1U35D

Crystal structure of the nucleosome core particle containing the histone domain of macroh2a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA
publication title Structural characterization of the histone variant macroH2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1u35D00
1P3MB 3REJA 1P3PB 3VH5W 3AZLA 3AN2C 4KGCD 2LY8A 4H9PA 5AV9C 3KWQD 3MGRA 3REKC 1EQZC 5FUGB 1F66B 5DNNB 3WAAB 5F99A 3AZMC 4DRAA 3AZIA 3AZFC 1M1AB 3O62C 1P3FD 5AY8A 1KX3C 5B0ZA 5CPKA 5GT3B 3AZEB 4H9OA 4HGAB 5B40C 3WTPC 4X23D 3B0CW 1M18D 5BT1D 5B1LD 5B24A 4UUZA 3KXBB 3B6GC 1P3LB 2YFWB 4Z5TA 3AFAA 3AZKC 3MNNB 4H9SA 5B0YC 3AZJD 4J8VA 4WV4B 1P3AB 5C3IC 5JA4A 4AWLC 3KWQB 3LJAD 4KHAB 4WU8D 3AYWD 3B6FC 3C1BC 3V9RB 2JSSA 1P3FB 3AZGA 5B32D 3W99C 1P3GB 4NE3A 3AN2A 3UTBD 3RELC 2HUEB 4XUJC 4X23B 1M18B 2NZDC 5G49A 3REKA 1EQZA 5CPIC 3W97C 5B1LB 2NQBA 1TZYC 3REJD 3AZMA 2HIOC 3AZNC 3AZLD 4G91C 4H9RB 1B67A 3AZFA 1HQ3D 3O62A 3B0BA 1KU5A 3MGRD 4YS3C 1KX3A 4H9QA 3AZJB 5F99D 3REHA 5B40A 4WZSB 2BYKA 3WTPA 4ZBJC 5E5AC 2IO5C 2YFVA 5AY8D 3LJAB 5B0ZD 5CPKD 4Z66C 4J8XD 3NQJA 4WU8B 5BNXA 3B6GA 5GXQA 3AYWB 3AZKA 4E44A 3X1SC 5B0YA 5B24D 5B32B 1P3BC 1M19C 1N1JB 5B2JC 2CV5D 5B2IC 3MGQD 3MVDC 3UTBB 1U35C 2RVQD 4Z5TD 3AFAD 1ZLAC 1P3ID 4YM6C 5B1MC 3LZ1C 3W98C 5B31C 4CSRB 3AZLB 3B6FA 1HQ3B 4H9PB 4WU9D 3MGRB 3X1VD 2FJ7C 1WWIA 3W99A 5F99B 3UTAD 3RELA 4XUJA 1H3OB 3W97A 5CPIA 5AY8B 3A6NC 3NQUA 5CPKB 2HIOA 4EO5B 3MGSC 3R45B 4J8UA 4J8XB 3AZNA 3AN2D 3AV1C 5GT0C 3WKJC 3VH5T 1R4VA 5CPJA 3REKD 3TU4C 3AV2B 4YS3A 1EQZD 5B24B 1A7WA 4NE6A 3B0DC 2NQBD 2CV5B 3REIC 5AVCA 1ID3C 3MGQB 3AZHD 4UUZB 4ZUXA 3AZFD 5BO0A 3O62D 5E5AA 4Z5TB 1P3MC 3AFAB 1P3IB 1KX3D 4Z66A 3REHD 1KX4D 5B40D 3LZ0C 4G92B 3WTPD 1P3KD 4H9NB 3X1SA 1KX5C 3WAAC 1P3BA 4WU9B 1M19A 5B2JA 3X1VB 5B2IA 3MVDA 3WA9A 3UTAB 1U35A 1P3OD 3B6GD 5GXQD 1ZLAA 1S32C 2F8NA 5GT3C 3X1UB 3KSYA 5B0YD 5B1MA 4YM6A 4XZQA 5GSUC 4HGAC 3LZ1A 3W98A 5B31A 2F8NK 3MGPC 2PYOA 3AN2B 1AOIC 5B33C 4J8WC 5G49B 1EQZB 3KXBC 2NQBB 2CWEA 1P3LC 3AZHB 3MNNC 5AV6D 3B6FD 3AZFB 5DNMD 5CP6C 3O62B 5AV5D 3A6NA 3W99D 1P3AC 1KX3B 4H9QB 4QLCD 3MGSA 4KGCB 1JFIB 3REHB 3AV1A 3X1TA 5GT0A 3RELD 5B40B 1KX4B 1P3KB 3KWQC 3WTPB 4XUJD 3WKJA 5CPID 3KUYD 2YFVB 3VH6W 4KUDC 3REIA 1ID3A 2HIOD 4J8UD 4JJNC 1P3FC 2AROC 3NQJB 5BNVB 1P3OB 3B6GB 5GXQB 1P3GC 5CPJD 4YS3D 5B0YB 5AVCD 4X23C 5AV9A 5AVBC 3LZ0A 4CAYA 5BS7C 4ZUXD 1M18C 5E5AD 5B1LC 4R8PC 5BT1C 5C3IB 1KX5A 3WAAA 5CHLB 4NE5A 4Z66D 5AV6B 3B6FB 5DNMB 1S32A 5AV5B 3X1SD 3AZJC 3C1CC 1P3BD 1M19D 5GSUA 5B2JD 3AZID 3W99B 5B2ID 3MGPA 4QLCB 3WA9D 1AOIA 5B33A 1U35D 3RELB 4XUJB 1ZLAD 4J8WA 3LJAC 2F8ND 5B1MD 4Z2MH 3KUYB 4XZQD 4WU8C 3LZ1D 3W98D 5B31D 3NQUB 3AYWC 2PYOD 4J8UB 4G91B 5CP6A 5CPJB 4YS3B 1P3AA 5AVCB 4ZUXB 3LELC 4KHAA 4ZBJB 5BO0B 5E5AB 5KDMB 3REJB 4J8VD 3A6ND 4KUDA 4LD9C 3C1BA 3UT9C 1HQ3C 4Z66B 4JJNA 1P3FA 2AROA 3X1TD 5GT0D 1P3GA 3X1SB 5B32G 1M19B 3AZIB 1ID3D 5B2IB 5AVBA 2NZDA 5BS7A 3AZGD 3WA9B 1U35B 5B1LA 4R8PA 4M6BA 1TZYA 3W96C 1ZLAB 5B0ZB 2F8NB 4EO5C 4J8XC 4XZQB 4H9OB 3LZ1B 1P34C 3W98B 5B31B 5AV9D 2PYOB 3LZ0D 3AV2C 1BH9A 1KX5D 3WAAD 2CV5C 5AV8C 3C1CA 3AZMD 3MGQC 5JRGC 1F1EA 3WTPE 2RVQC 1P3PC 1P3IC 4H9SC 3VH5A 1S32D 5GSUD 4J8VB 3A6NB 3MGPD 1F66C 1AOID 5DNNC 5B33D 3X1TB 5JA4B 1BH8A 4WU9C 3B0CT 3X1VC 1HTAA 4J8WD 1M1AC 2L5AA 3UTAC 2F8NH 1ID3B 3AZKD 3LELA 3X1UC 3AZGB 3AZEC 5CP6D 4CSRA 1P3AD 4LD9A 3UT9A 1HQ3A 1TAFA 5AV9B 3LZ0B 4CAYB 3REKB 2FJ7A 1KX5B 2NQBC 3AZMB 3AZHC 4KUDD 3C1BD 1H3OA 1Q9CA 4JJND 2AROD 3VH6T 4WNNA 3W96A 1P3GD 1S32B 4KGCC 3R45A 4J8XA 3REHC 1KX4C 5GSUB 1P34A 2BYKB 1P3KC 3MGPB 5AVBD 2NZDD 3TU4A 3AV2A 1AOIB 2BYMA 5B33B 3W97D 4R8PD 3VH6A 1TZYD 4J8WB 2CV5A 5AV8A 3MGQA 3AZND 5JRGA 5BNXB 1P3OC 5GXQC 1P3MA 3AZKB 1P3PA 1P3IA 5CP6B 2HUEC 3C1CD 4DRBA 5FUGA 4H9NA 1F66A 5DNNA 4AWLB 4WU9A 3X1VA 1M1AA 3UTAA 5AV6C 4KUDB 5DNMC 3C1BB 5AV5C 5GT3A 3X1UA 2AROB 4JJNB 3AZEA 4Z2MG 1BFMA 4QLCC 3MVDD 5AVBB 2NZDB 3LELD 4YM6D 5CPIB 3KXBA 3KUYC 3W97B 4R8PB 1TZYB 1P3LA 2YFWA 2HIOB 3MNNA 4J8UC 3AZNB 3AZHA 4LD9D 3UT9D 5B32C 1B6WA 5CPJC 2FJ7D 1BH9B 3UTBC 4KGCA 1JFIA 3C1CB 5AVCC 1KX4A 3KWQA 1P3KA 4ZUXC 2IO5B 3REJC 1WWSA 3W96D 3AZLC 3MGSD 3V9RA 3AV1D 4E45A 1P34D 5BNVA 1P3OA 3MGRC 3WKJD 3TU4D 3AV2D 5F99C 1P3BB 1BH8B 5B2JB 3AZIC 5AV8D 3REID 4X23A 1M18A 3MVDB 3WA9C 5JRGD 5AY8C 1ULYA 1P3MD 1P3PD 5B0ZC 5CPKC 3LELB 4YM6B 4H9RA 5B1MB 4XZQC 2PYOC 5AV6A 4LD9B 5DNMA 5B24C 3UT9B 1F66D 5AV5A 1TAFB 5DNND 3AZJA 1M1AD 2FJ7B 4QLCA 4Z5TC 3AFAC 3LJAA 5GT3D 3X1UD 3AZED 3KUYA 4WNNB 4WU8A 4J8VC 4G92C 3AYWA 3W96B 3MGSB 2F8NG 3AV1B 3X1TC 5GT0B 1P34B 5B32A 1N1JA 5B31G 3WKJB 3TU4B 2BYMB 3KXBD 3UTBA 3B0DB 1P3LD 5AV8B 3REIB 3MNND 3AZGC 5JRGB 5KDMA 4NFTA
