5C3IB

Crystal structure of the quaternary complex of histone h3-h4 heterodimer with chaperone asf1 and the replicative helicase subunit mcm2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
LREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1A
publication title Structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 27
structure length 87
sequence length 87
chains with identical sequence F, J, N, R, V
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5c3iB00
3LZ0C 2PYOC 1AOIB 3UT9D 5GXQB 1P3MB 1P3FB 3UTAD 1M19A 4KUDD 2L5AA 3LJAC 2NQBB 5JRGC 5GT3B 1KX4B 5B24A 4WU9B 2HUEB 4NE6A 4YM6C 5DNNB 1BH9B 4XUJC 5DNNC 4E45A 4Z66C 3AYWD 4DRAA 1M19B 1P3IB 2IO5C 1P3LB 5F99A 3KWQD 5B24C 4R8PC 5KDMA 3MVDD 3R45A 4JJNC 4YS3A 1M18D 2YFWA 3AV1C 3A6NB 5F99C 4ZBJB 3WTPC 4H9SA 1P3GB 3LELB 1ULYA 3MGPD 3WA9A 4YS3C 3AZIB 2YFWB 3B6FA 3AZGD 2PYOD 5BS7A 3LJAD 4Z2MH 1EQZB 5AV8C 5AV6A 4H9SC 3VH5T 2FJ7A 1P3OB 4XUJD 5B33C 3B6FB 4J8UA 1KX5D 3WA9C 5BNXB 4Z66D 5E5AA 3TU4B 4ZUXA 3W98C 5BS7C 5B1MA 5AV6C 2FJ7C 4J8VA 4WU8B 4R8PD 4J8UC 5CHLB 5E5AB 4CSRB 3LZ1A 4ZUXB 4KGCA 5AV5B 4JJND 5GT0A 5B1MB 3AV1D 5F99D 3W97A 3RELC 5DNMB 3WTPD 4J8VC 3KXBC 3AFAA 3O62D 3LZ1B 3B0CT 2YFVB 4KGCC 4YS3D 5GT0C 3W99D 5GSUA 3W97C 5CPKB 5AV8D 3AFAB 3KUYC 4H9PA 5CP6A 1ID3B 5B33D 3AN2A 3AZKB 4KHAA 5B31C 3AV2B 5G49A 5GSUC 3UT9A 1S32B 3UTAA 3W98D 4KUDA 4CAYA 1KU5A 3X1SC 2FJ7D 5CP6C 3AN2B 4J8UD 3AYWA 2BYMA 5BT1C 3UT9C 3UTAB 4KUDC 4CAYB 3KWQA 3RELD 2AROC 1B6WA 3KXBD 3MVDA 3AYWB 3WKJC 2BYMB 1TAFA 3REHB 3X1VC 1M18A 3MNNB 3KWQB 2CV5C 3KWQC 4Z5TB 5B2JB 3MVDB 2F8NH 4AWLB 3MGQB 3KUYD 1BH8B 3AZJD 1TAFB 4UUZA 4Z2MG 3MGPA 2BYKB 3AZGA 1M18C 5B31D 2PYOA 5FUGB 3AZHC 1P3BC 1P3PD 3LJAA 3B6GB 3X1SD 4EO5C 3C1CD 4XUJA 4UUZB 3MGPB 5CP6D 1KX5A 3AZGC 3LZ0B 4Z66A 2PYOB 5BT1D 4G92C 3LJAB 5JRGB 4YM6B 4XUJB 2AROD 4R8PA 2F8NK 3WAAC 3REKC 4Z66B 1KX5C 3WKJD 2HIOD 3MGSD 1WWSA 3REIC 2IO5B 4JJNA 3X1VD 3AV1A 2CV5D 5B24B 3NQUA 1HTAA 5CPJC 4XZQC 3WTPA 4R8PB 4J8XD 3O62A 3X1UD 4JJNB 3AV1B 5F99B 3W99A 3NQUB 3AZHD 1P3BD 4H9NA 3WTPB 2F8NA 5AV8A 1F1EA 3W96A 4J8WD 3O62B 5KDMB 1U35C 3R45B 3O62C 1ZLAA 4DRBA 5B33A 4YS3B 1N1JA 3W99C 3W98A 4H9NB 5AV8B 5B2ID 3W96C 3UTBD 5B33B 1ZLAC 1JFIA 4LD9C 3VH5A 1N1JB 3WA9B 3WAAD 3REKD 3W98B 3REID 5B40D 3B0DC 3AZFC 1WWIA 1P34A 5AV6B 5AVCC 5B0ZD 3RELA 1M1AD 2FJ7B 5CPJD 4HGAC 4XZQD 3KXBA 4J8UB 5JA4A 4NFTA 1P34C 5C3IC 1P3MD 5GT3D 3RELB 4NE3A 4J8VB 3KXBB 5JA4B 3C1BC 3KUYA 1U35D 3AZJA 4KGCB 3VH6A 5GT0B 5B31A 1P3LD 1P3PA 3W97B 4E44A 1TZYA 2F8ND 3X1SA 3W96D 1Q9CA 3X1TC 3KUYB 1B67A 4QLCA 4H9RA 3C1CA 3AZJC 1ZLAD 4LD9D 2CWEA 5B31B 5GSUB 4H9OA 3A6ND 5AY8C 1P3PC 3AZFD 1BFMA 1TZYC 3X1SB 5AVCD 3MGRC 4H9RB 4QLCC 3C1CC 1P3GD 4H9PB 5CP6B 2AROA 3LELD 4KHAB 5BO0A 2RVQC 3WKJA 2HIOA 5G49B 3MGSA 3AZID 4H9OB 3UT9B 4KUDB 3X1VA 1P34D 4H9QA 1H3OA 3VH5W 2CV5A 1HQ3C 2AROB 2LY8A 5BO0B 5B31G 4J8XA 3WKJB 1KX3C 3C1BD 2HIOC 3MGSC 3X1UA 5CPIC 3X1VB 4H9QB 3TU4D 3AZEA 2CV5B 3AZHA 1P3BA 4J8WA 4J8XB 5B1LD 4J8XC 5BNVA 3X1TD 4WU8D 3X1UC 1M18B 5AV5D 3AZEC 3AZHB 1P3BB 5AY8D 5AV9C 4X23C 3VH6W 5B2IA 4J8WB 1P3KC 1TZYD 4J8WC 3AZMC 2NZDC 5BNVB 4EO5B 4G91C 3MGRD 3UTBA 4QLCD 4WNNA 3AZGB 3REKA 3WAAA 2RVQD 3REIA 3AZNC 5B40A 3AZLD 4G92B 4NE5A 3V9RA 5B2IC 1HQ3D 5CPKD 5B0ZA 1M1AA 3UTBC 5CPJA 4XZQA 4WZSB 1KX5B 3REKB 3WAAB 1ID3D 1KX3D 3REIB 5B0YD 5B40B 3AV2D 5CPID 5B40C 3V9RB 5AVBC 1S32D 1P3FA 1P3MA 1P3AC 5GT3A 1KX4A 4M6BA 5B0ZC 5CPJB 1M1AC 4XZQB 4WV4B 1BH9A 1F66C 1U35A 1AOIC 5GXQC 1P3IA 1P3MC 1P3FC 1P3LA 3AZED 2NQBC 5GT3C 1KX4C 5AV9D 4X23D 4WU9C 2HUEC 1P3KD 3AZMD 2NZDD 1U35B 5B32D 4LD9A 3NQJA 3REHD 1M19C 1P3IC 3W99B 1P3LC 3A6NA 3MNND 3AZND 3AZFA 4Z5TD 2F8NB 3W96B 5AVCA 5B2JD 1P3GA 1ZLAB 3MGQD 4LD9B 3NQJB 3LELA 3AZIA 3A6NC 3B0DB 3AZFB 5AVBD 3REJD 4ZBJC 5AVCB 1P3AD 1EQZA 3B6GD 1P3GC 4HGAB 1JFIB 1P3OA 1F66D 3LELC 3C1BA 3AZIC 5BNXA 3LZ0D 1P34B 3TU4A 1AOID 5C3IB 5GXQD 2F8NG 1P3FD 5JRGD 1EQZC 2NQBD 1KX4D 1A7WA 4WU9D 4YM6D 5B1LA 5DNND 1P3OC 4WU8A 3C1BB 3X1TA 3B6FC 4CSRA 3TU4C 5AV5A 1P3ID 1M19D 5AY8A 5B24D 5B1LB 5DNMA 5B1LC 3X1TB 3MGRA 4WU8C 3AZJB 2YFVA 5E5AC 4ZUXC 5AV5C 5AY8B 5B1MC 3AZLA 1P3PB 1TZYB 1HQ3A 5DNMC 5CPKA 3MGRB 3VH6T 4QLCB 3C1CB 3LZ1C 1ID3A 3B0BA 1KX3A 3AZKA 3AV2A 5B0YA 3AZLB 5CPIA 3AZLC 1S32A 1HQ3B 5CPKC 1EQZD 3AFAC 1P3OD 1ID3C 1KX3B 2HIOB 3MGSB 5B0YB 3B6FD 3AZKC 3AV2C 5B0YC 5CPIB 3WA9D 1S32C 1H3OB 5AV9A 4X23A 5AV6D 1P3KA 3AZMA 2NZDA 5B32A 3AN2C 3WTPE 3X1UB 5E5AD 3REHA 2JSSA 4ZUXD 3UTAC 3AZEB 3MNNA 3AZNA 5AV9B 5B1MD 4X23B 4Z5TA 1P3KB 1R4VA 3AZMB 3B0CW 3KSYA 2NZDB 4J8VD 5DNMD 5B32B 4G91B 5B32C 5B2JA 3MGQA 3AYWC 1BH8A 3LZ1D 4KGCD 3REHC 2BYKA 5GT0D 3AZNB 3MNNC 5FUGA 5AVBA 4Z5TC 3W97D 5B2IB 3REJA 1P3AA 3B6GA 3UTBB 5B2JC 3MVDC 4WNNB 3AFAD 3MGQC 4AWLC 1F66A 3LZ0A 3AZKD 5GSUD 5AVBB 1AOIA 5GXQA 3REJB 3REJC 1P3AB 5JRGA 2NQBA 5B32G 5B0ZB 3B6GC 1M1AB 4WU9A 4YM6A 1F66B 5DNNA 3MGPC 3AN2D
