5C3IB

Crystal structure of the quaternary complex of histone h3-h4 heterodimer with chaperone asf1 and the replicative helicase subunit mcm2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
LREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1A
publication title Structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 27
structure length 87
sequence length 87
chains with identical sequence F, J, N, R, V
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5c3iB00
4X23D 1TZYC 3REKD 4ZBJC 1P3FB 5AV5C 3TU4C 4JJNC 3WA9B 1P3MD 5DNNB 1F66D 3MGSD 3RELA 1TZYB 3UT9D 4EO5C 4ZBJB 3AN2C 3WAAD 5AV5B 4UUZA 3AZFD 5AVBA 3TU4B 4JJNB 5AV8C 1P3LD 4H9PB 5B2IA 2JSSA 2NQBA 3B0BA 1ZLAD 2BYKA 3VH5T 3W99C 4WZSB 4EO5B 3AN2B 5B1MD 3W96A 3REIC 1M19D 3W97C 3C1BC 5GT3C 1P3BB 5FUGB 5AV8B 3AZGC 5G49B 1U35A 2CV5D 4Z5TA 3WKJC 4YM6D 3WTPC 3W99B 2AROA 3VH5W 4J8VD 5AY8D 1HQ3C 3AZJA 5BNVB 5B2JC 3REIB 3W97B 3C1BB 3X1SC 5GT3B 1P3PC 3AZGB 3X1VC 4R8PA 2HIOA 5CPJC 3WKJB 4Z66A 4LD9C 3WTPB 5DNMD 3VH5A 3X1UD 3KWQA 1P3OA 3KUYA 2L5AA 3AZNA 1HQ3B 5B31G 5B2JB 5B40D 4H9SA 3X1SB 3MGQC 3B6GA 1P3PB 3X1TD 3X1VB 4WU9C 5CPJB 4LD9B 1JFIB 3MGPA 3KXBC 5GXQD 5BNXB 5B33D 5GSUC 1P3FA 4J8WD 1P3IA 1ULYA 1S32A 4XZQC 1R4VA 3MGQB 3MGRA 3REHA 1ID3A 1KX5C 4WU9B 3LELC 3UTAA 1TZYA 3LZ1C 1P3AD 1HTAA 1EQZD 3KXBB 5GT0C 5GSUB 5CP6A 1P34C 4HGAC 3AZMC 4XZQB 3W98C 5CPKA 4H9PA 1BH8A 4XUJC 1KX5B 2YFVA 3LELB 3LZ1B 3V9RA 5GT0B 3AN2A 3C1CD 3AYWC 1P34B 4HGAB 1N1JB 4J8XC 3AZMB 4CAYA 3AV2A 5FUGA 3W98B 4XUJB 3AFAD 3LJAA 4YS3D 3AYWB 5B31C 3B6FC 5JRGA 5B24C 4J8XB 5B0ZA 3REIA 1M1AC 5GT3A 5B1LA 3B0DC 4H9OB 1P3KC 5C3IC 3AZLC 3NQUB 4Z2MG 1B67A 3RELD 1AOIC 5B31B 3B6FB 3REJC 3AZIA 5B24B 1M1AB 3B0DB 1P3PA 5AVBD 4DRAA 5F99A 1P3KB 1JFIA 5C3IB 5BNXA 2YFWB 5B2ID 4J8UD 3AZLB 2NQBD 3UTBC 1AOIB 3REJB 1P3GD 3W96D 4H9RB 4ZUXA 4X23C 4WU9A 2HUEC 3REKC 5CPIA 3KSYA 3LZ0A 5AV6D 1U35D 5CHLB 4Z5TD 3UTBB 2AROD 4DRBA 5DNNC 5BO0B 2F8NB 2FJ7D 1P3MC 1KX5A 4X23B 1F66C 3MGSC 2NZDA 2HUEB 1KU5A 3REKB 4R8PD 2HIOD 3WAAC 1P34A 4Z66D 3AZFC 2CWEA 3AZMA 3AZHA 5B32G 3KWQD 3W98A 1P3OD 3AZND 1P3MB 1ZLAC 1F66B 3MGSB 3B6GD 5E5AA 5B1MC 1P3BC 1TAFB 3AZKA 3WAAB 4QLCA 3AZFB 3MGPD 4KGCD 3NQJB 1P3FD 1P3ID 3VH6W 5AVCA 3MVDD 2CV5C 3R45B 3MNNC 1S32D 1ZLAB 4YM6C 3O62A 3MGRD 3REHD 1ID3D 5AY8C 3UTAD 5B1MB 1TZYD 1KX3C 5B24A 1M1AA 5CP6D 3AV1A 2CV5B 3MNNB 1H3OA 4YM6B 1KX4A 5CPKD 5DNMC 4H9QB 2YFWA 3X1UC 3AZLA 5KDMB 4CSRB 5AY8B 1AOIA 1KX3B 5B40C 4WU8A 5JA4A 3AN2D 1F1EA 3X1TC 1Q9CA 4H9NB 4H9RA 3AZEA 3AV2D 4KUDC 2PYOC 3X1UB 5GXQC 5DNMB 5B33C 4J8WC 3LJAD 1BFMA 1B6WA 5B40B 1M18C 2F8NA 5JRGD 3X1TB 5B0YD 3REID 5B0ZD 2LY8A 3A6NC 5GT3D 5B1LD 1P3AC 4NE6A 1EQZC 2PYOB 4KUDB 5GXQB 5B33B 5B32D 4J8WB 3WA9A 5DNNA 1M18B 3AZID 3A6NB 5AV5A 2IO5C 1P3AB 1EQZB 3TU4A 4WV4B 4JJNA 1BH9B 5F99D 1TAFA 3WTPE 4KHAB 3AFAC 2IO5B 5AV9D 4ZUXD 4WU9D 4NE3A 1P3BA 5CPID 5AV8A 3LZ0D 5G49A 3W99A 3MNNA 2F8NH 3AFAB 5BNVA 3W97A 1KX5D 3C1BA 3RELC 2NZDD 3AZGA 1KX3A 3WKJA 2RVQD 5AVBC 3WTPA 3AZMD 3B0CT 3AZHD 3W98D 1HQ3A 5B2IC 5B2JA 4J8UC 3X1SA 3RELB 3X1VA 5E5AD 5CPJA 1P3GC 4LD9A 3AZKD 4QLCD 5AVBB 3B0CW 4KUDA 2PYOA 5AV6C 5AVCD 5B2IB 1U35C 4Z5TC 4J8UB 4WNNB 2BYKB 5BS7C 3MGQA 3O62D 2AROC 5BT1D 1M18A 1P3GB 2FJ7C 5B24D 3KXBA 1M1AD 5GSUA 3A6NA 1P3AA 3AV1D 5AV6B 2HIOC 1U35B 4Z5TB 4XZQA 4Z66C 1KX4D 3AZJD 2AROB 3AZLD 3KWQC 3LELA 1P3OC 3LZ1A 3AZNC 3UT9C 2FJ7B 4AWLC 5GT0A 4WU8D 4E45A 3B6GC 1N1JA 2F8NK 3AZED 2HIOB 3VH6T 4Z66B 1P3LC 3KUYD 3MGPC 4KGCC 4XUJA 3KWQB 1P3IC 1P3OB 3AZNB 3MVDC 3UT9B 1S32C 4AWLB 3AYWA 3B6GB 3MGRC 4J8XA 3REHC 1M19C 1ID3C 3UTAC 4H9OA 1P3LB 3MGPB 4KGCB 4E44A 5CP6C 3WA9D 1P3IB 3MVDB 4J8VC 3NQUA 1S32B 5DNND 5CPKC 5B31A 3B6FA 3MGRB 3REHB 1M19B 1ID3B 3UTAB 5AV5D 3VH6A 3TU4D 4JJND 5CP6B 1P3KA 4J8VB 2BYMB 3AV2C 5CPKB 3REJA 1BH8B 4J8UA 4WNNA 2YFVB 3LJAC 3V9RB 1P3GA 1P3BD 5JRGC 5AV8D 5B0YC 4G92C 5B0ZC 1A7WA 5B1LC 4CAYB 3UTBA 3AV2B 5AV6A 3W99D 3MNND 5B32C 5BO0A 5BS7A 3LJAB 3W97D 4X23A 3C1BD 3REKA 5JRGB 3AZGD 3AZIC 5B0YB 4G92B 5B0ZB 1KX3D 2FJ7A 5B1LB 3WKJD 3WTPD 5B32B 5F99C 1HQ3D 5B2JD 1P3MA 1WWSA 1F66A 3X1SD 3MGSA 1P3PD 3UT9A 3AZIB 3X1VD 5CPJD 3C1CC 3WAAA 5AV9C 4LD9D 3AZFA 4ZUXC 3NQJA 5CPIC 5F99B 1P3LA 4KUDD 2PYOD 3LZ0C 4KGCA 3R45A 1ZLAA 3MGQD 4YS3C 3MVDA 3C1CB 1M18D 5B1MA 5AV9B 1M19A 3KXBD 4ZUXB 5GSUD 3A6ND 2NZDC 5CPIB 3LZ0B 2CV5A 4XZQD 4M6BA 4YM6A 2RVQC 4YS3B 4H9QA 4J8VA 5KDMA 4CSRA 2BYMA 3AZHC 5AY8A 3LELD 3LZ1D 2F8NG 5GT0D 2NZDB 1P34D 4G91C 4H9NA 5E5AC 4NE5A 3AZKC 4QLCC 5DNMA 3X1UA 2NQBC 4XUJD 3AZHB 5AVCC 5B40A 3AYWD 3O62C 3W96C 4G91B 4UUZB 3X1TA 4J8XD 5E5AB 5BT1C 3AZKB 4QLCB 5B0YA 5GXQA 5B33A 2NQBB 4J8WA 3AV1C 5AVCB 4Z2MH 5B32A 1KX4C 3O62B 5B31D 4NFTA 3AZJC 3B6FD 3W96B 1EQZA 4R8PC 1BH9A 4WU8C 1P3KD 3AV1B 3AZEC 1H3OB 1KX4B 3KUYC 1AOID 3REJD 3AZJB 1WWIA 4KHAA 4H9SC 4R8PB 4WU8B 5JA4B 3C1CA 5AV9A 3AZEB 1P3FC 3UTBD 3KUYB 3WA9C 3AFAA 4YS3A 2F8ND
