1U35D

Crystal structure of the nucleosome core particle containing the histone domain of macroh2a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-satellite DNA
publication title Structural characterization of the histone variant macroH2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1u35D00
3MGPB 4H9RA 3B0DC 5B32D 3WTPC 5GT3D 3O62D 1JFIA 1P3LA 1EQZA 3UTAA 5FUGB 3B6GD 3A6NC 5DNNB 5B0ZA 1S32B 2HIOB 3KWQC 3MGRA 5AV6D 4CSRB 2HUEB 4M6BA 3B0BA 5B31A 4J8WC 3AZGB 3WTPB 4KGCC 4ZUXC 3WAAC 1BFMA 3AZFA 4XZQC 5AY8D 5B32B 5GT3B 3O62B 3AV2D 3MGPA 3KWQB 1M18C 3AZJC 1ZLAC 5FUGA 5AV6B 3B6FD 3WAAB 5DNNA 4YS3C 1S32A 2HIOA 5JRGC 3MGQD 4CSRA 4H9OB 3AZIC 1P3AC 2F8ND 3AZGA 1ID3C 3WTPA 3MGQC 3V9RA 5E5AC 1M18B 1M1AC 3AV2B 5GT0C 4J8VD 1P3PC 5B32A 5GT3A 3O62A 4CAYB 5GXQC 4Z66D 4J8VC 3KWQA 1P3KD 3B6GA 5BO0B 4YM6D 3WKJD 3MVDD 4JJND 3MGQB 5AV6A 3REJD 5KDMB 3WAAA 1M1AB 2NZDD 3MVDC 3VH5W 5GT0B 2F8NB 3W99D 4H9OA 1P34D 3UT9D 3REHD 2LY8A 5B1MC 4J8VB 3VH6W 1M18A 2BYKB 5DNMD 5B24C 5CPJD 3AV2A 4J8UD 3X1VC 2YFWB 4CAYA 2IO5C 3MVDB 4JJNB 5BO0A 1M19D 5CHLB 2NZDB 5B1MB 3MGQA 1P3OD 1P3GC 5KDMA 3AZHD 5B24B 5CPKD 1P3LC 1M1AA 1M19C 1EQZC 5GT0A 2F8NA 1B67A 5B0ZC 1P3OC 1TAFB 4NE3A 5DNMB 3R45B 2RVQD 4J8VA 5CP6D 3UTBD 5B31C 2BYKA 4KHAB 1Q9CA 5BNVB 5G49B 2YFWA 4Z66A 4WU9D 5B2ID 1P3KA 1A7WA 1P3GB 3AZMD 3LZ1D 1EQZB 2PYOD 1M19B 3MVDA 4JJNA 4X23D 5B2JC 1P3OB 3AZMC 3AZHB 3LZ1C 2NZDA 5B1MA 1HQ3C 2BYMB 5B24A 1P34A 5DNNC 1TAFA 5CP6B 2HIOC 2JSSA 3X1UD 3C1CD 3REID 5DNMA 1S32C 2FJ7D 2HUEC 3R45A 4WZSB 4E45A 5B2JB 5B0YD 3AZGC 4KHAA 1HTAA 5B2IB 5BNVA 3AZMB 3LZ1B 5G49A 2PYOB 1HQ3B 4X23B 1P3GA 3AZKD 3TU4D 5B32C 1M19A 3MGSD 5GT3C 3O62C 1R4VA 4H9SA 1P3OA 3AZKC 3AZHA 3B6GC 3AFAD 2BYMA 5AV5D 3C1CB 3REIB 4Z2MG 5AV6C 2FJ7B 1KX4D 3V9RB 5CP6A 3VH5A 5B0YB 4NE6A 3REKD 1KX4C 5B2JA 4ZBJB 5B2IA 3MNND 5AY8C 3AZKB 3AZMA 3VH6A 3LZ1A 2PYOA 3B6GB 1HQ3A 3C1BD 3REKC 4X23A 3AV2C 1P3BD 4KUDD 5B1LD 5C3IC 4H9NB 4XUJD 3AFAB 5AV5B 5B1LC 3B6FC 5F99D 1KX4B 4Z2MH 2AROD 4J8XD 3X1UA 3C1CA 3REIA 5AY8B 2FJ7A 3RELD 4G92B 4WV4B 3X1TD 3REKB 5B0YA 4J8XC 5BNXB 3MNNB 5C3IB 3AZLD 1AOID 2NQBD 3AZKA 1P3BB 4KUDB 5B1LB 3B6FB 5AVBD 3AYWD 4Z66C 4H9NA 5GSUD 3X1SD 1P3KC 2CWEA 4YM6C 4R8PD 3NQUB 3AFAA 3VH5T 3WKJC 4JJNC 5AV5A 2AROB 4J8XB 1TZYD 5BT1D 4NFTA 1ULYA 3REJC 3RELB 1KX4A 3AZED 2NZDC 5AY8A 3VH6T 3W99C 5B33D 1AOIB 1P34C 3REKA 3UT9C 3REHC 5BNXA 3MNNA 4Z66B 1P3ID 1P3KB 5B33C 5DNMC 4E44A 4YM6B 3AV1D 5CPJC 3WKJB 1P3BA 4KUDA 5AVBB 4J8UC 5B1LA 4AWLB 3REJB 3B6FA 4R8PB 1P3FD 1TZYB 3W99B 3W97D 3NQUA 1P34B 3UT9B 5F99A 3REHB 2AROA 4J8XA 3AZEB 4H9SC 5B40D 1KX3D 3W98D 3RELA 5B33B 4Z5TD 3AZHC 4WU8D 5CPKC 3X1TA 2F8NH 5CPJB 4J8UB 4HGAB 1AOIA 3KXBD 2RVQC 1F66D 5CP6C 3WA9D 3UTBC 3KUYD 4YM6A 3LJAD 3WTPE 3WKJA 5AVBA 1P3FB 3LELD 4QLCD 4WU9C 5B2IC 3REJA 3KUYC 3W96D 4R8PA 3W97B 5CPKB 2PYOC 2L5AA 1TZYA 4X23C 3W99A 5AV8D 2CV5D 3LELC 4DRAA 5B40B 3W98B 3UT9A 3REHA 4Z5TB 3AZEA 5AV9D 3AZFD 1F1EA 3UTBB 5B33A 5B31G 5CPJA 4EO5B 3KXBB 4J8UA 3MGPD 5AVCD 3AZND 1F66B 4WU9B 3X1UC 3C1CC 3REIC 3KUYB 1KX5D 3LJAB 2FJ7C 4DRBA 5BS7A 5AVCC 5B0YC 3LELB 3AZNC 4QLCB 3W96B 1KX5C 1U35D 1P3FA 4ZBJC 4LD9D 3LZ0D 1B6WA 5AV8B 2CV5B 3TU4C 3W97A 5CPKA 3B0CW 3MGSC 5CPID 5AV9B 5B40A 3W98A 3X1UB 4Z5TA 2F8NK 4G91C 5CPIC 1KU5A 3AFAC 3UTBA 5AVCB 5AV5C 3AZNB 4NE5A 1KX5B 3KXBA 3A6ND 1F66A 3WA9A 3KWQD 4WU9A 3KUYA 3TU4B 3LJAA 4G92C 5B32G 1U35B 3MGSB 4J8WD 3LELA 4LD9B 4QLCA 3AN2D 3W96A 4ZUXD 3MNNC 3LZ0B 4KGCD 3WAAD 4G91B 5CPIB 3C1BC 4XZQD 5AV8A 2CV5A 1P3BC 4KUDC 3AN2C 3B0DB 4XUJC 1N1JB 5AV9A 3KSYA 1M18D 3A6NB 3AZJD 5F99C 1ZLAD 5AVCA 1WWIA 2AROC 3AZNA 1KX5A 1H3OB 3RELC 4YS3D 3C1BB 4J8WB 5JRGD 3X1TC 3TU4A 3AN2B 4KGCB 4ZUXB 3AZLC 1U35A 3MGSA 1AOIC 4XUJB 3AZID 4UUZB 1P3AD 1ID3D 4LD9A 4XZQB 3LZ0A 2NQBC 5E5AD 1M1AD 5CPIA 4H9PB 5GT0D 5F99B 5AVBC 5JA4B 3AYWC 1P3PD 4AWLC 5GSUC 1N1JA 3X1SC 5GXQD 4R8PC 3X1TB 3AZJB 1ZLAB 1BH8B 1TZYC 5BT1C 2F8NG 3AZLB 3A6NA 4YS3B 3AZEC 5JRGB 2NQBB 1H3OA 1P3MD 3C1BA 4J8WA 3AZIB 1P3AB 1ID3B 3AYWB 3AN2A 4KGCA 4ZUXA 4HGAC 5GSUB 4XUJA 1P3IC 5E5AB 3X1SB 4UUZA 4WNNB 1P3MC 5B1MD 4XZQA 3AV1C 1P3PB 5BS7C 5B24D 4H9PA 5GXQB 5JA4A 3X1VD 3NQJB 1P3FC 3W97C 3AZJA 1ZLAA 4H9QB 1BH8A 3AZLA 5B40C 1KX3C 3W98C 1P3IB 1WWSA 4YS3A 4WU8C 4Z5TC 1P3MB 5JRGA 3AV1B 2NQBA 1P3GD 1P3LD 1EQZD 3UTAD 3AZIA 1P3AA 1ID3A 4EO5C 3KXBC 3AYWA 5B0ZD 5GSUA 1F66C 3WA9C 5E5AA 3X1SA 3MGRD 4WNNA 3UTAC 2YFVB 3LJAC 3X1VB 1P3PA 5B31D 1BH9B 4QLCC 1KX3B 3MGRC 3W96C 5GXQA 4WU8B 2IO5B 3NQJA 5AV8C 2CV5C 4H9RB 4H9QA 5B2JD 5AV9C 1JFIB 3AZFC 1P3IA 3WA9B 1P3LB 1P3MA 3UTAB 3AV1A 1HQ3D 5B0ZB 3MGPC 3MGRB 5DNND 1S32D 2HIOD 5B31B 2YFVA 3B0CT 1U35C 3X1VA 1BH9A 3AZGD 4LD9C 3AZFB 1KX3A 3WTPD 3LZ0C 4WU8A
