4H9NB

Complex structure 1 of daxx/h3.3(sub5)/h4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
b'KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 27
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9nB00
5KDMA 4KHAA 1P3LA 4LD9D 3UTBA 5B40B 4JJNA 3R45A 3W96C 3W96D 2LY8A 2YFVA 5FUGB 4J8VC 3AZJA 1P3OC 3WKJA 3WAAA 4J8VD 3C1CD 5B2JA 2FJ7C 5AV9C 3MGSC 4WNNA 3VH5W 5B0ZC 2L5AA 5AV9D 1P3MA 4X23B 1ZLAA 1JFIA 4R8PB 3X1VB 3AZNA 1M1AB 3AN2D 1B67A 5DNMB 1KU5A 5JRGC 1F66B 5B1MC 5JRGD 5B0ZB 2CV5C 1ULYA 2CV5D 5BS7C 4WU8A 4QLCD 1P3LB 5BNXB 4KGCA 1BH9A 4J8UA 4JJNB 3LELC 3R45B 1P3FC 3LJAD 3W98A 2NQBA 3RELC 1Q9CA 1P3KD 4YS3C 3RELD 4YS3D 4NE3A 3B0DC 1M18A 2PYOA 4WNNB 4YM6D 1P3PA 4ZBJC 5AVBC 1P3FB 1P3GD 3AFAA 1HQ3A 3REJC 3MNNC 5CPKA 4CAYB 3REJD 3MNND 3KWQD 3UT9A 3WA9A 3AZIC 3B6FD 1P3AC 5CPJC 1BH9B 4J8UB 3AZKA 3LZ1A 3REHC 5F99C 1KX3D 3REHD 5F99D 4J8XB 1S32C 4G91B 1EQZA 1P3PB 5B33D 3KUYC 3KUYD 4Z5TA 3W97C 3W97D 3AZEA 3B6GB 5B32A 1P3IA 5AY8C 2BYKB 4H9NA 5GSUD 3VH5A 5G49A 5B2IA 1AOIC 5B0YB 3O62C 3LZ1B 5AY8B 3KXBC 1U35B 3O62D 5E5AC 1AOID 3REIA 3KXBD 5AV8A 5E5AD 3B0BA 3TU4B 5B1LD 3X1TA 4H9QB 3X1SC 3X1UA 5AV5C 3AV2A 3A6NC 4Z5TB 5AV5D 3AZLA 2AROC 3AZHC 1N1JA 5B32B 1P34B 1P3IB 3W99C 5AVCD 3AZMC 2NZDC 3W99D 3X1SB 1KX5B 2NZDD 3MGQC 1BH8A 3C1BB 1KX4A 3MGPB 4EO5C 5G49B 4ZUXD 5DNNC 4XUJC 3REKC 4XUJD 1WWSA 2HIOA 5B31A 4AWLC 3AZGB 5B32G 4E45A 4Z66B 3WTPB 1ID3C 4J8WA 4EO5B 3X1TB 4XZQA 4HGAB 3X1UB 3LZ0A 3AV2B 5CPIA 3AZLB 4WU9A 5CP6A 1TZYA 3MGRA 5GT3B 5B40C 3AYWA 3NQJA 1N1JB 5B24B 4KUDA 5B40D 5GT0A 4WV4B 5AV6D 3AZFB 3VH6W 4UUZA 1KX4B 2BYMB 4E44A 4X23C 4H9RA 4R8PC 3X1VC 4X23D 3AV1B 4LD9A 1M19B 3X1VD 1M1AC 5DNMC 1P3OD 3W96A 5DNMD 1P3BC 1F66C 4XZQB 1F66D 2FJ7D 4J8VA 3MGSD 3MVDB 3C1CA 5B0ZD 3UTAB 5CPIB 1P3LC 4WU9B 1TZYB 3MGRB 4JJNC 4DRAA 1P3BB 3AN2A 5B1MD 5KDMB 3WKJC 5JRGA 4KHAB 4UUZB 2CV5A 5C3IB 3UTBB 4QLCA 4G92B 1P3MC 3LELD 4LD9B 1P3FD 2YFVB 3AZJB 3WKJB 3B0CT 1H3OA 3WAAB 3LJAA 5B2JB 2HUEB 1P3KA 2F8ND 3RELA 3C1CB 4YS3A 1P3MB 4H9OB 1ZLAB 1JFIB 4YM6A 5AVBD 3AZNB 5GXQA 4J8UC 1P3GA 3AN2B 4J8XC 1R4VA 4G91C 2NQBC 4J8XD 3B0CW 4WU8B 1M18C 1P3PC 3REJA 3MNNA 3KWQA 3AZID 4CSRA 5CPJD 1P3AD 1P3PD 4KGCB 3B6FA 3W98B 2NQBB 1S32D 1KX3A 3REHA 5F99A 3B6GC 3LJAB 1M18B 4H9PA 1P3KB 2PYOB 3B6GD 3VH6A 1B6WA 4YM6B 5B33A 3AFAB 5GXQB 3KUYA 1HQ3B 3NQUA 5B0YC 3LZ1C 3W97A 5B0YD 1U35C 5AY8D 1U35D 5CPKB 3TU4C 3UT9B 3WA9B 3TU4D 5BO0A 5GSUA 1EQZC 2IO5B 3AZKB 2F8NH 2F8NK 4Z5TC 5BNVA 3AZEC 1AOIA 3O62A 1KX3B 3KSYA 3KXBA 5B32C 1P34C 1P3IC 5E5AA 1P34D 1EQZB 5B1LA 1KX5C 3C1BC 3X1SD 1KX5D 3C1BD 5B33B 3A6ND 3MGPC 5JA4A 3MGPD 3AZEB 5B2IC 2AROD 3AZHD 3AZGC 4H9NB 3AZGD 3AZMD 4Z66C 3WTPC 3MGQD 5AVCA 4Z66D 3WTPD 3X1TC 3W99A 2NZDA 5BO0B 5B2IB 4HGAC 5DNND 3X1UC 3REKD 3X1UD 3AV2C 4ZUXA 3REIB 5AV8B 3AZLC 3VH6T 4NFTA 4XUJA 5GT3C 5B24C 5GT3D 1ID3D 5B24D 5CHLB 5B1LB 4NE6A 3AZFC 3AZFD 4H9OA 1KX4C 3AV1C 1M19C 4H9SC 3AV1D 5B40A 1M19D 1BH8B 5AVCB 5AV6A 4XZQC 3MVDC 3MVDD 3LZ0C 3UTAC 5BT1C 2HIOB 5B31B 3UTAD 4R8PD 5CPIC 4WU9C 1TZYC 3MGRC 3V9RA 1M1AD 4X23A 4J8WB 1F1EA 3X1VA 1P3BD 1P3OA 4M6BA 4DRBA 5DNMA 3LZ0B 1F66A 2FJ7A 5AV9A 3MGSA 5B0ZA 4Z2MG 5C3IC 4Z2MH 5CP6B 3UTBC 3AYWB 1P3LD 5B31G 3NQJB 4KUDB 4G92C 3UTBD 4JJND 5GT0B 4LD9C 5BNXA 3AZJC 3WAAC 3AZJD 3WKJD 5B2JC 5B1MA 2HUEC 5AV6B 3WAAD 5B2JD 3C1CC 5BS7A 1ZLAC 4H9RB 1P3MD 1ZLAD 3AZNC 3WTPE 3LELA 3AZND 3V9RB 3W96B 1P3FA 3AN2C 1P3OB 4J8VB 4WU8C 2FJ7B 2F8NA 5AV9B 3MGSB 4WU8D 4KGCC 4CAYA 4QLCC 5AVBA 4J8UD 4KGCD 3W98C 3W98D 2NQBD 5JRGB 3LJAC 5B1MB 2CV5B 4J8XA 1P3KC 2PYOC 1M18D 1BFMA 2JSSA 2PYOD 4QLCB 4YM6C 3AZIA 1P3AA 5CPJA 3AFAC 5GXQC 1HQ3C 1H3OB 3AFAD 5GXQD 3LELB 1HQ3D 1P3GC 1S32A 3RELB 4YS3B 5CPKC 3B6GA 3B0DB 3UT9C 5CPKD 2F8NB 3WA9C 2BYKA 