chains in the Genus database with same CATH superfamily
4X23D 1TZYC 3REKD 4ZBJC 2BG1A 1P3FB 5AV5C 3TU4C 4JJNC 3WA9B 1P3MD 5DNNB 1F66D 3MGSD 3RELA 1TZYB 3UT9D 4EO5C 4ZBJB 3AN2C 3WAAD 5AV5B 2RIQA 4UUZA 3AZFD 2W8SA 5AVBA 3TU4B 4JJNB 5AV8C 1P3LD 4H9PB 5B2IA 2JSSA 2NQBA 3B0BA 1ZLAD 2BYKA 3VH5T 3W99C 3H0MC 4WZSB 4EO5B 3AN2B 5B1MD 3W96A 3REIC 1M19D 3W97C 3C1BC 5GT3C 1P3BB 5FUGB 5AV8B 3AZGC 5G49B 1U35A 2CV5D 4Z5TA 3WKJC 4YM6D 3WTPC 3W99B 2AROA 4WJ3C 3VH5W 4J8VD 5AY8D 1HQ3C 3AZJA 5BNVB 5B2JC 3REIB 3W97B 3C1BB 3X1SC 5GT3B 1P3PC 3AZGB 3X1VC 4R8PA 2HIOA 5CPJC 3WKJB 4Z66A 4LD9C 3WTPB 5DNMD 3VH5A 3X1UD 3KWQA 1P3OA 3KUYA 2L5AA 3AZNA 1HQ3B 5B31G 5B2JB 5B40D 4H9SA 3X1SB 3MGQC 3B6GA 1P3PB 3X1TD 3X1VB 4WU9C 5CPJB 2Y2IA 4LD9B 1JFIB 3MGPA 3KXBC 5GXQD 5BNXB 5B33D 5GSUC 1P3FA 4J8WD 1P3IA 1ULYA 1S32A 4XZQC 1R4VA 2ZY4A 3MGQB 3MGRA 3REHA 1ID3A 1KX5C 4WU9B 3LELC 3UTAA 1TZYA 3LZ1C 1P3AD 1HTAA 1EQZD 2UWXA 3KXBB 5GT0C 5GSUB 5CP6A 1P34C 4HGAC 3AZMC 4XZQB 3W98C 5CPKA 4H9PA 1BH8A 4XUJC 1KX5B 2YFVA 3LELB 3LZ1B 3V9RA 5GT0B 3AN2A 3C1CD 3AYWC 1P34B 4HGAB 1N1JB 4J8XC 3AZMB 4CAYA 3AV2A 5FUGA 3W98B 4XUJB 2VQRA 3AFAD 3LJAA 4YS3D 3AYWB 5B31C 3B6FC 5JRGA 2Y2GA 5B24C 4J8XB 5B0ZA 3REIA 1M1AC 5GT3A 5B1LA 3A1IA 3B0DC 4H9OB 1P3KC 5C3IC 3AZLC 3NQUB 1T3UA 4Z2MG 1B67A 3RELD 1AOIC 5B31B 3B6FB 3REJC 3AZIA 5B24B 1M1AB 2FFFB 3B0DB 1P3PA 5AVBD 4DRAA 5F99A 1P3KB 1JFIA 5C3IB 5BNXA 2YFWB 5B2ID 4J8UD 3AZLB 2NQBD 3UTBC 1AOIB 3REJB 2Y2KA 1P3GD 3W96D 4H9RB 4ZUXA 4X23C 4WU9A 2HUEC 3REKC 5CPIA 3KSYA 3LZ0A 5AV6D 1U35D 5CHLB 4Z5TD 3UTBB 2AROD 4DRBA 5DNNC 2F2AC 5BO0B 2F8NB 2FJ7D 1P3MC 1KX5A 4X23B 1F66C 3MGSC 2NZDA 2HUEB 1KU5A 3REKB 4R8PD 2HIOD 2JE5A 3WAAC 1P34A 4Z66D 3AZFC 2CWEA 3AZMA 3AZHA 5B32G 3KWQD 3W98A 1P3OD 3AZND 1PZRA 1P3MB 1ZLAC 1F66B 3MGSB 3B6GD 5E5AA 5B1MC 1P3BC 1TAFB 3AZKA 3WAAB 4QLCA 3AZFB 3MGPD 4KGCD 3NQJB 1P3FD 1W2EA 1P3ID 3VH6W 5AVCA 3MVDD 2CV5C 3R45B 3MNNC 1S32D 3P5JB 1ZLAB 4YM6C 3O62A 3MGRD 3REHD 1ID3D 5AY8C 3UTAD 5B1MB 1TZYD 3H0RC 1KX3C 5B24A 1M1AA 5CP6D 3AV1A 2CV5B 3MNNB 1H3OA 4YM6B 1KX4A 5CPKD 5DNMC 4H9QB 2YFWA 3X1UC 3AZLA 5KDMB 2Y2PA 4CSRB 5AY8B 1AOIA 1KX3B 5B40C 4WU8A 5JA4A 3AN2D 1F1EA 3X1TC 1Q9CA 4H9NB 2Y2QA 4H9RA 3AZEA 3AV2D 4KUDC 2PYOC 3X1UB 5GXQC 5DNMB 2DQNC 5B33C 4J8WC 3LJAD 1BFMA 1B6WA 4DQYB 5B40B 1M18C 2G5IC 2F8NA 5JRGD 3X1TB 5B0YD 3REID 5B0ZD 2LY8A 3A6NC 5GT3D 5B1LD 1P3AC 4NE6A 1EQZC 2PYOB 4KUDB 5GXQB 5B33B 5B32D 4J8WB 3WA9A 5DNNA 1M18B 3AZID 3A6NB 5AV5A 2IO5C 1P3AB 1EQZB 3TU4A 4WV4B 4JJNA 1BH9B 5F99D 1TAFA 3WTPE 4KHAB 3AFAC 3IP4C 2IO5B 5AV9D 3EPHA 4ZUXD 4WU9D 4NE3A 1P3BA 5CPID 5AV8A 3LZ0D 5G49A 3EPLA 2ZY2A 3W99A 3MNNA 2Y2HA 2F8NH 3AFAB 5BNVA 3W97A 1KX5D 3C1BA 3RELC 2NZDD 3FDDA 3AZGA 1KX3A 3WKJA 2RVQD 5AVBC 3WTPA 3AZMD 3B0CT 3AZHD 3W98D 3H0LC 1HQ3A 5B2IC 5B2JA 4J8UC 3X1SA 3RELB 3X1VA 5E5AD 5CPJA 1P3GC 4LD9A 3AZKD 4QLCD 5AVBB 3B0CW 4KUDA 2PYOA 5AV6C 5AVCD 5B2IB 1U35C 4Z5TC 4J8UB 4WNNB 2BYKB 5BS7C 3MGQA 3O62D 3EPKA 2AROC 5BT1D 1M18A 1P3GB 2FJ7C 5B24D 3KXBA 1M1AD 5GSUA 3A6NA 1P3AA 3AV1D 3EG5B 4UPKA 5AV6B 2HIOC 1U35B 4Z5TB 2Y2OA 4XZQA 4Z66C 1KX4D 3AZJD 2AROB 3AZLD 3KWQC 3LELA 1P3OC 3LZ1A 3AZNC 3A1KA 3UT9C 2FJ7B 4AWLC 5GT0A 4WU8D 2Y2MA 4E45A 3B6GC 1N1JA 2F8NK 3AZED 2HIOB 3VH6T 4Z66B 1P3LC 3KUYD 3MGPC 4KGCC 4XUJA 3KWQB 1P3IC 1P3OB 3AZNB 3MVDC 3UT9B 1S32C 4AWLB 3AYWA 3B6GB 3MGRC 4J8XA 3REHC 1M19C 1ID3C 3UTAC 4H9OA 1P3LB 3MGPB 4KGCB 4E44A 5CP6C 3WA9D 1P3IB 3MVDB 4J8VC 3NQUA 1S32B 5DNND 5CPKC 5B31A 3B6FA 3MGRB 3REHB 1M19B 1ID3B 3AL0C 3UTAB 5AV5D 3VH6A 3TU4D 4JJND 5CP6B 1P3KA 4J8VB 2BYMB 2Y2NA 3AV2C 5CPKB 3REJA 1BH8B 4J8UA 4WNNA 2YFVB 3LJAC 3V9RB 1P3GA 1P3BD 5JRGC 5AV8D 5B0YC 4G92C 5B0ZC 1A7WA 5B1LC 4CAYB 3UTBA 3AV2B 5AV6A 3W99D 3MNND 2XD1A 5B32C 5BO0A 5BS7A 3LJAB 3W97D 4X23A 3C1BD 3KFUG 3REKA 5JRGB 3AZGD 3AZIC 5B0YB 4G92B 5B0ZB 1KX3D 2FJ7A 5B1LB 3WKJD 2XD5A 3WTPD 2ZY5A 2Y2LA 5B32B 5F99C 1HQ3D 5B2JD 1P3MA 1WWSA 2DF4C 1F66A 3X1SD 3MGSA 1P3PD 3UT9A 3AZIB 3X1VD 