chains in the Genus database with same CATH superfamily
3MGPB 4H9RA 3B0DC 5B32D 3WTPC 5GT3D 3O62D 1JFIA 1P3LA 1EQZA 3UTAA 5FUGB 3B6GD 3H0RC 3A6NC 5DNNB 5B0ZA 1S32B 2HIOB 3KWQC 3MGRA 5AV6D 4CSRB 2HUEB 4M6BA 3B0BA 5B31A 4J8WC 3AZGB 3AL0C 3WTPB 4KGCC 4ZUXC 3WAAC 1BFMA 3AZFA 4XZQC 5AY8D 5B32B 5GT3B 3O62B 3AV2D 3MGPA 3EG5B 3KWQB 1M18C 3AZJC 1ZLAC 5FUGA 5AV6B 3B6FD 3WAAB 5DNNA 4YS3C 1S32A 2HIOA 1PZRA 5JRGC 3MGQD 4CSRA 4H9OB 3AZIC 1P3AC 2F8ND 2ZY2A 3AZGA 1ID3C 3WTPA 3MGQC 2ZY3A 3V9RA 5E5AC 1M18B 1M1AC 3AV2B 5GT0C 4J8VD 1P3PC 5B32A 5GT3A 3O62A 4CAYB 5GXQC 3EPJA 4Z66D 4J8VC 2JCHA 3KWQA 1P3KD 3B6GA 5BO0B 4YM6D 3WKJD 3MVDD 4JJND 3MGQB 5AV6A 3REJD 5KDMB 3WAAA 1W2EA 1M1AB 2NZDD 3MVDC 3VH5W 5GT0B 2F8NB 3W99D 4H9OA 1P34D 2RIQA 2Y2GA 3UT9D 3REHD 2LY8A 5B1MC 4J8VB 3VH6W 1M18A 2BYKB 5DNMD 5B24C 5CPJD 3AV2A 4J8UD 3X1VC 2YFWB 2Y2NA 4CAYA 2IO5C 3MVDB 4JJNB 5BO0A 1M19D 5CHLB 2NZDB 5B1MB 2Y2KA 3MGQA 1P3OD 1P3GC 5KDMA 3P5JB 3AZHD 5B24B 5CPKD 1P3LC 1M1AA 1M19C 1EQZC 5GT0A 2F8NA 1B67A 5B0ZC 1P3OC 1TAFB 4NE3A 5DNMB 3R45B 2RVQD 4J8VA 5CP6D 3UTBD 2Y2QA 5B31C 3A1KA 2BYKA 4KHAB 1Q9CA 5BNVB 5G49B 2YFWA 4Z66A 4WU9D 5B2ID 1P3KA 1A7WA 1P3GB 3AZMD 3LZ1D 1EQZB 2PYOD 1M19B 3MVDA 4JJNA 4X23D 5B2JC 1P3OB 3AZMC 3AZHB 3LZ1C 2NZDA 5B1MA 1HQ3C 2BYMB 5B24A 1P34A 5DNNC 1TAFA 5CP6B 2HIOC 2JSSA 3X1UD 3C1CD 3REID 5DNMA 1S32C 3KFUG 2FJ7D 2HUEC 3R45A 2W8SA 4WZSB 4E45A 5B2JB 5B0YD 2G5HC 3AZGC 4KHAA 1HTAA 5B2IB 5BNVA 3AZMB 3LZ1B 5G49A 2PYOB 1HQ3B 4X23B 1P3GA 3AZKD 3TU4D 5B32C 1M19A 3MGSD 5GT3C 3O62C 1R4VA 4H9SA 1P3OA 3AZKC 3AZHA 3B6GC 3AFAD 2BYMA 5AV5D 2Y2JA 3C1CB 3REIB 4Z2MG 5AV6C 2FJ7B 1KX4D 3V9RB 5CP6A 3VH5A 5B0YB 4NE6A 3REKD 3EPLA 1KX4C 5B2JA 4ZBJB 5B2IA 3MNND 5AY8C 2G5IC 3AZKB 3AZMA 3VH6A 3LZ1A 3FDDA 2PYOA 3B6GB 1HQ3A 3C1BD 3REKC 4X23A 3AV2C 1P3BD 4KUDD 5B1LD 5C3IC 4H9NB 4XUJD 3AFAB 2Y2OA 5AV5B 5B1LC 3B6FC 5F99D 1KX4B 4Z2MH 2AROD 4J8XD 3X1UA 3C1CA 3REIA 2JE5A 5AY8B 2FJ7A 3RELD 4G92B 4WV4B 3X1TD 3REKB 5B0YA 4J8XC 5BNXB 3MNNB 5C3IB 2F2AC 3AZLD 1AOID 2NQBD 3AZKA 1P3BB 4KUDB 5B1LB 3B6FB 5AVBD 3AYWD 4Z66C 4H9NA 5GSUD 3X1SD 1P3KC 2CWEA 4YM6C 4R8PD 3NQUB 3AFAA 3VH5T 3WKJC 4JJNC 5AV5A 2AROB 4J8XB 1TZYD 5BT1D 4NFTA 1ULYA 3REJC 3RELB 1KX4A 3AZED 2NZDC 5AY8A 3VH6T 3W99C 3IP4C 5B33D 1AOIB 1P34C 3REKA 3UT9C 3REHC 5BNXA 3MNNA 4Z66B 1P3ID 1P3KB 5B33C 5DNMC 4E44A 4YM6B 3AV1D 5CPJC 3WKJB 1P3BA 4KUDA 5AVBB 4J8UC 5B1LA 4AWLB 2XD5A 3REJB 3B6FA 2Y2MA 4R8PB 1P3FD 1TZYB 3W99B 2BG1A 3W97D 3NQUA 1Z2CB 3UT9B 1P34B 5F99A 3REHB 2AROA 4J8XA 3AZEB 4H9SC 5B40D 1KX3D 3W98D 3RELA 5B33B 4Z5TD 3AZHC 4WU8D 5CPKC 3X1TA 2F8NH 5CPJB 4J8UB 4HGAB 1AOIA 3KXBD 2RVQC 3EPHA 1F66D 5CP6C 3WA9D 3UTBC 2VQRA 3KUYD 4YM6A 3LJAD 3WTPE 3WKJA 5AVBA 1P3FB 3LELD 3F6TA 4QLCD 4WU9C 5B2IC 3REJA 3KUYC 3W96D 4R8PA 3W97B 5CPKB 2PYOC 2L5AA 1TZYA 4X23C 3W99A 5AV8D 2CV5D 3LELC 4DRAA 5B40B 3W98B 3UT9A 3REHA 4Z5TB 3AZEA 5AV9D 3AZFD 1F1EA 3UTBB 5B33A 5B31G 2Y2HA 5CPJA 4EO5B 3KXBB 4J8UA 3MGPD 5AVCD 3AZND 1F66B 4WU9B 2FFFB 3X1UC 3C1CC 3REIC 3KUYB 1KX5D 3LJAB 2FJ7C 4DRBA 5BS7A 5AVCC 5B0YC 3LELB 3AZNC 4QLCB 3W96B 1KX5C 1U35D 1P3FA 4ZBJC 4LD9D 3LZ0D 1B6WA 5AV8B 2CV5B 3TU4C 3W97A 5CPKA 3B0CW 3MGSC 5CPID 5AV9B 5B40A 3W98A 3X1UB 4Z5TA 2F8NK 4G91C 5CPIC 4DQYB 1KU5A 3AFAC 3UTBA 5AVCB 5AV5C 3AZNB 2DQNC 4NE5A 1KX5B 3KXBA 3A6ND 1F66A 3WA9A 3KWQD 4WU9A 3KUYA 3TU4B 3LJAA 4G92C 5B32G 1T3UA 1U35B 3MGSB 4J8WD 3LELA 4LD9B 4WJ3C 4QLCA 2DF4C 2ZY5A 3AN2D 3W96A 4ZUXD 3MNNC 3LZ0B 4KGCD 3WAAD 4G91B 5CPIB 3C1BC 4XZQD 5AV8A 2CV5A 1P3BC 4KUDC 3AN2C 3B0DB 4XUJC 1N1JB 5AV9A 3KSYA 1M18D 3A6NB 3AZJD 5F99C 1ZLAD 5AVCA 1WWIA 2AROC 3AZNA 1KX5A 1H3OB 3RELC 4YS3D 3C1BB 4J8WB 5JRGD 3X1TC 3TU4A 3AN2B 4KGCB 4ZUXB 3AZLC 1U35A 3MGSA 1AOIC 4XUJB 3AZID 4UUZB 1P3AD 1ID3D 4LD9A 2Y2IA 4XZQB 3LZ0A 2NQBC 5E5AD 1M1AD 5CPIA 4H9PB 5GT0D 5F99B 5AVBC 5JA4B 3AYWC 1P3PD 4AWLC 5GSUC 1N1JA 3X1SC 5GXQD 4R8PC 3X1TB 3AZJB 2XD1A 1ZLAB 1BH8B 1TZYC 5BT1C 2F8NG 3AZLB 2ZM5A 3A6NA 4YS3B 3EPKA 3AZEC 5JRGB 2Y2PA 2NQBB 1H3OA 1P3MD 3C1BA 4J8WA 3AZIB 1P3AB 1ID3B 3AYWB 3AN2A 4KGCA 4ZUXA 4HGAC 5GSUB 4XUJA 1P3IC 5E5AB 3X1SB 4UUZA 