3UT9D 3WA9D 2IO5C 4ZBJB 3KWQC 3AZKC 5AVBB 1P3GB 3AZKD 3B6FC 3LZ1D 5B0YA 1KX3C 5AY8A 1U35A 3REJB 3MNNB 3KWQB 1EQZD 4CSRB 3TU4A 2F8NG 3B6FB 5B33C 3AZIB 1WWIA 4H9QA 4Z5TD 5CPJB 1P3AB 3REHB 5F99B 3AZED 1TAFA 4H9PB 5B32D 1P3ID 1S32B 1P34A 5GSUC 3X1SA 3KUYB 1KX5A 3NQUB 1A7WA 5AV5A 3C1BA 3A6NA 5B2ID 3W97B 3MGPA 3REIC 5AV8C 2AROA 3AZHA 3REID 5AV8D 3AZGA 3AZMA 5GSUB 3X1TD 5B1LC 3MGQA 4Z66A 3WTPA 5BNVB 3AV2D 2YFWA 5DNNA 3REKA 3AZLD 1AOIB 3O62B 3KXBB 1TAFB 5E5AB 5GT3A 2RVQC 1ID3A 5B24A 2RVQD 5AVCC 5JA4B 1KX4D 3AZFA 5AV5B 1HTAA 3A6NB 2HIOC 5B31C 4ZUXC 2HIOD 2BYMA 2AROB 5B31D 3AZHB 4J8WC 3AV1A 3W99B 5FUGA 3AZMB 4H9SA 1M19A 4J8WD 2NZDB 4XZQD 3MGQB 4WZSB 4NE5A 4ZUXB 3LZ0D 5BT1D 2YFWB 5DNNB 3MVDA 5CP6C 4XUJB 3REKB 3AYWC 5CPID 4WU9D 5CP6D 3UTAA 1TZYD 4R8PA 3MGRD 3AYWD 4AWLB 4KUDC 5GT0C 4KUDD 1M1AA 5GT0D 1ID3B 1P3BA 5AV6C 3VH5T 2CWEA
chains in the Genus database with same CATH superfamily
3EPLA 3F6TA 5KDMA 4KHAA 1P3LA 4LD9D 3UTBA 5B40B 4JJNA 3R45A 3W96C 2Y2HA 2RIQA 3W96D 3IP4C 2LY8A 2YFVA 5FUGB 4J8VC 3AZJA 1P3OC 3WKJA 3WAAA 4J8VD 2Y2PA 3C1CD 5B2JA 2FJ7C 5AV9C 3MGSC 4WNNA 3VH5W 5B0ZC 2L5AA 5AV9D 1P3MA 4X23B 1ZLAA 1JFIA 4R8PB 3X1VB 3AZNA 1M1AB 3AN2D 1B67A 5DNMB 1KU5A 5JRGC 1F66B 5B1MC 5JRGD 5B0ZB 2CV5C 2Y2QA 1ULYA 2CV5D 5BS7C 4WU8A 4QLCD 1P3LB 5BNXB 4KGCA 1BH9A 4J8UA 4JJNB 4UPKA 3LELC 3R45B 2DF4C 1P3FC 3LJAD 3W98A 2NQBA 3RELC 1Q9CA 1P3KD 4YS3C 3RELD 4YS3D 4NE3A 3B0DC 1M18A 2PYOA 4WNNB 4YM6D 1P3PA 4ZBJC 5AVBC 1P3FB 1P3GD 3AFAA 2XD5A 1HQ3A 3REJC 3MNNC 1PZRA 5CPKA 4CAYB 3REJD 3MNND 3KWQD 3UT9A 3WA9A 3AZIC 3B6FD 2ZY4A 1P3AC 5CPJC 1BH9B 4J8UB 3H0RC 3LZ1A 3REHC 5F99C 3AZKA 1KX3D 3REHD 5F99D 4J8XB 1S32C 4G91B 1EQZA 1P3PB 5B33D 3KUYC 2F2AC 3KUYD 4Z5TA 3W97C 3W97D 3AZEA 3B6GB 5B32A 1P3IA 5AY8C 3A1IA 2BYKB 4H9NA 5GSUD 3EPJA 3EPKA 3VH5A 5G49A 5B2IA 1AOIC 5B0YB 3O62C 3LZ1B 5AY8B 3KXBC 1U35B 3O62D 5E5AC 1AOID 3REIA 3KXBD 5AV8A 5E5AD 3B0BA 3TU4B 5B1LD 3X1TA 4H9QB 3X1SC 3X1UA 5AV5C 3AV2A 3A6NC 4Z5TB 5AV5D 3AZLA 2AROC 3AZHC 1N1JA 5B32B 1P34B 1P3IB 3W99C 5AVCD 3AZMC 2NZDC 3W99D 3X1SB 1KX5B 2NZDD 3MGQC 2ZM5A 1BH8A 3C1BB 1KX4A 2ZY3A 4EO5C 3MGPB 5G49B 4ZUXD 5DNNC 4XUJC 3REKC 4XUJD 1WWSA 2HIOA 5B31A 4AWLC 3AZGB 5B32G 4E45A 4Z66B 3WTPB 1ID3C 4J8WA 4EO5B 3X1TB 4XZQA 4DQYB 4HGAB 3X1UB 3LZ0A 2ZY2A 3AV2B 5CPIA 3AZLB 4WU9A 5CP6A 1TZYA 3MGRA 5GT3B 5B40C 3AYWA 3NQJA 1N1JB 5B24B 4KUDA 5B40D 5GT0A 4WV4B 5AV6D 3AZFB 3VH6W 4UUZA 1KX4B 2BYMB 4E44A 4X23C 4H9RA 4R8PC 3X1VC 4X23D 3AV1B 4LD9A 1M19B 3X1VD 1M1AC 5DNMC 1P3OD 3W96A 5DNMD 1P3BC 1F66C 4XZQB 1F66D 2FJ7D 4J8VA 3MGSD 3MVDB 2Y2KA 5B0ZD 3C1CA 3UTAB 5CPIB 1P3LC 4WU9B 1TZYB 3MGRB 4JJNC 4DRAA 1P3BB 3AN2A 2JCHA 5B1MD 3A1KA 1W2EA 5KDMB 3WKJC 5JRGA 4KHAB 4UUZB 2CV5A 3FDDA 5C3IB 3UTBB 4QLCA 4G92B 1P3MC 3LELD 4LD9B 1P3FD 2YFVB 3AZJB 3WKJB 3B0CT 1H3OA 3EG5B 3WAAB 3LJAA 5B2JB 2HUEB 1P3KA 2F8ND 3RELA 3C1CB 4YS3A 1P3MB 4H9OB 1ZLAB 1JFIB 4YM6A 5AVBD 3AZNB 5GXQA 2Y2MA 4J8UC 1P3GA 3AN2B 4J8XC 1R4VA 4G91C 2NQBC 4J8XD 3B0CW 4WU8B 2Y2NA 1M18C 1P3PC 3REJA 3MNNA 3KWQA 3AZID 4CSRA 2Y2GA 5CPJD 1P3AD 1P3PD 4KGCB 3B6FA 3W98B 2NQBB 1Z2CB 1S32D 1KX3A 3REHA 5F99A 3B6GC 3LJAB 1M18B 4H9PA 1P3KB 2PYOB 3B6GD 3VH6A 1B6WA 4YM6B 5B33A 3AFAB 5GXQB 3KUYA 3NQUA 1HQ3B 3P5JB 5B0YC 3LZ1C 3W97A 5B0YD 1U35C 5AY8D 2J8PA 1U35D 5CPKB 3TU4C 3UT9B 3WA9B 3TU4D 5BO0A 5GSUA 1EQZC 2IO5B 3AZKB 2F8NH 2F8NK 4Z5TC 5BNVA 3AZEC 1AOIA 3O62A 1KX3B 3KSYA 3KXBA 5B32C 1P34C 1P3IC 5E5AA 1P34D 1EQZB 5B1LA 1KX5C 3C1BC 3X1SD 1KX5D 3C1BD 5B33B 3A6ND 3MGPC 5JA4A 3MGPD 3AZEB 5B2IC 2AROD 3AZHD 3AZGC 4H9NB 3AZGD 3AZMD 4Z66C 3WTPC 3MGQD 5AVCA 4Z66D 3WTPD 3X1TC 3W99A 2NZDA 5BO0B 5B2IB 4HGAC 5DNND 3X1UC 3REKD 2Y2OA 3X1UD 3AV2C 4ZUXA 3REIB 5AV8B 3AZLC 3VH6T 4NFTA 4XUJA 