chains in the Genus database with same CATH superfamily
3LZ0C 2PYOC 1AOIB 2Y2JA 3UT9D 5GXQB 1P3MB 1P3FB 3UTAD 1M19A 3P5JB 4KUDD 2L5AA 3LJAC 2NQBB 5JRGC 5GT3B 2J8PA 5B24A 1KX4B 4WU9B 2HUEB 4NE6A 4YM6C 5DNNB 1BH9B 4XUJC 5DNNC 4E45A 4Z66C 3AYWD 4DRAA 1M19B 1P3IB 2IO5C 1P3LB 5F99A 3KWQD 5B24C 4R8PC 5KDMA 3MVDD 3R45A 4JJNC 4YS3A 3EG5B 1M18D 2YFWA 3AV1C 3A6NB 5F99C 4ZBJB 3WTPC 4H9SA 1P3GB 2Y2OA 3LELB 1ULYA 3MGPD 3EPLA 3WA9A 2DQNC 4YS3C 2YFWB 3AZIB 3AZGD 3B6FA 2PYOD 2Y2NA 5BS7A 3LJAD 4Z2MH 1EQZB 5AV8C 5AV6A 4H9SC 3VH5T 2FJ7A 1P3OB 4XUJD 5B33C 3B6FB 4UPKA 4J8UA 1KX5D 3WA9C 5BNXB 4Z66D 5E5AA 3TU4B 2Y2HA 4ZUXA 3W98C 5BS7C 2DF4C 5B1MA 2BG1A 5AV6C 2FJ7C 4J8VA 4WU8B 4R8PD 4J8UC 5CHLB 5E5AB 4CSRB 3LZ1A 4ZUXB 4KGCA 5AV5B 4JJND 5GT0A 5B1MB 3AV1D 5F99D 3W97A 3RELC 5DNMB 3WTPD 4J8VC 3KXBC 3AFAA 3O62D 3LZ1B 3B0CT 2YFVB 4KGCC 4YS3D 5GT0C 4WJ3C 3W99D 5GSUA 3W97C 5CPKB 5AV8D 3AFAB 2ZM5A 3KUYC 4H9PA 5CP6A 1ID3B 5B33D 3AN2A 3AZKB 4KHAA 5B31C 3AV2B 5G49A 5GSUC 3UT9A 1S32B 3UTAA 3W98D 4KUDA 4CAYA 1KU5A 3X1SC 2FJ7D 5CP6C 3AN2B 4J8UD 3AYWA 2BYMA 5BT1C 3UT9C 3UTAB 4KUDC 4CAYB 3KWQA 3RELD 2AROC 1B6WA 3KXBD 3MVDA 3AYWB 3WKJC 2BYMB 1TAFA 3REHB 3X1VC 1M18A 3MNNB 3KWQB 2CV5C 3KWQC 4Z5TB 2W8SA 2XD1A 5B2JB 3MVDB 2F8NH 3A1IA 3MGQB 4AWLB 3KUYD 1BH8B 3AZJD 1TAFB 4UUZA 4Z2MG 3MGPA 2BYKB 3AZGA 1M18C 5B31D 2PYOA 5FUGB 3AZHC 1P3BC 1P3PD 3LJAA 3B6GB 3X1SD 4EO5C 3C1CD 4XUJA 4UUZB 3MGPB 5CP6D 1KX5A 3AZGC 3LZ0B 4Z66A 2PYOB 5BT1D 4G92C 3LJAB 5JRGB 2Y2LA 4YM6B 2ZY3A 4XUJB 2AROD 4R8PA 2F8NK 3WAAC 3REKC 1W2EA 4Z66B 1KX5C 3WKJD 2HIOD 3MGSD 1WWSA 3REIC 2IO5B 4JJNA 3X1VD 3AV1A 2CV5D 5B24B 3NQUA 1HTAA 5CPJC 4XZQC 3WTPA 3KFUG 4R8PB 4J8XD 3O62A 3X1UD 4JJNB 3AV1B 5F99B 3W99A 3EPHA 2FFFB 3NQUB 3AZHD 1P3BD 4H9NA 3WTPB 2F8NA 5AV8A 1F1EA 3W96A 4J8WD 3O62B 5KDMB 1U35C 3R45B 3O62C 1ZLAA 4DRBA 2UWXA 5B33A 4YS3B 1N1JA 3W99C 3W98A 4H9NB 5AV8B 5B2ID 3W96C 3UTBD 5B33B 1ZLAC 1JFIA 4LD9C 3VH5A 1N1JB 3WA9B 3WAAD 3REKD 3W98B 3REID 5B40D 3B0DC 3AZFC 1WWIA 1P34A 2Y2GA 5AV6B 5AVCC 5B0ZD 3RELA 1M1AD 2FJ7B 5CPJD 4HGAC 4XZQD 3KXBA 4J8UB 5JA4A 4NFTA 3FDDA 1P34C 2ZY5A 5C3IC 1P3MD 5GT3D 3RELB 4NE3A 4J8VB 3KXBB 5JA4B 3C1BC 3KUYA 1U35D 3AZJA 4KGCB 3VH6A 5GT0B 2VQRA 5B31A 1P3LD 1P3PA 3W97B 4E44A 1TZYA 2F8ND 3X1SA 3W96D 1Q9CA 3X1TC 3KUYB 1B67A 4QLCA 4H9RA 3C1CA 3AZJC 1ZLAD 4LD9D 2CWEA 5B31B 5GSUB 4H9OA 3A6ND 5AY8C 1P3PC 3AZFD 1BFMA 1TZYC 3X1SB 2F2AC 5AVCD 3MGRC 4H9RB 4QLCC 3C1CC 1P3GD 4H9PB 5CP6B 2AROA 3LELD 4KHAB 5BO0A 2RVQC 3WKJA 2HIOA 5G49B 3MGSA 3AZID 4H9OB 3UT9B 4KUDB 3X1VA 1P34D 4H9QA 1H3OA 3VH5W 3EPJA 2CV5A 1HQ3C 2JE5A 2Y2KA 2AROB 2LY8A 5BO0B 5B31G 4J8XA 3WKJB 1KX3C 3C1BD 2HIOC 3MGSC 3X1UA 5CPIC 3X1VB 4H9QB 3TU4D 3AZEA 2CV5B 3AZHA 1P3BA 4J8WA 4J8XB 5B1LD 4J8XC 5BNVA 3X1TD 4WU8D 3X1UC 1M18B 5AV5D 3AZEC 2Y2IA 3AZHB 1P3BB 5AY8D 5AV9C 4X23C 3VH6W 5B2IA 4J8WB 1P3KC 1TZYD 4J8WC 3AZMC 2NZDC 5BNVB 4EO5B 4G91C 3MGRD 3UTBA 4QLCD 4WNNA 3AZGB 3REKA 3WAAA 2RVQD 3REIA 3AZNC 5B40A 3AZLD 3EPKA 4G92B 4NE5A 3V9RA 5B2IC 1HQ3D 5CPKD 5B0ZA 1M1AA 2JCHA 3UTBC 5CPJA 4DQYB 4XZQA 4WZSB 1KX5B 3REKB 3WAAB 1ID3D 1KX3D 3REIB 5B0YD 5B40B 3AV2D 5CPID 5B40C 3V9RB 5AVBC 1S32D 1P3FA 1P3MA 1P3AC 5GT3A 3F6TA 1KX4A 4M6BA 5B0ZC 5CPJB 1M1AC 4XZQB 4WV4B 1BH9A 1F66C 1U35A 1AOIC 5GXQC 1P3IA 1P3MC 1P3FC 1P3LA 3AZED 2NQBC 5GT3C 1KX4C 5AV9D 4X23D 4WU9C 2HUEC 1P3KD 1T3UA 3AZMD 2NZDD 1U35B 5B32D 4LD9A 3NQJA 3REHD 1M19C 1P3IC 3W99B 1P3LC 3A6NA 3MNND 3AZND 3AZFA 2Y2MA 4Z5TD 2F8NB 3W96B 5AVCA 5B2JD 1P3GA 1ZLAB 3MGQD 4LD9B 3NQJB 3LELA 3AZIA 3A6NC 3B0DB 3AZFB 5AVBD 3A1KA 3REJD 4ZBJC 5AVCB 1P3AD 1EQZA 3B6GD 1P3GC 4HGAB 1JFIB 1P3OA 1F66D 3LELC 3C1BA 3AZIC 5BNXA 2Y2QA 3LZ0D 1P34B 3TU4A 1AOID 5C3IB 5GXQD 2F8NG 1P3FD 5JRGD 1EQZC 2NQBD 1KX4D 1A7WA 4WU9D 4YM6D 5B1LA 5DNND 1P3OC 3H0RC 4WU8A 3C1BB 3X1TA 3B6FC 4CSRA 3TU4C 5AV5A 1P3ID 1M19D 5AY8A 5B24D 2Y2PA 5B1LB 5DNMA 5B1LC 3X1TB 3IP4C 3MGRA 4WU8C 3AZJB 2YFVA 5E5AC 4ZUXC 5AV5C 2ZY2A 5AY8B 5B1MC 3AZLA 