4WNNB 1P3MC 5B1MD 4XZQA 3AV1C 1P3PB 5BS7C 5B24D 4H9PA 5GXQB 5JA4A 3X1VD 3NQJB 3H0LC 1P3FC 3W97C 3AZJA 1ZLAA 4H9QB 1BH8A 3AZLA 5B40C 1KX3C 3W98C 1P3IB 1WWSA 4YS3A 2Y2LA 4Z5TC 4WU8C 1P3MB 5JRGA 3AV1B 2NQBA 1P3GD 1P3LD 1EQZD 3UTAD 3AZIA 2J8PA 1P3AA 1ID3A 4EO5C 3A1IA 3KXBC 3AYWA 5B0ZD 5GSUA 1F66C 3WA9C 5E5AA 3X1SA 3MGRD 4WNNA 3UTAC 2YFVB 3LJAC 3X1VB 1P3PA 5B31D 3H0MC 1BH9B 4QLCC 1KX3B 3MGRC 3W96C 5GXQA 4WU8B 2IO5B 3NQJA 5AV8C 2CV5C 4H9RB 4H9QA 5B2JD 5AV9C 1JFIB 3AZFC 1P3IA 3WA9B 1P3LB 1P3MA 3UTAB 3AV1A 1HQ3D 5B0ZB 3MGPC 3MGRB 5DNND 1S32D 2HIOD 5B31B 2YFVA 2UWXA 3B0CT 1U35C 3X1VA 4UPKA 1BH9A 3AZGD 4LD9C 3AZFB 1KX3A 3WTPD 3LZ0C 4WU8A 2ZY4A
chains in the Genus database with same CATH topology
3MGPB 4H9RA 3B0DC 5B32D 3WTPC 5GT3D 3O62D 1JFIA 1P3LA 1EQZA 3UTAA 5FUGB 3B6GD 3H0RC 3A6NC 5DNNB 5B0ZA 1S32B 2HIOB 3KWQC 3MGRA 5AV6D 4CSRB 2HUEB 4M6BA 3B0BA 5B31A 4J8WC 3AZGB 3AL0C 3WTPB 4KGCC 4ZUXC 3WAAC 1BFMA 3AZFA 4XZQC 5AY8D 5B32B 5GT3B 3O62B 3AV2D 3MGPA 3EG5B 3KWQB 1M18C 3AZJC 1ZLAC 5FUGA 5AV6B 3B6FD 3WAAB 5DNNA 4YS3C 1S32A 2HIOA 1PZRA 5JRGC 3MGQD 4CSRA 4H9OB 3AZIC 1P3AC 2F8ND 2ZY2A 3AZGA 1ID3C 3WTPA 3MGQC 2ZY3A 3V9RA 5E5AC 1M18B 1M1AC 3AV2B 5GT0C 4J8VD 1P3PC 5B32A 5GT3A 3O62A 4CAYB 5GXQC 3EPJA 4Z66D 4J8VC 2JCHA 3KWQA 1P3KD 3B6GA 5BO0B 4YM6D 3WKJD 3MVDD 4JJND 3MGQB 5AV6A 3REJD 5KDMB 3WAAA 1W2EA 1M1AB 2NZDD 3MVDC 3VH5W 5GT0B 2F8NB 3W99D 4H9OA 1P34D 2RIQA 2Y2GA 3UT9D 3REHD 2LY8A 5B1MC 4J8VB 3VH6W 1M18A 2BYKB 5DNMD 5B24C 5CPJD 3AV2A 4J8UD 3X1VC 2YFWB 2Y2NA 4CAYA 2IO5C 3MVDB 4JJNB 5BO0A 1M19D 5CHLB 2NZDB 5B1MB 2Y2KA 3MGQA 1P3OD 1P3GC 5KDMA 3P5JB 3AZHD 5B24B 5CPKD 1P3LC 1M1AA 1M19C 1EQZC 5GT0A 2F8NA 1B67A 5B0ZC 1P3OC 1TAFB 4NE3A 5DNMB 3R45B 2RVQD 4J8VA 5CP6D 3UTBD 2Y2QA 5B31C 3A1KA 2BYKA 4KHAB 1Q9CA 5BNVB 5G49B 2YFWA 4Z66A 4WU9D 5B2ID 1P3KA 1A7WA 1P3GB 3AZMD 3LZ1D 1EQZB 2PYOD 1M19B 3MVDA 4JJNA 4X23D 5B2JC 1P3OB 3AZMC 3AZHB 3LZ1C 2NZDA 5B1MA 1HQ3C 2BYMB 5B24A 1P34A 5DNNC 1TAFA 5CP6B 2HIOC 2JSSA 3X1UD 3C1CD 3REID 5DNMA 1S32C 3KFUG 2FJ7D 2HUEC 3R45A 2W8SA 4WZSB 4E45A 5B2JB 5B0YD 2G5HC 3AZGC 4KHAA 1HTAA 5B2IB 5BNVA 3AZMB 3LZ1B 5G49A 2PYOB 1HQ3B 4X23B 1P3GA 3AZKD 3TU4D 5B32C 1M19A 3MGSD 5GT3C 3O62C 1R4VA 4H9SA 1P3OA 3AZKC 3AZHA 3B6GC 3AFAD 2BYMA 5AV5D 2Y2JA 3C1CB 3REIB 4Z2MG 5AV6C 2FJ7B 1KX4D 3V9RB 5CP6A 3VH5A 5B0YB 4NE6A 3REKD 3EPLA 1KX4C 5B2JA 4ZBJB 5B2IA 3MNND 5AY8C 2G5IC 3AZKB 3AZMA 3VH6A 3LZ1A 3FDDA 2PYOA 3B6GB 1HQ3A 3C1BD 3REKC 4X23A 3AV2C 1P3BD 4KUDD 5B1LD 5C3IC 4H9NB 4XUJD 3AFAB 2Y2OA 5AV5B 5B1LC 3B6FC 5F99D 1KX4B 4Z2MH 2AROD 4J8XD 3X1UA 3C1CA 3REIA 2JE5A 5AY8B 2FJ7A 3RELD 4G92B 4WV4B 3X1TD 3REKB 5B0YA 4J8XC 5BNXB 3MNNB 5C3IB 2F2AC 3AZLD 1AOID 2NQBD 3AZKA 1P3BB 4KUDB 5B1LB 3B6FB 5AVBD 3AYWD 4Z66C 4H9NA 5GSUD 3X1SD 1P3KC 2CWEA 4YM6C 4R8PD 3NQUB 3AFAA 3VH5T 3WKJC 4JJNC 5AV5A 2AROB 4J8XB 1TZYD 5BT1D 4NFTA 1ULYA 3REJC 3RELB 1KX4A 3AZED 2NZDC 5AY8A 3VH6T 3W99C 3IP4C 5B33D 1AOIB 1P34C 3REKA 3UT9C 3REHC 5BNXA 3MNNA 4Z66B 1P3ID 1P3KB 5B33C 5DNMC 4E44A 4YM6B 3AV1D 5CPJC 3WKJB 1P3BA 4KUDA 5AVBB 4J8UC 5B1LA 4AWLB 2XD5A 3REJB 3B6FA 2Y2MA 4R8PB 1P3FD 1TZYB 3W99B 2BG1A 3W97D 3NQUA 1Z2CB 3UT9B 1P34B 5F99A 3REHB 2AROA 4J8XA 3AZEB 4H9SC 5B40D 1KX3D 3W98D 3RELA 5B33B 4Z5TD 3AZHC 4WU8D 5CPKC 3X1TA 2F8NH 5CPJB 4J8UB 4HGAB 1AOIA 3KXBD 2RVQC 3EPHA 1F66D 5CP6C 3WA9D 3UTBC 2VQRA 3KUYD 4YM6A 3LJAD 3WTPE 3WKJA 5AVBA 1P3FB 3LELD 3F6TA 4QLCD 4WU9C 5B2IC 3REJA 3KUYC 3W96D 4R8PA 3W97B 5CPKB 2PYOC 2L5AA 1TZYA 4X23C 3W99A 5AV8D 2CV5D 3LELC 4DRAA 5B40B 3W98B 3UT9A 3REHA 4Z5TB 3AZEA 5AV9D 3AZFD 1F1EA 3UTBB 5B33A 5B31G 2Y2HA 5CPJA 4EO5B 3KXBB 4J8UA 3MGPD 5AVCD 3AZND 1F66B 4WU9B 2FFFB 3X1UC 3C1CC 3REIC 3KUYB 1KX5D 3LJAB 2FJ7C 4DRBA 5BS7A 5AVCC 5B0YC 3LELB 3AZNC 4QLCB 3W96B 1KX5C 1U35D 1P3FA 4ZBJC 4LD9D 3LZ0D 1B6WA 5AV8B 2CV5B 3TU4C 3W97A 5CPKA 3B0CW 3MGSC 5CPID 5AV9B 5B40A 3W98A 3X1UB 4Z5TA 2F8NK 4G91C 5CPIC 4DQYB 1KU5A 3AFAC 3UTBA 5AVCB 5AV5C 3AZNB 2DQNC 4NE5A 1KX5B 3KXBA 3A6ND 1F66A 3WA9A 3KWQD 4WU9A 3KUYA 3TU4B 3LJAA 4G92C 5B32G 1T3UA 1U35B 3MGSB 4J8WD 3LELA 4LD9B 4WJ3C 4QLCA 2DF4C 2ZY5A 3AN2D 3W96A 4ZUXD 3MNNC 3LZ0B 4KGCD 3WAAD 4G91B 5CPIB 3C1BC 4XZQD 5AV8A 2CV5A 1P3BC 4KUDC 3AN2C 3B0DB 4XUJC 1N1JB 5AV9A 3KSYA 1M18D 3A6NB 3AZJD 5F99C 1ZLAD 5AVCA 1WWIA 2AROC 3AZNA 1KX5A 1H3OB 3RELC 4YS3D 3C1BB 4J8WB 5JRGD 3X1TC 3TU4A 3AN2B 4KGCB 4ZUXB 3AZLC 1U35A 3MGSA 1AOIC 4XUJB 