5GT3C 2BG1A 5B24C 5GT3D 1ID3D 5B24D 2JE5A 5CHLB 5B1LB 4NE6A 3AZFC 4WJ3C 3AZFD 4H9OA 1KX4C 3AV1C 1M19C 4H9SC 3AV1D 5B40A 1M19D 1BH8B 5AVCB 5AV6A 2Y2IA 4XZQC 3MVDC 3MVDD 3LZ0C 3UTAC 5BT1C 2HIOB 5B31B 3H0MC 3UTAD 4R8PD 5CPIC 4WU9C 1TZYC 3MGRC 3V9RA 1M1AD 4X23A 4J8WB 1F1EA 3X1VA 1P3BD 1P3OA 4M6BA 4DRBA 5DNMA 3AL0C 3KFUG 3LZ0B 2UWXA 1F66A 2FJ7A 2Y2LA 5AV9A 3MGSA 5B0ZA 4Z2MG 5C3IC 4Z2MH 2W8SA 5CP6B 3UTBC 3AYWB 1P3LD 5B31G 3NQJB 4KUDB 4G92C 3UTBD 4JJND 5GT0B 4LD9C 5BNXA 3AZJC 3WAAC 3AZJD 3WKJD 5B2JC 5B1MA 2HUEC 2FFFB 5AV6B 3WAAD 5B2JD 3C1CC 5BS7A 1ZLAC 4H9RB 1P3MD 1ZLAD 3AZNC 3WTPE 3LELA 3AZND 3V9RB 3W96B 1P3FA 3AN2C 2VQRA 1P3OB 4J8VB 4WU8C 2FJ7B 2F8NA 5AV9B 3MGSB 4WU8D 4KGCC 4CAYA 4QLCC 5AVBA 4J8UD 4KGCD 3W98C 3W98D 2NQBD 5JRGB 3LJAC 5B1MB 2CV5B 4J8XA 1P3KC 2PYOC 1M18D 1BFMA 2JSSA 2PYOD 4QLCB 4YM6C 3AZIA 1P3AA 5CPJA 3AFAC 5GXQC 1HQ3C 1H3OB 3AFAD 5GXQD 3LELB 1HQ3D 1P3GC 1S32A 3RELB 4YS3B 5CPKC 3B6GA 3B0DB 3UT9C 5CPKD 2F8NB 3WA9C 2BYKA 3UT9D 3WA9D 2IO5C 4ZBJB 3KWQC 3AZKC 5AVBB 1P3GB 3AZKD 3B6FC 3LZ1D 2G5HC 5B0YA 1KX3C 5AY8A 1U35A 3REJB 3MNNB 3KWQB 1EQZD 4CSRB 3TU4A 2F8NG 3H0LC 3B6FB 5B33C 3AZIB 1WWIA 4H9QA 4Z5TD 5CPJB 1P3AB 3REHB 5F99B 3AZED 1TAFA 4H9PB 5B32D 1P3ID 1S32B 1T3UA 1P34A 2ZY5A 5GSUC 3X1SA 3KUYB 1KX5A 3NQUB 1A7WA 5AV5A 3C1BA 3A6NA 5B2ID 3W97B 3MGPA 3REIC 5AV8C 2AROA 3AZHA 3REID 5AV8D 3AZGA 3AZMA 5GSUB 3X1TD 5B1LC 3MGQA 4Z66A 3WTPA 5BNVB 3AV2D 2YFWA 5DNNA 3REKA 3AZLD 1AOIB 3O62B 3KXBB 1TAFB 5E5AB 5GT3A 2RVQC 1ID3A 5B24A 2RVQD 2G5IC 5AVCC 5JA4B 1KX4D 3AZFA 5AV5B 1HTAA 2Y2JA 2XD1A 3A6NB 2HIOC 5B31C 4ZUXC 2HIOD 2BYMA 2AROB 5B31D 3AZHB 2DQNC 4J8WC 3AV1A 3W99B 5FUGA 3AZMB 4H9SA 1M19A 4J8WD 2NZDB 4XZQD 3MGQB 4WZSB 3EPHA 4NE5A 4ZUXB 3LZ0D 5BT1D 2YFWB 5DNNB 3MVDA 5CP6C 4XUJB 3REKB 3AYWC 5CPID 4WU9D 5CP6D 3UTAA 1TZYD 4R8PA 3MGRD 3AYWD 4AWLB 4KUDC 5GT0C 4KUDD 1M1AA 5GT0D 1ID3B 1P3BA 5AV6C 3VH5T 2CWEA
chains in the Genus database with same CATH topology
3EPLA 3F6TA 5KDMA 4KHAA 1P3LA 4LD9D 3UTBA 5B40B 4JJNA 3R45A 3W96C 2Y2HA 2RIQA 3W96D 3IP4C 2LY8A 2YFVA 5FUGB 4J8VC 3AZJA 1P3OC 3WKJA 3WAAA 4J8VD 2Y2PA 3C1CD 5B2JA 2FJ7C 5AV9C 3MGSC 4WNNA 3VH5W 5B0ZC 2L5AA 5AV9D 1P3MA 4X23B 1ZLAA 1JFIA 4R8PB 3X1VB 3AZNA 1M1AB 3AN2D 1B67A 5DNMB 1KU5A 5JRGC 1F66B 5B1MC 5JRGD 5B0ZB 2CV5C 2Y2QA 1ULYA 2CV5D 5BS7C 4WU8A 4QLCD 1P3LB 5BNXB 4KGCA 1BH9A 4J8UA 4JJNB 4UPKA 3LELC 3R45B 2DF4C 1P3FC 3LJAD 3W98A 2NQBA 3RELC 1Q9CA 1P3KD 4YS3C 3RELD 4YS3D 4NE3A 3B0DC 1M18A 2PYOA 4WNNB 4YM6D 1P3PA 4ZBJC 5AVBC 1P3FB 1P3GD 3AFAA 2XD5A 1HQ3A 3REJC 3MNNC 1PZRA 5CPKA 4CAYB 3REJD 3MNND 3KWQD 3UT9A 3WA9A 3AZIC 3B6FD 2ZY4A 1P3AC 5CPJC 1BH9B 4J8UB 3H0RC 3LZ1A 3REHC 5F99C 3AZKA 1KX3D 3REHD 5F99D 4J8XB 1S32C 4G91B 1EQZA 1P3PB 5B33D 3KUYC 2F2AC 3KUYD 4Z5TA 3W97C 3W97D 3AZEA 3B6GB 5B32A 1P3IA 5AY8C 3A1IA 2BYKB 4H9NA 5GSUD 3EPJA 3EPKA 3VH5A 5G49A 5B2IA 1AOIC 5B0YB 3O62C 3LZ1B 5AY8B 3KXBC 1U35B 3O62D 5E5AC 1AOID 3REIA 3KXBD 5AV8A 5E5AD 3B0BA 3TU4B 5B1LD 3X1TA 4H9QB 3X1SC 3X1UA 5AV5C 3AV2A 3A6NC 4Z5TB 5AV5D 3AZLA 2AROC 3AZHC 1N1JA 5B32B 1P34B 1P3IB 3W99C 5AVCD 3AZMC 2NZDC 3W99D 3X1SB 1KX5B 2NZDD 3MGQC 2ZM5A 1BH8A 3C1BB 1KX4A 2ZY3A 4EO5C 3MGPB 5G49B 4ZUXD 5DNNC 4XUJC 3REKC 4XUJD 1WWSA 2HIOA 5B31A 4AWLC 3AZGB 5B32G 4E45A 4Z66B 3WTPB 1ID3C 4J8WA 4EO5B 3X1TB 4XZQA 4DQYB 4HGAB 3X1UB 3LZ0A 2ZY2A 3AV2B 5CPIA 3AZLB 4WU9A 5CP6A 1TZYA 3MGRA 5GT3B 5B40C 3AYWA 3NQJA 1N1JB 5B24B 4KUDA 5B40D 5GT0A 4WV4B 5AV6D 3AZFB 3VH6W 4UUZA 1KX4B 2BYMB 4E44A 4X23C 4H9RA 4R8PC 3X1VC 4X23D 3AV1B 4LD9A 1M19B 3X1VD 1M1AC 5DNMC 1P3OD 3W96A 5DNMD 1P3BC 1F66C 4XZQB 1F66D 2FJ7D 4J8VA 3MGSD 3MVDB 2Y2KA 5B0ZD 3C1CA 3UTAB 5CPIB 1P3LC 4WU9B 1TZYB 3MGRB 4JJNC 4DRAA 1P3BB 3AN2A 2JCHA 5B1MD 3A1KA 