1U35D

Crystal structure of the nucleosome core particle containing the histone domain of macroh2a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
93
structure length
93
Chain Sequence
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-satellite DNA
publication title Structural characterization of the histone variant macroH2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 37
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1u35D00
5B33A 3AZFB 1P3KC 1M1AB 1WWSA 5B0YC 3W97B 5GXQD 4KGCA 3VH5A 5B24C 4J8WA 5FUGB 1P3PA 4ZUXC 2YFVB 5AVBB 5B0YA 3AZIB 1BFMA 3AFAB 1BH9B 4J8XD 5B24A 5GSUC 5DNNC 4Z5TB 1P3LD 4ZUXA 4EO5C 4YS3C 3MGPC 3REKC 2AROD 3MNNC 2CV5D 5GSUA 5DNNA 3B6GC 2NZDC 1HQ3B 2BYKA 5B2IB 4ZBJC 2NZDA 5B1LA 2FJ7B 1P3MC 3O62D 3X1TA 4KHAB 3B0DB 5KDMA 2PYOA 4DRBA 4J8UC 1B6WA 3C1CC 1M19B 1F66D 2IO5B 1U35A 5AV8D 5BNVA 4G92C 1P3GC 5GT3B 3V9RB 1ULYA 3WTPD 5BS7C 3X1UD 5C3IB 3MVDC 3AZEB 1S32D 3KUYA 5B31B 1P3GA 5CPIC 3TU4C 3AZLA 4UUZB 3UT9B 3REHA 3B0BA 5BS7A 5B1MD 5BO0A 3RELD 3AYWA 2HUEB 3UTAC 3W99A 4J8VC 5AV6D 4WU9D 4YM6C 3KWQD 4R8PA 4JJNA 5B31G 5AVCC 3X1VC 2F8NB 3AZFA 4XUJC 4YM6A 3AV1B 4WNNB 3MGQB 2BYMA 5B33D 2NQBC 5FUGA 5GXQC 5AVBA 3AZIA 1P3OB 3AFAA 4KGCD 4E44A 2NQBA 2JSSA 3AZMC 4Z5TA 5AV9B 4J8WD 1P3PD 3WKJB 2F8NG 5B0YD 3AZGB 5CHLB 4J8XC 5B24D 3UTBB 4NE3A 3AZMA 1HQ3A 4ZUXD 5B2IA 4KUDB 5GSUD 5DNND 5AV5B 4Z2MG 5BNXB 5GT0C 1KX5B 4H9RB 1B67A 2NZDD 1A7WA 5B2JB 5B1LD 5GT0A 4QLCB 2F8NH 1P3BB 3LJAB 4KHAA 3X1TD 1M19A 4Z66B 2PYOD 5GT3A 1F66C 4Z2MH 5AV8C 1U35D 3REID 5B31A 2HIOB 3UT9A 3WTPC 5CP6B 3X1UC 1S32C 3KUYD 1P3GD 3AZLD 5JRGC 3NQJA 3WTPA 3REHD 3W96B 3KXBA 5F99B 4LD9B 5B1MC 1EQZB 5JRGA 3AYWD 5B32B 3MGSB 2F8NA 3W99D 5AV6C 4WU9C 4R8PD 4XZQC 4JJND 3AV1A 4WU8B 1HTAA 3C1BB 3AZFD 3WAAB 3W98B 5G49B 3R45B 1BH8B 4YM6D 3X1SB 3AV2B 4XZQA 5B33C 3B6FB 1TAFA 3B0CT 5B32G 3AZKB 3WKJA 5AVBD 3AZID 5B0ZC 4WZSB 3AZGA 1TZYB 3AFAD 4KGCC 1AOIB 4G91C 2NQBD 3UTBA 4J8WC 4Z5TD 1P3PC 3LZ1B 4H9SC 5B0ZA 4H9OB 3B0CW 4KUDA 4CSRB 4HGAC 3MGRB 3REJB 5AV5A 3AZMD 4H9NB 1JFIB 1HQ3D 4H9SA 5B2ID 1KX5A 5B2JA 1KX3B 1P34B 1P3BA 3LJAA 2FJ7D 4X23B 5B1LC 5GT0D 1WWIA 5B40B 1P3FB 1ZLAB 4Z66A 3X1TC 1M19D 3AZNB 5E5AC 2PYOC 3LELB 5GT3D 2HIOA 1U35C 5CP6A 3NQUB 3REIC 4AWLC 5E5AA 5B31D 3AZHB 5CPKB 3UT9D 3KUYC 3REIA 5F99A 3AZLC 4LD9A 3REHC 5JA4A 3WTPE 3KXBD 3MGSA 1P3LB 5JRGD 3AYWC 3VH6T 2AROB 3AZJB 3AN2B 4WU8A 2CV5B 2F8ND 3C1BA 3W99C 3WAAA 3W98A 5G49A 1P3AB 1BH8A 4R8PC 3X1SA 4JJNC 3AV2A 3AV1D 2L5AA 3AZFC 1M1AC 3VH6W 3B6FA 5CPJB 4JJNB 2CWEA 3AZKA 3W97C 1P3OD 4XZQD 1TZYA 4DRAA 3WA9B 1AOIA 1F1EA 1M1AA 5AVBC 3AZIC 3W97A 3LZ1A 3A6NB 3WKJD 3O62B 3AFAC 3AZGD 4H9OA 4CSRA 3MGRA 4Z5TC 3REJA 3UTBD 1N1JB 1JFIA 2YFVA 5B0ZD 4KUDD 1BH9A 1P3IB 5AV5D 4WV4B 1HQ3C 1M18B 5B2IC 1KX5D 1P34A 5B2JD 4X23A 4QLCD 2FJ7C 5AY8B 1P3BD 3LJAD 5B40A 3LZ0B 1P3FA 3RELB 1ID3B 1KX4B 2FJ7A 3B0DC 3AZNA 3KWQB 4Z66D 1M19C 2IO5C 3NQUA 2F8NK 3AZHA 5GT3C 5DNMB 5CPKA 2HIOD 4NE6A 5CP6D 3AZEC 5C3IC 4H9PB 5B31C 5E5AD 3UT9C 3V9RA 3AZEA 1P3KB 5B0YB 5F99D 4UUZA 4LD9D 1EQZD 2HUEC 5B24B 3AZJA 3KXBC 3AN2A 3MGSD 4ZUXB 1P3AA 5GSUB 5DNNB 4WU8D 3C1BD 3WAAD 1KU5A 5CPJA 4EO5B 3W98D 3MGPB 4YS3B 3X1SD 3MGQC 3REKB 3AV1C 3AV2D 3MNNB 2NZDB 3WA9A 3B6GB 3VH6A 3B6FD 3AZKD 1P3OC 3A6NA 4ZBJB 4WNNA 3MGQA 5BT1D 1TZYD 1AOID 1M1AD 5AV9C 1N1JA 3WKJC 2LY8A 1P3OA 3W97D 3LZ1D 3AZGC 3UTBC 3MGRD 3REJD 1P3IA 1P3MB 5KDMB 1R4VA 5AV9A 1M18A 4KUDC 5AV5C 2RVQC 4J8UB 1KX5C 3C1CB 3KSYA 5AY8A 1P34D 4G92B 5B2JC 1P3GB 4X23D 5BNXA 3LZ0A 4H9RA 4QLCC 1ID3A 3MVDB 1P3BC 3LJAC 1KX4A 5B40D 5CPIB 3TU4B 1P3FD 5BO0B 4QLCA 3AZND 4Z66C 5DNMA 3UTAB 4H9PA 2YFWB 4J8VB 4YM6B 3AZHD 2HIOC 2BYMB 5AVCB 3X1VB 5CP6C 5CPKD 1P3KA 4XUJB 3W96C 3AZED 2NQBB 5F99C 4H9QB 5GXQB 4LD9C 1EQZC 5B32C 3AZJD 3W96A 3MGSC 3AZMB 3AN2D 4CAYB 1P3AD 1EQZA 3MGPA 4J8XB 4YS3A 3REKA 4NE5A 5B32A 3MNNA 4WU8C 3C1BC 3B6GA 3WAAC 3W98C 5CPJD 3X1SC 3AV2C 3WA9D 3B6FC 3AZKC 3R45A 5GT0B 3A6ND 5BT1C 1TZYC 3MGQD 1AOIC 1P3MA 3LZ1C 3MGRC 3REJC 1P3ID 5AV9D 1M18D 4J8UA 3C1CA 4H9NA 1KX3C 1F66B 5AV8B 1P34C 3MVDA 5AY8D 4X23C 5CPIA 3TU4A 3LZ0D 3NQJB 2RVQD 3WTPB 1KX3A 3X1UB 1S32B 3KXBB 1ID3D 1KX4D 1H3OB 5B40C 1P3FC 1ZLAC 5JRGB 3UTAA 3AZNC 2YFWA 4J8VA 5B1MB 4M6BA 1ZLAA 3LELC 5DNMD 3X1VA 5AVCA 5AV6B 4XUJA 4WU9B 3VH5T 3AZHC 4XZQB 3LELA 5CPKC 1TAFB 1P3KD 4H9QA 5GXQA 3VH5W 5B33B 1P3LC 4CAYA 5B0ZB 4KGCB 4J8XA 2AROC 4G91B 3AZJC 3AN2C 2CV5C 3W96D 4J8WB 1P3PB 1P3LA 1P3AC 4YS3D 3MGPD 3REKD 2AROA 5B32D 4HGAB 3MNND 2CV5A 3B6GD 5CPJC 3WA9C 2BYKB 3A6NC 3O62C 1P3MD 5B1LB 3O62A 1P3IC 4E45A 1M18C 3X1TB 4J8UD 1F66A 3C1CD 5AV8A 5E5AB 2PYOB 1U35B 3X1UA 1S32A 5BNVB 5AY8C 3MVDD 4AWLB 3REIB 1H3OA 3LZ0C 3TU4D 5CPID 3RELC 4NFTA 5JA4B 1KX3D 1ID3C 1KX4C 3KUYB 3AZLB 3KWQC 5B1MA 3REHB 3RELA 3UTAD 5AV6A 4WU9A 1Q9CA 4J8VD 3KWQA 1ZLAD 5DNMC 3AYWB 3X1VD 5AVCD 3W99B 4XUJD 4R8PB 3LELD