chains in the Genus database with same CATH superfamily
1P3MB 3REJA 1P3PB 3VH5W 3AZLA 3AN2C 4KGCD 2LY8A 3EG5B 4H9PA 5AV9C 3KWQD 3MGRA 3REKC 1EQZC 5FUGB 1F66B 5DNNB 2Y2MA 5F99A 3WAAB 3AZMC 2BG1A 4DRAA 3AZIA 3AZFC 1M1AB 3O62C 2FFFB 1P3FD 2Y2GA 5AY8A 1KX3C 5B0ZA 5CPKA 5GT3B 3AZEB 4H9OA 4HGAB 5B40C 3WTPC 4X23D 3B0CW 1M18D 5BT1D 5B1LD 5B24A 2Y2QA 2Y2NA 4UUZA 3KXBB 3B6GC 1P3LB 2YFWB 4Z5TA 3AFAA 3AZKC 3MNNB 4H9SA 5B0YC 2DQNC 3P5JB 2XD5A 3AZJD 4J8VA 4WV4B 1P3AB 5C3IC 5JA4A 4AWLC 3KWQB 3LJAD 4KHAB 4WU8D 3AYWD 3B6FC 3C1BC 3V9RB 2JSSA 1P3FB 2ZY2A 3AZGA 5B32D 2G5HC 3W99C 1P3GB 4NE3A 3AN2A 2ZY3A 3UTBD 3RELC 2HUEB 4XUJC 4X23B 1M18B 2NZDC 5G49A 3REKA 1EQZA 5CPIC 3W97C 5B1LB 2NQBA 1TZYC 3REJD 3AZMA 2HIOC 3AZNC 3AZLD 4G91C 4H9RB 1B67A 3AZFA 1HQ3D 3O62A 3B0BA 1KU5A 3MGRD 4YS3C 1KX3A 4H9QA 3AZJB 5F99D 3REHA 5B40A 4WZSB 2BYKA 2F2AC 3WTPA 4ZBJC 5E5AC 2IO5C 2YFVA 5AY8D 3LJAB 5B0ZD 5CPKD 4Z66C 4J8XD 3NQJA 4WU8B 5BNXA 3B6GA 5GXQA 3AYWB 2JE5A 3AZKA 4E44A 3X1SC 5B0YA 5B24D 3H0RC 5B32B 1P3BC 1M19C 1N1JB 5B2JC 2CV5D 5B2IC 3MGQD 3MVDC 3UTBB 1U35C 2RVQD 4Z5TD 3AFAD 1ZLAC 1P3ID 4YM6C 5B1MC 3LZ1C 3W98C 3EPJA 5B31C 4CSRB 3AZLB 3B6FA 3IP4C 1HQ3B 1W2EA 4H9PB 4WU9D 3MGRB 3X1VD 2FJ7C 1WWIA 3W99A 3FDDA 5F99B 3UTAD 3RELA 4XUJA 1H3OB 3W97A 5CPIA 5AY8B 3A6NC 3NQUA 5CPKB 2Y2JA 2HIOA 4EO5B 3MGSC 3R45B 4J8UA 4J8XB 3AZNA 3AN2D 3AV1C 5GT0C 3WKJC 3VH5T 1R4VA 5CPJA 2VQRA 3REKD 3TU4C 3AV2B 4YS3A 1EQZD 1A7WA 4NE6A 5B24B 3B0DC 2NQBD 2CV5B 3REIC 5AVCA 1ID3C 3MGQB 3AZHD 4UUZB 4ZUXA 3AZFD 1PZRA 5BO0A 5E5AA 3O62D 4Z5TB 1P3MC 3AFAB 1P3IB 2Y2LA 1KX3D 4Z66A 3REHD 1KX4D 4DQYB 5B40D 3LZ0C 4G92B 3WTPD 1P3KD 4H9NB 3X1SA 1KX5C 3WAAC 1P3BA 4WU9B 1T3UA 1M19A 5B2JA 3X1VB 5B2IA 3MVDA 3WA9A 3UTAB 1U35A 1P3OD 3B6GD 5GXQD 1ZLAA 1S32C 2F8NA 5GT3C 3X1UB 3KSYA 5B0YD 5B1MA 4YM6A 4XZQA 5GSUC 4HGAC 3LZ1A 3W98A 5B31A 2F8NK 3MGPC 2PYOA 3AN2B 1AOIC 5B33C 4J8WC 5G49B 1EQZB 3KXBC 2NQBB 2CWEA 1P3LC 3AZHB 3MNNC 5AV6D 3B6FD 3AZFB 5DNMD 5CP6C 3O62B 5AV5D 3A6NA 3W99D 1P3AC 1KX3B 4H9QB 4QLCD 3MGSA 4KGCB 1JFIB 3REHB 3AV1A 3X1TA 5GT0A 3RELD 5B40B 1KX4B 1P3KB 3KWQC 3WTPB 4XUJD 3WKJA 2RIQA 5CPID 3KUYD 2YFVB 3VH6W 4KUDC 3REIA 1ID3A 2HIOD 4J8UD 4JJNC 1P3FC 2AROC 3NQJB 5BNVB 1P3OB 3B6GB 5GXQB 3H0MC 1P3GC 5CPJD 2J8PA 4WJ3C 4YS3D 5B0YB 5AVCD 4X23C 5AV9A 5AVBC 2Y2PA 4CAYA 5BS7C 4ZUXD 3LZ0A 1M18C 5C3IB 5B1LC 4R8PC 5E5AD 5BT1C 1KX5A 3WAAA 5CHLB 4NE5A 4Z66D 5AV6B 3B6FB 4UPKA 5DNMB 1S32A 3AL0C 5AV5B 3X1SD 3AZJC 3C1CC 1P3BD 2UWXA 5GSUA 5B2JD 1M19D 3AZID 3W99B 5B2ID 3MGPA 4QLCB 3WA9D 1AOIA 5B33A 1U35D 3RELB 4XUJB 1ZLAD 4J8WA 3LJAC 3EPHA 2F8ND 5B1MD 4Z2MH 3KUYB 4XZQD 4WU8C 3LZ1D 3W98D 5B31D 3NQUB 3AYWC 2PYOD 4J8UB 2Y2OA 4G91B 5CP6A 5CPJB 4YS3B 1P3AA 5AVCB 4ZUXB 3LELC 4KHAA 4ZBJB 5BO0B 5E5AB 5KDMB 3REJB 4J8VD 3A6ND 4KUDA 4LD9C 3C1BA 3UT9C 1HQ3C 4Z66B 4JJNA 1P3FA 2AROA 3X1TD 5GT0D 1P3GA 3X1SB 5B32G 1M19B 3AZIB 1ID3D 5B2IB 5AVBA 2NZDA 5BS7A 3AZGD 3WA9B 1U35B 5B1LA 4R8PA 4M6BA 1TZYA 3W96C 3EPKA 5B0ZB 1ZLAB 2ZY5A 2F8NB 4EO5C 4J8XC 4XZQB 4H9OB 3LZ1B 1P34C 3W98B 5B31B 5AV9D 2PYOB 3LZ0D 3AV2C 1BH9A 1KX5D 3WAAD 2CV5C 5AV8C 3C1CA 3AZMD 3MGQC 5JRGC 1F1EA 3WTPE 2RVQC 2Y2IA 1P3PC 1P3IC 4H9SC 3VH5A 1S32D 5GSUD 4J8VB 3A6NB 3MGPD 1F66C 1AOID 5DNNC 5B33D 3X1TB 5JA4B 1BH8A 4WU9C 3B0CT 1HTAA 3X1VC 4J8WD 1M1AC 2L5AA 3UTAC 2F8NH 1ID3B 3AZKD 3LELA 3X1UC 3AZGB 3AZEC 2G5IC 5CP6D 4CSRA 1P3AD 4LD9A 3UT9A 1HQ3A 1TAFA 5AV9B 3LZ0B 4CAYB 3REKB 2FJ7A 1KX5B 2NQBC 3AZMB 3AZHC 4KUDD 3C1BD 1H3OA 1Q9CA 4JJND 2ZY4A 2AROD 3VH6T 4WNNA 3W96A 1P3GD 1S32B 3A1IA 4KGCC 3R45A 4J8XA 3REHC 1KX4C 5GSUB 1P34A 2BYKB 1P3KC 3MGPB 5AVBD 2NZDD 3TU4A 3AV2A 1AOIB 2BYMA 5B33B 3W97D 4R8PD 3VH6A 1TZYD 3EPLA 4J8WB 5AV8A 2CV5A 3MGQA 3AZND 3KFUG 5JRGA 5BNXB 1P3OC 2JCHA 5GXQC 1P3MA 3AZKB 1P3PA 1P3IA 5CP6B 2HUEC 3C1CD 2ZM5A 4DRBA 5FUGA 4H9NA 3H0LC 1F66A 5DNNA 4AWLB 4WU9A 3X1VA 1M1AA 2XD1A 3UTAA 2Y2KA 3A1KA 5AV6C 4KUDB 5DNMC 3C1BB 5AV5C 5GT3A 3X1UA 2AROB 2W8SA 4JJNB 3AZEA 4Z2MG 1Z2CB 1BFMA 4QLCC 3MVDD 5AVBB 2NZDB 3LELD 4YM6D 5CPIB 3KXBA 3KUYC 3W97B 4R8PB 1TZYB 1P3LA 2YFWA 2HIOB 3MNNA 4J8UC 3AZNB 3AZHA 4LD9D 3UT9D 