3AZID 4UUZB 1P3AD 1ID3D 4LD9A 2Y2IA 4XZQB 3LZ0A 2NQBC 5E5AD 1M1AD 5CPIA 4H9PB 5GT0D 5F99B 5AVBC 5JA4B 3AYWC 1P3PD 4AWLC 5GSUC 1N1JA 3X1SC 5GXQD 4R8PC 3X1TB 3AZJB 2XD1A 1ZLAB 1BH8B 1TZYC 5BT1C 2F8NG 3AZLB 2ZM5A 3A6NA 4YS3B 3EPKA 3AZEC 5JRGB 2Y2PA 2NQBB 1H3OA 1P3MD 3C1BA 4J8WA 3AZIB 1P3AB 1ID3B 3AYWB 3AN2A 4KGCA 4ZUXA 4HGAC 5GSUB 4XUJA 1P3IC 5E5AB 3X1SB 4UUZA 4WNNB 1P3MC 5B1MD 4XZQA 3AV1C 1P3PB 5BS7C 5B24D 4H9PA 5GXQB 5JA4A 3X1VD 3NQJB 3H0LC 1P3FC 3W97C 3AZJA 1ZLAA 4H9QB 1BH8A 3AZLA 5B40C 1KX3C 3W98C 1P3IB 1WWSA 4YS3A 2Y2LA 4Z5TC 4WU8C 1P3MB 5JRGA 3AV1B 2NQBA 1P3GD 1P3LD 1EQZD 3UTAD 3AZIA 2J8PA 1P3AA 1ID3A 4EO5C 3A1IA 3KXBC 3AYWA 5B0ZD 5GSUA 1F66C 3WA9C 5E5AA 3X1SA 3MGRD 4WNNA 3UTAC 2YFVB 3LJAC 3X1VB 1P3PA 5B31D 3H0MC 1BH9B 4QLCC 1KX3B 3MGRC 3W96C 5GXQA 4WU8B 2IO5B 3NQJA 5AV8C 2CV5C 4H9RB 4H9QA 5B2JD 5AV9C 1JFIB 3AZFC 1P3IA 3WA9B 1P3LB 1P3MA 3UTAB 3AV1A 1HQ3D 5B0ZB 3MGPC 3MGRB 5DNND 1S32D 2HIOD 5B31B 2YFVA 2UWXA 3B0CT 1U35C 3X1VA 4UPKA 1BH9A 3AZGD 4LD9C 3AZFB 1KX3A 3WTPD 3LZ0C 4WU8A 2ZY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGP B;  4H9R A;  3B0D C;  5B32 D;  3WTP C;  5GT3 D;  3O62 D;  1JFI A;  1P3L A;  1EQZ A;  3UTA A;  5FUG B;  3B6G D;  3A6N C;  5DNN B;  5B0Z A;  1S32 B;  2HIO B;  3KWQ C;  3MGR A;  5AV6 D;  4CSR B;  2HUE B;  4M6B A;  3B0B A;  5B31 A;  4J8W C;  3AZG B;  3WTP B;  4KGC C;  4ZUX C;  3WAA C;  1BFM A;  3AZF A;  4XZQ C;  5AY8 D;  5B32 B;  5GT3 B;  3O62 B;  3AV2 D;  3MGP A;  3KWQ B;  1M18 C;  3AZJ C;  1ZLA C;  5FUG A;  5AV6 B;  3B6F D;  3WAA B;  5DNN A;  4YS3 C;  1S32 A;  2HIO A;  5JRG C;  3MGQ D;  4CSR A;  4H9O B;  3AZI C;  1P3A C;  2F8N D;  3AZG A;  1ID3 C;  3WTP A;  3MGQ C;  3V9R A;  5E5A C;  1M18 B;  1M1A C;  3AV2 B;  5GT0 C;  4J8V D;  1P3P C;  5B32 A;  5GT3 A;  3O62 A;  4CAY B;  5GXQ C;  4Z66 D;  4J8V C;  3KWQ A;  1P3K D;  3B6G A;  5BO0 B;  4YM6 D;  3WKJ D;  3MVD D;  4JJN D;  3MGQ B;  5AV6 A;  3REJ D;  5KDM B;  3WAA A;  1M1A B;  2NZD D;  3MVD C;  3VH5 W;  5GT0 B;  2F8N B;  3W99 D;  4H9O A;  1P34 D;  3UT9 D;  3REH D;  2LY8 A;  5B1M C;  4J8V B;  3VH6 W;  1M18 A;  2BYK B;  5DNM D;  5B24 C;  5CPJ D;  3AV2 A;  4J8U D;  3X1V C;  2YFW B;  4CAY A;  2IO5 C;  3MVD B;  4JJN B;  5BO0 A;  1M19 D;  5CHL B;  2NZD B;  5B1M B;  3MGQ A;  1P3O D;  1P3G C;  5KDM A;  3AZH D;  5B24 B;  5CPK D;  1P3L C;  1M1A A;  1M19 C;  1EQZ C;  5GT0 A;  2F8N A;  1B67 A;  5B0Z C;  1P3O C;  1TAF B;  4NE3 A;  5DNM B;  3R45 B;  2RVQ D;  4J8V A;  5CP6 D;  3UTB D;  5B31 C;  2BYK A;  4KHA B;  1Q9C A;  5BNV B;  5G49 B;  2YFW A;  4Z66 A;  4WU9 D;  5B2I D;  1P3K A;  1A7W A;  1P3G B;  3AZM D;  3LZ1 D;  1EQZ B;  2PYO D;  1M19 B;  3MVD A;  4JJN A;  4X23 D;  5B2J C;  1P3O B;  3AZM C;  3AZH B;  3LZ1 C;  2NZD A;  5B1M A;  1HQ3 C;  2BYM B;  5B24 A;  1P34 A;  5DNN C;  1TAF A;  5CP6 B;  2HIO C;  2JSS A;  3X1U D;  3C1C D;  3REI D;  5DNM A;  1S32 C;  2FJ7 D;  2HUE C;  3R45 A;  4WZS B;  4E45 A;  5B2J B;  5B0Y D;  3AZG C;  4KHA A;  1HTA A;  5B2I B;  5BNV A;  3AZM B;  3LZ1 B;  5G49 A;  2PYO B;  1HQ3 B;  4X23 B;  1P3G A;  3AZK D;  3TU4 D;  5B32 C;  1M19 A;  3MGS D;  5GT3 C;  3O62 C;  1R4V A;  4H9S A;  1P3O A;  3AZK C;  3AZH A;  3B6G C;  3AFA D;  2BYM A;  5AV5 D;  3C1C B;  3REI B;  4Z2M G;  5AV6 C;  2FJ7 B;  1KX4 D;  3V9R B;  5CP6 A;  3VH5 A;  5B0Y B;  4NE6 A;  3REK D;  1KX4 C;  5B2J A;  4ZBJ B;  5B2I A;  3MNN D;  5AY8 C;  3AZK B;  3AZM A;  3VH6 A;  3LZ1 A;  2PYO A;  3B6G B;  1HQ3 A;  3C1B D;  3REK C;  4X23 A;  3AV2 C;  1P3B D;  4KUD D;  5B1L D;  5C3I C;  4H9N B;  4XUJ D;  3AFA B;  5AV5 B;  5B1L C;  3B6F C;  5F99 D;  1KX4 B;  4Z2M H;  2ARO D;  4J8X D;  3X1U A;  3C1C A;  3REI A;  5AY8 B;  2FJ7 A;  3REL D;  4G92 B;  4WV4 B;  3X1T D;  3REK B;  5B0Y A;  4J8X C;  5BNX B;  3MNN B;  5C3I B;  3AZL D;  1AOI D;  2NQB D;  3AZK A;  1P3B B;  4KUD B;  5B1L B;  3B6F B;  5AVB D;  3AYW D;  4Z66 C;  4H9N A;  5GSU D;  3X1S D;  1P3K C;  2CWE A;  4YM6 C;  4R8P D;  3NQU B;  3AFA A;  3VH5 T;  3WKJ C;  4JJN C;  5AV5 A;  2ARO B;  4J8X B;  1TZY D;  5BT1 D;  4NFT A;  1ULY A;  3REJ C;  3REL B;  1KX4 A;  3AZE D;  2NZD C;  5AY8 A;  3VH6 T;  3W99 C;  5B33 D;  1AOI B;  1P34 C;  3REK A;  3UT9 C;  3REH C;  5BNX A;  3MNN A;  4Z66 B;  1P3I D;  1P3K B;  5B33 C;  5DNM C;  4E44 A;  4YM6 B;  3AV1 D;  5CPJ C;  3WKJ B;  1P3B A;  4KUD A;  5AVB B;  4J8U C;  5B1L A;  4AWL B;  3REJ B;  3B6F A;  