1P3PB 1TZYB 1HQ3A 5DNMC 5CPKA 3MGRB 3VH6T 4QLCB 3C1CB 3AL0C 3LZ1C 1ID3A 3B0BA 1KX3A 3AZKA 3AV2A 5B0YA 3AZLB 5CPIA 3AZLC 1S32A 2ZY4A 1HQ3B 2G5IC 5CPKC 1EQZD 3AFAC 1P3OD 1ID3C 1KX3B 2HIOB 3MGSB 5B0YB 3B6FD 3AZKC 3AV2C 5B0YC 5CPIB 3WA9D 1S32C 1H3OB 2G5HC 2XD5A 5AV9A 4X23A 5AV6D 1P3KA 3AZMA 1PZRA 3H0MC 2NZDA 5B32A 3AN2C 3WTPE 3X1UB 5E5AD 3REHA 2JSSA 4ZUXD 3UTAC 3AZEB 3MNNA 3AZNA 5AV9B 5B1MD 4X23B 4Z5TA 1P3KB 1R4VA 3AZMB 3B0CW 3KSYA 2NZDB 4J8VD 5DNMD 5B32B 4G91B 5B32C 2RIQA 5B2JA 3MGQA 3AYWC 1BH8A 3LZ1D 4KGCD 3REHC 2BYKA 5GT0D 3AZNB 3MNNC 5FUGA 5AVBA 4Z5TC 3W97D 5B2IB 3REJA 1P3AA 3B6GA 3UTBB 5B2JC 3MVDC 1Z2CB 4WNNB 3AFAD 3MGQC 4AWLC 1F66A 3LZ0A 3AZKD 5GSUD 5AVBB 1AOIA 5GXQA 3REJB 3REJC 1P3AB 5JRGA 2NQBA 5B32G 5B0ZB 3B6GC 1M1AB 3H0LC 4WU9A 4YM6A 1F66B 5DNNA 3MGPC 3AN2D
chains in the Genus database with same CATH topology
3LZ0C 2PYOC 1AOIB 2Y2JA 3UT9D 5GXQB 1P3MB 1P3FB 3UTAD 1M19A 3P5JB 4KUDD 2L5AA 3LJAC 2NQBB 5JRGC 5GT3B 2J8PA 5B24A 1KX4B 4WU9B 2HUEB 4NE6A 4YM6C 5DNNB 1BH9B 4XUJC 5DNNC 4E45A 4Z66C 3AYWD 4DRAA 1M19B 1P3IB 2IO5C 1P3LB 5F99A 3KWQD 5B24C 4R8PC 5KDMA 3MVDD 3R45A 4JJNC 4YS3A 3EG5B 1M18D 2YFWA 3AV1C 3A6NB 5F99C 4ZBJB 3WTPC 4H9SA 1P3GB 2Y2OA 3LELB 1ULYA 3MGPD 3EPLA 3WA9A 2DQNC 4YS3C 2YFWB 3AZIB 3AZGD 3B6FA 2PYOD 2Y2NA 5BS7A 3LJAD 4Z2MH 1EQZB 5AV8C 5AV6A 4H9SC 3VH5T 2FJ7A 1P3OB 4XUJD 5B33C 3B6FB 4UPKA 4J8UA 1KX5D 3WA9C 5BNXB 4Z66D 5E5AA 3TU4B 2Y2HA 4ZUXA 3W98C 5BS7C 2DF4C 5B1MA 2BG1A 5AV6C 2FJ7C 4J8VA 4WU8B 4R8PD 4J8UC 5CHLB 5E5AB 4CSRB 3LZ1A 4ZUXB 4KGCA 5AV5B 4JJND 5GT0A 5B1MB 3AV1D 5F99D 3W97A 3RELC 5DNMB 3WTPD 4J8VC 3KXBC 3AFAA 3O62D 3LZ1B 3B0CT 2YFVB 4KGCC 4YS3D 5GT0C 4WJ3C 3W99D 5GSUA 3W97C 5CPKB 5AV8D 3AFAB 2ZM5A 3KUYC 4H9PA 5CP6A 1ID3B 5B33D 3AN2A 3AZKB 4KHAA 5B31C 3AV2B 5G49A 5GSUC 3UT9A 1S32B 3UTAA 3W98D 4KUDA 4CAYA 1KU5A 3X1SC 2FJ7D 5CP6C 3AN2B 4J8UD 3AYWA 2BYMA 5BT1C 3UT9C 3UTAB 4KUDC 4CAYB 3KWQA 3RELD 2AROC 1B6WA 3KXBD 3MVDA 3AYWB 3WKJC 2BYMB 1TAFA 3REHB 3X1VC 1M18A 3MNNB 3KWQB 2CV5C 3KWQC 4Z5TB 2W8SA 2XD1A 5B2JB 3MVDB 2F8NH 3A1IA 3MGQB 4AWLB 3KUYD 1BH8B 3AZJD 1TAFB 4UUZA 4Z2MG 3MGPA 2BYKB 3AZGA 1M18C 5B31D 2PYOA 5FUGB 3AZHC 1P3BC 1P3PD 3LJAA 3B6GB 3X1SD 4EO5C 3C1CD 4XUJA 4UUZB 3MGPB 5CP6D 1KX5A 3AZGC 3LZ0B 4Z66A 2PYOB 5BT1D 4G92C 3LJAB 5JRGB 2Y2LA 4YM6B 2ZY3A 4XUJB 2AROD 4R8PA 2F8NK 3WAAC 3REKC 1W2EA 4Z66B 1KX5C 3WKJD 2HIOD 3MGSD 1WWSA 3REIC 2IO5B 4JJNA 3X1VD 3AV1A 2CV5D 5B24B 3NQUA 1HTAA 5CPJC 4XZQC 3WTPA 3KFUG 4R8PB 4J8XD 3O62A 3X1UD 4JJNB 3AV1B 5F99B 3W99A 3EPHA 2FFFB 3NQUB 3AZHD 1P3BD 4H9NA 3WTPB 2F8NA 5AV8A 1F1EA 3W96A 4J8WD 3O62B 5KDMB 1U35C 3R45B 3O62C 1ZLAA 4DRBA 2UWXA 5B33A 4YS3B 1N1JA 3W99C 3W98A 4H9NB 5AV8B 5B2ID 3W96C 3UTBD 5B33B 1ZLAC 1JFIA 4LD9C 3VH5A 1N1JB 3WA9B 3WAAD 3REKD 3W98B 3REID 5B40D 3B0DC 3AZFC 1WWIA 1P34A 2Y2GA 5AV6B 5AVCC 5B0ZD 3RELA 1M1AD 2FJ7B 5CPJD 4HGAC 4XZQD 3KXBA 4J8UB 5JA4A 4NFTA 3FDDA 1P34C 2ZY5A 5C3IC 1P3MD 5GT3D 3RELB 4NE3A 4J8VB 3KXBB 5JA4B 3C1BC 3KUYA 1U35D 3AZJA 4KGCB 3VH6A 5GT0B 2VQRA 5B31A 1P3LD 1P3PA 3W97B 4E44A 1TZYA 2F8ND 3X1SA 3W96D 1Q9CA 3X1TC 3KUYB 1B67A 4QLCA 4H9RA 3C1CA 3AZJC 1ZLAD 4LD9D 2CWEA 5B31B 5GSUB 4H9OA 3A6ND 5AY8C 1P3PC 3AZFD 1BFMA 1TZYC 3X1SB 2F2AC 5AVCD 3MGRC 4H9RB 4QLCC 3C1CC 1P3GD 4H9PB 5CP6B 2AROA 3LELD 4KHAB 5BO0A 2RVQC 3WKJA 2HIOA 5G49B 3MGSA 3AZID 4H9OB 3UT9B 4KUDB 3X1VA 1P34D 4H9QA 1H3OA 3VH5W 3EPJA 2CV5A 1HQ3C 2JE5A 2Y2KA 2AROB 2LY8A 5BO0B 5B31G 4J8XA 3WKJB 1KX3C 3C1BD 2HIOC 3MGSC 3X1UA 5CPIC 3X1VB 4H9QB 3TU4D 3AZEA 2CV5B 3AZHA 1P3BA 4J8WA 4J8XB 5B1LD 4J8XC 5BNVA 3X1TD 4WU8D 3X1UC 1M18B 5AV5D 3AZEC 2Y2IA 3AZHB 1P3BB 5AY8D 5AV9C 4X23C 3VH6W 5B2IA 4J8WB 1P3KC 1TZYD 4J8WC 3AZMC 2NZDC 5BNVB 4EO5B 4G91C 3MGRD 3UTBA 4QLCD 4WNNA 3AZGB 3REKA 3WAAA 2RVQD 3REIA 3AZNC 5B40A 3AZLD 3EPKA 4G92B 4NE5A 3V9RA 5B2IC 1HQ3D 5CPKD 5B0ZA 1M1AA 2JCHA 3UTBC 5CPJA 4DQYB 4XZQA 4WZSB 1KX5B 3REKB 3WAAB 1ID3D 1KX3D 3REIB 5B0YD 5B40B 3AV2D 5CPID 5B40C 3V9RB 5AVBC 1S32D 1P3FA 1P3MA 1P3AC 5GT3A 3F6TA 1KX4A 4M6BA 5B0ZC 5CPJB 1M1AC 4XZQB 4WV4B 1BH9A 1F66C 1U35A 1AOIC 5GXQC 1P3IA 1P3MC 1P3FC 1P3LA 3AZED 2NQBC 5GT3C 1KX4C 5AV9D 4X23D 4WU9C 2HUEC 1P3KD 1T3UA 3AZMD 2NZDD 1U35B 5B32D 4LD9A 3NQJA 3REHD 1M19C 1P3IC 3W99B 1P3LC 3A6NA 3MNND 3AZND 3AZFA 2Y2MA 4Z5TD 2F8NB 3W96B 5AVCA 5B2JD 1P3GA 1ZLAB 3MGQD 4LD9B 3NQJB 3LELA 3AZIA 3A6NC 3B0DB 3AZFB 5AVBD 3A1KA 3REJD 4ZBJC 5AVCB 1P3AD 1EQZA 3B6GD 1P3GC 