5B32C 1B6WA 5CPJC 2FJ7D 1BH9B 3UTBC 4KGCA 1JFIA 3C1CB 5AVCC 1KX4A 3KWQA 1P3KA 4ZUXC 2IO5B 3REJC 1WWSA 3W96D 3AZLC 3MGSD 3V9RA 3AV1D 4E45A 1P34D 5BNVA 1P3OA 3MGRC 3WKJD 3TU4D 3AV2D 5F99C 1P3BB 1BH8B 5B2JB 3AZIC 5AV8D 3REID 4X23A 1M18A 3MVDB 3WA9C 5JRGD 5AY8C 1ULYA 1P3MD 1P3PD 5B0ZC 5CPKC 3LELB 4YM6B 4H9RA 5B1MB 4XZQC 2PYOC 5AV6A 4LD9B 5DNMA 5B24C 3UT9B 1F66D 5AV5A 1TAFB 5DNND 3AZJA 2Y2HA 1M1AD 2FJ7B 4QLCA 4Z5TC 3AFAC 3LJAA 5GT3D 3X1UD 3AZED 3KUYA 4WNNB 4WU8A 4J8VC 3F6TA 4G92C 3AYWA 3W96B 3MGSB 2F8NG 3AV1B 3X1TC 5GT0B 1P34B 5B32A 1N1JA 5B31G 3WKJB 3TU4B 2BYMB 3KXBD 3UTBA 3B0DB 1P3LD 5AV8B 2DF4C 3REIB 3MNND 3AZGC 5JRGB 5KDMA 4NFTA
chains in the Genus database with same CATH topology
1P3MB 3REJA 1P3PB 3VH5W 3AZLA 3AN2C 4KGCD 2LY8A 3EG5B 4H9PA 5AV9C 3KWQD 3MGRA 3REKC 1EQZC 5FUGB 1F66B 5DNNB 2Y2MA 5F99A 3WAAB 3AZMC 2BG1A 4DRAA 3AZIA 3AZFC 1M1AB 3O62C 2FFFB 1P3FD 2Y2GA 5AY8A 1KX3C 5B0ZA 5CPKA 5GT3B 3AZEB 4H9OA 4HGAB 5B40C 3WTPC 4X23D 3B0CW 1M18D 5BT1D 5B1LD 5B24A 2Y2QA 2Y2NA 4UUZA 3KXBB 3B6GC 1P3LB 2YFWB 4Z5TA 3AFAA 3AZKC 3MNNB 4H9SA 5B0YC 2DQNC 3P5JB 2XD5A 3AZJD 4J8VA 4WV4B 1P3AB 5C3IC 5JA4A 4AWLC 3KWQB 3LJAD 4KHAB 4WU8D 3AYWD 3B6FC 3C1BC 3V9RB 2JSSA 1P3FB 2ZY2A 3AZGA 5B32D 2G5HC 3W99C 1P3GB 4NE3A 3AN2A 2ZY3A 3UTBD 3RELC 2HUEB 4XUJC 4X23B 1M18B 2NZDC 5G49A 3REKA 1EQZA 5CPIC 3W97C 5B1LB 2NQBA 1TZYC 3REJD 3AZMA 2HIOC 3AZNC 3AZLD 4G91C 4H9RB 1B67A 3AZFA 1HQ3D 3O62A 3B0BA 1KU5A 3MGRD 4YS3C 1KX3A 4H9QA 3AZJB 5F99D 3REHA 5B40A 4WZSB 2BYKA 2F2AC 3WTPA 4ZBJC 5E5AC 2IO5C 2YFVA 5AY8D 3LJAB 5B0ZD 5CPKD 4Z66C 4J8XD 3NQJA 4WU8B 5BNXA 3B6GA 5GXQA 3AYWB 2JE5A 3AZKA 4E44A 3X1SC 5B0YA 5B24D 3H0RC 5B32B 1P3BC 1M19C 1N1JB 5B2JC 2CV5D 5B2IC 3MGQD 3MVDC 3UTBB 1U35C 2RVQD 4Z5TD 3AFAD 1ZLAC 1P3ID 4YM6C 5B1MC 3LZ1C 3W98C 3EPJA 5B31C 4CSRB 3AZLB 3B6FA 3IP4C 1HQ3B 1W2EA 4H9PB 4WU9D 3MGRB 3X1VD 2FJ7C 1WWIA 3W99A 3FDDA 5F99B 3UTAD 3RELA 4XUJA 1H3OB 3W97A 5CPIA 5AY8B 3A6NC 3NQUA 5CPKB 2Y2JA 2HIOA 4EO5B 3MGSC 3R45B 4J8UA 4J8XB 3AZNA 3AN2D 3AV1C 5GT0C 3WKJC 3VH5T 1R4VA 5CPJA 2VQRA 3REKD 3TU4C 3AV2B 4YS3A 1EQZD 1A7WA 4NE6A 5B24B 3B0DC 2NQBD 2CV5B 3REIC 5AVCA 1ID3C 3MGQB 3AZHD 4UUZB 4ZUXA 3AZFD 1PZRA 5BO0A 5E5AA 3O62D 4Z5TB 1P3MC 3AFAB 1P3IB 2Y2LA 1KX3D 4Z66A 3REHD 1KX4D 4DQYB 5B40D 3LZ0C 4G92B 3WTPD 1P3KD 4H9NB 3X1SA 1KX5C 3WAAC 1P3BA 4WU9B 1T3UA 1M19A 5B2JA 3X1VB 5B2IA 3MVDA 3WA9A 3UTAB 1U35A 1P3OD 3B6GD 5GXQD 1ZLAA 1S32C 2F8NA 5GT3C 3X1UB 3KSYA 5B0YD 5B1MA 4YM6A 4XZQA 5GSUC 4HGAC 3LZ1A 3W98A 5B31A 2F8NK 3MGPC 2PYOA 3AN2B 1AOIC 5B33C 4J8WC 5G49B 1EQZB 3KXBC 2NQBB 2CWEA 1P3LC 3AZHB 3MNNC 5AV6D 3B6FD 3AZFB 5DNMD 5CP6C 3O62B 5AV5D 3A6NA 3W99D 1P3AC 1KX3B 4H9QB 4QLCD 3MGSA 4KGCB 1JFIB 3REHB 3AV1A 3X1TA 5GT0A 3RELD 5B40B 1KX4B 1P3KB 3KWQC 3WTPB 4XUJD 3WKJA 2RIQA 5CPID 3KUYD 2YFVB 3VH6W 4KUDC 3REIA 1ID3A 2HIOD 4J8UD 4JJNC 1P3FC 2AROC 3NQJB 5BNVB 1P3OB 3B6GB 5GXQB 3H0MC 1P3GC 5CPJD 2J8PA 4WJ3C 4YS3D 5B0YB 5AVCD 4X23C 5AV9A 5AVBC 2Y2PA 4CAYA 5BS7C 4ZUXD 3LZ0A 1M18C 5C3IB 5B1LC 4R8PC 5E5AD 5BT1C 1KX5A 3WAAA 5CHLB 4NE5A 4Z66D 5AV6B 3B6FB 4UPKA 5DNMB 1S32A 3AL0C 5AV5B 3X1SD 3AZJC 3C1CC 1P3BD 2UWXA 5GSUA 5B2JD 1M19D 3AZID 3W99B 5B2ID 3MGPA 4QLCB 3WA9D 1AOIA 5B33A 1U35D 3RELB 4XUJB 1ZLAD 4J8WA 3LJAC 3EPHA 2F8ND 5B1MD 4Z2MH 3KUYB 4XZQD 4WU8C 3LZ1D 3W98D 5B31D 3NQUB 3AYWC 2PYOD 4J8UB 2Y2OA 4G91B 5CP6A 5CPJB 4YS3B 1P3AA 5AVCB 4ZUXB 3LELC 4KHAA 4ZBJB 5BO0B 5E5AB 5KDMB 3REJB 4J8VD 3A6ND 4KUDA 4LD9C 3C1BA 3UT9C 1HQ3C 4Z66B 4JJNA 1P3FA 2AROA 3X1TD 5GT0D 1P3GA 3X1SB 5B32G 1M19B 3AZIB 1ID3D 5B2IB 5AVBA 2NZDA 5BS7A 3AZGD 3WA9B 1U35B 5B1LA 4R8PA 4M6BA 1TZYA 3W96C 3EPKA 5B0ZB 1ZLAB 2ZY5A 2F8NB 4EO5C 4J8XC 4XZQB 4H9OB 3LZ1B 1P34C 3W98B 5B31B 5AV9D 2PYOB 3LZ0D 3AV2C 1BH9A 1KX5D 3WAAD 2CV5C 5AV8C 3C1CA 3AZMD 3MGQC 5JRGC 1F1EA 3WTPE 2RVQC 2Y2IA 1P3PC 1P3IC 4H9SC 3VH5A 1S32D 5GSUD 4J8VB 3A6NB 3MGPD 1F66C 1AOID 5DNNC 5B33D 3X1TB 5JA4B 1BH8A 4WU9C 3B0CT 1HTAA 3X1VC 4J8WD 1M1AC 2L5AA 3UTAC 2F8NH 1ID3B 3AZKD 3LELA 3X1UC 3AZGB 3AZEC 2G5IC 5CP6D 4CSRA 1P3AD 4LD9A 3UT9A 1HQ3A 1TAFA 5AV9B 3LZ0B 4CAYB 3REKB 2FJ7A 1KX5B 2NQBC 3AZMB 3AZHC 4KUDD 3C1BD 1H3OA 1Q9CA 4JJND 2ZY4A 2AROD 3VH6T 4WNNA 3W96A 1P3GD 1S32B 3A1IA 4KGCC 3R45A 4J8XA 3REHC 1KX4C 5GSUB 1P34A 2BYKB 1P3KC 3MGPB 5AVBD 2NZDD 3TU4A 3AV2A 1AOIB 2BYMA 5B33B 3W97D 4R8PD 3VH6A 1TZYD 3EPLA 4J8WB 5AV8A 2CV5A 3MGQA 3AZND 3KFUG 5JRGA 5BNXB 