4R8P B;  1P3F D;  1TZY B;  3W99 B;  3W97 D;  3NQU A;  1P34 B;  3UT9 B;  5F99 A;  3REH B;  2ARO A;  4J8X A;  3AZE B;  4H9S C;  5B40 D;  1KX3 D;  3W98 D;  3REL A;  5B33 B;  4Z5T D;  3AZH C;  4WU8 D;  5CPK C;  3X1T A;  2F8N H;  5CPJ B;  4J8U B;  4HGA B;  1AOI A;  3KXB D;  2RVQ C;  1F66 D;  5CP6 C;  3WA9 D;  3UTB C;  3KUY D;  4YM6 A;  3LJA D;  3WTP E;  3WKJ A;  5AVB A;  1P3F B;  3LEL D;  4QLC D;  4WU9 C;  5B2I C;  3REJ A;  3KUY C;  3W96 D;  4R8P A;  3W97 B;  5CPK B;  2PYO C;  2L5A A;  1TZY A;  4X23 C;  3W99 A;  5AV8 D;  2CV5 D;  3LEL C;  4DRA A;  5B40 B;  3W98 B;  3UT9 A;  3REH A;  4Z5T B;  3AZE A;  5AV9 D;  3AZF D;  1F1E A;  3UTB B;  5B33 A;  5B31 G;  5CPJ A;  4EO5 B;  3KXB B;  4J8U A;  3MGP D;  5AVC D;  3AZN D;  1F66 B;  4WU9 B;  3X1U C;  3C1C C;  3REI C;  3KUY B;  1KX5 D;  3LJA B;  2FJ7 C;  4DRB A;  5BS7 A;  5AVC C;  5B0Y C;  3LEL B;  3AZN C;  4QLC B;  3W96 B;  1KX5 C;  1U35 D;  1P3F A;  4ZBJ C;  4LD9 D;  3LZ0 D;  1B6W A;  5AV8 B;  2CV5 B;  3TU4 C;  3W97 A;  5CPK A;  3B0C W;  3MGS C;  5CPI D;  5AV9 B;  5B40 A;  3W98 A;  3X1U B;  4Z5T A;  2F8N K;  4G91 C;  5CPI C;  1KU5 A;  3AFA C;  3UTB A;  5AVC B;  5AV5 C;  3AZN B;  4NE5 A;  1KX5 B;  3KXB A;  3A6N D;  1F66 A;  3WA9 A;  3KWQ D;  4WU9 A;  3KUY A;  3TU4 B;  3LJA A;  4G92 C;  5B32 G;  1U35 B;  3MGS B;  4J8W D;  3LEL A;  4LD9 B;  4QLC A;  3AN2 D;  3W96 A;  4ZUX D;  3MNN C;  3LZ0 B;  4KGC D;  3WAA D;  4G91 B;  5CPI B;  3C1B C;  4XZQ D;  5AV8 A;  2CV5 A;  1P3B C;  4KUD C;  3AN2 C;  3B0D B;  4XUJ C;  1N1J B;  5AV9 A;  3KSY A;  1M18 D;  3A6N B;  3AZJ D;  5F99 C;  1ZLA D;  5AVC A;  1WWI A;  2ARO C;  3AZN A;  1KX5 A;  1H3O B;  3REL C;  4YS3 D;  3C1B B;  4J8W B;  5JRG D;  3X1T C;  3TU4 A;  3AN2 B;  4KGC B;  4ZUX B;  3AZL C;  1U35 A;  3MGS A;  1AOI C;  4XUJ B;  3AZI D;  4UUZ B;  1P3A D;  1ID3 D;  4LD9 A;  4XZQ B;  3LZ0 A;  2NQB C;  5E5A D;  1M1A D;  5CPI A;  4H9P B;  5GT0 D;  5F99 B;  5AVB C;  5JA4 B;  3AYW C;  1P3P D;  4AWL C;  5GSU C;  1N1J A;  3X1S C;  5GXQ D;  4R8P C;  3X1T B;  3AZJ B;  1ZLA B;  1BH8 B;  1TZY C;  5BT1 C;  2F8N G;  3AZL B;  3A6N A;  4YS3 B;  3AZE C;  5JRG B;  2NQB B;  1H3O A;  1P3M D;  3C1B A;  4J8W A;  3AZI B;  1P3A B;  1ID3 B;  3AYW B;  3AN2 A;  4KGC A;  4ZUX A;  4HGA C;  5GSU B;  4XUJ A;  1P3I C;  5E5A B;  3X1S B;  4UUZ A;  4WNN B;  1P3M C;  5B1M D;  4XZQ A;  3AV1 C;  1P3P B;  5BS7 C;  5B24 D;  4H9P A;  5GXQ B;  5JA4 A;  3X1V D;  3NQJ B;  1P3F C;  3W97 C;  3AZJ A;  1ZLA A;  4H9Q B;  1BH8 A;  3AZL A;  5B40 C;  1KX3 C;  3W98 C;  1P3I B;  1WWS A;  4YS3 A;  4WU8 C;  4Z5T C;  1P3M B;  5JRG A;  3AV1 B;  2NQB A;  1P3G D;  1P3L D;  1EQZ D;  3UTA D;  3AZI A;  1P3A A;  1ID3 A;  4EO5 C;  3KXB C;  3AYW A;  5B0Z D;  5GSU A;  1F66 C;  3WA9 C;  5E5A A;  3X1S A;  3MGR D;  4WNN A;  3UTA C;  2YFV B;  3LJA C;  3X1V B;  1P3P A;  5B31 D;  1BH9 B;  4QLC C;  1KX3 B;  3MGR C;  3W96 C;  5GXQ A;  4WU8 B;  2IO5 B;  3NQJ A;  5AV8 C;  2CV5 C;  4H9R B;  4H9Q A;  5B2J D;  5AV9 C;  1JFI B;  3AZF C;  1P3I A;  3WA9 B;  1P3L B;  1P3M A;  3UTA B;  3AV1 A;  1HQ3 D;  5B0Z B;  3MGP C;  3MGR B;  5DNN D;  1S32 D;  2HIO D;  5B31 B;  2YFV A;  3B0C T;  1U35 C;  3X1V A;  1BH9 A;  3AZG D;  4LD9 C;  3AZF B;  1KX3 A;  3WTP D;  3LZ0 C;  4WU8 A; 
#chains in the Genus database with same CATH topology
 3MGP B;  4H9R A;  3B0D C;  5B32 D;  3WTP C;  5GT3 D;  3O62 D;  1JFI A;  1P3L A;  1EQZ A;  3UTA A;  5FUG B;  3B6G D;  3H0R C;  3A6N C;  5DNN B;  5B0Z A;  1S32 B;  2HIO B;  3KWQ C;  3MGR A;  5AV6 D;  4CSR B;  2HUE B;  4M6B A;  3B0B A;  5B31 A;  4J8W C;  3AZG B;  3AL0 C;  3WTP B;  4KGC C;  4ZUX C;  3WAA C;  1BFM A;  3AZF A;  4XZQ C;  5AY8 D;  5B32 B;  5GT3 B;  3O62 B;  3AV2 D;  3MGP A;  3EG5 B;  3KWQ B;  1M18 C;  3AZJ C;  1ZLA C;  5FUG A;  5AV6 B;  3B6F D;  3WAA B;  5DNN A;  4YS3 C;  1S32 A;  2HIO A;  1PZR A;  5JRG C;  3MGQ D;  4CSR A;  4H9O B;  3AZI C;  1P3A C;  2F8N D;  2ZY2 A;  3AZG A;  1ID3 C;  3WTP A;  3MGQ C;  2ZY3 A;  3V9R A;  5E5A C;  1M18 B;  1M1A C;  3AV2 B;  5GT0 C;  4J8V D;  1P3P C;  5B32 A;  5GT3 A;  3O62 A;  4CAY B;  5GXQ C;  3EPJ A;  4Z66 D;  4J8V C;  2JCH A;  3KWQ A;  1P3K D;  3B6G A;  5BO0 B;  4YM6 D;  3WKJ D;  3MVD D;  4JJN D;  3MGQ B;  5AV6 A;  3REJ D;  5KDM B;  3WAA A;  1W2E A;  1M1A B;  2NZD D;  3MVD C;  3VH5 W;  5GT0 B;  2F8N B;  3W99 D;  4H9O A;  1P34 D;  2RIQ A;  2Y2G A;  3UT9 D;  3REH D;  