4HGAB 1JFIB 1P3OA 1F66D 3LELC 3C1BA 3AZIC 5BNXA 2Y2QA 3LZ0D 1P34B 3TU4A 1AOID 5C3IB 5GXQD 2F8NG 1P3FD 5JRGD 1EQZC 2NQBD 1KX4D 1A7WA 4WU9D 4YM6D 5B1LA 5DNND 1P3OC 3H0RC 4WU8A 3C1BB 3X1TA 3B6FC 4CSRA 3TU4C 5AV5A 1P3ID 1M19D 5AY8A 5B24D 2Y2PA 5B1LB 5DNMA 5B1LC 3X1TB 3IP4C 3MGRA 4WU8C 3AZJB 2YFVA 5E5AC 4ZUXC 5AV5C 2ZY2A 5AY8B 5B1MC 3AZLA 1P3PB 1TZYB 1HQ3A 5DNMC 5CPKA 3MGRB 3VH6T 4QLCB 3C1CB 3AL0C 3LZ1C 1ID3A 3B0BA 1KX3A 3AZKA 3AV2A 5B0YA 3AZLB 5CPIA 3AZLC 1S32A 2ZY4A 1HQ3B 2G5IC 5CPKC 1EQZD 3AFAC 1P3OD 1ID3C 1KX3B 2HIOB 3MGSB 5B0YB 3B6FD 3AZKC 3AV2C 5B0YC 5CPIB 3WA9D 1S32C 1H3OB 2G5HC 2XD5A 5AV9A 4X23A 5AV6D 1P3KA 3AZMA 1PZRA 3H0MC 2NZDA 5B32A 3AN2C 3WTPE 3X1UB 5E5AD 3REHA 2JSSA 4ZUXD 3UTAC 3AZEB 3MNNA 3AZNA 5AV9B 5B1MD 4X23B 4Z5TA 1P3KB 1R4VA 3AZMB 3B0CW 3KSYA 2NZDB 4J8VD 5DNMD 5B32B 4G91B 5B32C 2RIQA 5B2JA 3MGQA 3AYWC 1BH8A 3LZ1D 4KGCD 3REHC 2BYKA 5GT0D 3AZNB 3MNNC 5FUGA 5AVBA 4Z5TC 3W97D 5B2IB 3REJA 1P3AA 3B6GA 3UTBB 5B2JC 3MVDC 1Z2CB 4WNNB 3AFAD 3MGQC 4AWLC 1F66A 3LZ0A 3AZKD 5GSUD 5AVBB 1AOIA 5GXQA 3REJB 3REJC 1P3AB 5JRGA 2NQBA 5B32G 5B0ZB 3B6GC 1M1AB 3H0LC 4WU9A 4YM6A 1F66B 5DNNA 3MGPC 3AN2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZ0 C;  2PYO C;  1AOI B;  3UT9 D;  5GXQ B;  1P3M B;  1P3F B;  3UTA D;  1M19 A;  4KUD D;  2L5A A;  3LJA C;  2NQB B;  5JRG C;  5GT3 B;  1KX4 B;  5B24 A;  4WU9 B;  2HUE B;  4NE6 A;  4YM6 C;  5DNN B;  1BH9 B;  4XUJ C;  5DNN C;  4E45 A;  4Z66 C;  3AYW D;  4DRA A;  1M19 B;  1P3I B;  2IO5 C;  1P3L B;  5F99 A;  3KWQ D;  5B24 C;  4R8P C;  5KDM A;  3MVD D;  3R45 A;  4JJN C;  4YS3 A;  1M18 D;  2YFW A;  3AV1 C;  3A6N B;  5F99 C;  4ZBJ B;  3WTP C;  4H9S A;  1P3G B;  3LEL B;  1ULY A;  3MGP D;  3WA9 A;  4YS3 C;  3AZI B;  2YFW B;  3B6F A;  3AZG D;  2PYO D;  5BS7 A;  3LJA D;  4Z2M H;  1EQZ B;  5AV8 C;  5AV6 A;  4H9S C;  3VH5 T;  2FJ7 A;  1P3O B;  4XUJ D;  5B33 C;  3B6F B;  4J8U A;  1KX5 D;  3WA9 C;  5BNX B;  4Z66 D;  5E5A A;  3TU4 B;  4ZUX A;  3W98 C;  5BS7 C;  5B1M A;  5AV6 C;  2FJ7 C;  4J8V A;  4WU8 B;  4R8P D;  4J8U C;  5CHL B;  5E5A B;  4CSR B;  3LZ1 A;  4ZUX B;  4KGC A;  5AV5 B;  4JJN D;  5GT0 A;  5B1M B;  3AV1 D;  5F99 D;  3W97 A;  3REL C;  5DNM B;  3WTP D;  4J8V C;  3KXB C;  3AFA A;  3O62 D;  3LZ1 B;  3B0C T;  2YFV B;  4KGC C;  4YS3 D;  5GT0 C;  3W99 D;  5GSU A;  3W97 C;  5CPK B;  5AV8 D;  3AFA B;  3KUY C;  4H9P A;  5CP6 A;  1ID3 B;  5B33 D;  3AN2 A;  3AZK B;  4KHA A;  5B31 C;  3AV2 B;  5G49 A;  5GSU C;  3UT9 A;  1S32 B;  3UTA A;  3W98 D;  4KUD A;  4CAY A;  1KU5 A;  3X1S C;  2FJ7 D;  5CP6 C;  3AN2 B;  4J8U D;  3AYW A;  2BYM A;  5BT1 C;  3UT9 C;  3UTA B;  4KUD C;  4CAY B;  3KWQ A;  3REL D;  2ARO C;  1B6W A;  3KXB D;  3MVD A;  3AYW B;  3WKJ C;  2BYM B;  1TAF A;  3REH B;  3X1V C;  1M18 A;  3MNN B;  3KWQ B;  2CV5 C;  3KWQ C;  4Z5T B;  5B2J B;  3MVD B;  2F8N H;  4AWL B;  3MGQ B;  3KUY D;  1BH8 B;  3AZJ D;  1TAF B;  4UUZ A;  4Z2M G;  3MGP A;  2BYK B;  3AZG A;  1M18 C;  5B31 D;  2PYO A;  5FUG B;  3AZH C;  1P3B C;  1P3P D;  3LJA A;  3B6G B;  3X1S D;  4EO5 C;  3C1C D;  4XUJ A;  4UUZ B;  3MGP B;  5CP6 D;  1KX5 A;  3AZG C;  3LZ0 B;  4Z66 A;  2PYO B;  5BT1 D;  4G92 C;  3LJA B;  5JRG B;  4YM6 B;  4XUJ B;  2ARO D;  4R8P A;  2F8N K;  3WAA C;  3REK C;  4Z66 B;  1KX5 C;  3WKJ D;  2HIO D;  3MGS D;  1WWS A;  3REI C;  2IO5 B;  4JJN A;  3X1V D;  3AV1 A;  2CV5 D;  5B24 B;  3NQU A;  1HTA A;  5CPJ C;  4XZQ C;  3WTP A;  4R8P B;  4J8X D;  3O62 A;  3X1U D;  4JJN B;  3AV1 B;  5F99 B;  3W99 A;  3NQU B;  3AZH D;  1P3B D;  4H9N A;  3WTP B;  2F8N A;  5AV8 A;  1F1E A;  3W96 A;  4J8W D;  3O62 B;  5KDM B;  1U35 C;  3R45 B;  3O62 C;  1ZLA A;  4DRB A;  5B33 A;  4YS3 B;  1N1J A;  3W99 C;  3W98 A;  4H9N B;  5AV8 B;  5B2I D;  3W96 C;  3UTB D;  5B33 B;  1ZLA C;  1JFI A;  4LD9 C;  3VH5 A;  1N1J B;  3WA9 B;  3WAA D;  3REK D;  3W98 B;  3REI D;  5B40 D;  3B0D C;  3AZF C;  1WWI A;  1P34 A;  5AV6 B;  5AVC C;  5B0Z D;  3REL A;  1M1A D;  2FJ7 B;  5CPJ D;  4HGA C;  4XZQ D;  3KXB A;  4J8U B;  5JA4 A;  4NFT A;  1P34 C;  5C3I C;  1P3M D;  5GT3 D;  3REL B;  4NE3 A;  4J8V B;  3KXB B;  5JA4 B;  3C1B C;  3KUY A;  1U35 D;  3AZJ A;  4KGC B;  3VH6 A;  5GT0 B;  5B31 A;  1P3L D;  1P3P A;  3W97 B;  4E44 A;  1TZY A;  2F8N D;  3X1S A;  3W96 D;  1Q9C A;  3X1T C;  3KUY B;  1B67 A;  4QLC A;  4H9R A;  3C1C A;  3AZJ C;  1ZLA D;  4LD9 D;  2CWE A;  5B31 B;  5GSU B;  4H9O A;  3A6N