1P3OC 2JCHA 5GXQC 1P3MA 3AZKB 1P3PA 1P3IA 5CP6B 2HUEC 3C1CD 2ZM5A 4DRBA 5FUGA 4H9NA 3H0LC 1F66A 5DNNA 4AWLB 4WU9A 3X1VA 1M1AA 2XD1A 3UTAA 2Y2KA 3A1KA 5AV6C 4KUDB 5DNMC 3C1BB 5AV5C 5GT3A 3X1UA 2AROB 2W8SA 4JJNB 3AZEA 4Z2MG 1Z2CB 1BFMA 4QLCC 3MVDD 5AVBB 2NZDB 3LELD 4YM6D 5CPIB 3KXBA 3KUYC 3W97B 4R8PB 1TZYB 1P3LA 2YFWA 2HIOB 3MNNA 4J8UC 3AZNB 3AZHA 4LD9D 3UT9D 5B32C 1B6WA 5CPJC 2FJ7D 1BH9B 3UTBC 4KGCA 1JFIA 3C1CB 5AVCC 1KX4A 3KWQA 1P3KA 4ZUXC 2IO5B 3REJC 1WWSA 3W96D 3AZLC 3MGSD 3V9RA 3AV1D 4E45A 1P34D 5BNVA 1P3OA 3MGRC 3WKJD 3TU4D 3AV2D 5F99C 1P3BB 1BH8B 5B2JB 3AZIC 5AV8D 3REID 4X23A 1M18A 3MVDB 3WA9C 5JRGD 5AY8C 1ULYA 1P3MD 1P3PD 5B0ZC 5CPKC 3LELB 4YM6B 4H9RA 5B1MB 4XZQC 2PYOC 5AV6A 4LD9B 5DNMA 5B24C 3UT9B 1F66D 5AV5A 1TAFB 5DNND 3AZJA 2Y2HA 1M1AD 2FJ7B 4QLCA 4Z5TC 3AFAC 3LJAA 5GT3D 3X1UD 3AZED 3KUYA 4WNNB 4WU8A 4J8VC 3F6TA 4G92C 3AYWA 3W96B 3MGSB 2F8NG 3AV1B 3X1TC 5GT0B 1P34B 5B32A 1N1JA 5B31G 3WKJB 3TU4B 2BYMB 3KXBD 3UTBA 3B0DB 1P3LD 5AV8B 2DF4C 3REIB 3MNND 3AZGC 5JRGB 5KDMA 4NFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3M B;  3REJ A;  1P3P B;  3VH5 W;  3AZL A;  3AN2 C;  4KGC D;  2LY8 A;  4H9P A;  5AV9 C;  3KWQ D;  3MGR A;  3REK C;  1EQZ C;  5FUG B;  1F66 B;  5DNN B;  3WAA B;  5F99 A;  3AZM C;  4DRA A;  3AZI A;  3AZF C;  1M1A B;  3O62 C;  1P3F D;  5AY8 A;  1KX3 C;  5B0Z A;  5CPK A;  5GT3 B;  3AZE B;  4H9O A;  4HGA B;  5B40 C;  3WTP C;  4X23 D;  3B0C W;  1M18 D;  5BT1 D;  5B1L D;  5B24 A;  4UUZ A;  3KXB B;  3B6G C;  1P3L B;  2YFW B;  4Z5T A;  3AFA A;  3AZK C;  3MNN B;  4H9S A;  5B0Y C;  3AZJ D;  4J8V A;  4WV4 B;  1P3A B;  5C3I C;  5JA4 A;  4AWL C;  3KWQ B;  3LJA D;  4KHA B;  4WU8 D;  3AYW D;  3B6F C;  3C1B C;  3V9R B;  2JSS A;  1P3F B;  3AZG A;  5B32 D;  3W99 C;  1P3G B;  4NE3 A;  3AN2 A;  3UTB D;  3REL C;  2HUE B;  4XUJ C;  4X23 B;  1M18 B;  2NZD C;  5G49 A;  3REK A;  1EQZ A;  5CPI C;  3W97 C;  5B1L B;  2NQB A;  1TZY C;  3REJ D;  3AZM A;  2HIO C;  3AZN C;  3AZL D;  4G91 C;  4H9R B;  1B67 A;  3AZF A;  1HQ3 D;  3O62 A;  3B0B A;  1KU5 A;  3MGR D;  4YS3 C;  1KX3 A;  4H9Q A;  3AZJ B;  5F99 D;  3REH A;  5B40 A;  4WZS B;  2BYK A;  3WTP A;  4ZBJ C;  5E5A C;  2IO5 C;  2YFV A;  5AY8 D;  3LJA B;  5B0Z D;  5CPK D;  4Z66 C;  4J8X D;  3NQJ A;  4WU8 B;  5BNX A;  3B6G A;  5GXQ A;  3AYW B;  3AZK A;  4E44 A;  3X1S C;  5B0Y A;  5B24 D;  5B32 B;  1P3B C;  1M19 C;  1N1J B;  5B2J C;  2CV5 D;  5B2I C;  3MGQ D;  3MVD C;  3UTB B;  1U35 C;  2RVQ D;  4Z5T D;  3AFA D;  1ZLA C;  1P3I D;  4YM6 C;  5B1M C;  3LZ1 C;  3W98 C;  5B31 C;  4CSR B;  3AZL B;  3B6F A;  1HQ3 B;  4H9P B;  4WU9 D;  3MGR B;  3X1V D;  2FJ7 C;  1WWI A;  3W99 A;  5F99 B;  3UTA D;  3REL A;  4XUJ A;  1H3O B;  3W97 A;  5CPI A;  5AY8 B;  3A6N C;  3NQU A;  5CPK B;  2HIO A;  4EO5 B;  3MGS C;  3R45 B;  4J8U A;  4J8X B;  3AZN A;  3AN2 D;  3AV1 C;  5GT0 C;  3WKJ C;  3VH5 T;  1R4V A;  5CPJ A;  3REK D;  3TU4 C;  3AV2 B;  4YS3 A;  1EQZ D;  5B24 B;  1A7W A;  4NE6 A;  3B0D C;  2NQB D;  2CV5 B;  3REI C;  5AVC A;  1ID3 C;  3MGQ B;  3AZH D;  4UUZ B;  4ZUX A;  3AZF D;  5BO0 A;  3O62 D;  5E5A A;  4Z5T B;  1P3M C;  3AFA B;  1P3I B;  1KX3 D;  4Z66 A;  3REH D;  1KX4 D;  5B40 D;  3LZ0 C;  4G92 B;  3WTP D;  1P3K D;  4H9N B;  3X1S A;  1KX5 C;  3WAA C;  1P3B A;  4WU9 B;  1M19 A;  5B2J A;  3X1V B;  5B2I A;  3MVD A;  3WA9 A;  3UTA B;  1U35 A;  1P3O D;  3B6G D;  5GXQ D;  1ZLA A;  1S32 C;  2F8N A;  5GT3 C;  3X1U B;  3KSY A;  5B0Y D;  5B1M A;  4YM6 A;  4XZQ A;  5GSU C;  4HGA C;  3LZ1 A;  3W98 A;  5B31 A;  2F8N K;  3MGP C;  2PYO A;  3AN2 B;  1AOI C;  5B33 C;  4J8W C;  5G49 B;  1EQZ B;  3KXB C;  2NQB B;  2CWE A;  1P3L C;  3AZH B;  3MNN C;  5AV6 D;  3B6F D;  3AZF B;  5DNM D;  5CP6 C;  3O62 B;  5AV5 D;  3A6N A;  3W99 D;  1P3A C;  1KX3 B;  4H9Q B;  4QLC D;  3MGS A;  4KGC B;  1JFI B;  3REH B;  3AV1 A;  3X1T A;  5GT0 A;  3REL D;  5B40 B;  1KX4 B;  1P3K B;  3KWQ C;  3WTP B;  4XUJ D;  3WKJ A;  5CPI D;  3KUY D;  2YFV B;  3VH6 W;  4KUD C;  3REI A;  1ID3 A;  2HIO D;  4J8U D;  4JJN C;  1P3F C;  2ARO C;  3NQJ B;  5BNV B;  1P3O B;  3B6G B;  5GXQ B;  1P3G C;  5CPJ D;  4YS3 D;  5B0Y B;  5AVC D;  4X23 C;  5AV9 A;  5AVB C;  3LZ0 A;  4CAY A;  5BS7 C;  4ZUX D;  1M18 C;  5E5A D;  5B1L C;  4R8P C;  5BT1 C;  5C3I B;  1KX5 A;  3WAA A;  5CHL B;  4NE5 A;  4Z66 D;  5AV6 B;  3B6F B;  5DNM B;  1S32 A;  5AV5 B;  3X1S D;  3AZJ C;  