2LY8 A;  5B1M C;  4J8V B;  3VH6 W;  1M18 A;  2BYK B;  5DNM D;  5B24 C;  5CPJ D;  3AV2 A;  4J8U D;  3X1V C;  2YFW B;  2Y2N A;  4CAY A;  2IO5 C;  3MVD B;  4JJN B;  5BO0 A;  1M19 D;  5CHL B;  2NZD B;  5B1M B;  2Y2K A;  3MGQ A;  1P3O D;  1P3G C;  5KDM A;  3P5J B;  3AZH D;  5B24 B;  5CPK D;  1P3L C;  1M1A A;  1M19 C;  1EQZ C;  5GT0 A;  2F8N A;  1B67 A;  5B0Z C;  1P3O C;  1TAF B;  4NE3 A;  5DNM B;  3R45 B;  2RVQ D;  4J8V A;  5CP6 D;  3UTB D;  2Y2Q A;  5B31 C;  3A1K A;  2BYK A;  4KHA B;  1Q9C A;  5BNV B;  5G49 B;  2YFW A;  4Z66 A;  4WU9 D;  5B2I D;  1P3K A;  1A7W A;  1P3G B;  3AZM D;  3LZ1 D;  1EQZ B;  2PYO D;  1M19 B;  3MVD A;  4JJN A;  4X23 D;  5B2J C;  1P3O B;  3AZM C;  3AZH B;  3LZ1 C;  2NZD A;  5B1M A;  1HQ3 C;  2BYM B;  5B24 A;  1P34 A;  5DNN C;  1TAF A;  5CP6 B;  2HIO C;  2JSS A;  3X1U D;  3C1C D;  3REI D;  5DNM A;  1S32 C;  3KFU G;  2FJ7 D;  2HUE C;  3R45 A;  2W8S A;  4WZS B;  4E45 A;  5B2J B;  5B0Y D;  2G5H C;  3AZG C;  4KHA A;  1HTA A;  5B2I B;  5BNV A;  3AZM B;  3LZ1 B;  5G49 A;  2PYO B;  1HQ3 B;  4X23 B;  1P3G A;  3AZK D;  3TU4 D;  5B32 C;  1M19 A;  3MGS D;  5GT3 C;  3O62 C;  1R4V A;  4H9S A;  1P3O A;  3AZK C;  3AZH A;  3B6G C;  3AFA D;  2BYM A;  5AV5 D;  2Y2J A;  3C1C B;  3REI B;  4Z2M G;  5AV6 C;  2FJ7 B;  1KX4 D;  3V9R B;  5CP6 A;  3VH5 A;  5B0Y B;  4NE6 A;  3REK D;  3EPL A;  1KX4 C;  5B2J A;  4ZBJ B;  5B2I A;  3MNN D;  5AY8 C;  2G5I C;  3AZK B;  3AZM A;  3VH6 A;  3LZ1 A;  3FDD A;  2PYO A;  3B6G B;  1HQ3 A;  3C1B D;  3REK C;  4X23 A;  3AV2 C;  1P3B D;  4KUD D;  5B1L D;  5C3I C;  4H9N B;  4XUJ D;  3AFA B;  2Y2O A;  5AV5 B;  5B1L C;  3B6F C;  5F99 D;  1KX4 B;  4Z2M H;  2ARO D;  4J8X D;  3X1U A;  3C1C A;  3REI A;  2JE5 A;  5AY8 B;  2FJ7 A;  3REL D;  4G92 B;  4WV4 B;  3X1T D;  3REK B;  5B0Y A;  4J8X C;  5BNX B;  3MNN B;  5C3I B;  2F2A C;  3AZL D;  1AOI D;  2NQB D;  3AZK A;  1P3B B;  4KUD B;  5B1L B;  3B6F B;  5AVB D;  3AYW D;  4Z66 C;  4H9N A;  5GSU D;  3X1S D;  1P3K C;  2CWE A;  4YM6 C;  4R8P D;  3NQU B;  3AFA A;  3VH5 T;  3WKJ C;  4JJN C;  5AV5 A;  2ARO B;  4J8X B;  1TZY D;  5BT1 D;  4NFT A;  1ULY A;  3REJ C;  3REL B;  1KX4 A;  3AZE D;  2NZD C;  5AY8 A;  3VH6 T;  3W99 C;  3IP4 C;  5B33 D;  1AOI B;  1P34 C;  3REK A;  3UT9 C;  3REH C;  5BNX A;  3MNN A;  4Z66 B;  1P3I D;  1P3K B;  5B33 C;  5DNM C;  4E44 A;  4YM6 B;  3AV1 D;  5CPJ C;  3WKJ B;  1P3B A;  4KUD A;  5AVB B;  4J8U C;  5B1L A;  4AWL B;  2XD5 A;  3REJ B;  3B6F A;  2Y2M A;  4R8P B;  1P3F D;  1TZY B;  3W99 B;  2BG1 A;  3W97 D;  3NQU A;  1Z2C B;  3UT9 B;  1P34 B;  5F99 A;  3REH B;  2ARO A;  4J8X A;  3AZE B;  4H9S C;  5B40 D;  1KX3 D;  3W98 D;  3REL A;  5B33 B;  4Z5T D;  3AZH C;  4WU8 D;  5CPK C;  3X1T A;  2F8N H;  5CPJ B;  4J8U B;  4HGA B;  1AOI A;  3KXB D;  2RVQ C;  3EPH A;  1F66 D;  5CP6 C;  3WA9 D;  3UTB C;  2VQR A;  3KUY D;  4YM6 A;  3LJA D;  3WTP E;  3WKJ A;  5AVB A;  1P3F B;  3LEL D;  3F6T A;  4QLC D;  4WU9 C;  5B2I C;  3REJ A;  3KUY C;  3W96 D;  4R8P A;  3W97 B;  5CPK B;  2PYO C;  2L5A A;  1TZY A;  4X23 C;  3W99 A;  5AV8 D;  2CV5 D;  3LEL C;  4DRA A;  5B40 B;  3W98 B;  3UT9 A;  3REH A;  4Z5T B;  3AZE A;  5AV9 D;  3AZF D;  1F1E A;  3UTB B;  5B33 A;  5B31 G;  2Y2H A;  5CPJ A;  4EO5 B;  3KXB B;  4J8U A;  3MGP D;  5AVC D;  3AZN D;  1F66 B;  4WU9 B;  2FFF B;  3X1U C;  3C1C C;  3REI C;  3KUY B;  1KX5 D;  3LJA B;  2FJ7 C;  4DRB A;  5BS7 A;  5AVC C;  5B0Y C;  3LEL B;  3AZN C;  4QLC B;  3W96 B;  1KX5 C;  1U35 D;  1P3F A;  4ZBJ C;  4LD9 D;  3LZ0 D;  1B6W A;  5AV8 B;  2CV5 B;  3TU4 C;  3W97 A;  5CPK A;  3B0C W;  3MGS C;  5CPI D;  5AV9 B;  5B40 A;  3W98 A;  3X1U B;  4Z5T A;  2F8N K;  4G91 C;  5CPI C;  4DQY B;  1KU5 A;  3AFA C;  3UTB A;  5AVC B;  5AV5 C;  3AZN B;  2DQN C;  4NE5 A;  1KX5 B;  3KXB A;  3A6N D;  1F66 A;  3WA9 A;  3KWQ D;  4WU9 A;  3KUY A;  3TU4 B;  3LJA A;  4G92 C;  5B32 G;  1T3U A;  1U35 B;  3MGS B;  4J8W D;  3LEL A;  4LD9 B;  4WJ3 C;  4QLC A;  2DF4 C;  2ZY5 A;  3AN2 D;  3W96 A;  4ZUX D;  3MNN C;  3LZ0 B;  4KGC D;  3WAA D;  4G91 B;  5CPI B;  3C1B C;  4XZQ D;  5AV8 A;  2CV5 A;  1P3B C;  4KUD C;  3AN2 C;  3B0D B;  4XUJ C;  1N1J B;  5AV9 A;  3KSY A;  1M18 D;  3A6N B;  3AZJ D;  5F99 C;  1ZLA D;  5AVC A;  1WWI A;  2ARO C;  3AZN A;  1KX5 A;  1H3O B;  3REL C;  4YS3 D;  3C1B B;  4J8W B;  5JRG D;  3X1T C;  3TU4 A;  3AN2 B;  4KGC B;  4ZUX B;  3AZL C;  1U35 A;  