1W2EA 5KDMB 3WKJC 5JRGA 4KHAB 4UUZB 2CV5A 3FDDA 5C3IB 3UTBB 4QLCA 4G92B 1P3MC 3LELD 4LD9B 1P3FD 2YFVB 3AZJB 3WKJB 3B0CT 1H3OA 3EG5B 3WAAB 3LJAA 5B2JB 2HUEB 1P3KA 2F8ND 3RELA 3C1CB 4YS3A 1P3MB 4H9OB 1ZLAB 1JFIB 4YM6A 5AVBD 3AZNB 5GXQA 2Y2MA 4J8UC 1P3GA 3AN2B 4J8XC 1R4VA 4G91C 2NQBC 4J8XD 3B0CW 4WU8B 2Y2NA 1M18C 1P3PC 3REJA 3MNNA 3KWQA 3AZID 4CSRA 2Y2GA 5CPJD 1P3AD 1P3PD 4KGCB 3B6FA 3W98B 2NQBB 1Z2CB 1S32D 1KX3A 3REHA 5F99A 3B6GC 3LJAB 1M18B 4H9PA 1P3KB 2PYOB 3B6GD 3VH6A 1B6WA 4YM6B 5B33A 3AFAB 5GXQB 3KUYA 3NQUA 1HQ3B 3P5JB 5B0YC 3LZ1C 3W97A 5B0YD 1U35C 5AY8D 2J8PA 1U35D 5CPKB 3TU4C 3UT9B 3WA9B 3TU4D 5BO0A 5GSUA 1EQZC 2IO5B 3AZKB 2F8NH 2F8NK 4Z5TC 5BNVA 3AZEC 1AOIA 3O62A 1KX3B 3KSYA 3KXBA 5B32C 1P34C 1P3IC 5E5AA 1P34D 1EQZB 5B1LA 1KX5C 3C1BC 3X1SD 1KX5D 3C1BD 5B33B 3A6ND 3MGPC 5JA4A 3MGPD 3AZEB 5B2IC 2AROD 3AZHD 3AZGC 4H9NB 3AZGD 3AZMD 4Z66C 3WTPC 3MGQD 5AVCA 4Z66D 3WTPD 3X1TC 3W99A 2NZDA 5BO0B 5B2IB 4HGAC 5DNND 3X1UC 3REKD 2Y2OA 3X1UD 3AV2C 4ZUXA 3REIB 5AV8B 3AZLC 3VH6T 4NFTA 4XUJA 5GT3C 2BG1A 5B24C 5GT3D 1ID3D 5B24D 2JE5A 5CHLB 5B1LB 4NE6A 3AZFC 4WJ3C 3AZFD 4H9OA 1KX4C 3AV1C 1M19C 4H9SC 3AV1D 5B40A 1M19D 1BH8B 5AVCB 5AV6A 2Y2IA 4XZQC 3MVDC 3MVDD 3LZ0C 3UTAC 5BT1C 2HIOB 5B31B 3H0MC 3UTAD 4R8PD 5CPIC 4WU9C 1TZYC 3MGRC 3V9RA 1M1AD 4X23A 4J8WB 1F1EA 3X1VA 1P3BD 1P3OA 4M6BA 4DRBA 5DNMA 3AL0C 3KFUG 3LZ0B 2UWXA 1F66A 2FJ7A 2Y2LA 5AV9A 3MGSA 5B0ZA 4Z2MG 5C3IC 4Z2MH 2W8SA 5CP6B 3UTBC 3AYWB 1P3LD 5B31G 3NQJB 4KUDB 4G92C 3UTBD 4JJND 5GT0B 4LD9C 5BNXA 3AZJC 3WAAC 3AZJD 3WKJD 5B2JC 5B1MA 2HUEC 2FFFB 5AV6B 3WAAD 5B2JD 3C1CC 5BS7A 1ZLAC 4H9RB 1P3MD 1ZLAD 3AZNC 3WTPE 3LELA 3AZND 3V9RB 3W96B 1P3FA 3AN2C 2VQRA 1P3OB 4J8VB 4WU8C 2FJ7B 2F8NA 5AV9B 3MGSB 4WU8D 4KGCC 4CAYA 4QLCC 5AVBA 4J8UD 4KGCD 3W98C 3W98D 2NQBD 5JRGB 3LJAC 5B1MB 2CV5B 4J8XA 1P3KC 2PYOC 1M18D 1BFMA 2JSSA 2PYOD 4QLCB 4YM6C 3AZIA 1P3AA 5CPJA 3AFAC 5GXQC 1HQ3C 1H3OB 3AFAD 5GXQD 3LELB 1HQ3D 1P3GC 1S32A 3RELB 4YS3B 5CPKC 3B6GA 3B0DB 3UT9C 5CPKD 2F8NB 3WA9C 2BYKA 3UT9D 3WA9D 2IO5C 4ZBJB 3KWQC 3AZKC 5AVBB 1P3GB 3AZKD 3B6FC 3LZ1D 2G5HC 5B0YA 1KX3C 5AY8A 1U35A 3REJB 3MNNB 3KWQB 1EQZD 4CSRB 3TU4A 2F8NG 3H0LC 3B6FB 5B33C 3AZIB 1WWIA 4H9QA 4Z5TD 5CPJB 1P3AB 3REHB 5F99B 3AZED 1TAFA 4H9PB 5B32D 1P3ID 1S32B 1T3UA 1P34A 2ZY5A 5GSUC 3X1SA 3KUYB 1KX5A 3NQUB 1A7WA 5AV5A 3C1BA 3A6NA 5B2ID 3W97B 3MGPA 3REIC 5AV8C 2AROA 3AZHA 3REID 5AV8D 3AZGA 3AZMA 5GSUB 3X1TD 5B1LC 3MGQA 4Z66A 3WTPA 5BNVB 3AV2D 2YFWA 5DNNA 3REKA 3AZLD 1AOIB 3O62B 3KXBB 1TAFB 5E5AB 5GT3A 2RVQC 1ID3A 5B24A 2RVQD 2G5IC 5AVCC 5JA4B 1KX4D 3AZFA 5AV5B 1HTAA 2Y2JA 2XD1A 3A6NB 2HIOC 5B31C 4ZUXC 2HIOD 2BYMA 2AROB 5B31D 3AZHB 2DQNC 4J8WC 3AV1A 3W99B 5FUGA 3AZMB 4H9SA 1M19A 4J8WD 2NZDB 4XZQD 3MGQB 4WZSB 3EPHA 4NE5A 4ZUXB 3LZ0D 5BT1D 2YFWB 5DNNB 3MVDA 5CP6C 4XUJB 3REKB 3AYWC 5CPID 4WU9D 5CP6D 3UTAA 1TZYD 4R8PA 3MGRD 3AYWD 4AWLB 4KUDC 5GT0C 4KUDD 1M1AA 5GT0D 1ID3B 1P3BA 5AV6C 3VH5T 2CWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDM A;  4KHA A;  1P3L A;  4LD9 D;  3UTB A;  5B40 B;  4JJN A;  3R45 A;  3W96 C;  3W96 D;  2LY8 A;  2YFV A;  5FUG B;  4J8V C;  3AZJ A;  1P3O C;  3WKJ A;  3WAA A;  4J8V D;  3C1C D;  5B2J A;  2FJ7 C;  5AV9 C;  3MGS C;  4WNN A;  3VH5 W;  5B0Z C;  2L5A A;  5AV9 D;  1P3M A;  4X23 B;  1ZLA A;  1JFI A;  4R8P B;  3X1V B;  3AZN A;  1M1A B;  3AN2 D;  1B67 A;  5DNM B;  1KU5 A;  5JRG C;  1F66 B;  5B1M C;  5JRG D;  5B0Z B;  2CV5 C;  1ULY A;  2CV5 D;  5BS7 C;  4WU8 A;  4QLC D;  1P3L B;  5BNX B;  4KGC A;  1BH9 A;  4J8U A;  4JJN B;  3LEL C;  3R45 B;  1P3F C;  3LJA D;  3W98 A;  2NQB A;  3REL C;  1Q9C A;  1P3K D;  4YS3 C;  3REL D;  4YS3 D;  4NE3 A;  3B0D C;  1M18 A;  2PYO A;  4WNN B;  4YM6 D;  1P3P A;  