3C1C C;  1P3B D;  1M19 D;  5GSU A;  5B2J D;  3AZI D;  3W99 B;  5B2I D;  3MGP A;  4QLC B;  3WA9 D;  1AOI A;  5B33 A;  1U35 D;  3REL B;  4XUJ B;  1ZLA D;  4J8W A;  3LJA C;  2F8N D;  5B1M D;  4Z2M H;  3KUY B;  4XZQ D;  4WU8 C;  3LZ1 D;  3W98 D;  5B31 D;  3NQU B;  3AYW C;  2PYO D;  4J8U B;  4G91 B;  5CP6 A;  5CPJ B;  4YS3 B;  1P3A A;  5AVC B;  4ZUX B;  3LEL C;  4KHA A;  4ZBJ B;  5BO0 B;  5E5A B;  5KDM B;  3REJ B;  4J8V D;  3A6N D;  4KUD A;  4LD9 C;  3C1B A;  3UT9 C;  1HQ3 C;  4Z66 B;  4JJN A;  1P3F A;  2ARO A;  3X1T D;  5GT0 D;  1P3G A;  3X1S B;  5B32 G;  1M19 B;  3AZI B;  1ID3 D;  5B2I B;  5AVB A;  2NZD A;  5BS7 A;  3AZG D;  3WA9 B;  1U35 B;  5B1L A;  4R8P A;  4M6B A;  1TZY A;  3W96 C;  1ZLA B;  5B0Z B;  2F8N B;  4EO5 C;  4J8X C;  4XZQ B;  4H9O B;  3LZ1 B;  1P34 C;  3W98 B;  5B31 B;  5AV9 D;  2PYO B;  3LZ0 D;  3AV2 C;  1BH9 A;  1KX5 D;  3WAA D;  2CV5 C;  5AV8 C;  3C1C A;  3AZM D;  3MGQ C;  5JRG C;  1F1E A;  3WTP E;  2RVQ C;  1P3P C;  1P3I C;  4H9S C;  3VH5 A;  1S32 D;  5GSU D;  4J8V B;  3A6N B;  3MGP D;  1F66 C;  1AOI D;  5DNN C;  5B33 D;  3X1T B;  5JA4 B;  1BH8 A;  4WU9 C;  3B0C T;  3X1V C;  1HTA A;  4J8W D;  1M1A C;  2L5A A;  3UTA C;  2F8N H;  1ID3 B;  3AZK D;  3LEL A;  3X1U C;  3AZG B;  3AZE C;  5CP6 D;  4CSR A;  1P3A D;  4LD9 A;  3UT9 A;  1HQ3 A;  1TAF A;  5AV9 B;  3LZ0 B;  4CAY B;  3REK B;  2FJ7 A;  1KX5 B;  2NQB C;  3AZM B;  3AZH C;  4KUD D;  3C1B D;  1H3O A;  1Q9C A;  4JJN D;  2ARO D;  3VH6 T;  4WNN A;  3W96 A;  1P3G D;  1S32 B;  4KGC C;  3R45 A;  4J8X A;  3REH C;  1KX4 C;  5GSU B;  1P34 A;  2BYK B;  1P3K C;  3MGP B;  5AVB D;  2NZD D;  3TU4 A;  3AV2 A;  1AOI B;  2BYM A;  5B33 B;  3W97 D;  4R8P D;  3VH6 A;  1TZY D;  4J8W B;  2CV5 A;  5AV8 A;  3MGQ A;  3AZN D;  5JRG A;  5BNX B;  1P3O C;  5GXQ C;  1P3M A;  3AZK B;  1P3P A;  1P3I A;  5CP6 B;  2HUE C;  3C1C D;  4DRB A;  5FUG A;  4H9N A;  1F66 A;  5DNN A;  4AWL B;  4WU9 A;  3X1V A;  1M1A A;  3UTA A;  5AV6 C;  4KUD B;  5DNM C;  3C1B B;  5AV5 C;  5GT3 A;  3X1U A;  2ARO B;  4JJN B;  3AZE A;  4Z2M G;  1BFM A;  4QLC C;  3MVD D;  5AVB B;  2NZD B;  3LEL D;  4YM6 D;  5CPI B;  3KXB A;  3KUY C;  3W97 B;  4R8P B;  1TZY B;  1P3L A;  2YFW A;  2HIO B;  3MNN A;  4J8U C;  3AZN B;  3AZH A;  4LD9 D;  3UT9 D;  5B32 C;  1B6W A;  5CPJ C;  2FJ7 D;  1BH9 B;  3UTB C;  4KGC A;  1JFI A;  3C1C B;  5AVC C;  1KX4 A;  3KWQ A;  1P3K A;  4ZUX C;  2IO5 B;  3REJ C;  1WWS A;  3W96 D;  3AZL C;  3MGS D;  3V9R A;  3AV1 D;  4E45 A;  1P34 D;  5BNV A;  1P3O A;  3MGR C;  3WKJ D;  3TU4 D;  3AV2 D;  5F99 C;  1P3B B;  1BH8 B;  5B2J B;  3AZI C;  5AV8 D;  3REI D;  4X23 A;  1M18 A;  3MVD B;  3WA9 C;  5JRG D;  5AY8 C;  1ULY A;  1P3M D;  1P3P D;  5B0Z C;  5CPK C;  3LEL B;  4YM6 B;  4H9R A;  5B1M B;  4XZQ C;  2PYO C;  5AV6 A;  4LD9 B;  5DNM A;  5B24 C;  3UT9 B;  1F66 D;  5AV5 A;  1TAF B;  5DNN D;  3AZJ A;  1M1A D;  2FJ7 B;  4QLC A;  4Z5T C;  3AFA C;  3LJA A;  5GT3 D;  3X1U D;  3AZE D;  3KUY A;  4WNN B;  4WU8 A;  4J8V C;  4G92 C;  3AYW A;  3W96 B;  3MGS B;  2F8N G;  3AV1 B;  3X1T C;  5GT0 B;  1P34 B;  5B32 A;  1N1J A;  5B31 G;  3WKJ B;  3TU4 B;  2BYM B;  3KXB D;  3UTB A;  3B0D B;  1P3L D;  5AV8 B;  3REI B;  3MNN D;  3AZG C;  5JRG B;  5KDM A;  4NFT A; 
#chains in the Genus database with same CATH topology
 1P3M B;  3REJ A;  1P3P B;  3VH5 W;  3AZL A;  3AN2 C;  4KGC D;  2LY8 A;  3EG5 B;  4H9P A;  5AV9 C;  3KWQ D;  3MGR A;  3REK C;  1EQZ C;  5FUG B;  1F66 B;  5DNN B;  2Y2M A;  5F99 A;  3WAA B;  3AZM C;  2BG1 A;  4DRA A;  3AZI A;  3AZF C;  1M1A B;  3O62 C;  2FFF B;  1P3F D;  2Y2G A;  5AY8 A;  1KX3 C;  5B0Z A;  5CPK A;  5GT3 B;  3AZE B;  4H9O A;  4HGA B;  5B40 C;  3WTP C;  4X23 D;  3B0C W;  1M18 D;  5BT1 D;  5B1L D;  5B24 A;  2Y2Q A;  2Y2N A;  4UUZ A;  3KXB B;  3B6G C;  1P3L B;  2YFW B;  4Z5T A;  3AFA A;  3AZK C;  3MNN B;  4H9S A;  5B0Y C;  2DQN C;  3P5J B;  2XD5 A;  3AZJ D;  4J8V A;  4WV4 B;  1P3A B;  5C3I C;  5JA4 A;  4AWL C;  3KWQ B;  3LJA D;  4KHA B;  4WU8 D;  3AYW D;  3B6F C;  3C1B C;  3V9R B;  2JSS A;  1P3F B;  2ZY2 A;  3AZG A;  5B32 D;  2G5H C;  3W99 C;  1P3G B;  4NE3 A;  3AN2 A;  2ZY3 A;  3UTB D;  3REL C;  2HUE B;  4XUJ C;  4X23 B;  1M18 B;  2NZD C;  5G49 A;  3REK A;  1EQZ A;  5CPI C;  3W97 C;  5B1L B;  2NQB A;  1TZY C;  3REJ D;  3AZM A;  2HIO C;  3AZN C;  3AZL D;  4G91 C;  4H9R B;  1B67 A;  3AZF A;  1HQ3 D;  3O62 