D;  5AY8 C;  1P3P C;  3AZF D;  1BFM A;  1TZY C;  3X1S B;  5AVC D;  3MGR C;  4H9R B;  4QLC C;  3C1C C;  1P3G D;  4H9P B;  5CP6 B;  2ARO A;  3LEL D;  4KHA B;  5BO0 A;  2RVQ C;  3WKJ A;  2HIO A;  5G49 B;  3MGS A;  3AZI D;  4H9O B;  3UT9 B;  4KUD B;  3X1V A;  1P34 D;  4H9Q A;  1H3O A;  3VH5 W;  2CV5 A;  1HQ3 C;  2ARO B;  2LY8 A;  5BO0 B;  5B31 G;  4J8X A;  3WKJ B;  1KX3 C;  3C1B D;  2HIO C;  3MGS C;  3X1U A;  5CPI C;  3X1V B;  4H9Q B;  3TU4 D;  3AZE A;  2CV5 B;  3AZH A;  1P3B A;  4J8W A;  4J8X B;  5B1L D;  4J8X C;  5BNV A;  3X1T D;  4WU8 D;  3X1U C;  1M18 B;  5AV5 D;  3AZE C;  3AZH B;  1P3B B;  5AY8 D;  5AV9 C;  4X23 C;  3VH6 W;  5B2I A;  4J8W B;  1P3K C;  1TZY D;  4J8W C;  3AZM C;  2NZD C;  5BNV B;  4EO5 B;  4G91 C;  3MGR D;  3UTB A;  4QLC D;  4WNN A;  3AZG B;  3REK A;  3WAA A;  2RVQ D;  3REI A;  3AZN C;  5B40 A;  3AZL D;  4G92 B;  4NE5 A;  3V9R A;  5B2I C;  1HQ3 D;  5CPK D;  5B0Z A;  1M1A A;  3UTB C;  5CPJ A;  4XZQ A;  4WZS B;  1KX5 B;  3REK B;  3WAA B;  1ID3 D;  1KX3 D;  3REI B;  5B0Y D;  5B40 B;  3AV2 D;  5CPI D;  5B40 C;  3V9R B;  5AVB C;  1S32 D;  1P3F A;  1P3M A;  1P3A C;  5GT3 A;  1KX4 A;  4M6B A;  5B0Z C;  5CPJ B;  1M1A C;  4XZQ B;  4WV4 B;  1BH9 A;  1F66 C;  1U35 A;  1AOI C;  5GXQ C;  1P3I A;  1P3M C;  1P3F C;  1P3L A;  3AZE D;  2NQB C;  5GT3 C;  1KX4 C;  5AV9 D;  4X23 D;  4WU9 C;  2HUE C;  1P3K D;  3AZM D;  2NZD D;  1U35 B;  5B32 D;  4LD9 A;  3NQJ A;  3REH D;  1M19 C;  1P3I C;  3W99 B;  1P3L C;  3A6N A;  3MNN D;  3AZN D;  3AZF A;  4Z5T D;  2F8N B;  3W96 B;  5AVC A;  5B2J D;  1P3G A;  1ZLA B;  3MGQ D;  4LD9 B;  3NQJ B;  3LEL A;  3AZI A;  3A6N C;  3B0D B;  3AZF B;  5AVB D;  3REJ D;  4ZBJ C;  5AVC B;  1P3A D;  1EQZ A;  3B6G D;  1P3G C;  4HGA B;  1JFI B;  1P3O A;  1F66 D;  3LEL C;  3C1B A;  3AZI C;  5BNX A;  3LZ0 D;  1P34 B;  3TU4 A;  1AOI D;  5C3I B;  5GXQ D;  2F8N G;  1P3F D;  5JRG D;  1EQZ C;  2NQB D;  1KX4 D;  1A7W A;  4WU9 D;  4YM6 D;  5B1L A;  5DNN D;  1P3O C;  4WU8 A;  3C1B B;  3X1T A;  3B6F C;  4CSR A;  3TU4 C;  5AV5 A;  1P3I D;  1M19 D;  5AY8 A;  5B24 D;  5B1L B;  5DNM A;  5B1L C;  3X1T B;  3MGR A;  4WU8 C;  3AZJ B;  2YFV A;  5E5A C;  4ZUX C;  5AV5 C;  5AY8 B;  5B1M C;  3AZL A;  1P3P B;  1TZY B;  1HQ3 A;  5DNM C;  5CPK A;  3MGR B;  3VH6 T;  4QLC B;  3C1C B;  3LZ1 C;  1ID3 A;  3B0B A;  1KX3 A;  3AZK A;  3AV2 A;  5B0Y A;  3AZL B;  5CPI A;  3AZL C;  1S32 A;  1HQ3 B;  5CPK C;  1EQZ D;  3AFA C;  1P3O D;  1ID3 C;  1KX3 B;  2HIO B;  3MGS B;  5B0Y B;  3B6F D;  3AZK C;  3AV2 C;  5B0Y C;  5CPI B;  3WA9 D;  1S32 C;  1H3O B;  5AV9 A;  4X23 A;  5AV6 D;  1P3K A;  3AZM A;  2NZD A;  5B32 A;  3AN2 C;  3WTP E;  3X1U B;  5E5A D;  3REH A;  2JSS A;  4ZUX D;  3UTA C;  3AZE B;  3MNN A;  3AZN A;  5AV9 B;  5B1M D;  4X23 B;  4Z5T A;  1P3K B;  1R4V A;  3AZM B;  3B0C W;  3KSY A;  2NZD B;  4J8V D;  5DNM D;  5B32 B;  4G91 B;  5B32 C;  5B2J A;  3MGQ A;  3AYW C;  1BH8 A;  3LZ1 D;  4KGC D;  3REH C;  2BYK A;  5GT0 D;  3AZN B;  3MNN C;  5FUG A;  5AVB A;  4Z5T C;  3W97 D;  5B2I B;  3REJ A;  1P3A A;  3B6G A;  3UTB B;  5B2J C;  3MVD C;  4WNN B;  3AFA D;  3MGQ C;  4AWL C;  1F66 A;  3LZ0 A;  3AZK D;  5GSU D;  5AVB B;  1AOI A;  5GXQ A;  3REJ B;  3REJ C;  1P3A B;  5JRG A;  2NQB A;  5B32 G;  5B0Z B;  3B6G C;  1M1A B;  4WU9 A;  4YM6 A;  1F66 B;  5DNN A;  3MGP C;  3AN2 D; 
#chains in the Genus database with same CATH topology
 3LZ0 C;  2PYO C;  1AOI B;  2Y2J A;  3UT9 D;  5GXQ B;  1P3M B;  1P3F B;  3UTA D;  1M19 A;  3P5J B;  4KUD D;  2L5A A;  3LJA C;  2NQB B;  5JRG C;  5GT3 B;  2J8P A;  5B24 A;  1KX4 B;  4WU9 B;  2HUE B;  4NE6 A;  4YM6 C;  5DNN B;  1BH9 B;  4XUJ C;  5DNN C;  4E45 A;  4Z66 C;  3AYW D;  4DRA A;  1M19 B;  1P3I B;  2IO5 C;  1P3L B;  5F99 A;  3KWQ D;  5B24 C;  4R8P C;  5KDM A;  3MVD D;  3R45 A;  4JJN C;  4YS3 A;  3EG5 B;  1M18 D;  2YFW A;  3AV1 C;  3A6N B;  5F99 C;  4ZBJ B;  3WTP C;  4H9S A;  1P3G B;  2Y2O A;  3LEL B;  1ULY A;  3MGP D;  3EPL A;  3WA9 A;  2DQN C;  4YS3 C;  2YFW B;  3AZI B;  3AZG D;  3B6F A;  2PYO D;  2Y2N A;  5BS7 A;  3LJA D;  4Z2M H;  1EQZ B;  5AV8 C;  5AV6 A;  4H9S C;  3VH5 T;  2FJ7 A;  1P3O B;  4XUJ D;  5B33 C;  3B6F B;  4UPK A;  4J8U A;  1KX5 D;  3WA9 C;  5BNX B;  4Z66 D;  5E5A A;  3TU4 B;  2Y2H A;  4ZUX A;  3W98 C;  5BS7 C;  2DF4 C;  5B1M A;  2BG1 A;  5AV6 C;  2FJ7 C;  4J8V A;  4WU8 B;  4R8P D;  4J8U C;  5CHL B;  5E5A B;  4CSR B;  3LZ1 