4ZBJ C;  5AVB C;  1P3F B;  1P3G D;  3AFA A;  1HQ3 A;  3REJ C;  3MNN C;  5CPK A;  4CAY B;  3REJ D;  3MNN D;  3KWQ D;  3UT9 A;  3WA9 A;  3AZI C;  3B6F D;  1P3A C;  5CPJ C;  1BH9 B;  4J8U B;  3AZK A;  3LZ1 A;  3REH C;  5F99 C;  1KX3 D;  3REH D;  5F99 D;  4J8X B;  1S32 C;  4G91 B;  1EQZ A;  1P3P B;  5B33 D;  3KUY C;  3KUY D;  4Z5T A;  3W97 C;  3W97 D;  3AZE A;  3B6G B;  5B32 A;  1P3I A;  5AY8 C;  2BYK B;  4H9N A;  5GSU D;  3VH5 A;  5G49 A;  5B2I A;  1AOI C;  5B0Y B;  3O62 C;  3LZ1 B;  5AY8 B;  3KXB C;  1U35 B;  3O62 D;  5E5A C;  1AOI D;  3REI A;  3KXB D;  5AV8 A;  5E5A D;  3B0B A;  3TU4 B;  5B1L D;  3X1T A;  4H9Q B;  3X1S C;  3X1U A;  5AV5 C;  3AV2 A;  3A6N C;  4Z5T B;  5AV5 D;  3AZL A;  2ARO C;  3AZH C;  1N1J A;  5B32 B;  1P34 B;  1P3I B;  3W99 C;  5AVC D;  3AZM C;  2NZD C;  3W99 D;  3X1S B;  1KX5 B;  2NZD D;  3MGQ C;  1BH8 A;  3C1B B;  1KX4 A;  3MGP B;  4EO5 C;  5G49 B;  4ZUX D;  5DNN C;  4XUJ C;  3REK C;  4XUJ D;  1WWS A;  2HIO A;  5B31 A;  4AWL C;  3AZG B;  5B32 G;  4E45 A;  4Z66 B;  3WTP B;  1ID3 C;  4J8W A;  4EO5 B;  3X1T B;  4XZQ A;  4HGA B;  3X1U B;  3LZ0 A;  3AV2 B;  5CPI A;  3AZL B;  4WU9 A;  5CP6 A;  1TZY A;  3MGR A;  5GT3 B;  5B40 C;  3AYW A;  3NQJ A;  1N1J B;  5B24 B;  4KUD A;  5B40 D;  5GT0 A;  4WV4 B;  5AV6 D;  3AZF B;  3VH6 W;  4UUZ A;  1KX4 B;  2BYM B;  4E44 A;  4X23 C;  4H9R A;  4R8P C;  3X1V C;  4X23 D;  3AV1 B;  4LD9 A;  1M19 B;  3X1V D;  1M1A C;  5DNM C;  1P3O D;  3W96 A;  5DNM D;  1P3B C;  1F66 C;  4XZQ B;  1F66 D;  2FJ7 D;  4J8V A;  3MGS D;  3MVD B;  3C1C A;  5B0Z D;  3UTA B;  5CPI B;  1P3L C;  4WU9 B;  1TZY B;  3MGR B;  4JJN C;  4DRA A;  1P3B B;  3AN2 A;  5B1M D;  5KDM B;  3WKJ C;  5JRG A;  4KHA B;  4UUZ B;  2CV5 A;  5C3I B;  3UTB B;  4QLC A;  4G92 B;  1P3M C;  3LEL D;  4LD9 B;  1P3F D;  2YFV B;  3AZJ B;  3WKJ B;  3B0C T;  1H3O A;  3WAA B;  3LJA A;  5B2J B;  2HUE B;  1P3K A;  2F8N D;  3REL A;  3C1C B;  4YS3 A;  1P3M B;  4H9O B;  1ZLA B;  1JFI B;  4YM6 A;  5AVB D;  3AZN B;  5GXQ A;  4J8U C;  1P3G A;  3AN2 B;  4J8X C;  1R4V A;  4G91 C;  2NQB C;  4J8X D;  3B0C W;  4WU8 B;  1M18 C;  1P3P C;  3REJ A;  3MNN A;  3KWQ A;  3AZI D;  4CSR A;  5CPJ D;  1P3A D;  1P3P D;  4KGC B;  3B6F A;  3W98 B;  2NQB B;  1S32 D;  1KX3 A;  3REH A;  5F99 A;  3B6G C;  3LJA B;  1M18 B;  4H9P A;  1P3K B;  2PYO B;  3B6G D;  3VH6 A;  1B6W A;  4YM6 B;  5B33 A;  3AFA B;  5GXQ B;  3KUY A;  1HQ3 B;  3NQU A;  5B0Y C;  3LZ1 C;  3W97 A;  5B0Y D;  1U35 C;  5AY8 D;  1U35 D;  5CPK B;  3TU4 C;  3UT9 B;  3WA9 B;  3TU4 D;  5BO0 A;  5GSU A;  1EQZ C;  2IO5 B;  3AZK B;  2F8N H;  2F8N K;  4Z5T C;  5BNV A;  3AZE C;  1AOI A;  3O62 A;  1KX3 B;  3KSY A;  3KXB A;  5B32 C;  1P34 C;  1P3I C;  5E5A A;  1P34 D;  1EQZ B;  5B1L A;  1KX5 C;  3C1B C;  3X1S D;  1KX5 D;  3C1B D;  5B33 B;  3A6N D;  3MGP C;  5JA4 A;  3MGP D;  3AZE B;  5B2I C;  2ARO D;  3AZH D;  3AZG C;  4H9N B;  3AZG D;  3AZM D;  4Z66 C;  3WTP C;  3MGQ D;  5AVC A;  4Z66 D;  3WTP D;  3X1T C;  3W99 A;  2NZD A;  5BO0 B;  5B2I B;  4HGA C;  5DNN D;  3X1U C;  3REK D;  3X1U D;  3AV2 C;  4ZUX A;  3REI B;  5AV8 B;  3AZL C;  3VH6 T;  4NFT A;  4XUJ A;  5GT3 C;  5B24 C;  5GT3 D;  1ID3 D;  5B24 D;  5CHL B;  5B1L B;  4NE6 A;  3AZF C;  3AZF D;  4H9O A;  1KX4 C;  3AV1 C;  1M19 C;  4H9S C;  3AV1 D;  5B40 A;  1M19 D;  1BH8 B;  5AVC B;  5AV6 A;  4XZQ C;  3MVD C;  3MVD D;  3LZ0 C;  3UTA C;  5BT1 C;  2HIO B;  5B31 B;  3UTA D;  4R8P D;  5CPI C;  4WU9 C;  1TZY C;  3MGR C;  3V9R A;  1M1A D;  4X23 A;  4J8W B;  1F1E A;  3X1V A;  1P3B D;  1P3O A;  4M6B A;  4DRB A;  5DNM A;  3LZ0 B;  1F66 A;  2FJ7 A;  5AV9 A;  3MGS A;  5B0Z A;  4Z2M G;  5C3I C;  4Z2M H;  5CP6 B;  3UTB C;  3AYW B;  1P3L D;  5B31 G;  3NQJ B;  4KUD B;  4G92 C;  3UTB D;  4JJN D;  5GT0 B;  4LD9 C;  5BNX A;  3AZJ C;  3WAA C;  3AZJ D;  3WKJ D;  5B2J C;  5B1M A;  2HUE C;  5AV6 B;  3WAA D;  5B2J D;  3C1C C;  5BS7 A;  1ZLA C;  4H9R B;  1P3M D;  1ZLA D;  3AZN C;  3WTP E;  3LEL A;  3AZN D;  3V9R B;  3W96 B;  1P3F A;  3AN2 C;  1P3O B;  4J8V B;  4WU8 C;  2FJ7 B;  2F8N A;  5AV9 B;  3MGS B;  4WU8 D;  4KGC C;  4CAY A;  4QLC C;  5AVB A;  4J8U D;  4KGC D;  3W98 C;  3W98 D;  2NQB D;  5JRG B;  3LJA C;  5B1M B;  2CV5 B;  4J8X A;  1P3K C;  2PYO C;  1M18 D;  1BFM A;  2JSS A;  2PYO D;  4QLC B;  4YM6 C;  3AZI A;  1P3A A;  5CPJ A;  3AFA C;  5GXQ C;  1HQ3 C;  1H3O B;  3AFA D;  5GXQ D;  3LEL B;  1HQ3 D;  1P3G C;  1S32 A;  3REL B;  4YS3 B;  5CPK C;  3B6G A;  3B0D B;  3UT9 C;  5CPK D;  2F8N B;  3WA9 C;  2BYK A;  3UT9 D;  3WA9 D;  2IO5 C;  4ZBJ B;  3KWQ C;  3AZK C;  5AVB B;  1P3G B;  3AZK D;  3B6F C;  3LZ1 D;  5B0Y A;  1KX3 C;  5AY8 A;  1U35 A;  3REJ B;  3MNN B;  3KWQ B;  1EQZ D;  4CSR B;  3TU4 A;  2F8N G;  3B6F B;  5B33 C;  3AZI B;  1WWI A;  4H9Q A;  4Z5T D;  5CPJ B;  1P3A B;  3REH B;  5F99 B;  3AZE D;  1TAF A;  4H9P B;  5B32 D;  1P3I D;  1S32 B;  1P34 A;  5GSU C;  3X1S A;  3KUY B;  1KX5 A;  3NQU B;  1A7W A;  5AV5 A;  3C1B A;  3A6N A;  5B2I D;  3W97 B;  3MGP A;  3REI C;  5AV8 C;  2ARO A;  3AZH A;  3REI D;  5AV8 D;  3AZG A;  3AZM A;  5GSU B;  3X1T D;  5B1L C;  3MGQ A;  4Z66 A;  3WTP A;  5BNV B;  3AV2 D;  2YFW A;  5DNN A;  3REK A;  3AZL D;  1AOI B;  3O62 B;  3KXB B;  1TAF B;  5E5A B;  5GT3 A;  2RVQ C;  1ID3 A;  5B24 A;  2RVQ D;  5AVC C;  5JA4 B;  1KX4 D;  3AZF A;  5AV5 B;  1HTA A;  3A6N B;  2HIO C;  5B31 C;  4ZUX C;  2HIO D;  2BYM A;  2ARO B;  5B31 D;  3AZH B;  4J8W C;  3AV1 A;  3W99 B;  5FUG A;  3AZM B;  4H9S A;  1M19 A;  4J8W D;  2NZD B;  4XZQ D;  3MGQ B;  4WZS B;  4NE5 A;  4ZUX B;  3LZ0 D;  5BT1 D;  2YFW B;  5DNN B;  3MVD A;  5CP6 C;  4XUJ B;  3REK B;  3AYW C;  5CPI D;  4WU9 D;  5CP6 D;  3UTA A;  1TZY D;  4R8P A;  3MGR D;  3AYW D;  4AWL B;  4KUD C;  5GT0 C;  4KUD D;  1M1A A;  5GT0 D;  1ID3 B;  1P3B A;  5AV6 C;  3VH5 T;  2CWE A; 
#chains in the Genus database with same CATH topology
 3EPL A;  3F6T A;  5KDM A;  4KHA A;  1P3L A;  4LD9 D;  3UTB A;  5B40 B;  4JJN A;  3R45 A;  3W96 C;  2Y2H A;  2RIQ A;  3W96 D;  3IP4 C;  2LY8 A;  2YFV A;  5FUG B;  4J8V C;  3AZJ A;  1P3O C;  3WKJ A;  3WAA A;  4J8V D;  2Y2P A;  3C1C D;  5B2J A;  2FJ7 C;  5AV9 C;  3MGS C;  4WNN A;  3VH5 W;  5B0Z C;  2L5A A;  5AV9 D;  1P3M A;  4X23 B;  1ZLA A;  1JFI A;  4R8P B;  3X1V B;  3AZN A;  1M1A B;  3AN2 D;  1B67 A;  5DNM B;  1KU5 A;  5JRG C;  1F66 B;  5B1M C;  5JRG D;  5B0Z B;  2CV5 C;  2Y2Q A;  1ULY A;  2CV5 D;  5BS7 C;  4WU8 A;  4QLC D;  1P3L B;  5BNX B;  4KGC A;  1BH9 A;  4J8U A;  4JJN B;  4UPK A;  3LEL C;  3R45 B;  2DF4 C;  1P3F C;  3LJA D;  3W98 A;  2NQB A;  3REL C;  1Q9C A;  1P3K D;  4YS3 C;  3REL D;  4YS3 D;  4NE3 A;  3B0D C;  1M18 A;  2PYO A;  4WNN B;  4YM6 D;  1P3P A;  4ZBJ C;  5AVB C;  1P3F B;  1P3G D;  3AFA A;  2XD5 A;  1HQ3 A;  3REJ C;  3MNN C;  1PZR A;  5CPK A;  4CAY B;  3REJ D;  3MNN D;  3KWQ D;  3UT9 A;  3WA9 A;  3AZI C;  3B6F D;  2ZY4 A;  1P3A C;  5CPJ C;  1BH9 B;  4J8U B;  3H0R C;  3LZ1 A;  3REH C;  5F99 C;  3AZK A;  1KX3 D;  3REH D;  5F99 D;  4J8X B;  1S32 C;  4G91 B;  1EQZ A;  1P3P B;  5B33 D;  3KUY C;  2F2A C;  3KUY D;  4Z5T A;  3W97 C;  3W97 D;  3AZE A;  3B6G B;  5B32 A;  1P3I A;  5AY8 C;  3A1I A;  2BYK B;  4H9N A;  5GSU D;  3EPJ A;  3EPK A;  3VH5 A;  5G49 A;  5B2I A;  1AOI C;  5B0Y B;  3O62 C;  3LZ1 B;  5AY8 B;  3KXB C;  1U35 B;  3O62 D;  5E5A C;  1AOI D;  3REI A;  3KXB D;  5AV8 A;  5E5A D;  3B0B A;  3TU4 B;  5B1L D;  3X1T A;  4H9Q B;  3X1S C;  3X1U A;  5AV5 C;  3AV2 A;  