A;  3B0B A;  1KU5 A;  3MGR D;  4YS3 C;  1KX3 A;  4H9Q A;  3AZJ B;  5F99 D;  3REH A;  5B40 A;  4WZS B;  2BYK A;  2F2A C;  3WTP A;  4ZBJ C;  5E5A C;  2IO5 C;  2YFV A;  5AY8 D;  3LJA B;  5B0Z D;  5CPK D;  4Z66 C;  4J8X D;  3NQJ A;  4WU8 B;  5BNX A;  3B6G A;  5GXQ A;  3AYW B;  2JE5 A;  3AZK A;  4E44 A;  3X1S C;  5B0Y A;  5B24 D;  3H0R C;  5B32 B;  1P3B C;  1M19 C;  1N1J B;  5B2J C;  2CV5 D;  5B2I C;  3MGQ D;  3MVD C;  3UTB B;  1U35 C;  2RVQ D;  4Z5T D;  3AFA D;  1ZLA C;  1P3I D;  4YM6 C;  5B1M C;  3LZ1 C;  3W98 C;  3EPJ A;  5B31 C;  4CSR B;  3AZL B;  3B6F A;  3IP4 C;  1HQ3 B;  1W2E A;  4H9P B;  4WU9 D;  3MGR B;  3X1V D;  2FJ7 C;  1WWI A;  3W99 A;  3FDD A;  5F99 B;  3UTA D;  3REL A;  4XUJ A;  1H3O B;  3W97 A;  5CPI A;  5AY8 B;  3A6N C;  3NQU A;  5CPK B;  2Y2J A;  2HIO A;  4EO5 B;  3MGS C;  3R45 B;  4J8U A;  4J8X B;  3AZN A;  3AN2 D;  3AV1 C;  5GT0 C;  3WKJ C;  3VH5 T;  1R4V A;  5CPJ A;  2VQR A;  3REK D;  3TU4 C;  3AV2 B;  4YS3 A;  1EQZ D;  1A7W A;  4NE6 A;  5B24 B;  3B0D C;  2NQB D;  2CV5 B;  3REI C;  5AVC A;  1ID3 C;  3MGQ B;  3AZH D;  4UUZ B;  4ZUX A;  3AZF D;  1PZR A;  5BO0 A;  5E5A A;  3O62 D;  4Z5T B;  1P3M C;  3AFA B;  1P3I B;  2Y2L A;  1KX3 D;  4Z66 A;  3REH D;  1KX4 D;  4DQY B;  5B40 D;  3LZ0 C;  4G92 B;  3WTP D;  1P3K D;  4H9N B;  3X1S A;  1KX5 C;  3WAA C;  1P3B A;  4WU9 B;  1T3U A;  1M19 A;  5B2J A;  3X1V B;  5B2I A;  3MVD A;  3WA9 A;  3UTA B;  1U35 A;  1P3O D;  3B6G D;  5GXQ D;  1ZLA A;  1S32 C;  2F8N A;  5GT3 C;  3X1U B;  3KSY A;  5B0Y D;  5B1M A;  4YM6 A;  4XZQ A;  5GSU C;  4HGA C;  3LZ1 A;  3W98 A;  5B31 A;  2F8N K;  3MGP C;  2PYO A;  3AN2 B;  1AOI C;  5B33 C;  4J8W C;  5G49 B;  1EQZ B;  3KXB C;  2NQB B;  2CWE A;  1P3L C;  3AZH B;  3MNN C;  5AV6 D;  3B6F D;  3AZF B;  5DNM D;  5CP6 C;  3O62 B;  5AV5 D;  3A6N A;  3W99 D;  1P3A C;  1KX3 B;  4H9Q B;  4QLC D;  3MGS A;  4KGC B;  1JFI B;  3REH B;  3AV1 A;  3X1T A;  5GT0 A;  3REL D;  5B40 B;  1KX4 B;  1P3K B;  3KWQ C;  3WTP B;  4XUJ D;  3WKJ A;  2RIQ A;  5CPI D;  3KUY D;  2YFV B;  3VH6 W;  4KUD C;  3REI A;  1ID3 A;  2HIO D;  4J8U D;  4JJN C;  1P3F C;  2ARO C;  3NQJ B;  5BNV B;  1P3O B;  3B6G B;  5GXQ B;  3H0M C;  1P3G C;  5CPJ D;  2J8P A;  4WJ3 C;  4YS3 D;  5B0Y B;  5AVC D;  4X23 C;  5AV9 A;  5AVB C;  2Y2P A;  4CAY A;  5BS7 C;  4ZUX D;  3LZ0 A;  1M18 C;  5C3I B;  5B1L C;  4R8P C;  5E5A D;  5BT1 C;  1KX5 A;  3WAA A;  5CHL B;  4NE5 A;  4Z66 D;  5AV6 B;  3B6F B;  4UPK A;  5DNM B;  1S32 A;  3AL0 C;  5AV5 B;  3X1S D;  3AZJ C;  3C1C C;  1P3B D;  2UWX A;  5GSU A;  5B2J D;  1M19 D;  3AZI D;  3W99 B;  5B2I D;  3MGP A;  4QLC B;  3WA9 D;  1AOI A;  5B33 A;  1U35 D;  3REL B;  4XUJ B;  1ZLA D;  4J8W A;  3LJA C;  3EPH A;  2F8N D;  5B1M D;  4Z2M H;  3KUY B;  4XZQ D;  4WU8 C;  3LZ1 D;  3W98 D;  5B31 D;  3NQU B;  3AYW C;  2PYO D;  4J8U B;  2Y2O A;  4G91 B;  5CP6 A;  5CPJ B;  4YS3 B;  1P3A A;  5AVC B;  4ZUX B;  3LEL C;  4KHA A;  4ZBJ B;  5BO0 B;  5E5A B;  5KDM B;  3REJ B;  4J8V D;  3A6N D;  4KUD A;  4LD9 C;  3C1B A;  3UT9 C;  1HQ3 C;  4Z66 B;  4JJN A;  1P3F A;  2ARO A;  3X1T D;  5GT0 D;  1P3G A;  3X1S B;  5B32 G;  1M19 B;  3AZI B;  1ID3 D;  5B2I B;  5AVB A;  2NZD A;  5BS7 A;  3AZG D;  3WA9 B;  1U35 B;  5B1L A;  4R8P A;  4M6B A;  1TZY A;  3W96 C;  3EPK A;  5B0Z B;  1ZLA B;  2ZY5 A;  2F8N B;  4EO5 C;  4J8X C;  4XZQ B;  4H9O B;  3LZ1 B;  1P34 C;  3W98 B;  5B31 B;  5AV9 D;  2PYO B;  3LZ0 D;  3AV2 C;  1BH9 A;  1KX5 D;  3WAA D;  2CV5 C;  5AV8 C;  3C1C A;  3AZM D;  3MGQ C;  5JRG C;  1F1E A;  3WTP E;  2RVQ C;  2Y2I A;  1P3P C;  1P3I C;  4H9S C;  3VH5 A;  1S32 D;  5GSU D;  4J8V B;  3A6N B;  3MGP D;  1F66 C;  1AOI D;  5DNN C;  5B33 D;  3X1T B;  5JA4 B;  1BH8 A;  4WU9 C;  3B0C T;  1HTA A;  3X1V C;  4J8W D;  1M1A C;  2L5A A;  3UTA C;  2F8N H;  1ID3 B;  3AZK D;  3LEL A;  3X1U C;  3AZG B;  3AZE C;  2G5I C;  5CP6 D;  4CSR A;  1P3A D;  4LD9 A;  3UT9 A;  1HQ3 A;  1TAF A;  5AV9 B;  3LZ0 B;  4CAY B;  3REK B;  2FJ7 A;  1KX5 B;  2NQB C;  3AZM B;  3AZH C;  4KUD D;  3C1B D;  1H3O A;  1Q9C A;  4JJN D;  2ZY4 A;  2ARO D;  3VH6 T;  4WNN A;  3W96 A;  1P3G D;  1S32 B;  3A1I A;  4KGC C;  3R45 A;  4J8X A;  3REH C;  1KX4 C;  5GSU B;  1P34 A;  2BYK B;  1P3K C;  3MGP B;  5AVB D;  2NZD D;  3TU4 A;  3AV2 A;  1AOI B;  2BYM A;  5B33 B;  3W97 D;  4R8P D;  3VH6 A;  1TZY D;  3EPL A;  4J8W B;  5AV8 A;  2CV5 A;  3MGQ A;  