A;  4ZUX B;  4KGC A;  5AV5 B;  4JJN D;  5GT0 A;  5B1M B;  3AV1 D;  5F99 D;  3W97 A;  3REL C;  5DNM B;  3WTP D;  4J8V C;  3KXB C;  3AFA A;  3O62 D;  3LZ1 B;  3B0C T;  2YFV B;  4KGC C;  4YS3 D;  5GT0 C;  4WJ3 C;  3W99 D;  5GSU A;  3W97 C;  5CPK B;  5AV8 D;  3AFA B;  2ZM5 A;  3KUY C;  4H9P A;  5CP6 A;  1ID3 B;  5B33 D;  3AN2 A;  3AZK B;  4KHA A;  5B31 C;  3AV2 B;  5G49 A;  5GSU C;  3UT9 A;  1S32 B;  3UTA A;  3W98 D;  4KUD A;  4CAY A;  1KU5 A;  3X1S C;  2FJ7 D;  5CP6 C;  3AN2 B;  4J8U D;  3AYW A;  2BYM A;  5BT1 C;  3UT9 C;  3UTA B;  4KUD C;  4CAY B;  3KWQ A;  3REL D;  2ARO C;  1B6W A;  3KXB D;  3MVD A;  3AYW B;  3WKJ C;  2BYM B;  1TAF A;  3REH B;  3X1V C;  1M18 A;  3MNN B;  3KWQ B;  2CV5 C;  3KWQ C;  4Z5T B;  2W8S A;  2XD1 A;  5B2J B;  3MVD B;  2F8N H;  3A1I A;  3MGQ B;  4AWL B;  3KUY D;  1BH8 B;  3AZJ D;  1TAF B;  4UUZ A;  4Z2M G;  3MGP A;  2BYK B;  3AZG A;  1M18 C;  5B31 D;  2PYO A;  5FUG B;  3AZH C;  1P3B C;  1P3P D;  3LJA A;  3B6G B;  3X1S D;  4EO5 C;  3C1C D;  4XUJ A;  4UUZ B;  3MGP B;  5CP6 D;  1KX5 A;  3AZG C;  3LZ0 B;  4Z66 A;  2PYO B;  5BT1 D;  4G92 C;  3LJA B;  5JRG B;  2Y2L A;  4YM6 B;  2ZY3 A;  4XUJ B;  2ARO D;  4R8P A;  2F8N K;  3WAA C;  3REK C;  1W2E A;  4Z66 B;  1KX5 C;  3WKJ D;  2HIO D;  3MGS D;  1WWS A;  3REI C;  2IO5 B;  4JJN A;  3X1V D;  3AV1 A;  2CV5 D;  5B24 B;  3NQU A;  1HTA A;  5CPJ C;  4XZQ C;  3WTP A;  3KFU G;  4R8P B;  4J8X D;  3O62 A;  3X1U D;  4JJN B;  3AV1 B;  5F99 B;  3W99 A;  3EPH A;  2FFF B;  3NQU B;  3AZH D;  1P3B D;  4H9N A;  3WTP B;  2F8N A;  5AV8 A;  1F1E A;  3W96 A;  4J8W D;  3O62 B;  5KDM B;  1U35 C;  3R45 B;  3O62 C;  1ZLA A;  4DRB A;  2UWX A;  5B33 A;  4YS3 B;  1N1J A;  3W99 C;  3W98 A;  4H9N B;  5AV8 B;  5B2I D;  3W96 C;  3UTB D;  5B33 B;  1ZLA C;  1JFI A;  4LD9 C;  3VH5 A;  1N1J B;  3WA9 B;  3WAA D;  3REK D;  3W98 B;  3REI D;  5B40 D;  3B0D C;  3AZF C;  1WWI A;  1P34 A;  2Y2G A;  5AV6 B;  5AVC C;  5B0Z D;  3REL A;  1M1A D;  2FJ7 B;  5CPJ D;  4HGA C;  4XZQ D;  3KXB A;  4J8U B;  5JA4 A;  4NFT A;  3FDD A;  1P34 C;  2ZY5 A;  5C3I C;  1P3M D;  5GT3 D;  3REL B;  4NE3 A;  4J8V B;  3KXB B;  5JA4 B;  3C1B C;  3KUY A;  1U35 D;  3AZJ A;  4KGC B;  3VH6 A;  5GT0 B;  2VQR A;  5B31 A;  1P3L D;  1P3P A;  3W97 B;  4E44 A;  1TZY A;  2F8N D;  3X1S A;  3W96 D;  1Q9C A;  3X1T C;  3KUY B;  1B67 A;  4QLC A;  4H9R A;  3C1C A;  3AZJ C;  1ZLA D;  4LD9 D;  2CWE A;  5B31 B;  5GSU B;  4H9O A;  3A6N D;  5AY8 C;  1P3P C;  3AZF D;  1BFM A;  1TZY C;  3X1S B;  2F2A C;  5AVC D;  3MGR C;  4H9R B;  4QLC C;  3C1C C;  1P3G D;  4H9P B;  5CP6 B;  2ARO A;  3LEL D;  4KHA B;  5BO0 A;  2RVQ C;  3WKJ A;  2HIO A;  5G49 B;  3MGS A;  3AZI D;  4H9O B;  3UT9 B;  4KUD B;  3X1V A;  1P34 D;  4H9Q A;  1H3O A;  3VH5 W;  3EPJ A;  2CV5 A;  1HQ3 C;  2JE5 A;  2Y2K A;  2ARO B;  2LY8 A;  5BO0 B;  5B31 G;  4J8X A;  3WKJ B;  1KX3 C;  3C1B D;  2HIO C;  3MGS C;  3X1U A;  5CPI C;  3X1V B;  4H9Q B;  3TU4 D;  3AZE A;  2CV5 B;  3AZH A;  1P3B A;  4J8W A;  4J8X B;  5B1L D;  4J8X C;  5BNV A;  3X1T D;  4WU8 D;  3X1U C;  1M18 B;  5AV5 D;  3AZE C;  2Y2I A;  3AZH B;  1P3B B;  5AY8 D;  5AV9 C;  4X23 C;  3VH6 W;  5B2I A;  4J8W B;  1P3K C;  1TZY D;  4J8W C;  3AZM C;  2NZD C;  5BNV B;  4EO5 B;  4G91 C;  3MGR D;  3UTB A;  4QLC D;  4WNN A;  3AZG B;  3REK A;  3WAA A;  2RVQ D;  3REI A;  3AZN C;  5B40 A;  3AZL D;  3EPK A;  4G92 B;  4NE5 A;  3V9R A;  5B2I C;  1HQ3 D;  5CPK D;  5B0Z A;  1M1A A;  2JCH A;  3UTB C;  5CPJ A;  4DQY B;  4XZQ A;  4WZS B;  1KX5 B;  3REK B;  3WAA B;  1ID3 D;  1KX3 D;  3REI B;  5B0Y D;  5B40 B;  3AV2 D;  5CPI D;  5B40 C;  3V9R B;  5AVB C;  1S32 D;  1P3F A;  1P3M A;  1P3A C;  5GT3 A;  3F6T A;  1KX4 A;  4M6B A;  5B0Z C;  5CPJ B;  1M1A C;  4XZQ B;  4WV4 B;  1BH9 A;  1F66 C;  1U35 A;  1AOI C;  5GXQ C;  1P3I A;  1P3M C;  1P3F C;  1P3L A;  3AZE D;  2NQB C;  5GT3 C;  1KX4 C;  5AV9 D;  4X23 D;  4WU9 C;  2HUE C;  1P3K D;  1T3U A;  3AZM D;  2NZD D;  1U35 B;  5B32 D;  4LD9 A;  3NQJ A;  3REH D;  1M19 C;  1P3I C;  3W99 B;  1P3L C;  3A6N A;  3MNN D;  3AZN D;  3AZF A;  2Y2M A;  4Z5T D;  2F8N B;  3W96 B;  5AVC A;  5B2J D;  1P3G A;  1ZLA B;  3MGQ D;  4LD9 B;  3NQJ B;  3LEL A;  3AZI A;  3A6N C;  3B0D B;  3AZF B;  5AVB D;  3A1K A;  3REJ D;  4ZBJ C;  5AVC B;  1P3A D;  1EQZ A;  3B6G D;  1P3G C;  4HGA B;  1JFI B;  1P3O A;  1F66 D;  3LEL C;  3C1B A;  3AZI C;  5BNX A;  2Y2Q A;  3LZ0 D;  