3A6N C;  4Z5T B;  5AV5 D;  3AZL A;  2ARO C;  3AZH C;  1N1J A;  5B32 B;  1P34 B;  1P3I B;  3W99 C;  5AVC D;  3AZM C;  2NZD C;  3W99 D;  3X1S B;  1KX5 B;  2NZD D;  3MGQ C;  2ZM5 A;  1BH8 A;  3C1B B;  1KX4 A;  2ZY3 A;  4EO5 C;  3MGP B;  5G49 B;  4ZUX D;  5DNN C;  4XUJ C;  3REK C;  4XUJ D;  1WWS A;  2HIO A;  5B31 A;  4AWL C;  3AZG B;  5B32 G;  4E45 A;  4Z66 B;  3WTP B;  1ID3 C;  4J8W A;  4EO5 B;  3X1T B;  4XZQ A;  4DQY B;  4HGA B;  3X1U B;  3LZ0 A;  2ZY2 A;  3AV2 B;  5CPI A;  3AZL B;  4WU9 A;  5CP6 A;  1TZY A;  3MGR A;  5GT3 B;  5B40 C;  3AYW A;  3NQJ A;  1N1J B;  5B24 B;  4KUD A;  5B40 D;  5GT0 A;  4WV4 B;  5AV6 D;  3AZF B;  3VH6 W;  4UUZ A;  1KX4 B;  2BYM B;  4E44 A;  4X23 C;  4H9R A;  4R8P C;  3X1V C;  4X23 D;  3AV1 B;  4LD9 A;  1M19 B;  3X1V D;  1M1A C;  5DNM C;  1P3O D;  3W96 A;  5DNM D;  1P3B C;  1F66 C;  4XZQ B;  1F66 D;  2FJ7 D;  4J8V A;  3MGS D;  3MVD B;  2Y2K A;  5B0Z D;  3C1C A;  3UTA B;  5CPI B;  1P3L C;  4WU9 B;  1TZY B;  3MGR B;  4JJN C;  4DRA A;  1P3B B;  3AN2 A;  2JCH A;  5B1M D;  3A1K A;  1W2E A;  5KDM B;  3WKJ C;  5JRG A;  4KHA B;  4UUZ B;  2CV5 A;  3FDD A;  5C3I B;  3UTB B;  4QLC A;  4G92 B;  1P3M C;  3LEL D;  4LD9 B;  1P3F D;  2YFV B;  3AZJ B;  3WKJ B;  3B0C T;  1H3O A;  3EG5 B;  3WAA B;  3LJA A;  5B2J B;  2HUE B;  1P3K A;  2F8N D;  3REL A;  3C1C B;  4YS3 A;  1P3M B;  4H9O B;  1ZLA B;  1JFI B;  4YM6 A;  5AVB D;  3AZN B;  5GXQ A;  2Y2M A;  4J8U C;  1P3G A;  3AN2 B;  4J8X C;  1R4V A;  4G91 C;  2NQB C;  4J8X D;  3B0C W;  4WU8 B;  2Y2N A;  1M18 C;  1P3P C;  3REJ A;  3MNN A;  3KWQ A;  3AZI D;  4CSR A;  2Y2G A;  5CPJ D;  1P3A D;  1P3P D;  4KGC B;  3B6F A;  3W98 B;  2NQB B;  1Z2C B;  1S32 D;  1KX3 A;  3REH A;  5F99 A;  3B6G C;  3LJA B;  1M18 B;  4H9P A;  1P3K B;  2PYO B;  3B6G D;  3VH6 A;  1B6W A;  4YM6 B;  5B33 A;  3AFA B;  5GXQ B;  3KUY A;  3NQU A;  1HQ3 B;  3P5J B;  5B0Y C;  3LZ1 C;  3W97 A;  5B0Y D;  1U35 C;  5AY8 D;  2J8P A;  1U35 D;  5CPK B;  3TU4 C;  3UT9 B;  3WA9 B;  3TU4 D;  5BO0 A;  5GSU A;  1EQZ C;  2IO5 B;  3AZK B;  2F8N H;  2F8N K;  4Z5T C;  5BNV A;  3AZE C;  1AOI A;  3O62 A;  1KX3 B;  3KSY A;  3KXB A;  5B32 C;  1P34 C;  1P3I C;  5E5A A;  1P34 D;  1EQZ B;  5B1L A;  1KX5 C;  3C1B C;  3X1S D;  1KX5 D;  3C1B D;  5B33 B;  3A6N D;  3MGP C;  5JA4 A;  3MGP D;  3AZE B;  5B2I C;  2ARO D;  3AZH D;  3AZG C;  4H9N B;  3AZG D;  3AZM D;  4Z66 C;  3WTP C;  3MGQ D;  5AVC A;  4Z66 D;  3WTP D;  3X1T C;  3W99 A;  2NZD A;  5BO0 B;  5B2I B;  4HGA C;  5DNN D;  3X1U C;  3REK D;  2Y2O A;  3X1U D;  3AV2 C;  4ZUX A;  3REI B;  5AV8 B;  3AZL C;  3VH6 T;  4NFT A;  4XUJ A;  5GT3 C;  2BG1 A;  5B24 C;  5GT3 D;  1ID3 D;  5B24 D;  2JE5 A;  5CHL B;  5B1L B;  4NE6 A;  3AZF C;  4WJ3 C;  3AZF D;  4H9O A;  1KX4 C;  3AV1 C;  1M19 C;  4H9S C;  3AV1 D;  5B40 A;  1M19 D;  1BH8 B;  5AVC B;  5AV6 A;  2Y2I A;  4XZQ C;  3MVD C;  3MVD D;  3LZ0 C;  3UTA C;  5BT1 C;  2HIO B;  5B31 B;  3H0M C;  3UTA D;  4R8P D;  5CPI C;  4WU9 C;  1TZY C;  3MGR C;  3V9R A;  1M1A D;  4X23 A;  4J8W B;  1F1E A;  3X1V A;  1P3B D;  1P3O A;  4M6B A;  4DRB A;  5DNM A;  3AL0 C;  3KFU G;  3LZ0 B;  2UWX A;  1F66 A;  2FJ7 A;  2Y2L A;  5AV9 A;  3MGS A;  5B0Z A;  4Z2M G;  5C3I C;  4Z2M H;  2W8S A;  5CP6 B;  3UTB C;  3AYW B;  1P3L D;  5B31 G;  3NQJ B;  4KUD B;  4G92 C;  3UTB D;  4JJN D;  5GT0 B;  4LD9 C;  5BNX A;  3AZJ C;  3WAA C;  3AZJ D;  3WKJ D;  5B2J C;  5B1M A;  2HUE C;  2FFF B;  5AV6 B;  3WAA D;  5B2J D;  3C1C C;  5BS7 A;  1ZLA C;  4H9R B;  1P3M D;  1ZLA D;  3AZN C;  3WTP E;  3LEL A;  3AZN D;  3V9R B;  3W96 B;  1P3F A;  3AN2 C;  2VQR A;  1P3O B;  4J8V B;  4WU8 C;  2FJ7 B;  2F8N A;  5AV9 B;  3MGS B;  4WU8 D;  4KGC C;  4CAY A;  4QLC C;  5AVB A;  4J8U