chains in the Genus database with same CATH superfamily
5B33A 3AZFB 1P3KC 1M1AB 1WWSA 5B0YC 3W97B 5GXQD 4KGCA 3VH5A 5B24C 2JE5A 4J8WA 5FUGB 1P3PA 4ZUXC 2YFVB 5AVBB 5B0YA 3AZIB 1BFMA 3AFAB 1BH9B 4J8XD 3EPLA 5B24A 5GSUC 5DNNC 4Z5TB 1P3LD 4ZUXA 4EO5C 4YS3C 3MGPC 3REKC 2AROD 3MNNC 2CV5D 5GSUA 5DNNA 3B6GC 2NZDC 1HQ3B 2BYKA 5B2IB 4ZBJC 2NZDA 5B1LA 2JCHA 2FJ7B 1P3MC 4WJ3C 3O62D 3X1TA 4KHAB 3B0DB 5KDMA 2PYOA 4DRBA 4J8UC 1B6WA 3C1CC 1M19B 1F66D 2IO5B 1U35A 5AV8D 5BNVA 4G92C 1P3GC 5GT3B 3V9RB 1ULYA 3WTPD 5BS7C 3X1UD 5C3IB 3MVDC 3AZEB 1S32D 3KUYA 5B31B 1P3GA 2RIQA 5CPIC 3TU4C 3AZLA 4UUZB 3UT9B 3REHA 3B0BA 5BS7A 2Y2MA 5B1MD 5BO0A 3RELD 3AYWA 2HUEB 3UTAC 3W99A 4J8VC 5AV6D 4WU9D 4YM6C 3KWQD 4R8PA 4JJNA 5B31G 5AVCC 3X1VC 2F8NB 3AZFA 4XUJC 2Y2HA 4YM6A 2Y2QA 3AV1B 4WNNB 3MGQB 2BYMA 2VQRA 5B33D 2NQBC 2W8SA 5FUGA 5GXQC 5AVBA 3AZIA 1P3OB 3AFAA 4KGCD 4E44A 2NQBA 2JSSA 3AZMC 4Z5TA 5AV9B 4J8WD 1P3PD 3WKJB 2F8NG 5B0YD 3AZGB 5CHLB 4J8XC 5B24D 3UTBB 4NE3A 3AZMA 1HQ3A 4ZUXD 5B2IA 4KUDB 5GSUD 5DNND 5AV5B 1Z2CB 4Z2MG 5BNXB 5GT0C 1KX5B 4H9RB 1B67A 2NZDD 1A7WA 5B2JB 2UWXA 5B1LD 5GT0A 4QLCB 2F8NH 1P3BB 3LJAB 4KHAA 2ZY2A 3X1TD 1M19A 4Z66B 2PYOD 5GT3A 1F66C 4Z2MH 5AV8C 1U35D 3REID 5B31A 2HIOB 3UT9A 3WTPC 5CP6B 3X1UC 1S32C 3KUYD 1P3GD 3AZLD 5JRGC 3NQJA 3WTPA 3REHD 3W96B 3KXBA 4DQYB 5F99B 4LD9B 5B1MC 1EQZB 2F2AC 5JRGA 3AYWD 5B32B 3MGSB 2F8NA 3W99D 5AV6C 4WU9C 2ZY5A 4R8PD 4XZQC 4JJND 3AV1A 4WU8B 1HTAA 3C1BB 3AZFD 3WAAB 3W98B 5G49B 3R45B 1BH8B 4YM6D 3X1SB 3AV2B 4XZQA 5B33C 3B6FB 1TAFA 3B0CT 5B32G 3AZKB 3WKJA 5AVBD 3AZID 5B0ZC 4WZSB 3AZGA 1TZYB 3AFAD 4KGCC 1AOIB 4G91C 2NQBD 3UTBA 4J8WC 4Z5TD 1P3PC 3LZ1B 4H9SC 5B0ZA 4H9OB 3B0CW 4KUDA 4CSRB 4HGAC 3MGRB 3REJB 5AV5A 3AZMD 4H9NB 1JFIB 1HQ3D 4H9SA 5B2ID 2BG1A 1KX5A 5B2JA 1KX3B 1P34B 1P3BA 3LJAA 2FJ7D 4X23B 5B1LC 2XD1A 5GT0D 1WWIA 5B40B 1P3FB 1ZLAB 4Z66A 3X1TC 1M19D 2Y2NA 2Y2OA 3AZNB 4UPKA 2J8PA 5E5AC 2PYOC 3LELB 5GT3D 2HIOA 1U35C 2ZY4A 3NQUB 5CP6A 3REIC 4AWLC 5E5AA 5B31D 3AZHB 5CPKB 3UT9D 3KUYC 3REIA 5F99A 3AZLC 4LD9A 3REHC 5JA4A 3WTPE 3KXBD 3MGSA 1P3LB 5JRGD 3AYWC 3VH6T 2AROB 3AZJB 3AN2B 4WU8A 2CV5B 2F8ND 3C1BA 3W99C 3WAAA 3W98A 5G49A 1P3AB 1BH8A 4R8PC 3X1SA 4JJNC 3AV2A 3AV1D 2L5AA 3AZFC 1M1AC 3VH6W 3B6FA 5CPJB 4JJNB 2CWEA 3AZKA 3W97C 1P3OD 4XZQD 1TZYA 4DRAA 3WA9B 1AOIA 1F1EA 1M1AA 2DF4C 5AVBC 3AZIC 3W97A 3LZ1A 3A6NB 3WKJD 3O62B 3AFAC 3AZGD 4H9OA 4CSRA 3MGRA 4Z5TC 3REJA 3UTBD 1N1JB 1JFIA 2YFVA 5B0ZD 4KUDD 1BH9A 1P3IB 5AV5D 4WV4B 1HQ3C 2Y2LA 1M18B 5B2IC 3FDDA 1KX5D 1P34A 5B2JD 4X23A 4QLCD 2FJ7C 5AY8B 1P3BD 3LJAD 5B40A 3LZ0B 1P3FA 3RELB 2Y2PA 1ID3B 1KX4B 2FJ7A 3B0DC 3AZNA 3KWQB 4Z66D 1M19C 2IO5C 3NQUA 1T3UA 2F8NK 3AZHA 5GT3C 5DNMB 5CPKA 2HIOD 4NE6A 3EPJA 5CP6D 3AZEC 5C3IC 4H9PB 5B31C 5E5AD 3UT9C 3V9RA 3AZEA 1P3KB 2Y2KA 3H0MC 5F99D 5B0YB 4UUZA 4LD9D 1EQZD 2HUEC 5B24B 3AZJA 3KXBC 3AN2A 3H0LC 3MGSD 1PZRA 2G5HC 4ZUXB 1P3AA 5GSUB 5DNNB 4WU8D 3C1BD 3WAAD 1KU5A 5CPJA 4EO5B 3W98D 3KFUG 3MGPB 4YS3B 3X1SD 3MGQC 3REKB 3AV1C 3AV2D 3MNNB 2NZDB 3WA9A 3B6GB 3VH6A 3B6FD 3AZKD 1P3OC 3A6NA 4ZBJB 4WNNA 3MGQA 5BT1D 1TZYD 1AOID 1M1AD 5AV9C 1N1JA 3WKJC 2LY8A 1P3OA 3W97D 3LZ1D 3A1KA 3AZGC 3UTBC 3MGRD 3REJD 1P3IA 1P3MB 5KDMB 1R4VA 5AV9A 1M18A 4KUDC 5AV5C 2RVQC 4J8UB 1KX5C 3C1CB 3KSYA 5AY8A 3IP4C 1P34D 4G92B 5B2JC 1P3GB 4X23D 5BNXA 3LZ0A 4H9RA 4QLCC 1ID3A 3MVDB 1P3BC 3LJAC 1KX4A 5B40D 5CPIB 3TU4B 1P3FD 5BO0B 4QLCA 3F6TA 3AZND 4Z66C 5DNMA 3UTAB 4H9PA 2G5IC 2YFWB 4J8VB 4YM6B 3AZHD 2HIOC 2BYMB 5AVCB 3X1VB 5CP6C 5CPKD 1P3KA 4XUJB 3W96C 3AZED 2NQBB 5F99C 4H9QB 5GXQB 4LD9C 1EQZC 5B32C 3AZJD 3W96A 3MGSC 3AZMB 3AN2D 4CAYB 1P3AD 1EQZA 3MGPA 4J8XB 4YS3A 3REKA 4NE5A 5B32A 3MNNA 4WU8C 3C1BC 2Y2JA 3B6GA 3WAAC 3W98C 5CPJD 3X1SC 3AV2C 3WA9D 3B6FC 3AZKC 3R45A 5GT0B 3A6ND 5BT1C 1TZYC 3MGQD 1AOIC 1P3MA 3LZ1C 2Y2GA 3MGRC 3REJC 1P3ID 5AV9D 1M18D 4J8UA 3C1CA 4H9NA 3EG5B 1KX3C 1F66B 2FFFB 5AV8B 1P34C 3MVDA 5AY8D 4X23C 5CPIA 3TU4A 3LZ0D 3NQJB 2RVQD 3WTPB 1KX3A 3X1UB 1S32B 