3AZJ B;  1KU5 A;  4AWL B;  3AZH D;  3MNN D;  3AZI B;  1S32 D;  3AZE A;  3AV2 C;  1P3I B;  5AVB D;  3AZG C;  3AZL B;  1P3G D;  1WWS A;  3LJA B;  3R45 B;  4XUJ B;  4XZQ A;  4JJN B;  5G49 A;  4H9S A;  1F66 B;  1KX5 B;  2PYO B;  2G5I C;  3LZ1 B;  3AZM C;  1P3B C;  1N1J A;  3WAA C;  5BT1 C;  4J8W C;  5DNM C;  3B6F A;  2L5A A;  3AZN C;  5JA4 B;  3KWQ B;  1M1A B;  5AV9 A;  4NE3 A;  3X1T B;  3REI C;  3AZF C;  3UTA A;  5B33 D;  1HQ3 A;  2NZD A;  5CP6 B;  5AVC A;  3W97 A;  2W8S A;  5AV5 B;  3MGP D;  1KX4 B;  3REJ A;  3KUY A;  3W99 B;  3AFA A;  3EPL A;  5GXQ A;  4WU8 B;  3REL B;  1M18 B;  1BH8 B;  3AZK C;  4KGC C;  5B2I A;  2CWE A;  3X1S B;  4ZUX B;  5CPI D;  3B6G D;  4Z66 A;  1F1E A;  3REH D;  3REK B;  1T3U A;  4YS3 B;  2XD1 A;  2Y2M A;  3TU4 D;  3UT9 D;  5AY8 D;  1KX3 B;  5CPJ A;  3AV2 B;  4R8P A;  3AZG B;  5B0Z A;  4Z66 D;  3AZE C;  4H9P A;  3P5J B;  3IP4 C;  4XZQ C;  5BNX A;  2Y2K A;  3UTB A;  4UUZ B;  5B32 D;  4H9S C;  3WAA B;  4J8W B;  3EPH A;  5DNM B;  5GT3 D;  3AZN B;  1P3M A;  3REI B;  4WU9 A;  5B40 A;  3W98 A;  3AZJ D;  2ARO A;  2YFV A;  3LZ0 A;  1P3A A;  2NZD C;  5AVC C;  2BG1 A;  2Y2P A;  3A6N C;  3W97 C;  3LEL D;  1M19 D;  3REJ C;  4X23 A;  3KUY C;  3AZL D;  5DNN B;  3AZK B;  2Y2O A;  3AFA C;  1P34 C;  5GXQ C;  5B1M D;  4KUD A;  2Y2J A;  3A1I A;  4XUJ D;  3NQU B;  1ZLA B;  5B2I C;  3X1U B;  3MGS A;  4DRB A;  4JJN D;  1F66 D;  1KX5 D;  1P3P A;  1W2E A;  3AV1 D;  4J8V B;  1M1A D;  5F99 C;  2CV5 B;  3X1T D;  2BYM A;  3O62 A;  3WA9 A;  5GT0 C;  3X1V B;  2F8N D;  4H9R B;  5CP6 D;  5CPJ C;  1EQZ A;  5FUG B;  3MGQ C;  5AV5 D;  1U35 C;  3AZE B;  5AV8 A;  4R8P C;  5GSU A;  3NQJ A;  3W96 A;  5B0Z C;  3REL D;  4EO5 C;  4HGA C;  3X1S D;  4Z5T D;  2DF4 C;  4ZUX D;  3EPJ A;  3VH5 A;  3MVD B;  5G49 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...