3MGS A;  1AOI C;  4XUJ B;  3AZI D;  4UUZ B;  1P3A D;  1ID3 D;  4LD9 A;  2Y2I A;  4XZQ B;  3LZ0 A;  2NQB C;  5E5A D;  1M1A D;  5CPI A;  4H9P B;  5GT0 D;  5F99 B;  5AVB C;  5JA4 B;  3AYW C;  1P3P D;  4AWL C;  5GSU C;  1N1J A;  3X1S C;  5GXQ D;  4R8P C;  3X1T B;  3AZJ B;  2XD1 A;  1ZLA B;  1BH8 B;  1TZY C;  5BT1 C;  2F8N G;  3AZL B;  2ZM5 A;  3A6N A;  4YS3 B;  3EPK A;  3AZE C;  5JRG B;  2Y2P A;  2NQB B;  1H3O A;  1P3M D;  3C1B A;  4J8W A;  3AZI B;  1P3A B;  1ID3 B;  3AYW B;  3AN2 A;  4KGC A;  4ZUX A;  4HGA C;  5GSU B;  4XUJ A;  1P3I C;  5E5A B;  3X1S B;  4UUZ A;  4WNN B;  1P3M C;  5B1M D;  4XZQ A;  3AV1 C;  1P3P B;  5BS7 C;  5B24 D;  4H9P A;  5GXQ B;  5JA4 A;  3X1V D;  3NQJ B;  3H0L C;  1P3F C;  3W97 C;  3AZJ A;  1ZLA A;  4H9Q B;  1BH8 A;  3AZL A;  5B40 C;  1KX3 C;  3W98 C;  1P3I B;  1WWS A;  4YS3 A;  2Y2L A;  4Z5T C;  4WU8 C;  1P3M B;  5JRG A;  3AV1 B;  2NQB A;  1P3G D;  1P3L D;  1EQZ D;  3UTA D;  3AZI A;  2J8P A;  1P3A A;  1ID3 A;  4EO5 C;  3A1I A;  3KXB C;  3AYW A;  5B0Z D;  5GSU A;  1F66 C;  3WA9 C;  5E5A A;  3X1S A;  3MGR D;  4WNN A;  3UTA C;  2YFV B;  3LJA C;  3X1V B;  1P3P A;  5B31 D;  3H0M C;  1BH9 B;  4QLC C;  1KX3 B;  3MGR C;  3W96 C;  5GXQ A;  4WU8 B;  2IO5 B;  3NQJ A;  5AV8 C;  2CV5 C;  4H9R B;  4H9Q A;  5B2J D;  5AV9 C;  1JFI B;  3AZF C;  1P3I A;  3WA9 B;  1P3L B;  1P3M A;  3UTA B;  3AV1 A;  1HQ3 D;  5B0Z B;  3MGP C;  3MGR B;  5DNN D;  1S32 D;  2HIO D;  5B31 B;  2YFV A;  2UWX A;  3B0C T;  1U35 C;  3X1V A;  4UPK A;  1BH9 A;  3AZG D;  4LD9 C;  3AZF B;  1KX3 A;  3WTP D;  3LZ0 C;  4WU8 A;  2ZY4 A; 
#chains in the Genus database with same CATH homology
 3MGP B;  4H9R A;  3B0D C;  5B32 D;  3WTP C;  5GT3 D;  3O62 D;  1JFI A;  1P3L A;  1EQZ A;  3UTA A;  5FUG B;  3B6G D;  3H0R C;  3A6N C;  5DNN B;  5B0Z A;  1S32 B;  2HIO B;  3KWQ C;  3MGR A;  5AV6 D;  4CSR B;  2HUE B;  4M6B A;  3B0B A;  5B31 A;  4J8W C;  3AZG B;  3AL0 C;  3WTP B;  4KGC C;  4ZUX C;  3WAA C;  1BFM A;  3AZF A;  4XZQ C;  5AY8 D;  5B32 B;  5GT3 B;  3O62 B;  3AV2 D;  3MGP A;  3EG5 B;  3KWQ B;  1M18 C;  3AZJ C;  1ZLA C;  5FUG A;  5AV6 B;  3B6F D;  3WAA B;  5DNN A;  4YS3 C;  1S32 A;  2HIO A;  1PZR A;  5JRG C;  3MGQ D;  4CSR A;  4H9O B;  3AZI C;  1P3A C;  2F8N D;  2ZY2 A;  3AZG A;  1ID3 C;  3WTP A;  3MGQ C;  2ZY3 A;  3V9R A;  5E5A C;  1M18 B;  1M1A C;  3AV2 B;  5GT0 C;  4J8V D;  1P3P C;  5B32 A;  5GT3 A;  3O62 A;  4CAY B;  5GXQ C;  3EPJ A;  4Z66 D;  4J8V C;  2JCH A;  3KWQ A;  1P3K D;  3B6G A;  5BO0 B;  4YM6 D;  3WKJ D;  3MVD D;  4JJN D;  3MGQ B;  5AV6 A;  3REJ D;  5KDM B;  3WAA A;  1W2E A;  1M1A B;  2NZD D;  3MVD C;  3VH5 W;  5GT0 B;  2F8N B;  3W99 D;  4H9O A;  1P34 D;  2RIQ A;  2Y2G A;  3UT9 D;  3REH D;  2LY8 A;  5B1M C;  4J8V B;  3VH6 W;  1M18 A;  2BYK B;  5DNM D;  5B24 C;  5CPJ D;  3AV2 A;  4J8U D;  3X1V C;  2YFW B;  2Y2N A;  4CAY A;  2IO5 C;  3MVD B;  4JJN B;  5BO0 A;  1M19 D;  5CHL B;  2NZD B;  5B1M B;  2Y2K A;  3MGQ A;  1P3O D;  1P3G C;  5KDM A;  3P5J B;  3AZH D;  5B24 B;  5CPK D;  1P3L C;  1M1A A;  1M19 C;  1EQZ C;  5GT0 A;  2F8N A;  1B67 A;  5B0Z C;  1P3O C;  1TAF B;  4NE3 A;  5DNM B;  3R45 B;  2RVQ D;  4J8V A;  5CP6 D;  3UTB D;  2Y2Q A;  5B31 C;  3A1K A;  2BYK A;  4KHA B;  1Q9C A;  5BNV B;  5G49 B;  2YFW A;  4Z66 A;  4WU9 D;  5B2I D;  1P3K A;  1A7W A;  1P3G B;  3AZM D;  3LZ1 D;  1EQZ B;  2PYO D;  1M19 B;  3MVD A;  4JJN A;  4X23 D;  5B2J C;  1P3O B;  3AZM C;  3AZH B;  3LZ1 C;  2NZD A;  5B1M A;  1HQ3 C;  2BYM B;  5B24 A;  1P34 A;  5DNN C;  1TAF A;  5CP6 B;  2HIO C;  2JSS A;  3X1U D;  3C1C D;  3REI D;  5DNM A;  1S32 C;  3KFU G;  2FJ7 D;  2HUE C;  3R45 A;  2W8S A;  4WZS B;  4E45 A;  5B2J B;  5B0Y D;  2G5H C;  3AZG C;  4KHA A;  1HTA A;  5B2I B;  5BNV A;  3AZM B;  3LZ1 B;  5G49 A;  2PYO B;  1HQ3 B;  4X23 B;  1P3G A;  3AZK D;  3TU4 D;  5B32 C;  1M19 A;  3MGS D;  5GT3 C;  3O62 C;  1R4V A;  4H9S A;  1P3O A;  3AZK C;  3AZH A;  3B6G C;  3AFA D;  2BYM A;  5AV5 D;  2Y2J A;  3C1C B;  3REI B;  4Z2M G;  5AV6 C;  2FJ7 B;  1KX4 D;  3V9R B;  5CP6 A;  3VH5 A;  5B0Y B;  4NE6 A;  3REK D;  3EPL A;  1KX4 C;  5B2J A;  4ZBJ B;  5B2I A;  3MNN D;  5AY8 C;  2G5I C;  3AZK B;  3AZM A;  3VH6 A;  3LZ1 A;  3FDD A;  2PYO A;  3B6G B;  1HQ3 A;  3C1B D;  3REK C;  4X23 A;  3AV2 C;  1P3B D;  4KUD D;  5B1L D;  5C3I C;  4H9N B;  4XUJ D;  3AFA B;  2Y2O A;  5AV5 B;  5B1L C;  3B6F C;  5F99 