3KXBB 1ID3D 1KX4D 1H3OB 5B40C 1P3FC 1ZLAC 5JRGB 3UTAA 3AZNC 2YFWA 4J8VA 5B1MB 4M6BA 1ZLAA 3LELC 5DNMD 3X1VA 5AVCA 5AV6B 4XUJA 4WU9B 3VH5T 3AZHC 4XZQB 3LELA 5CPKC 2ZM5A 1TAFB 1P3KD 3P5JB 4H9QA 5GXQA 3VH5W 5B33B 1P3LC 4CAYA 5B0ZB 4KGCB 4J8XA 2AROC 4G91B 3AZJC 3AN2C 2CV5C 3W96D 4J8WB 1P3PB 1P3LA 1P3AC 4YS3D 3MGPD 3REKD 2AROA 5B32D 4HGAB 3MNND 2CV5A 3B6GD 5CPJC 2DQNC 3WA9C 3EPKA 2BYKB 3A6NC 3O62C 2Y2IA 1P3MD 3EPHA 2XD5A 5B1LB 3O62A 1P3IC 4E45A 1M18C 3X1TB 4J8UD 1F66A 3C1CD 5AV8A 5E5AB 2PYOB 1U35B 3X1UA 1S32A 5BNVB 5AY8C 3MVDD 4AWLB 3REIB 1H3OA 3LZ0C 3TU4D 5CPID 3RELC 4NFTA 5JA4B 1KX3D 1ID3C 1KX4C 3KUYB 3AL0C 3AZLB 3KWQC 1W2EA 5B1MA 3REHB 3RELA 3UTAD 5AV6A 4WU9A 1Q9CA 4J8VD 3KWQA 1ZLAD 5DNMC 3AYWB 3X1VD 3H0RC 5AVCD 3W99B 3A1IA 4XUJD 4R8PB 2ZY3A 3LELD
chains in the Genus database with same CATH topology
5B33A 3AZFB 1P3KC 1M1AB 1WWSA 5B0YC 3W97B 5GXQD 4KGCA 3VH5A 5B24C 2JE5A 4J8WA 5FUGB 1P3PA 4ZUXC 2YFVB 5AVBB 5B0YA 3AZIB 1BFMA 3AFAB 1BH9B 4J8XD 3EPLA 5B24A 5GSUC 5DNNC 4Z5TB 1P3LD 4ZUXA 4EO5C 4YS3C 3MGPC 3REKC 2AROD 3MNNC 2CV5D 5GSUA 5DNNA 3B6GC 2NZDC 1HQ3B 2BYKA 5B2IB 4ZBJC 2NZDA 5B1LA 2JCHA 2FJ7B 1P3MC 4WJ3C 3O62D 3X1TA 4KHAB 3B0DB 5KDMA 2PYOA 4DRBA 4J8UC 1B6WA 3C1CC 1M19B 1F66D 2IO5B 1U35A 5AV8D 5BNVA 4G92C 1P3GC 5GT3B 3V9RB 1ULYA 3WTPD 5BS7C 3X1UD 5C3IB 3MVDC 3AZEB 1S32D 3KUYA 5B31B 1P3GA 2RIQA 5CPIC 3TU4C 3AZLA 4UUZB 3UT9B 3REHA 3B0BA 5BS7A 2Y2MA 5B1MD 5BO0A 3RELD 3AYWA 2HUEB 3UTAC 3W99A 4J8VC 5AV6D 4WU9D 4YM6C 3KWQD 4R8PA 4JJNA 5B31G 5AVCC 3X1VC 2F8NB 3AZFA 4XUJC 2Y2HA 4YM6A 2Y2QA 3AV1B 4WNNB 3MGQB 2BYMA 2VQRA 5B33D 2NQBC 2W8SA 5FUGA 5GXQC 5AVBA 3AZIA 1P3OB 3AFAA 4KGCD 4E44A 2NQBA 2JSSA 3AZMC 4Z5TA 5AV9B 4J8WD 1P3PD 3WKJB 2F8NG 5B0YD 3AZGB 5CHLB 4J8XC 5B24D 3UTBB 4NE3A 3AZMA 1HQ3A 4ZUXD 5B2IA 4KUDB 5GSUD 5DNND 5AV5B 1Z2CB 4Z2MG 5BNXB 5GT0C 1KX5B 4H9RB 1B67A 2NZDD 1A7WA 5B2JB 2UWXA 5B1LD 5GT0A 4QLCB 2F8NH 1P3BB 3LJAB 4KHAA 2ZY2A 3X1TD 1M19A 4Z66B 2PYOD 5GT3A 1F66C 4Z2MH 5AV8C 1U35D 3REID 5B31A 2HIOB 3UT9A 3WTPC 5CP6B 3X1UC 1S32C 3KUYD 1P3GD 3AZLD 5JRGC 3NQJA 3WTPA 3REHD 3W96B 3KXBA 4DQYB 5F99B 4LD9B 5B1MC 1EQZB 2F2AC 5JRGA 3AYWD 5B32B 3MGSB 2F8NA 3W99D 5AV6C 4WU9C 2ZY5A 4R8PD 4XZQC 4JJND 3AV1A 4WU8B 1HTAA 3C1BB 3AZFD 3WAAB 3W98B 5G49B 3R45B 1BH8B 4YM6D 3X1SB 3AV2B 4XZQA 5B33C 3B6FB 1TAFA 3B0CT 5B32G 3AZKB 3WKJA 5AVBD 3AZID 5B0ZC 4WZSB 3AZGA 1TZYB 3AFAD 4KGCC 1AOIB 4G91C 2NQBD 3UTBA 4J8WC 4Z5TD 1P3PC 3LZ1B 4H9SC 5B0ZA 4H9OB 3B0CW 4KUDA 4CSRB 4HGAC 3MGRB 3REJB 5AV5A 3AZMD 4H9NB 1JFIB 1HQ3D 4H9SA 5B2ID 2BG1A 1KX5A 5B2JA 1KX3B 1P34B 1P3BA 3LJAA 2FJ7D 4X23B 5B1LC 2XD1A 5GT0D 1WWIA 5B40B 1P3FB 1ZLAB 4Z66A 3X1TC 1M19D 2Y2NA 2Y2OA 3AZNB 4UPKA 2J8PA 5E5AC 2PYOC 3LELB 5GT3D 2HIOA 1U35C 2ZY4A 3NQUB 5CP6A 3REIC 4AWLC 5E5AA 5B31D 3AZHB 5CPKB 3UT9D 3KUYC 3REIA 5F99A 3AZLC 4LD9A 3REHC 5JA4A 3WTPE 3KXBD 3MGSA 1P3LB 5JRGD 3AYWC 3VH6T 2AROB 3AZJB 3AN2B 4WU8A 2CV5B 2F8ND 3C1BA 3W99C 3WAAA 3W98A 5G49A 1P3AB 1BH8A 4R8PC 3X1SA 4JJNC 3AV2A 3AV1D 2L5AA 3AZFC 1M1AC 3VH6W 3B6FA 5CPJB 4JJNB 2CWEA 3AZKA 3W97C 1P3OD 4XZQD 1TZYA 4DRAA 3WA9B 1AOIA 1F1EA 1M1AA 2DF4C 5AVBC 3AZIC 3W97A 3LZ1A 3A6NB 3WKJD 3O62B 3AFAC 3AZGD 4H9OA 4CSRA 3MGRA 4Z5TC 3REJA 3UTBD 1N1JB 1JFIA 2YFVA 5B0ZD 4KUDD 1BH9A 1P3IB 5AV5D 4WV4B 1HQ3C 2Y2LA 1M18B 5B2IC 3FDDA 1KX5D 1P34A 5B2JD 4X23A 4QLCD 2FJ7C 5AY8B 1P3BD 3LJAD 5B40A 3LZ0B 1P3FA 3RELB 2Y2PA 1ID3B 1KX4B 2FJ7A 3B0DC 3AZNA 3KWQB 4Z66D 1M19C 2IO5C 3NQUA 1T3UA 2F8NK 3AZHA 5GT3C 5DNMB 5CPKA 2HIOD 4NE6A 3EPJA 5CP6D 3AZEC 5C3IC 4H9PB 5B31C 5E5AD 3UT9C 3V9RA 3AZEA 1P3KB 2Y2KA 3H0MC 5F99D 5B0YB 4UUZA 4LD9D 1EQZD 2HUEC 5B24B 3AZJA 3KXBC 3AN2A 3H0LC 3MGSD 1PZRA 2G5HC 4ZUXB 1P3AA 5GSUB 5DNNB 4WU8D 3C1BD 3WAAD 1KU5A 5CPJA 4EO5B 3W98D 3KFUG 3MGPB 4YS3B 3X1SD 3MGQC 3REKB 3AV1C 3AV2D 3MNNB 2NZDB 3WA9A 3B6GB 3VH6A 3B6FD 3AZKD 1P3OC 3A6NA 4ZBJB 4WNNA 3MGQA 5BT1D 1TZYD 1AOID 1M1AD 5AV9C 1N1JA 3WKJC 2LY8A 1P3OA 3W97D 3LZ1D 3A1KA 3AZGC 3UTBC 3MGRD 3REJD 1P3IA 1P3MB 5KDMB 1R4VA 5AV9A 1M18A 4KUDC 5AV5C 2RVQC 4J8UB 1KX5C 3C1CB 3KSYA 5AY8A 3IP4C 1P34D 4G92B 5B2JC 1P3GB 4X23D 5BNXA 3LZ0A 4H9RA 4QLCC 1ID3A 3MVDB 1P3BC 3LJAC 1KX4A 5B40D 5CPIB 3TU4B 1P3FD 5BO0B 4QLCA 3F6TA 3AZND 4Z66C 5DNMA 3UTAB 4H9PA 2G5IC 2YFWB 4J8VB 4YM6B 3AZHD 2HIOC 2BYMB 5AVCB 3X1VB 5CP6C 5CPKD 1P3KA 4XUJB 3W96C 3AZED 2NQBB 5F99C 4H9QB 5GXQB 4LD9C 1EQZC 5B32C 3AZJD 3W96A 3MGSC 3AZMB 3AN2D 4CAYB 1P3AD 