5CPJD 3C1CC 3WAAA 5AV9C 4LD9D 3AZFA 4ZUXC 3NQJA 5CPIC 5F99B 1P3LA 4KUDD 2PYOD 3LZ0C 4KGCA 3R45A 1ZLAA 3MGQD 4YS3C 3MVDA 2ZM5A 1Z2CB 3C1CB 1M18D 5B1MA 5AV9B 1M19A 3KXBD 4ZUXB 5GSUD 3A6ND 2NZDC 5CPIB 3LZ0B 2CV5A 4XZQD 4M6BA 4YM6A 2RVQC 4YS3B 4H9QA 4J8VA 5KDMA 4CSRA 2BYMA 3AZHC 5AY8A 3LELD 3LZ1D 2F8NG 5GT0D 2NZDB 1P34D 4G91C 4H9NA 5E5AC 4NE5A 3AZKC 4QLCC 5DNMA 3X1UA 2NQBC 4XUJD 3AZHB 5AVCC 5B40A 3AYWD 3O62C 3W96C 4G91B 4UUZB 3X1TA 4J8XD 5E5AB 5BT1C 3AZKB 4QLCB 5B0YA 2J8PA 5B33A 5GXQA 2NQBB 4J8WA 3AV1C 5AVCB 4Z2MH 2Y2JA 3F6TA 5B32A 1KX4C 3O62B 5B31D 4NFTA 3EPJA 3AZJC 3B6FD 3W96B 2ZY3A 1EQZA 4R8PC 1BH9A 4WU8C 2JCHA 1P3KD 3AV1B 3AZEC 1H3OB 1KX4B 3KUYC 1AOID 3REJD 3AZJB 1WWIA 4KHAA 4H9SC 4R8PB 4WU8B 5JA4B 3C1CA 5AV9A 2G5HC 3AZEB 1P3FC 3UTBD 3KUYB 3WA9C 3AFAA 4YS3A 2F8ND
chains in the Genus database with same CATH topology
4X23D 1TZYC 3REKD 4ZBJC 2BG1A 1P3FB 5AV5C 3TU4C 4JJNC 3WA9B 1P3MD 5DNNB 1F66D 3MGSD 3RELA 1TZYB 3UT9D 4EO5C 4ZBJB 3AN2C 3WAAD 5AV5B 2RIQA 4UUZA 3AZFD 2W8SA 5AVBA 3TU4B 4JJNB 5AV8C 1P3LD 4H9PB 5B2IA 2JSSA 2NQBA 3B0BA 1ZLAD 2BYKA 3VH5T 3W99C 3H0MC 4WZSB 4EO5B 3AN2B 5B1MD 3W96A 3REIC 1M19D 3W97C 3C1BC 5GT3C 1P3BB 5FUGB 5AV8B 3AZGC 5G49B 1U35A 2CV5D 4Z5TA 3WKJC 4YM6D 3WTPC 3W99B 2AROA 4WJ3C 3VH5W 4J8VD 5AY8D 1HQ3C 3AZJA 5BNVB 5B2JC 3REIB 3W97B 3C1BB 3X1SC 5GT3B 1P3PC 3AZGB 3X1VC 4R8PA 2HIOA 5CPJC 3WKJB 4Z66A 4LD9C 3WTPB 5DNMD 3VH5A 3X1UD 3KWQA 1P3OA 3KUYA 2L5AA 3AZNA 1HQ3B 5B31G 5B2JB 5B40D 4H9SA 3X1SB 3MGQC 3B6GA 1P3PB 3X1TD 3X1VB 4WU9C 5CPJB 2Y2IA 4LD9B 1JFIB 3MGPA 3KXBC 5GXQD 5BNXB 5B33D 5GSUC 1P3FA 4J8WD 1P3IA 1ULYA 1S32A 4XZQC 1R4VA 2ZY4A 3MGQB 3MGRA 3REHA 1ID3A 1KX5C 4WU9B 3LELC 3UTAA 1TZYA 3LZ1C 1P3AD 1HTAA 1EQZD 2UWXA 3KXBB 5GT0C 5GSUB 5CP6A 1P34C 4HGAC 3AZMC 4XZQB 3W98C 5CPKA 4H9PA 1BH8A 4XUJC 1KX5B 2YFVA 3LELB 3LZ1B 3V9RA 5GT0B 3AN2A 3C1CD 3AYWC 1P34B 4HGAB 1N1JB 4J8XC 3AZMB 4CAYA 3AV2A 5FUGA 3W98B 4XUJB 2VQRA 3AFAD 3LJAA 4YS3D 3AYWB 5B31C 3B6FC 5JRGA 2Y2GA 5B24C 4J8XB 5B0ZA 3REIA 1M1AC 5GT3A 5B1LA 3A1IA 3B0DC 4H9OB 1P3KC 5C3IC 3AZLC 3NQUB 1T3UA 4Z2MG 1B67A 3RELD 1AOIC 5B31B 3B6FB 3REJC 3AZIA 5B24B 1M1AB 2FFFB 3B0DB 1P3PA 5AVBD 4DRAA 5F99A 1P3KB 1JFIA 5C3IB 5BNXA 2YFWB 5B2ID 4J8UD 3AZLB 2NQBD 3UTBC 1AOIB 3REJB 2Y2KA 1P3GD 3W96D 4H9RB 4ZUXA 4X23C 4WU9A 2HUEC 3REKC 5CPIA 3KSYA 3LZ0A 5AV6D 1U35D 5CHLB 4Z5TD 3UTBB 2AROD 4DRBA 5DNNC 2F2AC 5BO0B 2F8NB 2FJ7D 1P3MC 1KX5A 4X23B 1F66C 3MGSC 2NZDA 2HUEB 1KU5A 3REKB 4R8PD 2HIOD 2JE5A 3WAAC 1P34A 4Z66D 3AZFC 2CWEA 3AZMA 3AZHA 5B32G 3KWQD 3W98A 1P3OD 3AZND 1PZRA 1P3MB 1ZLAC 1F66B 3MGSB 3B6GD 5E5AA 5B1MC 1P3BC 1TAFB 3AZKA 3WAAB 4QLCA 3AZFB 3MGPD 4KGCD 3NQJB 1P3FD 1W2EA 1P3ID 3VH6W 5AVCA 3MVDD 2CV5C 3R45B 3MNNC 1S32D 3P5JB 1ZLAB 4YM6C 3O62A 3MGRD 3REHD 1ID3D 5AY8C 3UTAD 5B1MB 1TZYD 3H0RC 1KX3C 5B24A 1M1AA 5CP6D 3AV1A 2CV5B 3MNNB 1H3OA 4YM6B 1KX4A 5CPKD 5DNMC 4H9QB 2YFWA 3X1UC 3AZLA 5KDMB 2Y2PA 4CSRB 5AY8B 1AOIA 1KX3B 5B40C 4WU8A 5JA4A 3AN2D 1F1EA 3X1TC 1Q9CA 4H9NB 2Y2QA 4H9RA 3AZEA 3AV2D 4KUDC 2PYOC 3X1UB 5GXQC 5DNMB 2DQNC 5B33C 4J8WC 3LJAD 1BFMA 1B6WA 4DQYB 5B40B 1M18C 2G5IC 2F8NA 5JRGD 3X1TB 5B0YD 3REID 5B0ZD 2LY8A 3A6NC 5GT3D 5B1LD 1P3AC 4NE6A 1EQZC 2PYOB 4KUDB 5GXQB 5B33B 5B32D 4J8WB 3WA9A 5DNNA 1M18B 3AZID 3A6NB 5AV5A 2IO5C 1P3AB 1EQZB 3TU4A 4WV4B 4JJNA 1BH9B 5F99D 1TAFA 3WTPE 4KHAB 3AFAC 3IP4C 2IO5B 5AV9D 3EPHA 4ZUXD 4WU9D 4NE3A 1P3BA 5CPID 5AV8A 3LZ0D 5G49A 3EPLA 2ZY2A 3W99A 3MNNA 2Y2HA 2F8NH 3AFAB 5BNVA 3W97A 1KX5D 3C1BA 3RELC 2NZDD 3FDDA 3AZGA 1KX3A 3WKJA 2RVQD 5AVBC 3WTPA 3AZMD 3B0CT 3AZHD 3W98D 3H0LC 1HQ3A 5B2IC 5B2JA 4J8UC 3X1SA 3RELB 3X1VA 5E5AD 5CPJA 1P3GC 4LD9A 3AZKD 4QLCD 5AVBB 3B0CW 4KUDA 2PYOA 5AV6C 5AVCD 5B2IB 1U35C 4Z5TC 4J8UB 4WNNB 2BYKB 5BS7C 3MGQA 3O62D 3EPKA 2AROC 5BT1D 1M18A 1P3GB 2FJ7C 5B24D 3KXBA 1M1AD 5GSUA 3A6NA 1P3AA 3AV1D 3EG5B 4UPKA 5AV6B 2HIOC 1U35B 4Z5TB 2Y2OA 4XZQA 4Z66C 1KX4D 3AZJD 2AROB 3AZLD 3KWQC 3LELA 1P3OC 3LZ1A 3AZNC 3A1KA 3UT9C 2FJ7B 4AWLC 5GT0A 4WU8D 2Y2MA 4E45A 3B6GC 1N1JA 2F8NK 3AZED 2HIOB 3VH6T 4Z66B 1P3LC 3KUYD 3MGPC 4KGCC 4XUJA 3KWQB 1P3IC 1P3OB 3AZNB 3MVDC 3UT9B 1S32C 4AWLB 3AYWA 3B6GB 3MGRC 4J8XA 3REHC 1M19C 1ID3C 3UTAC 4H9OA 1P3LB 3MGPB 4KGCB 4E44A 5CP6C 3WA9D 1P3IB 3MVDB 4J8VC 3NQUA 1S32B 5DNND 5CPKC 5B31A 3B6FA 3MGRB 3REHB 1M19B 1ID3B 3AL0C 3UTAB 5AV5D 3VH6A 3TU4D 4JJND 5CP6B 1P3KA 4J8VB 2BYMB 2Y2NA 3AV2C 5CPKB 3REJA 1BH8B 4J8UA 4WNNA 2YFVB 3LJAC 3V9RB 1P3GA 1P3BD 5JRGC 5AV8D 5B0YC 4G92C 5B0ZC 1A7WA 5B1LC 4CAYB 3UTBA 3AV2B 5AV6A 3W99D 3MNND 2XD1A 5B32C 5BO0A 5BS7A 3LJAB 3W97D 4X23A 3C1BD 3KFUG 3REKA 5JRGB 3AZGD 3AZIC 5B0YB 4G92B 5B0ZB 1KX3D 2FJ7A 5B1LB 3WKJD 2XD5A 3WTPD 2ZY5A 2Y2LA 5B32B 5F99C 1HQ3D 5B2JD 1P3MA 1WWSA 2DF4C 1F66A 3X1SD 3MGSA 1P3PD 3UT9A 3AZIB 3X1VD 5CPJD 3C1CC 3WAAA 5AV9C 4LD9D 3AZFA 4ZUXC 3NQJA 5CPIC 5F99B 1P3LA 4KUDD 2PYOD 3LZ0C 4KGCA 3R45A 1ZLAA 3MGQD 4YS3C 3MVDA 2ZM5A 1Z2CB 3C1CB 1M18D 5B1MA 5AV9B 1M19A 3KXBD 4ZUXB 5GSUD 3A6ND 2NZDC 5CPIB 3LZ0B 2CV5A 4XZQD 4M6BA 4YM6A 2RVQC 4YS3B 4H9QA 4J8VA 5KDMA 4CSRA 2BYMA 3AZHC 5AY8A 3LELD 3LZ1D 2F8NG 5GT0D 2NZDB 1P34D 4G91C 4H9NA 5E5AC 4NE5A 3AZKC 4QLCC 5DNMA 3X1UA 2NQBC 4XUJD 3AZHB 5AVCC 5B40A 3AYWD 3O62C 3W96C 4G91B 4UUZB 3X1TA 4J8XD 5E5AB 5BT1C 3AZKB 4QLCB 5B0YA 2J8PA 5B33A 5GXQA 2NQBB 4J8WA 3AV1C 5AVCB 4Z2MH 2Y2JA 3F6TA 5B32A 1KX4C 3O62B 5B31D 4NFTA 3EPJA 3AZJC 3B6FD 3W96B 2ZY3A 1EQZA 4R8PC 1BH9A 4WU8C 2JCHA 1P3KD 3AV1B 3AZEC 1H3OB 1KX4B 3KUYC 1AOID 3REJD 3AZJB 1WWIA 4KHAA 4H9SC 4R8PB 4WU8B 5JA4B 3C1CA 5AV9A 2G5HC 3AZEB 1P3FC 3UTBD 3KUYB 3WA9C 3AFAA 4YS3A 2F8ND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 D;  1TZY C;  3REK D;  4ZBJ C;  1P3F B;  5AV5 C;  3TU4 C;  4JJN C;  3WA9 B;  1P3M D;  5DNN B;  1F66 D;  3MGS D;  3REL A;  1TZY B;  3UT9 D;  4EO5 C;  4ZBJ B;  3AN2 C;  3WAA D;  5AV5 B;  4UUZ A;  3AZF D;  5AVB A;  3TU4 B;  4JJN B;  5AV8 C;  1P3L D;  4H9P B;  5B2I A;  2JSS A;  2NQB A;  3B0B A;  1ZLA D;  2BYK A;  3VH5 T;  3W99 C;  4WZS B;  4EO5 B;  3AN2 B;  5B1M D;  3W96 A;  3REI C;  1M19 D;  3W97 C;  3C1B C;  5GT3 C;  1P3B B;  5FUG B;  5AV8 B;  3AZG C;  5G49 B;  1U35 A;  2CV5 D;  4Z5T A;  3WKJ C;  4YM6 D;  3WTP C;  3W99 B;  2ARO A;  3VH5 W;  4J8V D;  5AY8 D;  1HQ3 C;  3AZJ A;  5BNV B;  5B2J C;  3REI B;  3W97 B;  3C1B B;  3X1S C;  5GT3 B;  1P3P C;  3AZG B;  3X1V C;  4R8P A;  2HIO A;  5CPJ C;  3WKJ B;  4Z66 A;  4LD9 C;  3WTP B;  5DNM D;  3VH5 A;  3X1U D;  3KWQ A;  1P3O A;  3KUY A;  2L5A A;  3AZN A;  1HQ3 B;  5B31 G;  5B2J B;  5B40 D;  4H9S A;  3X1S B;  3MGQ C;  3B6G A;  1P3P B;  3X1T D;  3X1V B;  4WU9 C;  5CPJ B;  4LD9 B;  1JFI B;  3MGP A;  3KXB C;  5GXQ D;  5BNX B;  5B33 D;  5GSU C;  1P3F A;  4J8W D;  1P3I A;  1ULY A;  1S32 A;  4XZQ C;  1R4V A;  3MGQ B;  3MGR A;  3REH A;  1ID3 A;  1KX5 C;  4WU9 B;  3LEL C;  3UTA A;  1TZY A;  3LZ1 C;  1P3A D;  1HTA A;  1EQZ D;  3KXB B;  5GT0 C;  5GSU B;  5CP6 A;  1P34 C;  4HGA C;  3AZM C;  4XZQ B;  3W98 C;  5CPK A;  4H9P A;  1BH8 A;  4XUJ C;  1KX5 B;  2YFV A;  3LEL B;  3LZ1 B;  3V9R A;  5GT0 B;  3AN2 A;  3C1C D;  3AYW C;  1P34 B;  4HGA B;  1N1J B;  4J8X C;  3AZM B;  4CAY A;  3AV2 A;  5FUG A;  3W98 B;  4XUJ B;  3AFA D;  3LJA A;  4YS3 D;  3AYW B;  5B31 C;  3B6F C;  5JRG A;  5B24 C;  4J8X B;  5B0Z A;  3REI A;  1M1A C;  5GT3 A;  5B1L A;  3B0D C;  4H9O B;  1P3K C;  5C3I C;  3AZL C;  3NQU B;  4Z2M G;  1B67 A;  3REL D;  1AOI C;  5B31 B;  3B6F B;  3REJ C;  3AZI A;  5B24 B;  1M1A B;  3B0D B;  1P3P A;  5AVB D;  4DRA A;  5F99 A;  1P3K B;  1JFI A;  5C3I B;  5BNX A;  2YFW B;  5B2I D;  4J8U D;  3AZL B;  2NQB D;  3UTB C;  1AOI B;  3REJ B;  1P3G D;  3W96 D;  4H9R B;  4ZUX A;  4X23 C;  4WU9 A;  2HUE C;  3REK C;  5CPI A;  3KSY A;  3LZ0 A;  5AV6 D;  1U35 D;  5CHL B;  4Z5T D;  3UTB B;  2ARO D;  4DRB A;  5DNN C;  5BO0 B;  2F8N B;  2FJ7 D;  1P3M C;  1KX5 A;  4X23 B;  1F66 C;  3MGS C;  2NZD A;  2HUE B;  1KU5 A;  3REK B;  4R8P D;  2HIO D;  3WAA C;  1P34 A;  4Z66 D;  3AZF C;  2CWE A;  3AZM A;  3AZH A;  5B32 G;  3KWQ D;  3W98 A;  1P3O D;  3AZN D;  1P3M B;  1ZLA C;  1F66 B;  3MGS B;  3B6G D;  5E5A A;  5B1M C;  1P3B C;  1TAF B;  3AZK A;  3WAA B;  4QLC A;  3AZF B;  3MGP D;  4KGC D;  3NQJ B;  1P3F D;  1P3I D;  3VH6 W;  5AVC A;  3MVD D;  2CV5 C;  3R45 B;  3MNN C;  1S32 D;  1ZLA B;  4YM6 C;  3O62 A;  3MGR D;  3REH D;  1ID3 D;  5AY8 C;  3UTA D;  5B1M B;  1TZY D;  1KX3 C;  5B24 A;  1M1A A;  5CP6 D;  3AV1 A;  2CV5 B;  3MNN B;  1H3O A;  4YM6 B;  1KX4 A;  5CPK D;  5DNM C;  4H9Q B;  2YFW A;  3X1U C;  3AZL A;  5KDM B;  4CSR B;  5AY8 B;  1AOI A;  1KX3 B;  5B40 C;  4WU8 A;  5JA4 A;  3AN2 D;  1F1E A;  3X1T C;  1Q9C A;  4H9N B;  4H9R A;  3AZE A;  3AV2 D;  4KUD C;  2PYO C;  3X1U B;  5GXQ C;  5DNM B;  5B33 C;  4J8W C;  3LJA D;  1BFM A;  1B6W A;  5B40 B;  1M18 C;  2F8N A;  5JRG D;  3X1T B;  5B0Y D;  3REI D;  5B0Z