D;  1KX4 B;  4Z2M H;  2ARO D;  4J8X D;  3X1U A;  3C1C A;  3REI A;  2JE5 A;  5AY8 B;  2FJ7 A;  3REL D;  4G92 B;  4WV4 B;  3X1T D;  3REK B;  5B0Y A;  4J8X C;  5BNX B;  3MNN B;  5C3I B;  2F2A C;  3AZL D;  1AOI D;  2NQB D;  3AZK A;  1P3B B;  4KUD B;  5B1L B;  3B6F B;  5AVB D;  3AYW D;  4Z66 C;  4H9N A;  5GSU D;  3X1S D;  1P3K C;  2CWE A;  4YM6 C;  4R8P D;  3NQU B;  3AFA A;  3VH5 T;  3WKJ C;  4JJN C;  5AV5 A;  2ARO B;  4J8X B;  1TZY D;  5BT1 D;  4NFT A;  1ULY A;  3REJ C;  3REL B;  1KX4 A;  3AZE D;  2NZD C;  5AY8 A;  3VH6 T;  3W99 C;  3IP4 C;  5B33 D;  1AOI B;  1P34 C;  3REK A;  3UT9 C;  3REH C;  5BNX A;  3MNN A;  4Z66 B;  1P3I D;  1P3K B;  5B33 C;  5DNM C;  4E44 A;  4YM6 B;  3AV1 D;  5CPJ C;  3WKJ B;  1P3B A;  4KUD A;  5AVB B;  4J8U C;  5B1L A;  4AWL B;  2XD5 A;  3REJ B;  3B6F A;  2Y2M A;  4R8P B;  1P3F D;  1TZY B;  3W99 B;  2BG1 A;  3W97 D;  3NQU A;  1Z2C B;  3UT9 B;  1P34 B;  5F99 A;  3REH B;  2ARO A;  4J8X A;  3AZE B;  4H9S C;  5B40 D;  1KX3 D;  3W98 D;  3REL A;  5B33 B;  4Z5T D;  3AZH C;  4WU8 D;  5CPK C;  3X1T A;  2F8N H;  5CPJ B;  4J8U B;  4HGA B;  1AOI A;  3KXB D;  2RVQ C;  3EPH A;  1F66 D;  5CP6 C;  3WA9 D;  3UTB C;  2VQR A;  3KUY D;  4YM6 A;  3LJA D;  3WTP E;  3WKJ A;  5AVB A;  1P3F B;  3LEL D;  3F6T A;  4QLC D;  4WU9 C;  5B2I C;  3REJ A;  3KUY C;  3W96 D;  4R8P A;  3W97 B;  5CPK B;  2PYO C;  2L5A A;  1TZY A;  4X23 C;  3W99 A;  5AV8 D;  2CV5 D;  3LEL C;  4DRA A;  5B40 B;  3W98 B;  3UT9 A;  3REH A;  4Z5T B;  3AZE A;  5AV9 D;  3AZF D;  1F1E A;  3UTB B;  5B33 A;  5B31 G;  2Y2H A;  5CPJ A;  4EO5 B;  3KXB B;  4J8U A;  3MGP D;  5AVC D;  3AZN D;  1F66 B;  4WU9 B;  2FFF B;  3X1U C;  3C1C C;  3REI C;  3KUY B;  1KX5 D;  3LJA B;  2FJ7 C;  4DRB A;  5BS7 A;  5AVC C;  5B0Y C;  3LEL B;  3AZN C;  4QLC B;  3W96 B;  1KX5 C;  1U35 D;  1P3F A;  4ZBJ C;  4LD9 D;  3LZ0 D;  1B6W A;  5AV8 B;  2CV5 B;  3TU4 C;  3W97 A;  5CPK A;  3B0C W;  3MGS C;  5CPI D;  5AV9 B;  5B40 A;  3W98 A;  3X1U B;  4Z5T A;  2F8N K;  4G91 C;  5CPI C;  4DQY B;  1KU5 A;  3AFA C;  3UTB A;  5AVC B;  5AV5 C;  3AZN B;  2DQN C;  4NE5 A;  1KX5 B;  3KXB A;  3A6N D;  1F66 A;  3WA9 A;  3KWQ D;  4WU9 A;  3KUY A;  3TU4 B;  3LJA A;  4G92 C;  5B32 G;  1T3U A;  1U35 B;  3MGS B;  4J8W D;  3LEL A;  4LD9 B;  4WJ3 C;  4QLC A;  2DF4 C;  2ZY5 A;  3AN2 D;  3W96 A;  4ZUX D;  3MNN C;  3LZ0 B;  4KGC D;  3WAA D;  4G91 B;  5CPI B;  3C1B C;  4XZQ D;  5AV8 A;  2CV5 A;  1P3B C;  4KUD C;  3AN2 C;  3B0D B;  4XUJ C;  1N1J B;  5AV9 A;  3KSY A;  1M18 D;  3A6N B;  3AZJ D;  5F99 C;  1ZLA D;  5AVC A;  1WWI A;  2ARO C;  3AZN A;  1KX5 A;  1H3O B;  3REL C;  4YS3 D;  3C1B B;  4J8W B;  5JRG D;  3X1T C;  3TU4 A;  3AN2 B;  4KGC B;  4ZUX B;  3AZL C;  1U35 A;  3MGS A;  1AOI C;  4XUJ B;  3AZI D;  4UUZ B;  1P3A D;  1ID3 D;  4LD9 A;  2Y2I A;  4XZQ B;  3LZ0 A;  2NQB C;  5E5A D;  1M1A D;  5CPI A;  4H9P B;  5GT0 D;  5F99 B;  5AVB C;  5JA4 B;  3AYW C;  1P3P D;  4AWL C;  5GSU C;  1N1J A;  3X1S C;  5GXQ D;  4R8P C;  3X1T B;  3AZJ B;  2XD1 A;  1ZLA B;  1BH8 B;  1TZY C;  5BT1 C;  2F8N G;  3AZL B;  2ZM5 A;  3A6N A;  4YS3 B;  3EPK A;  3AZE C;  5JRG B;  2Y2P A;  2NQB B;  1H3O A;  1P3M D;  3C1B A;  4J8W A;  3AZI B;  1P3A B;  1ID3 B;  3AYW B;  3AN2 A;  4KGC A;  4ZUX A;  4HGA C;  5GSU B;  4XUJ A;  1P3I C;  5E5A B;  3X1S B;  4UUZ A;  4WNN B;  1P3M C;  5B1M D;  4XZQ A;  3AV1 C;  1P3P B;  5BS7 C;  5B24 D;  4H9P A;  5GXQ B;  5JA4 A;  3X1V D;  3NQJ B;  3H0L C;  1P3F C;  3W97 C;  3AZJ A;  1ZLA A;  4H9Q B;  1BH8 A;  3AZL A;  5B40 C;  1KX3 C;  3W98 C;  1P3I B;  1WWS A;  4YS3 A;  2Y2L A;  4Z5T C;  4WU8 C;  1P3M B;  5JRG A;  3AV1 B;  2NQB A;  1P3G D;  1P3L D;  1EQZ D;  3UTA D;  3AZI A;  2J8P A;  1P3A A;  1ID3 A;  4EO5 C;  3A1I A;  3KXB C;  3AYW A;  5B0Z D;  5GSU A;  1F66 C;  3WA9 C;  5E5A A;  3X1S A;  3MGR D;  4WNN A;  3UTA C;  2YFV B;  3LJA C;  3X1V B;  1P3P A;  5B31 D;  3H0M C;  1BH9 B;  4QLC C;  1KX3 B;  3MGR C;  3W96 C;  5GXQ A;  4WU8 B;  2IO5 B;  3NQJ A;  5AV8 C;  2CV5 C;  4H9R B;  4H9Q A;  5B2J D;  5AV9 C;  1JFI B;  3AZF C;  1P3I A;  3WA9 B;  1P3L B;  1P3M A;  3UTA B;  3AV1 A;  1HQ3 D;  5B0Z B;  3MGP C;  3MGR B;  5DNN D;  1S32 D;  2HIO D;  5B31 B;  2YFV A;  2UWX A;  3B0C T;  1U35 C;  3X1V A;  4UPK A;  1BH9 A;  3AZG D;  4LD9 C;  3AZF B;  1KX3 A;  3WTP D;  3LZ0 C;  4WU8 A;  2ZY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...