1EQZA 3MGPA 4J8XB 4YS3A 3REKA 4NE5A 5B32A 3MNNA 4WU8C 3C1BC 2Y2JA 3B6GA 3WAAC 3W98C 5CPJD 3X1SC 3AV2C 3WA9D 3B6FC 3AZKC 3R45A 5GT0B 3A6ND 5BT1C 1TZYC 3MGQD 1AOIC 1P3MA 3LZ1C 2Y2GA 3MGRC 3REJC 1P3ID 5AV9D 1M18D 4J8UA 3C1CA 4H9NA 3EG5B 1KX3C 1F66B 2FFFB 5AV8B 1P34C 3MVDA 5AY8D 4X23C 5CPIA 3TU4A 3LZ0D 3NQJB 2RVQD 3WTPB 1KX3A 3X1UB 1S32B 3KXBB 1ID3D 1KX4D 1H3OB 5B40C 1P3FC 1ZLAC 5JRGB 3UTAA 3AZNC 2YFWA 4J8VA 5B1MB 4M6BA 1ZLAA 3LELC 5DNMD 3X1VA 5AVCA 5AV6B 4XUJA 4WU9B 3VH5T 3AZHC 4XZQB 3LELA 5CPKC 2ZM5A 1TAFB 1P3KD 3P5JB 4H9QA 5GXQA 3VH5W 5B33B 1P3LC 4CAYA 5B0ZB 4KGCB 4J8XA 2AROC 4G91B 3AZJC 3AN2C 2CV5C 3W96D 4J8WB 1P3PB 1P3LA 1P3AC 4YS3D 3MGPD 3REKD 2AROA 5B32D 4HGAB 3MNND 2CV5A 3B6GD 5CPJC 2DQNC 3WA9C 3EPKA 2BYKB 3A6NC 3O62C 2Y2IA 1P3MD 3EPHA 2XD5A 5B1LB 3O62A 1P3IC 4E45A 1M18C 3X1TB 4J8UD 1F66A 3C1CD 5AV8A 5E5AB 2PYOB 1U35B 3X1UA 1S32A 5BNVB 5AY8C 3MVDD 4AWLB 3REIB 1H3OA 3LZ0C 3TU4D 5CPID 3RELC 4NFTA 5JA4B 1KX3D 1ID3C 1KX4C 3KUYB 3AL0C 3AZLB 3KWQC 1W2EA 5B1MA 3REHB 3RELA 3UTAD 5AV6A 4WU9A 1Q9CA 4J8VD 3KWQA 1ZLAD 5DNMC 3AYWB 3X1VD 3H0RC 5AVCD 3W99B 3A1IA 4XUJD 4R8PB 2ZY3A 3LELD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B33 A;  3AZF B;  1P3K C;  1M1A B;  1WWS A;  5B0Y C;  3W97 B;  5GXQ D;  4KGC A;  3VH5 A;  5B24 C;  4J8W A;  5FUG B;  1P3P A;  4ZUX C;  2YFV B;  5AVB B;  5B0Y A;  3AZI B;  1BFM A;  3AFA B;  1BH9 B;  4J8X D;  5B24 A;  5GSU C;  5DNN C;  4Z5T B;  1P3L D;  4ZUX A;  4EO5 C;  4YS3 C;  3MGP C;  3REK C;  2ARO D;  3MNN C;  2CV5 D;  5GSU A;  5DNN A;  3B6G C;  2NZD C;  1HQ3 B;  2BYK A;  5B2I B;  4ZBJ C;  2NZD A;  5B1L A;  2FJ7 B;  1P3M C;  3O62 D;  3X1T A;  4KHA B;  3B0D B;  5KDM A;  2PYO A;  4DRB A;  4J8U C;  1B6W A;  3C1C C;  1M19 B;  1F66 D;  2IO5 B;  1U35 A;  5AV8 D;  5BNV A;  4G92 C;  1P3G C;  5GT3 B;  3V9R B;  1ULY A;  3WTP D;  5BS7 C;  3X1U D;  5C3I B;  3MVD C;  3AZE B;  1S32 D;  3KUY A;  5B31 B;  1P3G A;  5CPI C;  3TU4 C;  3AZL A;  4UUZ B;  3UT9 B;  3REH A;  3B0B A;  5BS7 A;  5B1M D;  5BO0 A;  3REL D;  3AYW A;  2HUE B;  3UTA C;  3W99 A;  4J8V C;  5AV6 D;  4WU9 D;  4YM6 C;  3KWQ D;  4R8P A;  4JJN A;  5B31 G;  5AVC C;  3X1V C;  2F8N B;  3AZF A;  4XUJ C;  4YM6 A;  3AV1 B;  4WNN B;  3MGQ B;  2BYM A;  5B33 D;  2NQB C;  5FUG A;  5GXQ C;  5AVB A;  3AZI A;  1P3O B;  3AFA A;  4KGC D;  4E44 A;  2NQB A;  2JSS A;  3AZM C;  4Z5T A;  5AV9 B;  4J8W D;  1P3P D;  3WKJ B;  2F8N G;  5B0Y D;  3AZG B;  5CHL B;  4J8X C;  5B24 D;  3UTB B;  4NE3 A;  3AZM A;  1HQ3 A;  4ZUX D;  5B2I A;  4KUD B;  5GSU D;  5DNN D;  5AV5 B;  4Z2M G;  5BNX B;  5GT0 C;  1KX5 B;  4H9R B;  1B67 A;  2NZD D;  1A7W A;  5B2J B;  5B1L D;  5GT0 A;  4QLC B;  2F8N H;  1P3B B;  3LJA B;  4KHA A;  3X1T D;  1M19 A;  4Z66 B;  2PYO D;  5GT3 A;  1F66 C;  4Z2M H;  5AV8 C;  1U35 D;  3REI D;  5B31 A;  2HIO B;  3UT9 A;  3WTP C;  5CP6 B;  3X1U C;  1S32 C;  3KUY D;  1P3G D;  3AZL D;  5JRG C;  3NQJ A;  3WTP A;  3REH D;  3W96 B;  3KXB A;  5F99 B;  4LD9 B;  5B1M C;  1EQZ B;  5JRG A;  3AYW D;  5B32 B;  3MGS B;  2F8N A;  3W99 D;  5AV6 C;  4WU9 C;  4R8P D;  4XZQ C;  4JJN D;  3AV1 A;  4WU8 B;  1HTA A;  3C1B B;  3AZF D;  3WAA B;  3W98 B;  5G49 B;  3R45 B;  1BH8 B;  4YM6 D;  3X1S B;  3AV2 B;  4XZQ A;  5B33 C;  3B6F B;  1TAF A;  3B0C T;  5B32 G;  3AZK B;  3WKJ A;  5AVB D;  3AZI D;  5B0Z C;  4WZS B;  3AZG A;  1TZY B;  3AFA D;  4KGC C;  1AOI B;  4G91 C;  2NQB D;  3UTB A;  4J8W C;  4Z5T D;  1P3P C;  3LZ1 B;  4H9S C;  5B0Z A;  4H9O B;  3B0C W;  4KUD A;  4CSR B;  4HGA C;  3MGR B;  3REJ B;  5AV5 A;  3AZM D;  4H9N B;  1JFI B;  1HQ3 D;  4H9S A;  5B2I D;  1KX5 A;  5B2J A;  1KX3 B;  1P34 B;  1P3B A;  3LJA A;  2FJ7 D;  4X23 B;  5B1L C;  5GT0 D;  1WWI A;  5B40 B;  1P3F B;  1ZLA B;  4Z66 A;  3X1T C;  1M19 D;  3AZN B;  5E5A C;  2PYO C;  3LEL B;  5GT3 D;  2HIO A;  1U35 C;  5CP6 A;  3NQU B;  3REI C;  4AWL C;  5E5A A;  5B31 D;  3AZH B;  5CPK B;  3UT9 D;  3KUY C;  3REI A;  5F99 A;  3AZL C;  4LD9 A;  3REH C;  5JA4 A;  3WTP E;  3KXB D;  3MGS A;  1P3L B;  5JRG D;  3AYW C;  3VH6 T;  2ARO B;  3AZJ B;  3AN2 B;  4WU8 A;  2CV5 B;  2F8N D;  3C1B A;  3W99 C;  3WAA A;  3W98 A;  5G49 A;  1P3A B;  1BH8 A;  4R8P C;  3X1S A;  4JJN C;  3AV2 A;  3AV1 D;  2L5A A;  3AZF C;  1M1A C;  3VH6 W;  3B6F A;  5CPJ B;  4JJN B;  2CWE A;  3AZK A;  3W97 C;  1P3O D;  4XZQ D;  1TZY A;  4DRA A;  3WA9 B;  1AOI A;  1F1E A;  1M1A A;  5AVB C;  3AZI