D;  2LY8 A;  3A6N C;  5GT3 D;  5B1L D;  1P3A C;  4NE6 A;  1EQZ C;  2PYO B;  4KUD B;  5GXQ B;  5B33 B;  5B32 D;  4J8W B;  3WA9 A;  5DNN A;  1M18 B;  3AZI D;  3A6N B;  5AV5 A;  2IO5 C;  1P3A B;  1EQZ B;  3TU4 A;  4WV4 B;  4JJN A;  1BH9 B;  5F99 D;  1TAF A;  3WTP E;  4KHA B;  3AFA C;  2IO5 B;  5AV9 D;  4ZUX D;  4WU9 D;  4NE3 A;  1P3B A;  5CPI D;  5AV8 A;  3LZ0 D;  5G49 A;  3W99 A;  3MNN A;  2F8N H;  3AFA B;  5BNV A;  3W97 A;  1KX5 D;  3C1B A;  3REL C;  2NZD D;  3AZG A;  1KX3 A;  3WKJ A;  2RVQ D;  5AVB C;  3WTP A;  3AZM D;  3B0C T;  3AZH D;  3W98 D;  1HQ3 A;  5B2I C;  5B2J A;  4J8U C;  3X1S A;  3REL B;  3X1V A;  5E5A D;  5CPJ A;  1P3G C;  4LD9 A;  3AZK D;  4QLC D;  5AVB B;  3B0C W;  4KUD A;  2PYO A;  5AV6 C;  5AVC D;  5B2I B;  1U35 C;  4Z5T C;  4J8U B;  4WNN B;  2BYK B;  5BS7 C;  3MGQ A;  3O62 D;  2ARO C;  5BT1 D;  1M18 A;  1P3G B;  2FJ7 C;  5B24 D;  3KXB A;  1M1A D;  5GSU A;  3A6N A;  1P3A A;  3AV1 D;  5AV6 B;  2HIO C;  1U35 B;  4Z5T B;  4XZQ A;  4Z66 C;  1KX4 D;  3AZJ D;  2ARO B;  3AZL D;  3KWQ C;  3LEL A;  1P3O C;  3LZ1 A;  3AZN C;  3UT9 C;  2FJ7 B;  4AWL C;  5GT0 A;  4WU8 D;  4E45 A;  3B6G C;  1N1J A;  2F8N K;  3AZE D;  2HIO B;  3VH6 T;  4Z66 B;  1P3L C;  3KUY D;  3MGP C;  4KGC C;  4XUJ A;  3KWQ B;  1P3I C;  1P3O B;  3AZN B;  3MVD C;  3UT9 B;  1S32 C;  4AWL B;  3AYW A;  3B6G B;  3MGR C;  4J8X A;  3REH C;  1M19 C;  1ID3 C;  3UTA C;  4H9O A;  1P3L B;  3MGP B;  4KGC B;  4E44 A;  5CP6 C;  3WA9 D;  1P3I B;  3MVD B;  4J8V C;  3NQU A;  1S32 B;  5DNN D;  5CPK C;  5B31 A;  3B6F A;  3MGR B;  3REH B;  1M19 B;  1ID3 B;  3UTA B;  5AV5 D;  3VH6 A;  3TU4 D;  4JJN D;  5CP6 B;  1P3K A;  4J8V B;  2BYM B;  3AV2 C;  5CPK B;  3REJ A;  1BH8 B;  4J8U A;  4WNN A;  2YFV B;  3LJA C;  3V9R B;  1P3G A;  1P3B D;  5JRG C;  5AV8 D;  5B0Y C;  4G92 C;  5B0Z C;  1A7W A;  5B1L C;  4CAY B;  3UTB A;  3AV2 B;  5AV6 A;  3W99 D;  3MNN D;  5B32 C;  5BO0 A;  5BS7 A;  3LJA B;  3W97 D;  4X23 A;  3C1B D;  3REK A;  5JRG B;  3AZG D;  3AZI C;  5B0Y B;  4G92 B;  5B0Z B;  1KX3 D;  2FJ7 A;  5B1L B;  3WKJ D;  3WTP D;  5B32 B;  5F99 C;  1HQ3 D;  5B2J D;  1P3M A;  1WWS A;  1F66 A;  3X1S D;  3MGS A;  1P3P D;  3UT9 A;  3AZI B;  3X1V D;  5CPJ D;  3C1C C;  3WAA A;  5AV9 C;  4LD9 D;  3AZF A;  4ZUX C;  3NQJ A;  5CPI C;  5F99 B;  1P3L A;  4KUD D;  2PYO D;  3LZ0 C;  4KGC A;  3R45 A;  1ZLA A;  3MGQ D;  4YS3 C;  3MVD A;  3C1C B;  1M18 D;  5B1M A;  5AV9 B;  1M19 A;  3KXB D;  4ZUX B;  5GSU D;  3A6N D;  2NZD C;  5CPI B;  3LZ0 B;  2CV5 A;  4XZQ D;  4M6B A;  4YM6 A;  2RVQ C;  4YS3 B;  4H9Q A;  4J8V A;  5KDM A;  4CSR A;  2BYM A;  3AZH C;  5AY8 A;  3LEL D;  3LZ1 D;  2F8N G;  5GT0 D;  2NZD B;  1P34 D;  4G91 C;  4H9N A;  5E5A C;  4NE5 A;  3AZK C;  4QLC C;  5DNM A;  3X1U A;  2NQB C;  4XUJ D;  3AZH B;  5AVC C;  5B40 A;  3AYW D;  3O62 C;  3W96 C;  4G91 B;  4UUZ B;  3X1T A;  4J8X D;  5E5A B;  5BT1 C;  3AZK B;  4QLC B;  5B0Y A;  5GXQ A;  5B33 A;  2NQB B;  4J8W A;  3AV1 C;  5AVC B;  4Z2M H;  5B32 A;  1KX4 C;  3O62 B;  5B31 D;  4NFT A;  3AZJ C;  3B6F D;  3W96 B;  1EQZ A;  4R8P C;  1BH9 A;  4WU8 C;  1P3K D;  3AV1 B;  3AZE C;  1H3O B;  1KX4 B;  3KUY C;  1AOI D;  3REJ D;  3AZJ B;  1WWI A;  4KHA A;  4H9S C;  4R8P B;  4WU8 B;  5JA4 B;  3C1C A;  5AV9 A;  3AZE B;  1P3F C;  3UTB D;  3KUY B;  3WA9 C;  3AFA A;  4YS3 A;  2F8N D; 
#chains in the Genus database with same CATH topology
 4X23 D;  1TZY C;  3REK D;  4ZBJ C;  2BG1 A;  1P3F B;  5AV5 C;  3TU4 C;  4JJN C;  3WA9 B;  1P3M D;  5DNN B;  1F66 D;  3MGS D;  3REL A;  1TZY B;  3UT9 D;  4EO5 C;  4ZBJ B;  3AN2 C;  3WAA D;  5AV5 B;  2RIQ A;  4UUZ A;  3AZF D;  2W8S A;  5AVB A;  3TU4 B;  4JJN B;  5AV8 C;  1P3L D;  4H9P B;  5B2I A;  2JSS A;  2NQB A;  3B0B A;  1ZLA D;  2BYK A;  3VH5 T;  3W99 C;  3H0M C;  4WZS B;  4EO5 B;  3AN2 B;  5B1M D;  3W96 A;  3REI C;  1M19 D;  3W97 C;  3C1B C;  5GT3 C;  1P3B B;  5FUG B;  5AV8 B;  3AZG C;  5G49 B;  1U35 A;  2CV5 D;  4Z5T A;  3WKJ C;  4YM6 D;  3WTP C;  3W99 B;  2ARO A;  4WJ3 C;  3VH5 W;  4J8V D;  5AY8 D;  1HQ3 C;  3AZJ A;  5BNV B;  5B2J C;  3REI B;  3W97 B;  3C1B B;  3X1S C;  5GT3 B;  1P3P C;  3AZG B;  3X1V C;  4R8P A;  2HIO A;  5CPJ C;  3WKJ B;  4Z66 A;  4LD9 C;  3WTP B;  5DNM D;  3VH5 A;  3X1U D;  3KWQ A;  1P3O A;  3KUY A;  2L5A A;  3AZN A;  1HQ3 B;  5B31 G;  5B2J B;  5B40 D;  4H9S A;  3X1S B;  3MGQ C;  3B6G A;  1P3P B;  3X1T D;  3X1V B;  4WU9 C;  