1P34 B;  3TU4 A;  1AOI D;  5C3I B;  5GXQ D;  2F8N G;  1P3F D;  5JRG D;  1EQZ C;  2NQB D;  1KX4 D;  1A7W A;  4WU9 D;  4YM6 D;  5B1L A;  5DNN D;  1P3O C;  3H0R C;  4WU8 A;  3C1B B;  3X1T A;  3B6F C;  4CSR A;  3TU4 C;  5AV5 A;  1P3I D;  1M19 D;  5AY8 A;  5B24 D;  2Y2P A;  5B1L B;  5DNM A;  5B1L C;  3X1T B;  3IP4 C;  3MGR A;  4WU8 C;  3AZJ B;  2YFV A;  5E5A C;  4ZUX C;  5AV5 C;  2ZY2 A;  5AY8 B;  5B1M C;  3AZL A;  1P3P B;  1TZY B;  1HQ3 A;  5DNM C;  5CPK A;  3MGR B;  3VH6 T;  4QLC B;  3C1C B;  3AL0 C;  3LZ1 C;  1ID3 A;  3B0B A;  1KX3 A;  3AZK A;  3AV2 A;  5B0Y A;  3AZL B;  5CPI A;  3AZL C;  1S32 A;  2ZY4 A;  1HQ3 B;  2G5I C;  5CPK C;  1EQZ D;  3AFA C;  1P3O D;  1ID3 C;  1KX3 B;  2HIO B;  3MGS B;  5B0Y B;  3B6F D;  3AZK C;  3AV2 C;  5B0Y C;  5CPI B;  3WA9 D;  1S32 C;  1H3O B;  2G5H C;  2XD5 A;  5AV9 A;  4X23 A;  5AV6 D;  1P3K A;  3AZM A;  1PZR A;  3H0M C;  2NZD A;  5B32 A;  3AN2 C;  3WTP E;  3X1U B;  5E5A D;  3REH A;  2JSS A;  4ZUX D;  3UTA C;  3AZE B;  3MNN A;  3AZN A;  5AV9 B;  5B1M D;  4X23 B;  4Z5T A;  1P3K B;  1R4V A;  3AZM B;  3B0C W;  3KSY A;  2NZD B;  4J8V D;  5DNM D;  5B32 B;  4G91 B;  5B32 C;  2RIQ A;  5B2J A;  3MGQ A;  3AYW C;  1BH8 A;  3LZ1 D;  4KGC D;  3REH C;  2BYK A;  5GT0 D;  3AZN B;  3MNN C;  5FUG A;  5AVB A;  4Z5T C;  3W97 D;  5B2I B;  3REJ A;  1P3A A;  3B6G A;  3UTB B;  5B2J C;  3MVD C;  1Z2C B;  4WNN B;  3AFA D;  3MGQ C;  4AWL C;  1F66 A;  3LZ0 A;  3AZK D;  5GSU D;  5AVB B;  1AOI A;  5GXQ A;  3REJ B;  3REJ C;  1P3A B;  5JRG A;  2NQB A;  5B32 G;  5B0Z B;  3B6G C;  1M1A B;  3H0L C;  4WU9 A;  4YM6 A;  1F66 B;  5DNN A;  3MGP C;  3AN2 D; 
#chains in the Genus database with same CATH homology
 3LZ0 C;  2PYO C;  1AOI B;  2Y2J A;  3UT9 D;  5GXQ B;  1P3M B;  1P3F B;  3UTA D;  1M19 A;  3P5J B;  4KUD D;  2L5A A;  3LJA C;  2NQB B;  5JRG C;  5GT3 B;  2J8P A;  5B24 A;  1KX4 B;  4WU9 B;  2HUE B;  4NE6 A;  4YM6 C;  5DNN B;  1BH9 B;  4XUJ C;  5DNN C;  4E45 A;  4Z66 C;  3AYW D;  4DRA A;  1M19 B;  1P3I B;  2IO5 C;  1P3L B;  5F99 A;  3KWQ D;  5B24 C;  4R8P C;  5KDM A;  3MVD D;  3R45 A;  4JJN C;  4YS3 A;  3EG5 B;  1M18 D;  2YFW A;  3AV1 C;  3A6N B;  5F99 C;  4ZBJ B;  3WTP C;  4H9S A;  1P3G B;  2Y2O A;  3LEL B;  1ULY A;  3MGP D;  3EPL A;  3WA9 A;  2DQN C;  4YS3 C;  2YFW B;  3AZI B;  3AZG D;  3B6F A;  2PYO D;  2Y2N A;  5BS7 A;  3LJA D;  4Z2M H;  1EQZ B;  5AV8 C;  5AV6 A;  4H9S C;  3VH5 T;  2FJ7 A;  1P3O B;  4XUJ D;  5B33 C;  3B6F B;  4UPK A;  4J8U A;  1KX5 D;  3WA9 C;  5BNX B;  4Z66 D;  5E5A A;  3TU4 B;  2Y2H A;  4ZUX A;  3W98 C;  5BS7 C;  2DF4 C;  5B1M A;  2BG1 A;  5AV6 C;  2FJ7 C;  4J8V A;  4WU8 B;  4R8P D;  4J8U C;  5CHL B;  5E5A B;  4CSR B;  3LZ1 A;  4ZUX B;  4KGC A;  5AV5 B;  4JJN D;  5GT0 A;  5B1M B;  3AV1 D;  5F99 D;  3W97 A;  3REL C;  5DNM B;  3WTP D;  4J8V C;  3KXB C;  3AFA A;  3O62 D;  3LZ1 B;  3B0C T;  2YFV B;  4KGC C;  4YS3 D;  5GT0 C;  4WJ3 C;  3W99 D;  5GSU A;  3W97 C;  5CPK B;  5AV8 D;  3AFA B;  2ZM5 A;  3KUY C;  4H9P A;  5CP6 A;  1ID3 B;  5B33 D;  3AN2 A;  3AZK B;  4KHA A;  5B31 C;  3AV2 B;  5G49 A;  5GSU C;  3UT9 A;  1S32 B;  3UTA A;  3W98 D;  4KUD A;  4CAY A;  1KU5 A;  3X1S C;  2FJ7 D;  5CP6 C;  3AN2 B;  4J8U D;  3AYW A;  2BYM A;  5BT1 C;  3UT9 C;  3UTA B;  4KUD C;  4CAY B;  3KWQ A;  3REL D;  2ARO C;  1B6W A;  3KXB D;  3MVD A;  3AYW B;  3WKJ C;  2BYM B;  1TAF A;  3REH B;  3X1V C;  1M18 A;  3MNN B;  3KWQ B;  2CV5 C;  3KWQ C;  4Z5T B;  2W8S A;  2XD1 A;  5B2J B;  3MVD B;  2F8N H;  3A1I A;  3MGQ B;  4AWL B;  3KUY D;  1BH8 B;  3AZJ D;  1TAF B;  4UUZ A;  4Z2M G;  3MGP A;  2BYK B;  3AZG A;  1M18 C;  5B31 D;  2PYO A;  5FUG B;  3AZH C;  1P3B C;  1P3P D;  3LJA A;  3B6G B;  3X1S D;  4EO5 C;  3C1C D;  4XUJ A;  4UUZ B;  3MGP B;  5CP6 D;  1KX5 A;  3AZG C;  3LZ0 B;  4Z66 A;  2PYO B;  5BT1 D;  4G92 C;  3LJA B;  5JRG B;  2Y2L A;  4YM6 B;  2ZY3 A;  4XUJ B;  2ARO D;  4R8P A;  2F8N K;  3WAA C;  3REK C;  1W2E A;  4Z66 B;  1KX5 C;  3WKJ D;  2HIO D;  3MGS D;  1WWS A;  3REI C;  2IO5 B;  4JJN A;  3X1V D;  3AV1 A;  2CV5 D;  5B24 B;  3NQU A;  1HTA A;  5CPJ C;  4XZQ C;  3WTP A;  3KFU G;  4R8P B;  4J8X D;  3O62 A;  3X1U D;  4JJN B;  3AV1 B;  5F99 B;  3W99 A;  3EPH A;  2FFF B;  3NQU B;  3AZH D;  1P3B D;  4H9N A;  3WTP B;  2F8N A;  5AV8 A;  1F1E A;  3W96 A;  4J8W D;  3O62 B;  5KDM B;  1U35 C;  3R45 B;  3O62 C;  1ZLA A;  4DRB A;  2UWX A;  5B33 A;  4YS3 B;  