C;  3W97 A;  3LZ1 A;  3A6N B;  3WKJ D;  3O62 B;  3AFA C;  3AZG D;  4H9O A;  4CSR A;  3MGR A;  4Z5T C;  3REJ A;  3UTB D;  1N1J B;  1JFI A;  2YFV A;  5B0Z D;  4KUD D;  1BH9 A;  1P3I B;  5AV5 D;  4WV4 B;  1HQ3 C;  1M18 B;  5B2I C;  1KX5 D;  1P34 A;  5B2J D;  4X23 A;  4QLC D;  2FJ7 C;  5AY8 B;  1P3B D;  3LJA D;  5B40 A;  3LZ0 B;  1P3F A;  3REL B;  1ID3 B;  1KX4 B;  2FJ7 A;  3B0D C;  3AZN A;  3KWQ B;  4Z66 D;  1M19 C;  2IO5 C;  3NQU A;  2F8N K;  3AZH A;  5GT3 C;  5DNM B;  5CPK A;  2HIO D;  4NE6 A;  5CP6 D;  3AZE C;  5C3I C;  4H9P B;  5B31 C;  5E5A D;  3UT9 C;  3V9R A;  3AZE A;  1P3K B;  5B0Y B;  5F99 D;  4UUZ A;  4LD9 D;  1EQZ D;  2HUE C;  5B24 B;  3AZJ A;  3KXB C;  3AN2 A;  3MGS D;  4ZUX B;  1P3A A;  5GSU B;  5DNN B;  4WU8 D;  3C1B D;  3WAA D;  1KU5 A;  5CPJ A;  4EO5 B;  3W98 D;  3MGP B;  4YS3 B;  3X1S D;  3MGQ C;  3REK B;  3AV1 C;  3AV2 D;  3MNN B;  2NZD B;  3WA9 A;  3B6G B;  3VH6 A;  3B6F D;  3AZK D;  1P3O C;  3A6N A;  4ZBJ B;  4WNN A;  3MGQ A;  5BT1 D;  1TZY D;  1AOI D;  1M1A D;  5AV9 C;  1N1J A;  3WKJ C;  2LY8 A;  1P3O A;  3W97 D;  3LZ1 D;  3AZG C;  3UTB C;  3MGR D;  3REJ D;  1P3I A;  1P3M B;  5KDM B;  1R4V A;  5AV9 A;  1M18 A;  4KUD C;  5AV5 C;  2RVQ C;  4J8U B;  1KX5 C;  3C1C B;  3KSY A;  5AY8 A;  1P34 D;  4G92 B;  5B2J C;  1P3G B;  4X23 D;  5BNX A;  3LZ0 A;  4H9R A;  4QLC C;  1ID3 A;  3MVD B;  1P3B C;  3LJA C;  1KX4 A;  5B40 D;  5CPI B;  3TU4 B;  1P3F D;  5BO0 B;  4QLC A;  3AZN D;  4Z66 C;  5DNM A;  3UTA B;  4H9P A;  2YFW B;  4J8V B;  4YM6 B;  3AZH D;  2HIO C;  2BYM B;  5AVC B;  3X1V B;  5CP6 C;  5CPK D;  1P3K A;  4XUJ B;  3W96 C;  3AZE D;  2NQB B;  5F99 C;  4H9Q B;  5GXQ B;  4LD9 C;  1EQZ C;  5B32 C;  3AZJ D;  3W96 A;  3MGS C;  3AZM B;  3AN2 D;  4CAY B;  1P3A D;  1EQZ A;  3MGP A;  4J8X B;  4YS3 A;  3REK A;  4NE5 A;  5B32 A;  3MNN A;  4WU8 C;  3C1B C;  3B6G A;  3WAA C;  3W98 C;  5CPJ D;  3X1S C;  3AV2 C;  3WA9 D;  3B6F C;  3AZK C;  3R45 A;  5GT0 B;  3A6N D;  5BT1 C;  1TZY C;  3MGQ D;  1AOI C;  1P3M A;  3LZ1 C;  3MGR C;  3REJ C;  1P3I D;  5AV9 D;  1M18 D;  4J8U A;  3C1C A;  4H9N A;  1KX3 C;  1F66 B;  5AV8 B;  1P34 C;  3MVD A;  5AY8 D;  4X23 C;  5CPI A;  3TU4 A;  3LZ0 D;  3NQJ B;  2RVQ D;  3WTP B;  1KX3 A;  3X1U B;  1S32 B;  3KXB B;  1ID3 D;  1KX4 D;  1H3O B;  5B40 C;  1P3F C;  1ZLA C;  5JRG B;  3UTA A;  3AZN C;  2YFW A;  4J8V A;  5B1M B;  4M6B A;  1ZLA A;  3LEL C;  5DNM D;  3X1V A;  5AVC A;  5AV6 B;  4XUJ A;  4WU9 B;  3VH5 T;  3AZH C;  4XZQ B;  3LEL A;  5CPK C;  1TAF B;  1P3K D;  4H9Q A;  5GXQ A;  3VH5 W;  5B33 B;  1P3L C;  4CAY A;  5B0Z B;  4KGC B;  4J8X A;  2ARO C;  4G91 B;  3AZJ C;  3AN2 C;  2CV5 C;  3W96 D;  4J8W B;  1P3P B;  1P3L A;  1P3A C;  4YS3 D;  3MGP D;  3REK D;  2ARO A;  5B32 D;  4HGA B;  3MNN D;  2CV5 A;  3B6G D;  5CPJ C;  3WA9 C;  2BYK B;  3A6N C;  3O62 C;  1P3M D;  5B1L B;  3O62 A;  1P3I C;  4E45 A;  1M18 C;  3X1T B;  4J8U D;  1F66 A;  3C1C D;  5AV8 A;  5E5A B;  2PYO B;  1U35 B;  3X1U A;  1S32 A;  5BNV B;  5AY8 C;  3MVD D;  4AWL B;  3REI B;  1H3O A;  3LZ0 C;  3TU4 D;  5CPI D;  3REL C;  4NFT A;  5JA4 B;  1KX3 D;  1ID3 C;  1KX4 C;  3KUY B;  3AZL B;  3KWQ C;  5B1M A;  3REH B;  3REL A;  3UTA D;  5AV6 A;  4WU9 A;  1Q9C A;  4J8V D;  3KWQ A;  1ZLA D;  5DNM C;  3AYW B;  3X1V D;  5AVC D;  3W99 B;  4XUJ D;  4R8P B;  3LEL D; 
#chains in the Genus database with same CATH topology
 5B33 A;  3AZF B;  1P3K C;  1M1A B;  1WWS A;  5B0Y C;  3W97 B;  5GXQ D;  4KGC A;  3VH5 A;  5B24 C;  2JE5 A;  4J8W A;  5FUG B;  1P3P A;  4ZUX C;  2YFV B;  5AVB B;  5B0Y A;  3AZI B;  1BFM A;  3AFA B;  1BH9 B;  4J8X D;  3EPL A;  5B24 A;  5GSU C;  5DNN C;  4Z5T B;  1P3L D;  4ZUX A;  4EO5 C;  4YS3 C;  3MGP C;  3REK C;  2ARO D;  3MNN C;  2CV5 D;  5GSU A;  5DNN A;  3B6G C;  2NZD C;  1HQ3 B;  2BYK A;  5B2I B;  4ZBJ C;  2NZD A;  5B1L A;  2JCH A;  2FJ7 B;  1P3M C;  4WJ3 C;  3O62 D;  3X1T A;  4KHA B;  3B0D B;  5KDM A;  2PYO A;  4DRB A;  4J8U C;  1B6W A;  3C1C C;  1M19 B;  1F66 D;  2IO5 B;  1U35 A;  5AV8 D;  5BNV A;  4G92 C;  1P3G C;  5GT3 B;  3V9R B;  1ULY A;  3WTP D;  5BS7 C;  3X1U D;  5C3I B;  3MVD C;  3AZE B;  1S32 D;  3KUY A;  5B31 B;  1P3G A;  2RIQ A;  5CPI C;  3TU4 C;  3AZL A;  4UUZ B;  3UT9 B;  3REH A;  3B0B A;  5BS7 A;  2Y2M A;  5B1M D;  5BO0 A;  3REL D;  3AYW A;  2HUE B;  3UTA C;  3W99 A;  4J8V C;  5AV6 D;  4WU9 D;  4YM6 C;  3KWQ D;  4R8P A;  4JJN A;  5B31 