5CPJ B;  2Y2I A;  4LD9 B;  1JFI B;  3MGP A;  3KXB C;  5GXQ D;  5BNX B;  5B33 D;  5GSU C;  1P3F A;  4J8W D;  1P3I A;  1ULY A;  1S32 A;  4XZQ C;  1R4V A;  2ZY4 A;  3MGQ B;  3MGR A;  3REH A;  1ID3 A;  1KX5 C;  4WU9 B;  3LEL C;  3UTA A;  1TZY A;  3LZ1 C;  1P3A D;  1HTA A;  1EQZ D;  2UWX A;  3KXB B;  5GT0 C;  5GSU B;  5CP6 A;  1P34 C;  4HGA C;  3AZM C;  4XZQ B;  3W98 C;  5CPK A;  4H9P A;  1BH8 A;  4XUJ C;  1KX5 B;  2YFV A;  3LEL B;  3LZ1 B;  3V9R A;  5GT0 B;  3AN2 A;  3C1C D;  3AYW C;  1P34 B;  4HGA B;  1N1J B;  4J8X C;  3AZM B;  4CAY A;  3AV2 A;  5FUG A;  3W98 B;  4XUJ B;  2VQR A;  3AFA D;  3LJA A;  4YS3 D;  3AYW B;  5B31 C;  3B6F C;  5JRG A;  2Y2G A;  5B24 C;  4J8X B;  5B0Z A;  3REI A;  1M1A C;  5GT3 A;  5B1L A;  3A1I A;  3B0D C;  4H9O B;  1P3K C;  5C3I C;  3AZL C;  3NQU B;  1T3U A;  4Z2M G;  1B67 A;  3REL D;  1AOI C;  5B31 B;  3B6F B;  3REJ C;  3AZI A;  5B24 B;  1M1A B;  2FFF B;  3B0D B;  1P3P A;  5AVB D;  4DRA A;  5F99 A;  1P3K B;  1JFI A;  5C3I B;  5BNX A;  2YFW B;  5B2I D;  4J8U D;  3AZL B;  2NQB D;  3UTB C;  1AOI B;  3REJ B;  2Y2K A;  1P3G D;  3W96 D;  4H9R B;  4ZUX A;  4X23 C;  4WU9 A;  2HUE C;  3REK C;  5CPI A;  3KSY A;  3LZ0 A;  5AV6 D;  1U35 D;  5CHL B;  4Z5T D;  3UTB B;  2ARO D;  4DRB A;  5DNN C;  2F2A C;  5BO0 B;  2F8N B;  2FJ7 D;  1P3M C;  1KX5 A;  4X23 B;  1F66 C;  3MGS C;  2NZD A;  2HUE B;  1KU5 A;  3REK B;  4R8P D;  2HIO D;  2JE5 A;  3WAA C;  1P34 A;  4Z66 D;  3AZF C;  2CWE A;  3AZM A;  3AZH A;  5B32 G;  3KWQ D;  3W98 A;  1P3O D;  3AZN D;  1PZR A;  1P3M B;  1ZLA C;  1F66 B;  3MGS B;  3B6G D;  5E5A A;  5B1M C;  1P3B C;  1TAF B;  3AZK A;  3WAA B;  4QLC A;  3AZF B;  3MGP D;  4KGC D;  3NQJ B;  1P3F D;  1W2E A;  1P3I D;  3VH6 W;  5AVC A;  3MVD D;  2CV5 C;  3R45 B;  3MNN C;  1S32 D;  3P5J B;  1ZLA B;  4YM6 C;  3O62 A;  3MGR D;  3REH D;  1ID3 D;  5AY8 C;  3UTA D;  5B1M B;  1TZY D;  3H0R C;  1KX3 C;  5B24 A;  1M1A A;  5CP6 D;  3AV1 A;  2CV5 B;  3MNN B;  1H3O A;  4YM6 B;  1KX4 A;  5CPK D;  5DNM C;  4H9Q B;  2YFW A;  3X1U C;  3AZL A;  5KDM B;  2Y2P A;  4CSR B;  5AY8 B;  1AOI A;  1KX3 B;  5B40 C;  4WU8 A;  5JA4 A;  3AN2 D;  1F1E A;  3X1T C;  1Q9C A;  4H9N B;  2Y2Q A;  4H9R A;  3AZE A;  3AV2 D;  4KUD C;  2PYO C;  3X1U B;  5GXQ C;  5DNM B;  2DQN C;  5B33 C;  4J8W C;  3LJA D;  1BFM A;  1B6W A;  4DQY B;  5B40 B;  1M18 C;  2G5I C;  2F8N A;  5JRG D;  3X1T B;  5B0Y D;  3REI D;  5B0Z D;  2LY8 A;  3A6N C;  5GT3 D;  5B1L D;  1P3A C;  4NE6 A;  1EQZ C;  2PYO B;  4KUD B;  5GXQ B;  5B33 B;  5B32 D;  4J8W B;  3WA9 A;  5DNN A;  1M18 B;  3AZI D;  3A6N B;  5AV5 A;  2IO5 C;  1P3A B;  1EQZ B;  3TU4 A;  4WV4 B;  4JJN A;  1BH9 B;  5F99 D;  1TAF A;  3WTP E;  4KHA B;  3AFA C;  3IP4 C;  2IO5 B;  5AV9 D;  3EPH A;  4ZUX D;  4WU9 D;  4NE3 A;  1P3B A;  5CPI D;  5AV8 A;  3LZ0 D;  5G49 A;  3EPL A;  2ZY2 A;  3W99 A;  3MNN A;  2Y2H A;  2F8N H;  3AFA B;  5BNV A;  3W97 A;  1KX5 D;  3C1B A;  3REL C;  2NZD D;  3FDD A;  3AZG A;  1KX3 A;  3WKJ A;  2RVQ D;  5AVB C;  3WTP A;  3AZM D;  3B0C T;  3AZH D;  3W98 D;  3H0L C;  1HQ3 A;  5B2I C;  5B2J A;  4J8U C;  3X1S A;  3REL B;  3X1V A;  5E5A D;  5CPJ A;  1P3G C;  4LD9 A;  3AZK D;  4QLC D;  5AVB B;  3B0C W;  4KUD A;  2PYO A;  5AV6 C;  5AVC D;  5B2I B;  1U35 C;  4Z5T C;  4J8U B;  4WNN B;  2BYK B;  5BS7 C;  3MGQ A;  3O62 D;  3EPK A;  2ARO C;  5BT1 D;  1M18 A;  1P3G B;  2FJ7 C;  5B24 D;  3KXB A;  1M1A D;  5GSU A;  3A6N A;  1P3A A;  3AV1 D;  3EG5 B;  4UPK A;  5AV6 B;  2HIO C;  1U35 B;  4Z5T B;  2Y2O A;  4XZQ A;  4Z66 C;  1KX4 D;  3AZJ D;  2ARO B;  3AZL D;  3KWQ C;  3LEL A;  1P3O C;  3LZ1 A;  3AZN C;  3A1K A;  3UT9 C;  2FJ7 B;  4AWL C;  5GT0 A;  4WU8 D;  2Y2M A;  4E45 A;  3B6G C;  1N1J A;  2F8N K;  3AZE D;  2HIO B;  3VH6 T;  4Z66 B;  1P3L C;  3KUY D;  3MGP C;  4KGC C;  4XUJ A;  3KWQ B;  1P3I C;  1P3O B;  3AZN B;  3MVD C;  3UT9 B;  1S32 C;  4AWL B;  3AYW A;  3B6G B;  3MGR C;  4J8X A;  3REH C;  1M19 C;  1ID3 C;  3UTA C;  4H9O A;  1P3L B;  3MGP B;  4KGC B;  4E44 A;  5CP6 C;  3WA9 D;  1P3I B;  3MVD B;  4J8V C;  3NQU A;  1S32 B;  5DNN D;  5CPK C;  5B31 A;  3B6F A;  3MGR B;  3REH B;  1M19 B;  1ID3 B;  3AL0 C;  3UTA B;  5AV5 D;  3VH6 A;  3TU4 D;  4JJN D;  5CP6 B;  1P3K A;  4J8V B;  2BYM B;  2Y2N A;  3AV2 C;  5CPK B;  3REJ A;  1BH8 B;  4J8U A;  4WNN A;  2YFV B;  3LJA C;  3V9R B;  1P3G A;  1P3B D;  5JRG C;  5AV8 D;  5B0Y C;  4G92 C;  5B0Z C;  