3AZN D;  3KFU G;  5JRG A;  5BNX B;  1P3O C;  2JCH A;  5GXQ C;  1P3M A;  3AZK B;  1P3P A;  1P3I A;  5CP6 B;  2HUE C;  3C1C D;  2ZM5 A;  4DRB A;  5FUG A;  4H9N A;  3H0L C;  1F66 A;  5DNN A;  4AWL B;  4WU9 A;  3X1V A;  1M1A A;  2XD1 A;  3UTA A;  2Y2K A;  3A1K A;  5AV6 C;  4KUD B;  5DNM C;  3C1B B;  5AV5 C;  5GT3 A;  3X1U A;  2ARO B;  2W8S A;  4JJN B;  3AZE A;  4Z2M G;  1Z2C B;  1BFM A;  4QLC C;  3MVD D;  5AVB B;  2NZD B;  3LEL D;  4YM6 D;  5CPI B;  3KXB A;  3KUY C;  3W97 B;  4R8P B;  1TZY B;  1P3L A;  2YFW A;  2HIO B;  3MNN A;  4J8U C;  3AZN B;  3AZH A;  4LD9 D;  3UT9 D;  5B32 C;  1B6W A;  5CPJ C;  2FJ7 D;  1BH9 B;  3UTB C;  4KGC A;  1JFI A;  3C1C B;  5AVC C;  1KX4 A;  3KWQ A;  1P3K A;  4ZUX C;  2IO5 B;  3REJ C;  1WWS A;  3W96 D;  3AZL C;  3MGS D;  3V9R A;  3AV1 D;  4E45 A;  1P34 D;  5BNV A;  1P3O A;  3MGR C;  3WKJ D;  3TU4 D;  3AV2 D;  5F99 C;  1P3B B;  1BH8 B;  5B2J B;  3AZI C;  5AV8 D;  3REI D;  4X23 A;  1M18 A;  3MVD B;  3WA9 C;  5JRG D;  5AY8 C;  1ULY A;  1P3M D;  1P3P D;  5B0Z C;  5CPK C;  3LEL B;  4YM6 B;  4H9R A;  5B1M B;  4XZQ C;  2PYO C;  5AV6 A;  4LD9 B;  5DNM A;  5B24 C;  3UT9 B;  1F66 D;  5AV5 A;  1TAF B;  5DNN D;  3AZJ A;  2Y2H A;  1M1A D;  2FJ7 B;  4QLC A;  4Z5T C;  3AFA C;  3LJA A;  5GT3 D;  3X1U D;  3AZE D;  3KUY A;  4WNN B;  4WU8 A;  4J8V C;  3F6T A;  4G92 C;  3AYW A;  3W96 B;  3MGS B;  2F8N G;  3AV1 B;  3X1T C;  5GT0 B;  1P34 B;  5B32 A;  1N1J A;  5B31 G;  3WKJ B;  3TU4 B;  2BYM B;  3KXB D;  3UTB A;  3B0D B;  1P3L D;  5AV8 B;  2DF4 C;  3REI B;  3MNN D;  3AZG C;  5JRG B;  5KDM A;  4NFT A; 
#chains in the Genus database with same CATH homology
 1P3M B;  3REJ A;  1P3P B;  3VH5 W;  3AZL A;  3AN2 C;  4KGC D;  2LY8 A;  3EG5 B;  4H9P A;  5AV9 C;  3KWQ D;  3MGR A;  3REK C;  1EQZ C;  5FUG B;  1F66 B;  5DNN B;  2Y2M A;  5F99 A;  3WAA B;  3AZM C;  2BG1 A;  4DRA A;  3AZI A;  3AZF C;  1M1A B;  3O62 C;  2FFF B;  1P3F D;  2Y2G A;  5AY8 A;  1KX3 C;  5B0Z A;  5CPK A;  5GT3 B;  3AZE B;  4H9O A;  4HGA B;  5B40 C;  3WTP C;  4X23 D;  3B0C W;  1M18 D;  5BT1 D;  5B1L D;  5B24 A;  2Y2Q A;  2Y2N A;  4UUZ A;  3KXB B;  3B6G C;  1P3L B;  2YFW B;  4Z5T A;  3AFA A;  3AZK C;  3MNN B;  4H9S A;  5B0Y C;  2DQN C;  3P5J B;  2XD5 A;  3AZJ D;  4J8V A;  4WV4 B;  1P3A B;  5C3I C;  5JA4 A;  4AWL C;  3KWQ B;  3LJA D;  4KHA B;  4WU8 D;  3AYW D;  3B6F C;  3C1B C;  3V9R B;  2JSS A;  1P3F B;  2ZY2 A;  3AZG A;  5B32 D;  2G5H C;  3W99 C;  1P3G B;  4NE3 A;  3AN2 A;  2ZY3 A;  3UTB D;  3REL C;  2HUE B;  4XUJ C;  4X23 B;  1M18 B;  2NZD C;  5G49 A;  3REK A;  1EQZ A;  5CPI C;  3W97 C;  5B1L B;  2NQB A;  1TZY C;  3REJ D;  3AZM A;  2HIO C;  3AZN C;  3AZL D;  4G91 C;  4H9R B;  1B67 A;  3AZF A;  1HQ3 D;  3O62 A;  3B0B A;  1KU5 A;  3MGR D;  4YS3 C;  1KX3 A;  4H9Q A;  3AZJ B;  5F99 D;  3REH A;  5B40 A;  4WZS B;  2BYK A;  2F2A C;  3WTP A;  4ZBJ C;  5E5A C;  2IO5 C;  2YFV A;  5AY8 D;  3LJA B;  5B0Z D;  5CPK D;  4Z66 C;  4J8X D;  3NQJ A;  4WU8 B;  5BNX A;  3B6G A;  5GXQ A;  3AYW B;  2JE5 A;  3AZK A;  4E44 A;  3X1S C;  5B0Y A;  5B24 D;  3H0R C;  5B32 B;  1P3B C;  1M19 C;  1N1J B;  5B2J C;  2CV5 D;  5B2I C;  3MGQ D;  3MVD C;  3UTB B;  1U35 C;  2RVQ D;  4Z5T D;  3AFA D;  1ZLA C;  1P3I D;  4YM6 C;  5B1M C;  3LZ1 C;  3W98 C;  3EPJ A;  5B31 C;  4CSR B;  3AZL B;  3B6F A;  3IP4 C;  1HQ3 B;  1W2E A;  4H9P B;  4WU9 D;  3MGR B;  3X1V D;  2FJ7 C;  1WWI A;  3W99 A;  3FDD A;  5F99 B;  3UTA D;  3REL A;  4XUJ A;  1H3O B;  3W97 A;  5CPI A;  5AY8 B;  3A6N C;  3NQU A;  5CPK B;  2Y2J A;  2HIO A;  4EO5 B;  3MGS C;  3R45 B;  4J8U A;  4J8X B;  3AZN A;  3AN2 D;  3AV1 C;  5GT0 C;  3WKJ C;  3VH5 T;  1R4V A;  5CPJ A;  2VQR A;  3REK D;  3TU4 C;  3AV2 B;  4YS3 A;  1EQZ D;  1A7W A;  4NE6 A;  5B24 B;  3B0D C;  2NQB D;  2CV5 B;  3REI C;  5AVC A;  1ID3 C;  3MGQ B;  3AZH D;  4UUZ B;  4ZUX A;  3AZF D;  1PZR A;  5BO0 A;  5E5A A;  3O62 D;  4Z5T B;  1P3M C;  3AFA B;  1P3I B;  2Y2L A;  1KX3 D;  4Z66 A;  3REH D;  1KX4 D;  4DQY B;  5B40 D;  3LZ0 C;  4G92 B;  3WTP D;  1P3K D;  4H9N B;  3X1S A;  1KX5 C;  3WAA C;  1P3B A;  4WU9 B;  1T3U A;  1M19 A;  5B2J A;  3X1V B;  5B2I A;  3MVD A;  3WA9 A;  3UTA B;  1U35 A;  1P3O D;  3B6G D;  5GXQ D;  1ZLA A;  1S32 C;  2F8N A;  5GT3 C;  3X1U B;  3KSY A;  5B0Y D;  5B1M A;  4YM6 A;  4XZQ A;  5GSU C;  4HGA C;  3LZ1 A;  3W98 A;  5B31 A;  2F8N K;  3MGP C;  2PYO A;  3AN2 B;  1AOI C;  5B33 C;  4J8W C;  5G49 B;  1EQZ B;  3KXB C;  2NQB B;  2CWE A;  1P3L C;  3AZH B;  3MNN C;  5AV6 D;  3B6F D;  3AZF B;  5DNM D;  5CP6 C;  3O62 B;  5AV5 D;  3A6N A;  3W99 D;  1P3A C;  1KX3 B;  4H9Q B;  4QLC D;  3MGS A;  4KGC B;  1JFI B;  3REH B;  3AV1 A;  3X1T A;  5GT0 A;  3REL D;  5B40 B;  1KX4 B;  1P3K B;  3KWQ C;  3WTP B;  4XUJ D;  3WKJ A;  2RIQ A;  5CPI D;  3KUY D;  2YFV B;  3VH6 W;  4KUD C;  3REI A;  1ID3 A;  2HIO D;  4J8U D;  4JJN C;  1P3F C;  2ARO C;  3NQJ B;  5BNV B;  1P3O B;  3B6G B;  5GXQ B;  3H0M C;  1P3G C;  5CPJ D;  2J8P A;  4WJ3 C;  4YS3 D;  5B0Y B;  5AVC D;  4X23 C;  5AV9 A;  5AVB C;  2Y2P A;  4CAY A;  5BS7 C;  4ZUX D;  3LZ0 A;  1M18 C;  5C3I B;  5B1L C;  4R8P C;  5E5A D;  5BT1 C;  1KX5 A;  3WAA A;  5CHL B;  4NE5 A;  4Z66 D;  5AV6 B;  3B6F B;  4UPK A;  5DNM B;  1S32 A;  3AL0 C;  5AV5 B;  3X1S D;  3AZJ C;  3C1C C;  1P3B D;  2UWX A;  5GSU A;  5B2J D;  1M19 D;  3AZI D;  3W99 B;  5B2I D;  3MGP A;  4QLC B;  3WA9 D;  1AOI A;  5B33 A;  1U35 D;  3REL B;  4XUJ B;  1ZLA D;  4J8W A;  3LJA C;  3EPH A;  2F8N D;  5B1M D;  4Z2M H;  3KUY B;  4XZQ D;  4WU8 C;  3LZ1 D;  3W98 D;  5B31 D;  3NQU B;  3AYW C;  2PYO D;  4J8U B;  2Y2O A;  4G91 B;  5CP6 A;  5CPJ B;  4YS3 B;  1P3A A;  5AVC B;  4ZUX B;  3LEL C;  4KHA A;  4ZBJ B;  5BO0 B;  5E5A B;  5KDM B;  3REJ B;  4J8V D;  3A6N D;  4KUD A;  4LD9 C;  3C1B A;  3UT9 C;  1HQ3 C;  4Z66 B;  4JJN A;  1P3F A;  2ARO A;  3X1T D;  5GT0 D;  1P3G A;  3X1S B;  5B32 G;  1M19 B;  3AZI B;  1ID3 D;  5B2I B;  5AVB A;  2NZD A;  5BS7 A;  3AZG D;  3WA9 B;  1U35 B;  5B1L A;  4R8P A;  4M6B A;  1TZY A;  3W96 C;  3EPK A;  5B0Z B;  1ZLA B;  2ZY5 A;  2F8N B;  4EO5 C;  4J8X C;  4XZQ B;  4H9O B;  3LZ1 B;  1P34 C;  3W98 B;  5B31 B;  5AV9 D;  2PYO B;  3LZ0 D;  3AV2 C;  1BH9 A;  1KX5 D;  3WAA D;  2CV5 C;  5AV8 C;  3C1C A;  3AZM D;  3MGQ C;  5JRG C;  1F1E A;  3WTP E;  2RVQ C;  2Y2I A;  1P3P C;  1P3I C;  4H9S C;  3VH5 A;  1S32 D;  5GSU D;  4J8V B;  3A6N B;  3MGP D;  1F66 C;  1AOI D;  5DNN C;  5B33 D;  3X1T B;  5JA4 B;  1BH8 A;  4WU9 C;  3B0C T;  1HTA A;  3X1V C;  4J8W D;  1M1A C;  2L5A A;  3UTA C;  2F8N H;  1ID3 B;  3AZK D;  3LEL A;  3X1U C;  3AZG B;  3AZE C;  2G5I C;  5CP6 D;  4CSR A;  1P3A D;  4LD9 A;  3UT9 A;  1HQ3 A;  1TAF A;  5AV9 B;  3LZ0 B;  4CAY B;  3REK B;  2FJ7 A;  1KX5 B;  2NQB C;  3AZM B;  3AZH C;  4KUD D;  3C1B D;  1H3O A;  1Q9C A;  4JJN D;  2ZY4 A;  2ARO D;  3VH6 T;  4WNN A;  3W96 A;  1P3G D;  1S32 B;  3A1I A;  4KGC C;  3R45 A;  4J8X A;  3REH C;  1KX4 C;  5GSU B;  1P34 A;  2BYK B;  1P3K C;  3MGP B;  5AVB D;  2NZD D;  3TU4 A;  3AV2 A;  1AOI B;  2BYM A;  5B33 B;  3W97 D;  4R8P D;  3VH6 A;  1TZY D;  3EPL A;  4J8W B;  5AV8 A;  2CV5 A;  3MGQ A;  3AZN D;  3KFU G;  5JRG A;  5BNX B;  1P3O C;  2JCH A;  5GXQ C;  1P3M A;  3AZK B;  1P3P A;  1P3I A;  5CP6 B;  2HUE C;  3C1C D;  2ZM5 A;  4DRB A;  5FUG A;  4H9N A;  3H0L C;  1F66 A;  5DNN A;  4AWL B;  4WU9 A;  3X1V A;  1M1A A;  2XD1 A;  3UTA A;  2Y2K A;  3A1K A;  5AV6 C;  4KUD B;  5DNM C;  3C1B B;  5AV5 C;  5GT3 A;  3X1U A;  2ARO B;  2W8S A;  4JJN B;  3AZE A;  4Z2M G;  1Z2C B;  1BFM A;  4QLC C;  3MVD D;  5AVB B;  2NZD B;  3LEL D;  4YM6 D;  5CPI B;  3KXB A;  3KUY C;  3W97 B;  4R8P B;  1TZY B;  1P3L A;  2YFW A;  2HIO B;  3MNN A;  4J8U C;  3AZN B;  3AZH A;  4LD9 D;  3UT9 D;  5B32 C;  1B6W A;  5CPJ C;  2FJ7 D;  1BH9 B;  3UTB C;  4KGC A;  1JFI A;  3C1C B;  5AVC C;  1KX4 A;  3KWQ A;  1P3K A;  4ZUX C;  2IO5 B;  3REJ C;  1WWS A;  3W96 D;  3AZL C;  3MGS D;  3V9R A;  3AV1 D;  4E45 A;  1P34 D;  5BNV A;  1P3O A;  3MGR C;  3WKJ D;  3TU4 D;  3AV2 D;  5F99 C;  1P3B B;  1BH8 B;  5B2J B;  3AZI C;  5AV8 D;  3REI D;  4X23 A;  1M18 A;  3MVD B;  3WA9 C;  5JRG D;  5AY8 C;  1ULY A;  1P3M D;  1P3P D;  5B0Z C;  5CPK C;  3LEL B;  4YM6 B;  4H9R A;  5B1M B;  4XZQ C;  2PYO C;  5AV6 A;  4LD9 B;  5DNM A;  5B24 C;  3UT9 B;  1F66 D;  5AV5 A;  1TAF B;  5DNN D;  3AZJ A;  2Y2H A;  1M1A D;  2FJ7 B;  4QLC A;  4Z5T C;  3AFA C;  3LJA A;  5GT3 D;  3X1U D;  3AZE D;  3KUY A;  4WNN B;  4WU8 A;  4J8V C;  3F6T A;  4G92 C;  3AYW A;  3W96 B;  3MGS B;  2F8N G;  3AV1 B;  3X1T C;  5GT0 B;  1P34 B;  5B32 A;  1N1J A;  5B31 G;  3WKJ B;  3TU4 B;  2BYM B;  3KXB D;  3UTB A;  3B0D B;  1P3L D;  5AV8 B;  2DF4 C;  3REI B;  3MNN D;  3AZG C;  5JRG B;  5KDM A;  4NFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...