G;  5AVC C;  3X1V C;  2F8N B;  3AZF A;  4XUJ C;  2Y2H A;  4YM6 A;  2Y2Q A;  3AV1 B;  4WNN B;  3MGQ B;  2BYM A;  2VQR A;  5B33 D;  2NQB C;  2W8S A;  5FUG A;  5GXQ C;  5AVB A;  3AZI A;  1P3O B;  3AFA A;  4KGC D;  4E44 A;  2NQB A;  2JSS A;  3AZM C;  4Z5T A;  5AV9 B;  4J8W D;  1P3P D;  3WKJ B;  2F8N G;  5B0Y D;  3AZG B;  5CHL B;  4J8X C;  5B24 D;  3UTB B;  4NE3 A;  3AZM A;  1HQ3 A;  4ZUX D;  5B2I A;  4KUD B;  5GSU D;  5DNN D;  5AV5 B;  1Z2C B;  4Z2M G;  5BNX B;  5GT0 C;  1KX5 B;  4H9R B;  1B67 A;  2NZD D;  1A7W A;  5B2J B;  2UWX A;  5B1L D;  5GT0 A;  4QLC B;  2F8N H;  1P3B B;  3LJA B;  4KHA A;  2ZY2 A;  3X1T D;  1M19 A;  4Z66 B;  2PYO D;  5GT3 A;  1F66 C;  4Z2M H;  5AV8 C;  1U35 D;  3REI D;  5B31 A;  2HIO B;  3UT9 A;  3WTP C;  5CP6 B;  3X1U C;  1S32 C;  3KUY D;  1P3G D;  3AZL D;  5JRG C;  3NQJ A;  3WTP A;  3REH D;  3W96 B;  3KXB A;  4DQY B;  5F99 B;  4LD9 B;  5B1M C;  1EQZ B;  2F2A C;  5JRG A;  3AYW D;  5B32 B;  3MGS B;  2F8N A;  3W99 D;  5AV6 C;  4WU9 C;  2ZY5 A;  4R8P D;  4XZQ C;  4JJN D;  3AV1 A;  4WU8 B;  1HTA A;  3C1B B;  3AZF D;  3WAA B;  3W98 B;  5G49 B;  3R45 B;  1BH8 B;  4YM6 D;  3X1S B;  3AV2 B;  4XZQ A;  5B33 C;  3B6F B;  1TAF A;  3B0C T;  5B32 G;  3AZK B;  3WKJ A;  5AVB D;  3AZI D;  5B0Z C;  4WZS B;  3AZG A;  1TZY B;  3AFA D;  4KGC C;  1AOI B;  4G91 C;  2NQB D;  3UTB A;  4J8W C;  4Z5T D;  1P3P C;  3LZ1 B;  4H9S C;  5B0Z A;  4H9O B;  3B0C W;  4KUD A;  4CSR B;  4HGA C;  3MGR B;  3REJ B;  5AV5 A;  3AZM D;  4H9N B;  1JFI B;  1HQ3 D;  4H9S A;  5B2I D;  2BG1 A;  1KX5 A;  5B2J A;  1KX3 B;  1P34 B;  1P3B A;  3LJA A;  2FJ7 D;  4X23 B;  5B1L C;  2XD1 A;  5GT0 D;  1WWI A;  5B40 B;  1P3F B;  1ZLA B;  4Z66 A;  3X1T C;  1M19 D;  2Y2N A;  2Y2O A;  3AZN B;  4UPK A;  2J8P A;  5E5A C;  2PYO C;  3LEL B;  5GT3 D;  2HIO A;  1U35 C;  2ZY4 A;  3NQU B;  5CP6 A;  3REI C;  4AWL C;  5E5A A;  5B31 D;  3AZH B;  5CPK B;  3UT9 D;  3KUY C;  3REI A;  5F99 A;  3AZL C;  4LD9 A;  3REH C;  5JA4 A;  3WTP E;  3KXB D;  3MGS A;  1P3L B;  5JRG D;  3AYW C;  3VH6 T;  2ARO B;  3AZJ B;  3AN2 B;  4WU8 A;  2CV5 B;  2F8N D;  3C1B A;  3W99 C;  3WAA A;  3W98 A;  5G49 A;  1P3A B;  1BH8 A;  4R8P C;  3X1S A;  4JJN C;  3AV2 A;  3AV1 D;  2L5A A;  3AZF C;  1M1A C;  3VH6 W;  3B6F A;  5CPJ B;  4JJN B;  2CWE A;  3AZK A;  3W97 C;  1P3O D;  4XZQ D;  1TZY A;  4DRA A;  3WA9 B;  1AOI A;  1F1E A;  1M1A A;  2DF4 C;  5AVB C;  3AZI C;  3W97 A;  3LZ1 A;  3A6N B;  3WKJ D;  3O62 B;  3AFA C;  3AZG D;  4H9O A;  4CSR A;  3MGR A;  4Z5T C;  3REJ A;  3UTB D;  1N1J B;  1JFI A;  2YFV A;  5B0Z D;  4KUD D;  1BH9 A;  1P3I B;  5AV5 D;  4WV4 B;  1HQ3 C;  2Y2L A;  1M18 B;  5B2I C;  3FDD A;  1KX5 D;  1P34 A;  5B2J D;  4X23 A;  4QLC D;  2FJ7 C;  5AY8 B;  1P3B D;  3LJA D;  5B40 A;  3LZ0 B;  1P3F A;  3REL B;  2Y2P A;  1ID3 B;  1KX4 B;  2FJ7 A;  3B0D C;  3AZN A;  3KWQ B;  4Z66 D;  1M19 C;  2IO5 C;  3NQU A;  1T3U A;  2F8N K;  3AZH A;  5GT3 C;  5DNM B;  5CPK A;  2HIO D;  4NE6 A;  3EPJ A;  5CP6 D;  3AZE C;  5C3I C;  4H9P B;  5B31 C;  5E5A D;  3UT9 C;  3V9R A;  3AZE A;  1P3K B;  2Y2K A;  3H0M C;  5F99 D;  5B0Y B;  4UUZ A;  4LD9 D;  1EQZ D;  2HUE C;  5B24 B;  3AZJ A;  3KXB C;  3AN2 A;  3H0L C;  3MGS D;  1PZR A;  2G5H C;  4ZUX B;  1P3A A;  5GSU B;  5DNN B;  4WU8 D;  3C1B D;  3WAA D;  1KU5 A;  5CPJ A;  4EO5 B;  3W98 D;  3KFU G;  3MGP B;  4YS3 B;  3X1S D;  3MGQ C;  3REK B;  3AV1 C;  3AV2 D;  3MNN B;  2NZD B;  3WA9 A;  3B6G B;  3VH6 A;  3B6F D;  3AZK D;  1P3O C;  3A6N A;  4ZBJ B;  4WNN A;  3MGQ A;  5BT1 D;  1TZY D;  1AOI D;  1M1A D;  5AV9 C;  1N1J A;  3WKJ C;  2LY8 A;  1P3O A;  3W97 D;  3LZ1 D;  3A1K A;  3AZG C;  3UTB C;  3MGR D;  3REJ D;  1P3I A;  1P3M B;  5KDM B;  1R4V A;  5AV9 A;  1M18 A;  4KUD C;  5AV5 C;  2RVQ C;  4J8U B;  1KX5 C;  3C1C B;  3KSY A;  5AY8 A;  3IP4 C;  1P34 D;  4G92 B;  5B2J C;  1P3G B;  4X23 D;  5BNX A;  3LZ0 A;  4H9R A;  4QLC C;  1ID3 A;  3MVD B;  1P3B C;  3LJA C;  1KX4 A;  5B40 D;  5CPI B;  3TU4 B;  1P3F D;  5BO0 B;  4QLC A;  3F6T A;  3AZN D;  4Z66 C;  5DNM A;  3UTA B;  4H9P A;  2G5I C;  2YFW B;  4J8V B;  4YM6 B;  3AZH D;  2HIO C;  2BYM B;  5AVC B;  3X1V B;  5CP6 C;  5CPK D;  1P3K A;  4XUJ B;  3W96 C;  3AZE D;  2NQB B;  5F99 C;  4H9Q B;  5GXQ B;  4LD9 C;  1EQZ C;  5B32 C;  3AZJ D;  3W96 A;  3MGS C;  3AZM B;  3AN2 D;  4CAY B;  1P3A D;  1EQZ A;  3MGP A;  4J8X B;  4YS3 A;  3REK A;  4NE5 A;  5B32 A;  3MNN