1A7W A;  5B1L C;  4CAY B;  3UTB A;  3AV2 B;  5AV6 A;  3W99 D;  3MNN D;  2XD1 A;  5B32 C;  5BO0 A;  5BS7 A;  3LJA B;  3W97 D;  4X23 A;  3C1B D;  3KFU G;  3REK A;  5JRG B;  3AZG D;  3AZI C;  5B0Y B;  4G92 B;  5B0Z B;  1KX3 D;  2FJ7 A;  5B1L B;  3WKJ D;  2XD5 A;  3WTP D;  2ZY5 A;  2Y2L A;  5B32 B;  5F99 C;  1HQ3 D;  5B2J D;  1P3M A;  1WWS A;  2DF4 C;  1F66 A;  3X1S D;  3MGS A;  1P3P D;  3UT9 A;  3AZI B;  3X1V D;  5CPJ D;  3C1C C;  3WAA A;  5AV9 C;  4LD9 D;  3AZF A;  4ZUX C;  3NQJ A;  5CPI C;  5F99 B;  1P3L A;  4KUD D;  2PYO D;  3LZ0 C;  4KGC A;  3R45 A;  1ZLA A;  3MGQ D;  4YS3 C;  3MVD A;  2ZM5 A;  1Z2C B;  3C1C B;  1M18 D;  5B1M A;  5AV9 B;  1M19 A;  3KXB D;  4ZUX B;  5GSU D;  3A6N D;  2NZD C;  5CPI B;  3LZ0 B;  2CV5 A;  4XZQ D;  4M6B A;  4YM6 A;  2RVQ C;  4YS3 B;  4H9Q A;  4J8V A;  5KDM A;  4CSR A;  2BYM A;  3AZH C;  5AY8 A;  3LEL D;  3LZ1 D;  2F8N G;  5GT0 D;  2NZD B;  1P34 D;  4G91 C;  4H9N A;  5E5A C;  4NE5 A;  3AZK C;  4QLC C;  5DNM A;  3X1U A;  2NQB C;  4XUJ D;  3AZH B;  5AVC C;  5B40 A;  3AYW D;  3O62 C;  3W96 C;  4G91 B;  4UUZ B;  3X1T A;  4J8X D;  5E5A B;  5BT1 C;  3AZK B;  4QLC B;  5B0Y A;  2J8P A;  5B33 A;  5GXQ A;  2NQB B;  4J8W A;  3AV1 C;  5AVC B;  4Z2M H;  2Y2J A;  3F6T A;  5B32 A;  1KX4 C;  3O62 B;  5B31 D;  4NFT A;  3EPJ A;  3AZJ C;  3B6F D;  3W96 B;  2ZY3 A;  1EQZ A;  4R8P C;  1BH9 A;  4WU8 C;  2JCH A;  1P3K D;  3AV1 B;  3AZE C;  1H3O B;  1KX4 B;  3KUY C;  1AOI D;  3REJ D;  3AZJ B;  1WWI A;  4KHA A;  4H9S C;  4R8P B;  4WU8 B;  5JA4 B;  3C1C A;  5AV9 A;  2G5H C;  3AZE B;  1P3F C;  3UTB D;  3KUY B;  3WA9 C;  3AFA A;  4YS3 A;  2F8N D; 
#chains in the Genus database with same CATH homology
 4X23 D;  1TZY C;  3REK D;  4ZBJ C;  2BG1 A;  1P3F B;  5AV5 C;  3TU4 C;  4JJN C;  3WA9 B;  1P3M D;  5DNN B;  1F66 D;  3MGS D;  3REL A;  1TZY B;  3UT9 D;  4EO5 C;  4ZBJ B;  3AN2 C;  3WAA D;  5AV5 B;  2RIQ A;  4UUZ A;  3AZF D;  2W8S A;  5AVB A;  3TU4 B;  4JJN B;  5AV8 C;  1P3L D;  4H9P B;  5B2I A;  2JSS A;  2NQB A;  3B0B A;  1ZLA D;  2BYK A;  3VH5 T;  3W99 C;  3H0M C;  4WZS B;  4EO5 B;  3AN2 B;  5B1M D;  3W96 A;  3REI C;  1M19 D;  3W97 C;  3C1B C;  5GT3 C;  1P3B B;  5FUG B;  5AV8 B;  3AZG C;  5G49 B;  1U35 A;  2CV5 D;  4Z5T A;  3WKJ C;  4YM6 D;  3WTP C;  3W99 B;  2ARO A;  4WJ3 C;  3VH5 W;  4J8V D;  5AY8 D;  1HQ3 C;  3AZJ A;  5BNV B;  5B2J C;  3REI B;  3W97 B;  3C1B B;  3X1S C;  5GT3 B;  1P3P C;  3AZG B;  3X1V C;  4R8P A;  2HIO A;  5CPJ C;  3WKJ B;  4Z66 A;  4LD9 C;  3WTP B;  5DNM D;  3VH5 A;  3X1U D;  3KWQ A;  1P3O A;  3KUY A;  2L5A A;  3AZN A;  1HQ3 B;  5B31 G;  5B2J B;  5B40 D;  4H9S A;  3X1S B;  3MGQ C;  3B6G A;  1P3P B;  3X1T D;  3X1V B;  4WU9 C;  5CPJ B;  2Y2I A;  4LD9 B;  1JFI B;  3MGP A;  3KXB C;  5GXQ D;  5BNX B;  5B33 D;  5GSU C;  1P3F A;  4J8W D;  1P3I A;  1ULY A;  1S32 A;  4XZQ C;  1R4V A;  2ZY4 A;  3MGQ B;  3MGR A;  3REH A;  1ID3 A;  1KX5 C;  4WU9 B;  3LEL C;  3UTA A;  1TZY A;  3LZ1 C;  1P3A D;  1HTA A;  1EQZ D;  2UWX A;  3KXB B;  5GT0 C;  5GSU B;  5CP6 A;  1P34 C;  4HGA C;  3AZM C;  4XZQ B;  3W98 C;  5CPK A;  4H9P A;  1BH8 A;  4XUJ C;  1KX5 B;  2YFV A;  3LEL B;  3LZ1 B;  3V9R A;  5GT0 B;  3AN2 A;  3C1C D;  3AYW C;  1P34 B;  4HGA B;  1N1J B;  4J8X C;  3AZM B;  4CAY A;  3AV2 A;  5FUG A;  3W98 B;  4XUJ B;  2VQR A;  3AFA D;  3LJA A;  4YS3 D;  3AYW B;  5B31 C;  3B6F C;  5JRG A;  2Y2G A;  5B24 C;  4J8X B;  5B0Z A;  3REI A;  1M1A C;  5GT3 A;  5B1L A;  3A1I A;  3B0D C;  4H9O B;  1P3K C;  5C3I C;  3AZL C;  3NQU B;  1T3U A;  4Z2M G;  1B67 A;  3REL D;  1AOI C;  5B31 B;  3B6F B;  3REJ C;  3AZI A;  5B24 B;  1M1A B;  2FFF B;  3B0D B;  1P3P A;  5AVB D;  4DRA A;  5F99 A;  1P3K B;  1JFI A;  5C3I B;  5BNX A;  2YFW B;  5B2I D;  4J8U D;  3AZL B;  2NQB D;  3UTB C;  1AOI B;  3REJ B;  2Y2K A;  1P3G D;  3W96 D;  4H9R B;  4ZUX A;  4X23 C;  4WU9 A;  2HUE C;  3REK C;  5CPI A;  3KSY A;  3LZ0 A;  5AV6 D;  1U35 D;  5CHL B;  4Z5T D;  3UTB B;  2ARO D;  4DRB A;  5DNN C;  2F2A C;  5BO0 B;  2F8N B;  2FJ7 D;  1P3M C;  1KX5 A;  4X23 B;  1F66 C;  3MGS C;  2NZD A;  2HUE B;  1KU5 A;  3REK B;  4R8P D;  2HIO D;  2JE5 A;  3WAA C;  1P34 A;  4Z66 D;  3AZF C;  2CWE A;  3AZM A;  3AZH A;  5B32 G;  3KWQ D;  3W98 A;  1P3O D;  3AZN D;  1PZR A;  1P3M B;  1ZLA C;  1F66 B;  3MGS B;  3B6G D;  5E5A A;  5B1M C;  1P3B C;  1TAF B;  3AZK A;  3WAA B;  4QLC A;  3AZF B;  3MGP D;  4KGC D;  3NQJ B;  1P3F D;  1W2E A;  1P3I D;  3VH6 W;  5AVC A;  3MVD D;  2CV5 C;  3R45 B;  3MNN C;  1S32 D;  3P5J B;  1ZLA B;  4YM6 C;  3O62 A;  3MGR D;  3REH D;  1ID3 D;  5AY8 C;  3UTA D;  5B1M B;  1TZY D;  3H0R C;  1KX3 C;  5B24 A;  1M1A A;  5CP6 D;  3AV1 A;  2CV5 B;  3MNN B;  1H3O A;  4YM6 B;  1KX4 A;  5CPK D;  5DNM C;  4H9Q B;  2YFW A;  3X1U C;  3AZL A;  5KDM B;  2Y2P A;  4CSR B;  5AY8 B;  1AOI A;  1KX3 B;  5B40 C;  4WU8 A;  5JA4 A;  3AN2 D;  1F1E A;  3X1T C;  1Q9C A;  4H9N B;  2Y2Q A;  4H9R A;  3AZE A;  3AV2 D;  4KUD C;  2PYO C;  3X1U B;  5GXQ C;  5DNM B;  2DQN C;  5B33 C;  4J8W C;  3LJA D;  1BFM A;  1B6W A;  4DQY B;  5B40 B;  1M18 C;  2G5I C;  2F8N A;  5JRG D;  3X1T B;  5B0Y D;  3REI D;  5B0Z D;  2LY8 A;  3A6N C;  5GT3 D;  5B1L D;  1P3A C;  4NE6 A;  1EQZ C;  2PYO B;  4KUD B;  5GXQ B;  5B33 B;  5B32 D;  4J8W B;  3WA9 A;  5DNN A;  1M18 B;  3AZI D;  3A6N B;  5AV5 A;  2IO5 C;  1P3A B;  1EQZ B;  3TU4 A;  4WV4 B;  4JJN A;  1BH9 B;  5F99 D;  1TAF A;  3WTP E;  4KHA B;  3AFA C;  3IP4 C;  2IO5 B;  5AV9 D;  3EPH A;  4ZUX D;  4WU9 D;  4NE3 A;  1P3B A;  5CPI D;  5AV8 A;  3LZ0 D;  5G49 A;  3EPL A;  2ZY2 A;  3W99 A;  3MNN A;  2Y2H A;  2F8N H;  3AFA B;  5BNV A;  3W97 A;  1KX5 D;  3C1B A;  3REL C;  2NZD D;  3FDD A;  3AZG A;  1KX3 A;  3WKJ A;  2RVQ D;  5AVB C;  3WTP A;  3AZM D;  3B0C T;  3AZH D;  3W98 D;  3H0L C;  1HQ3 A;  5B2I C;  5B2J A;  4J8U C;  3X1S A;  3REL B;  3X1V A;  5E5A D;  5CPJ A;  1P3G C;  4LD9 A;  3AZK D;  4QLC D;  5AVB B;  3B0C W;  4KUD A;  2PYO A;  5AV6 C;  5AVC D;  5B2I B;  1U35 C;  4Z5T C;  4J8U B;  4WNN B;  2BYK B;  5BS7 C;  3MGQ A;  3O62 D;  3EPK A;  2ARO C;  5BT1 D;  1M18 A;  1P3G B;  2FJ7 C;  5B24 D;  3KXB A;  1M1A D;  5GSU A;  3A6N A;  1P3A A;  3AV1 D;  3EG5 B;  4UPK A;  5AV6 B;  2HIO C;  1U35 B;  4Z5T B;  2Y2O A;  4XZQ A;  4Z66 C;  1KX4 D;  3AZJ D;  2ARO B;  3AZL D;  3KWQ C;  3LEL A;  1P3O C;  3LZ1 A;  3AZN C;  3A1K A;  3UT9 C;  2FJ7 B;  4AWL C;  5GT0 A;  4WU8 D;  2Y2M A;  4E45 A;  3B6G C;  1N1J A;  2F8N K;  3AZE D;  2HIO B;  3VH6 T;  4Z66 B;  1P3L C;  3KUY D;  3MGP C;  4KGC C;  4XUJ A;  3KWQ B;  1P3I C;  1P3O B;  3AZN B;  3MVD C;  3UT9 B;  1S32 C;  4AWL B;  3AYW A;  3B6G B;  3MGR C;  4J8X A;  3REH C;  1M19 C;  1ID3 C;  3UTA C;  4H9O A;  1P3L B;  3MGP B;  4KGC B;  4E44 A;  5CP6 C;  3WA9 D;  1P3I B;  3MVD B;  4J8V C;  3NQU A;  1S32 B;  5DNN D;  5CPK C;  5B31 A;  3B6F A;  3MGR B;  3REH B;  1M19 B;  1ID3 B;  3AL0 C;  3UTA B;  5AV5 D;  3VH6 A;  3TU4 D;  4JJN D;  5CP6 B;  1P3K A;  4J8V B;  2BYM B;  2Y2N A;  3AV2 C;  5CPK B;  3REJ A;  1BH8 B;  4J8U A;  4WNN A;  2YFV B;  3LJA C;  3V9R B;  1P3G A;  1P3B D;  5JRG C;  5AV8 D;  5B0Y C;  4G92 C;  5B0Z C;  1A7W A;  5B1L C;  4CAY B;  3UTB A;  3AV2 B;  5AV6 A;  3W99 D;  3MNN D;  2XD1 A;  5B32 C;  5BO0 A;  5BS7 A;  3LJA B;  3W97 D;  4X23 A;  3C1B D;  3KFU G;  3REK A;  5JRG B;  3AZG D;  3AZI C;  5B0Y B;  4G92 B;  5B0Z B;  1KX3 D;  2FJ7 A;  5B1L B;  3WKJ D;  2XD5 A;  3WTP D;  2ZY5 A;  2Y2L A;  5B32 B;  5F99 C;  1HQ3 D;  5B2J D;  1P3M A;  1WWS A;  2DF4 C;  1F66 A;  3X1S D;  3MGS A;  1P3P D;  3UT9 A;  3AZI B;  3X1V D;  5CPJ D;  3C1C C;  3WAA A;  5AV9 C;  4LD9 D;  3AZF A;  4ZUX C;  3NQJ A;  5CPI C;  5F99 B;  1P3L A;  4KUD D;  2PYO D;  3LZ0 C;  4KGC A;  3R45 A;  1ZLA A;  3MGQ D;  4YS3 C;  3MVD A;  2ZM5 A;  1Z2C B;  3C1C B;  1M18 D;  5B1M A;  5AV9 B;  1M19 A;  3KXB D;  4ZUX B;  5GSU D;  3A6N D;  2NZD C;  5CPI B;  3LZ0 B;  2CV5 A;  4XZQ D;  4M6B A;  4YM6 A;  2RVQ C;  4YS3 B;  4H9Q A;  4J8V A;  5KDM A;  4CSR A;  2BYM A;  3AZH C;  5AY8 A;  3LEL D;  3LZ1 D;  2F8N G;  5GT0 D;  2NZD B;  1P34 D;  4G91 C;  4H9N A;  5E5A C;  4NE5 A;  3AZK C;  4QLC C;  5DNM A;  3X1U A;  2NQB C;  4XUJ D;  3AZH B;  5AVC C;  5B40 A;  3AYW D;  3O62 C;  3W96 C;  4G91 B;  4UUZ B;  3X1T A;  4J8X D;  5E5A B;  5BT1 C;  3AZK B;  4QLC B;  5B0Y A;  2J8P A;  5B33 A;  5GXQ A;  2NQB B;  4J8W A;  3AV1 C;  5AVC B;  4Z2M H;  2Y2J A;  3F6T A;  5B32 A;  1KX4 C;  3O62 B;  5B31 D;  4NFT A;  3EPJ A;  3AZJ C;  3B6F D;  3W96 B;  2ZY3 A;  1EQZ A;  4R8P C;  1BH9 A;  4WU8 C;  2JCH A;  1P3K D;  3AV1 B;  3AZE C;  1H3O B;  1KX4 B;  3KUY C;  1AOI D;  3REJ D;  3AZJ B;  1WWI A;  4KHA A;  4H9S C;  4R8P B;  4WU8 B;  5JA4 B;  3C1C A;  5AV9 A;  2G5H C;  3AZE B;  1P3F C;  3UTB D;  3KUY B;  3WA9 C;  3AFA A;  4YS3 A;  2F8N D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...