1N1J A;  3W99 C;  3W98 A;  4H9N B;  5AV8 B;  5B2I D;  3W96 C;  3UTB D;  5B33 B;  1ZLA C;  1JFI A;  4LD9 C;  3VH5 A;  1N1J B;  3WA9 B;  3WAA D;  3REK D;  3W98 B;  3REI D;  5B40 D;  3B0D C;  3AZF C;  1WWI A;  1P34 A;  2Y2G A;  5AV6 B;  5AVC C;  5B0Z D;  3REL A;  1M1A D;  2FJ7 B;  5CPJ D;  4HGA C;  4XZQ D;  3KXB A;  4J8U B;  5JA4 A;  4NFT A;  3FDD A;  1P34 C;  2ZY5 A;  5C3I C;  1P3M D;  5GT3 D;  3REL B;  4NE3 A;  4J8V B;  3KXB B;  5JA4 B;  3C1B C;  3KUY A;  1U35 D;  3AZJ A;  4KGC B;  3VH6 A;  5GT0 B;  2VQR A;  5B31 A;  1P3L D;  1P3P A;  3W97 B;  4E44 A;  1TZY A;  2F8N D;  3X1S A;  3W96 D;  1Q9C A;  3X1T C;  3KUY B;  1B67 A;  4QLC A;  4H9R A;  3C1C A;  3AZJ C;  1ZLA D;  4LD9 D;  2CWE A;  5B31 B;  5GSU B;  4H9O A;  3A6N D;  5AY8 C;  1P3P C;  3AZF D;  1BFM A;  1TZY C;  3X1S B;  2F2A C;  5AVC D;  3MGR C;  4H9R B;  4QLC C;  3C1C C;  1P3G D;  4H9P B;  5CP6 B;  2ARO A;  3LEL D;  4KHA B;  5BO0 A;  2RVQ C;  3WKJ A;  2HIO A;  5G49 B;  3MGS A;  3AZI D;  4H9O B;  3UT9 B;  4KUD B;  3X1V A;  1P34 D;  4H9Q A;  1H3O A;  3VH5 W;  3EPJ A;  2CV5 A;  1HQ3 C;  2JE5 A;  2Y2K A;  2ARO B;  2LY8 A;  5BO0 B;  5B31 G;  4J8X A;  3WKJ B;  1KX3 C;  3C1B D;  2HIO C;  3MGS C;  3X1U A;  5CPI C;  3X1V B;  4H9Q B;  3TU4 D;  3AZE A;  2CV5 B;  3AZH A;  1P3B A;  4J8W A;  4J8X B;  5B1L D;  4J8X C;  5BNV A;  3X1T D;  4WU8 D;  3X1U C;  1M18 B;  5AV5 D;  3AZE C;  2Y2I A;  3AZH B;  1P3B B;  5AY8 D;  5AV9 C;  4X23 C;  3VH6 W;  5B2I A;  4J8W B;  1P3K C;  1TZY D;  4J8W C;  3AZM C;  2NZD C;  5BNV B;  4EO5 B;  4G91 C;  3MGR D;  3UTB A;  4QLC D;  4WNN A;  3AZG B;  3REK A;  3WAA A;  2RVQ D;  3REI A;  3AZN C;  5B40 A;  3AZL D;  3EPK A;  4G92 B;  4NE5 A;  3V9R A;  5B2I C;  1HQ3 D;  5CPK D;  5B0Z A;  1M1A A;  2JCH A;  3UTB C;  5CPJ A;  4DQY B;  4XZQ A;  4WZS B;  1KX5 B;  3REK B;  3WAA B;  1ID3 D;  1KX3 D;  3REI B;  5B0Y D;  5B40 B;  3AV2 D;  5CPI D;  5B40 C;  3V9R B;  5AVB C;  1S32 D;  1P3F A;  1P3M A;  1P3A C;  5GT3 A;  3F6T A;  1KX4 A;  4M6B A;  5B0Z C;  5CPJ B;  1M1A C;  4XZQ B;  4WV4 B;  1BH9 A;  1F66 C;  1U35 A;  1AOI C;  5GXQ C;  1P3I A;  1P3M C;  1P3F C;  1P3L A;  3AZE D;  2NQB C;  5GT3 C;  1KX4 C;  5AV9 D;  4X23 D;  4WU9 C;  2HUE C;  1P3K D;  1T3U A;  3AZM D;  2NZD D;  1U35 B;  5B32 D;  4LD9 A;  3NQJ A;  3REH D;  1M19 C;  1P3I C;  3W99 B;  1P3L C;  3A6N A;  3MNN D;  3AZN D;  3AZF A;  2Y2M A;  4Z5T D;  2F8N B;  3W96 B;  5AVC A;  5B2J D;  1P3G A;  1ZLA B;  3MGQ D;  4LD9 B;  3NQJ B;  3LEL A;  3AZI A;  3A6N C;  3B0D B;  3AZF B;  5AVB D;  3A1K A;  3REJ D;  4ZBJ C;  5AVC B;  1P3A D;  1EQZ A;  3B6G D;  1P3G C;  4HGA B;  1JFI B;  1P3O A;  1F66 D;  3LEL C;  3C1B A;  3AZI C;  5BNX A;  2Y2Q A;  3LZ0 D;  1P34 B;  3TU4 A;  1AOI D;  5C3I B;  5GXQ D;  2F8N G;  1P3F D;  5JRG D;  1EQZ C;  2NQB D;  1KX4 D;  1A7W A;  4WU9 D;  4YM6 D;  5B1L A;  5DNN D;  1P3O C;  3H0R C;  4WU8 A;  3C1B B;  3X1T A;  3B6F C;  4CSR A;  3TU4 C;  5AV5 A;  1P3I D;  1M19 D;  5AY8 A;  5B24 D;  2Y2P A;  5B1L B;  5DNM A;  5B1L C;  3X1T B;  3IP4 C;  3MGR A;  4WU8 C;  3AZJ B;  2YFV A;  5E5A C;  4ZUX C;  5AV5 C;  2ZY2 A;  5AY8 B;  5B1M C;  3AZL A;  1P3P B;  1TZY B;  1HQ3 A;  5DNM C;  5CPK A;  3MGR B;  3VH6 T;  4QLC B;  3C1C B;  3AL0 C;  3LZ1 C;  1ID3 A;  3B0B A;  1KX3 A;  3AZK A;  3AV2 A;  5B0Y A;  3AZL B;  5CPI A;  3AZL C;  1S32 A;  2ZY4 A;  1HQ3 B;  2G5I C;  5CPK C;  1EQZ D;  3AFA C;  1P3O D;  1ID3 C;  1KX3 B;  2HIO B;  3MGS B;  5B0Y B;  3B6F D;  3AZK C;  3AV2 C;  5B0Y C;  5CPI B;  3WA9 D;  1S32 C;  1H3O B;  2G5H C;  2XD5 A;  5AV9 A;  4X23 A;  5AV6 D;  1P3K A;  3AZM A;  1PZR A;  3H0M C;  2NZD A;  5B32 A;  3AN2 C;  3WTP E;  3X1U B;  5E5A D;  3REH A;  2JSS A;  4ZUX D;  3UTA C;  3AZE B;  3MNN A;  3AZN A;  5AV9 B;  5B1M D;  4X23 B;  4Z5T A;  1P3K B;  1R4V A;  3AZM B;  3B0C W;  3KSY A;  2NZD B;  4J8V D;  5DNM D;  5B32 B;  4G91 B;  5B32 C;  2RIQ A;  5B2J A;  3MGQ A;  3AYW C;  1BH8 A;  3LZ1 D;  4KGC D;  3REH C;  2BYK A;  5GT0 D;  3AZN B;  3MNN C;  5FUG A;  5AVB A;  4Z5T C;  3W97 D;  5B2I B;  3REJ A;  1P3A A;  3B6G A;  3UTB B;  5B2J C;  3MVD C;  1Z2C B;  4WNN B;  3AFA D;  3MGQ C;  4AWL C;  1F66 A;  3LZ0 A;  3AZK D;  5GSU D;  5AVB B;  1AOI A;  5GXQ A;  3REJ B;  3REJ C;  1P3A B;  5JRG A;  2NQB A;  5B32 G;  5B0Z B;  3B6G C;  1M1A B;  3H0L C;  4WU9 A;  4YM6 A;  1F66 B;  5DNN A;  3MGP C;  3AN2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...