A;  4WU8 C;  3C1B C;  2Y2J A;  3B6G A;  3WAA C;  3W98 C;  5CPJ D;  3X1S C;  3AV2 C;  3WA9 D;  3B6F C;  3AZK C;  3R45 A;  5GT0 B;  3A6N D;  5BT1 C;  1TZY C;  3MGQ D;  1AOI C;  1P3M A;  3LZ1 C;  2Y2G A;  3MGR C;  3REJ C;  1P3I D;  5AV9 D;  1M18 D;  4J8U A;  3C1C A;  4H9N A;  3EG5 B;  1KX3 C;  1F66 B;  2FFF B;  5AV8 B;  1P34 C;  3MVD A;  5AY8 D;  4X23 C;  5CPI A;  3TU4 A;  3LZ0 D;  3NQJ B;  2RVQ D;  3WTP B;  1KX3 A;  3X1U B;  1S32 B;  3KXB B;  1ID3 D;  1KX4 D;  1H3O B;  5B40 C;  1P3F C;  1ZLA C;  5JRG B;  3UTA A;  3AZN C;  2YFW A;  4J8V A;  5B1M B;  4M6B A;  1ZLA A;  3LEL C;  5DNM D;  3X1V A;  5AVC A;  5AV6 B;  4XUJ A;  4WU9 B;  3VH5 T;  3AZH C;  4XZQ B;  3LEL A;  5CPK C;  2ZM5 A;  1TAF B;  1P3K D;  3P5J B;  4H9Q A;  5GXQ A;  3VH5 W;  5B33 B;  1P3L C;  4CAY A;  5B0Z B;  4KGC B;  4J8X A;  2ARO C;  4G91 B;  3AZJ C;  3AN2 C;  2CV5 C;  3W96 D;  4J8W B;  1P3P B;  1P3L A;  1P3A C;  4YS3 D;  3MGP D;  3REK D;  2ARO A;  5B32 D;  4HGA B;  3MNN D;  2CV5 A;  3B6G D;  5CPJ C;  2DQN C;  3WA9 C;  3EPK A;  2BYK B;  3A6N C;  3O62 C;  2Y2I A;  1P3M D;  3EPH A;  2XD5 A;  5B1L B;  3O62 A;  1P3I C;  4E45 A;  1M18 C;  3X1T B;  4J8U D;  1F66 A;  3C1C D;  5AV8 A;  5E5A B;  2PYO B;  1U35 B;  3X1U A;  1S32 A;  5BNV B;  5AY8 C;  3MVD D;  4AWL B;  3REI B;  1H3O A;  3LZ0 C;  3TU4 D;  5CPI D;  3REL C;  4NFT A;  5JA4 B;  1KX3 D;  1ID3 C;  1KX4 C;  3KUY B;  3AL0 C;  3AZL B;  3KWQ C;  1W2E A;  5B1M A;  3REH B;  3REL A;  3UTA D;  5AV6 A;  4WU9 A;  1Q9C A;  4J8V D;  3KWQ A;  1ZLA D;  5DNM C;  3AYW B;  3X1V D;  3H0R C;  5AVC D;  3W99 B;  3A1I A;  4XUJ D;  4R8P B;  2ZY3 A;  3LEL D; 
#chains in the Genus database with same CATH homology
 5B33 A;  3AZF B;  1P3K C;  1M1A B;  1WWS A;  5B0Y C;  3W97 B;  5GXQ D;  4KGC A;  3VH5 A;  5B24 C;  2JE5 A;  4J8W A;  5FUG B;  1P3P A;  4ZUX C;  2YFV B;  5AVB B;  5B0Y A;  3AZI B;  1BFM A;  3AFA B;  1BH9 B;  4J8X D;  3EPL A;  5B24 A;  5GSU C;  5DNN C;  4Z5T B;  1P3L D;  4ZUX A;  4EO5 C;  4YS3 C;  3MGP C;  3REK C;  2ARO D;  3MNN C;  2CV5 D;  5GSU A;  5DNN A;  3B6G C;  2NZD C;  1HQ3 B;  2BYK A;  5B2I B;  4ZBJ C;  2NZD A;  5B1L A;  2JCH A;  2FJ7 B;  1P3M C;  4WJ3 C;  3O62 D;  3X1T A;  4KHA B;  3B0D B;  5KDM A;  2PYO A;  4DRB A;  4J8U C;  1B6W A;  3C1C C;  1M19 B;  1F66 D;  2IO5 B;  1U35 A;  5AV8 D;  5BNV A;  4G92 C;  1P3G C;  5GT3 B;  3V9R B;  1ULY A;  3WTP D;  5BS7 C;  3X1U D;  5C3I B;  3MVD C;  3AZE B;  1S32 D;  3KUY A;  5B31 B;  1P3G A;  2RIQ A;  5CPI C;  3TU4 C;  3AZL A;  4UUZ B;  3UT9 B;  3REH A;  3B0B A;  5BS7 A;  2Y2M A;  5B1M D;  5BO0 A;  3REL D;  3AYW A;  2HUE B;  3UTA C;  3W99 A;  4J8V C;  5AV6 D;  4WU9 D;  4YM6 C;  3KWQ D;  4R8P A;  4JJN A;  5B31 G;  5AVC C;  3X1V C;  2F8N B;  3AZF A;  4XUJ C;  2Y2H A;  4YM6 A;  2Y2Q A;  3AV1 B;  4WNN B;  3MGQ B;  2BYM A;  2VQR A;  5B33 D;  2NQB C;  2W8S A;  5FUG A;  5GXQ C;  5AVB A;  3AZI A;  1P3O B;  3AFA A;  4KGC D;  4E44 A;  2NQB A;  2JSS A;  3AZM C;  4Z5T A;  5AV9 B;  4J8W D;  1P3P D;  3WKJ B;  2F8N G;  5B0Y D;  3AZG B;  5CHL B;  4J8X C;  5B24 D;  3UTB B;  4NE3 A;  3AZM A;  1HQ3 A;  4ZUX D;  5B2I A;  4KUD B;  5GSU D;  5DNN D;  5AV5 B;  1Z2C B;  4Z2M G;  5BNX B;  5GT0 C;  1KX5 B;  4H9R B;  1B67 A;  2NZD D;  1A7W A;  5B2J B;  2UWX A;  5B1L D;  5GT0 A;  4QLC B;  2F8N H;  1P3B B;  3LJA B;  4KHA A;  2ZY2 A;  3X1T D;  1M19 A;  4Z66 B;  2PYO D;  5GT3 A;  1F66 C;  4Z2M H;  5AV8 C;  1U35 D;  3REI D;  5B31 A;  2HIO B;  3UT9 A;  3WTP C;  5CP6 B;  3X1U C;  1S32 C;  3KUY D;  1P3G D;  3AZL D;  5JRG C;  3NQJ A;  3WTP A;  3REH D;  3W96 B;  3KXB A;  4DQY B;  5F99 B;  4LD9 B;  5B1M C;  1EQZ B;  2F2A C;  5JRG A;  3AYW D;  5B32 B;  3MGS B;  2F8N A;  3W99 D;  5AV6 C;  4WU9 C;  2ZY5 A;  4R8P D;  4XZQ C;  4JJN D;  3AV1 A;  4WU8 B;  1HTA A;  3C1B B;  3AZF D;  3WAA B;  3W98 B;  5G49 B;  3R45 B;  1BH8 B;  4YM6 D;  3X1S B;  3AV2 B;  4XZQ A;  5B33 C;  3B6F B;  1TAF A;  3B0C T;  5B32 G;  3AZK B;  3WKJ A;  5AVB D;  3AZI D;  5B0Z C;  4WZS B;  3AZG A;  1TZY B;  3AFA D;  4KGC C;  1AOI B;  4G91 C;  2NQB D;  3UTB A;  4J8W C;  4Z5T D;  1P3P C;  3LZ1 B;  4H9S C;  5B0Z A;  4H9O B;  3B0C W;  4KUD A;  4CSR B;  4HGA C;  3MGR B;  3REJ B;  5AV5 A;  3AZM D;  4H9N B;  1JFI B;  1HQ3 D;  4H9S A;  5B2I D;  2BG1 A;  1KX5 A;  5B2J A;  1KX3 B;  1P34 B;  1P3B A;  3LJA A;  2FJ7 D;  4X23 B;  5B1L C;  2XD1 A;  5GT0 D;  1WWI A;  5B40 B;  1P3F B;  1ZLA B;  4Z66 A;  3X1T C;  1M19 D;  2Y2N A;  2Y2O A;  3AZN B;  4UPK A;  2J8P A;  5E5A C;  2PYO C;  3LEL B;  5GT3 D;  2HIO A;  1U35 C;  2ZY4 A;  3NQU B;  5CP6 A;  3REI C;  4AWL C;  5E5A A;  5B31 D;  3AZH B;  5CPK B;  3UT9 D;  3KUY C;  3REI A;  5F99 A;  3AZL C;  4LD9 A;  3REH C;  5JA4 A;  3WTP E;  3KXB D;  3MGS A;  1P3L B;  5JRG D;  3AYW C;  3VH6 T;  2ARO B;  3AZJ B;  3AN2 B;  4WU8 A;  2CV5 B;  2F8N D;  3C1B A;  3W99 C;  3WAA A;  3W98 A;  5G49 A;  1P3A B;  1BH8 A;  4R8P C;  3X1S A;  4JJN C;  3AV2 A;  3AV1 D;  2L5A A;  3AZF C;  1M1A C;  3VH6 W;  3B6F A;  5CPJ B;  4JJN B;  2CWE A;  3AZK A;  3W97 C;  1P3O D;  4XZQ D;  1TZY A;  4DRA A;  3WA9 B;  1AOI A;  1F1E A;  1M1A A;  2DF4 C;  5AVB C;  3AZI C;  3W97 A;  3LZ1 A;  3A6N B;  3WKJ D;  3O62 B;  3AFA C;  3AZG D;  4H9O A;  4CSR A;  3MGR A;  4Z5T C;  3REJ A;  3UTB D;  1N1J B;  1JFI A;  2YFV A;  5B0Z D;  4KUD D;  1BH9 A;  1P3I B;  5AV5 D;  4WV4 B;  1HQ3 C;  2Y2L A;  1M18 B;  5B2I C;  3FDD A;  1KX5 D;  1P34 A;  5B2J D;  4X23 A;  4QLC D;  2FJ7 C;  5AY8 B;  1P3B D;  3LJA D;  5B40 A;  3LZ0 B;  1P3F A;  3REL B;  2Y2P A;  1ID3 B;  1KX4 B;  2FJ7 A;  3B0D C;  3AZN A;  3KWQ B;  4Z66 D;  1M19 C;  2IO5 C;  3NQU A;  1T3U A;  2F8N K;  3AZH A;  5GT3 C;  5DNM B;  5CPK A;  2HIO D;  4NE6 A;  3EPJ A;  5CP6 D;  3AZE C;  5C3I C;  4H9P B;  5B31 C;  5E5A D;  3UT9 C;  3V9R A;  3AZE A;  1P3K B;  2Y2K A;  3H0M C;  5F99 D;  5B0Y B;  4UUZ A;  4LD9 D;  1EQZ D;  2HUE C;  5B24 B;  3AZJ A;  3KXB C;  3AN2 A;  3H0L C;  3MGS D;  1PZR A;  2G5H C;  4ZUX B;  1P3A A;  5GSU B;  5DNN B;  4WU8 D;  3C1B D;  3WAA D;  1KU5 A;  5CPJ A;  4EO5 B;  3W98 D;  3KFU G;  3MGP B;  4YS3 B;  3X1S D;  3MGQ C;  3REK B;  3AV1 C;  3AV2 D;  3MNN B;  2NZD B;  3WA9 A;  3B6G B;  3VH6 A;  3B6F D;  3AZK D;  1P3O C;  3A6N A;  4ZBJ B;  4WNN A;  3MGQ A;  5BT1 D;  1TZY D;  1AOI D;  1M1A D;  5AV9 C;  1N1J A;  3WKJ C;  2LY8 A;  1P3O A;  3W97 D;  3LZ1 D;  3A1K A;  3AZG C;  3UTB C;  3MGR D;  3REJ D;  1P3I A;  1P3M B;  5KDM B;  1R4V A;  5AV9 A;  1M18 A;  4KUD C;  5AV5 C;  2RVQ C;  4J8U B;  1KX5 C;  3C1C B;  3KSY A;  5AY8 A;  3IP4 C;  1P34 D;  4G92 B;  5B2J C;  1P3G B;  4X23 D;  5BNX A;  3LZ0 A;  4H9R A;  4QLC C;  1ID3 A;  3MVD B;  1P3B C;  3LJA C;  1KX4 A;  5B40 D;  5CPI B;  3TU4 B;  1P3F D;  5BO0 B;  4QLC A;  3F6T A;  3AZN D;  4Z66 C;  5DNM A;  3UTA B;  4H9P A;  2G5I C;  2YFW B;  4J8V B;  4YM6 B;  3AZH D;  2HIO C;  2BYM B;  5AVC B;  3X1V B;  5CP6 C;  5CPK D;  1P3K A;  4XUJ B;  3W96 C;  3AZE D;  2NQB B;  5F99 C;  4H9Q B;  5GXQ B;  4LD9 C;  1EQZ C;  5B32 C;  3AZJ D;  3W96 A;  3MGS C;  3AZM B;  3AN2 D;  4CAY B;  1P3A D;  1EQZ A;  3MGP A;  4J8X B;  4YS3 A;  3REK A;  4NE5 A;  5B32 A;  3MNN A;  4WU8 C;  3C1B C;  2Y2J A;  3B6G A;  3WAA C;  3W98 C;  5CPJ D;  3X1S C;  3AV2 C;  3WA9 D;  3B6F C;  3AZK C;  3R45 A;  5GT0 B;  3A6N D;  5BT1 C;  1TZY C;  3MGQ D;  1AOI C;  1P3M A;  3LZ1 C;  2Y2G A;  3MGR C;  3REJ C;  1P3I D;  5AV9 D;  1M18 D;  4J8U A;  3C1C A;  4H9N A;  3EG5 B;  1KX3 C;  1F66 B;  2FFF B;  5AV8 B;  1P34 C;  3MVD A;  5AY8 D;  4X23 C;  5CPI A;  3TU4 A;  3LZ0 D;  3NQJ B;  2RVQ D;  3WTP B;  1KX3 A;  3X1U B;  1S32 B;  3KXB B;  1ID3 D;  1KX4 D;  1H3O B;  5B40 C;  1P3F C;  1ZLA C;  5JRG B;  3UTA A;  3AZN C;  2YFW A;  4J8V A;  5B1M B;  4M6B A;  1ZLA A;  3LEL C;  5DNM D;  3X1V A;  5AVC A;  5AV6 B;  4XUJ A;  4WU9 B;  3VH5 T;  3AZH C;  4XZQ B;  3LEL A;  5CPK C;  2ZM5 A;  1TAF B;  1P3K D;  3P5J B;  4H9Q A;  5GXQ A;  3VH5 W;  5B33 B;  1P3L C;  4CAY A;  5B0Z B;  4KGC B;  4J8X A;  2ARO C;  4G91 B;  3AZJ C;  3AN2 C;  2CV5 C;  3W96 D;  4J8W B;  1P3P B;  1P3L A;  1P3A C;  4YS3 D;  3MGP D;  3REK D;  2ARO A;  5B32 D;  4HGA B;  3MNN D;  2CV5 A;  3B6G D;  5CPJ C;  2DQN C;  3WA9 C;  3EPK A;  2BYK B;  3A6N C;  3O62 C;  2Y2I A;  1P3M D;  3EPH A;  2XD5 A;  5B1L B;  3O62 A;  1P3I C;  4E45 A;  1M18 C;  3X1T B;  4J8U D;  1F66 A;  3C1C D;  5AV8 A;  5E5A B;  2PYO B;  1U35 B;  3X1U A;  1S32 A;  5BNV B;  5AY8 C;  3MVD D;  4AWL B;  3REI B;  1H3O A;  3LZ0 C;  3TU4 D;  5CPI D;  3REL C;  4NFT A;  5JA4 B;  1KX3 D;  1ID3 C;  1KX4 C;  3KUY B;  3AL0 C;  3AZL B;  3KWQ C;  1W2E A;  5B1M A;  3REH B;  3REL A;  3UTA D;  5AV6 A;  4WU9 A;  1Q9C A;  4J8V D;  3KWQ A;  1ZLA D;  5DNM C;  3AYW B;  3X1V D;  3H0R C;  5AVC D;  3W99 B;  3A1I A;  4XUJ D;  4R8P B;  2ZY3 A;  3LEL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...