D;  4KGC D;  3W98 C;  3W98 D;  2NQB D;  5JRG B;  3LJA C;  5B1M B;  2CV5 B;  4J8X A;  1P3K C;  2PYO C;  1M18 D;  1BFM A;  2JSS A;  2PYO D;  4QLC B;  4YM6 C;  3AZI A;  1P3A A;  5CPJ A;  3AFA C;  5GXQ C;  1HQ3 C;  1H3O B;  3AFA D;  5GXQ D;  3LEL B;  1HQ3 D;  1P3G C;  1S32 A;  3REL B;  4YS3 B;  5CPK C;  3B6G A;  3B0D B;  3UT9 C;  5CPK D;  2F8N B;  3WA9 C;  2BYK A;  3UT9 D;  3WA9 D;  2IO5 C;  4ZBJ B;  3KWQ C;  3AZK C;  5AVB B;  1P3G B;  3AZK D;  3B6F C;  3LZ1 D;  2G5H C;  5B0Y A;  1KX3 C;  5AY8 A;  1U35 A;  3REJ B;  3MNN B;  3KWQ B;  1EQZ D;  4CSR B;  3TU4 A;  2F8N G;  3H0L C;  3B6F B;  5B33 C;  3AZI B;  1WWI A;  4H9Q A;  4Z5T D;  5CPJ B;  1P3A B;  3REH B;  5F99 B;  3AZE D;  1TAF A;  4H9P B;  5B32 D;  1P3I D;  1S32 B;  1T3U A;  1P34 A;  2ZY5 A;  5GSU C;  3X1S A;  3KUY B;  1KX5 A;  3NQU B;  1A7W A;  5AV5 A;  3C1B A;  3A6N A;  5B2I D;  3W97 B;  3MGP A;  3REI C;  5AV8 C;  2ARO A;  3AZH A;  3REI D;  5AV8 D;  3AZG A;  3AZM A;  5GSU B;  3X1T D;  5B1L C;  3MGQ A;  4Z66 A;  3WTP A;  5BNV B;  3AV2 D;  2YFW A;  5DNN A;  3REK A;  3AZL D;  1AOI B;  3O62 B;  3KXB B;  1TAF B;  5E5A B;  5GT3 A;  2RVQ C;  1ID3 A;  5B24 A;  2RVQ D;  2G5I C;  5AVC C;  5JA4 B;  1KX4 D;  3AZF A;  5AV5 B;  1HTA A;  2Y2J A;  2XD1 A;  3A6N B;  2HIO C;  5B31 C;  4ZUX C;  2HIO D;  2BYM A;  2ARO B;  5B31 D;  3AZH B;  2DQN C;  4J8W C;  3AV1 A;  3W99 B;  5FUG A;  3AZM B;  4H9S A;  1M19 A;  4J8W D;  2NZD B;  4XZQ D;  3MGQ B;  4WZS B;  3EPH A;  4NE5 A;  4ZUX B;  3LZ0 D;  5BT1 D;  2YFW B;  5DNN B;  3MVD A;  5CP6 C;  4XUJ B;  3REK B;  3AYW C;  5CPI D;  4WU9 D;  5CP6 D;  3UTA A;  1TZY D;  4R8P A;  3MGR D;  3AYW D;  4AWL B;  4KUD C;  5GT0 C;  4KUD D;  1M1A A;  5GT0 D;  1ID3 B;  1P3B A;  5AV6 C;  3VH5 T;  2CWE A; 
#chains in the Genus database with same CATH homology
 3EPL A;  3F6T A;  5KDM A;  4KHA A;  1P3L A;  4LD9 D;  3UTB A;  5B40 B;  4JJN A;  3R45 A;  3W96 C;  2Y2H A;  2RIQ A;  3W96 D;  3IP4 C;  2LY8 A;  2YFV A;  5FUG B;  4J8V C;  3AZJ A;  1P3O C;  3WKJ A;  3WAA A;  4J8V D;  2Y2P A;  3C1C D;  5B2J A;  2FJ7 C;  5AV9 C;  3MGS C;  4WNN A;  3VH5 W;  5B0Z C;  2L5A A;  5AV9 D;  1P3M A;  4X23 B;  1ZLA A;  1JFI A;  4R8P B;  3X1V B;  3AZN A;  1M1A B;  3AN2 D;  1B67 A;  5DNM B;  1KU5 A;  5JRG C;  1F66 B;  5B1M C;  5JRG D;  5B0Z B;  2CV5 C;  2Y2Q A;  1ULY A;  2CV5 D;  5BS7 C;  4WU8 A;  4QLC D;  1P3L B;  5BNX B;  4KGC A;  1BH9 A;  4J8U A;  4JJN B;  4UPK A;  3LEL C;  3R45 B;  2DF4 C;  1P3F C;  3LJA D;  3W98 A;  2NQB A;  3REL C;  1Q9C A;  1P3K D;  4YS3 C;  3REL D;  4YS3 D;  4NE3 A;  3B0D C;  1M18 A;  2PYO A;  4WNN B;  4YM6 D;  1P3P A;  4ZBJ C;  5AVB C;  1P3F B;  1P3G D;  3AFA A;  2XD5 A;  1HQ3 A;  3REJ C;  3MNN C;  1PZR A;  5CPK A;  4CAY B;  3REJ D;  3MNN D;  3KWQ D;  3UT9 A;  3WA9 A;  3AZI C;  3B6F D;  2ZY4 A;  1P3A C;  5CPJ C;  1BH9 B;  4J8U B;  3H0R C;  3LZ1 A;  3REH C;  5F99 C;  3AZK A;  1KX3 D;  3REH D;  5F99 D;  4J8X B;  1S32 C;  4G91 B;  1EQZ A;  1P3P B;  5B33 D;  3KUY C;  2F2A C;  3KUY D;  4Z5T A;  3W97 C;  3W97 D;  3AZE A;  3B6G B;  5B32 A;  1P3I A;  5AY8 C;  3A1I A;  2BYK B;  4H9N A;  5GSU D;  3EPJ A;  3EPK A;  3VH5 A;  5G49 A;  5B2I A;  1AOI C;  5B0Y B;  3O62 C;  3LZ1 B;  5AY8 B;  3KXB C;  1U35 B;  3O62 D;  5E5A C;  1AOI D;  3REI A;  3KXB D;  5AV8 A;  5E5A D;  3B0B A;  3TU4 B;  5B1L D;  3X1T A;  4H9Q B;  3X1S C;  3X1U A;  5AV5 C;  3AV2 A;  3A6N C;  4Z5T B;  5AV5 D;  3AZL A;  2ARO C;  3AZH C;  1N1J A;  5B32 B;  1P34 B;  1P3I B;  3W99 C;  5AVC D;  3AZM C;  2NZD C;  3W99 D;  3X1S B;  1KX5 B;  2NZD D;  3MGQ C;  2ZM5 A;  1BH8 A;  3C1B B;  1KX4 A;  2ZY3 A;  4EO5 C;  3MGP B;  5G49 B;  4ZUX D;  5DNN C;  4XUJ C;  3REK C;  4XUJ D;  1WWS A;  2HIO A;  5B31 A;  4AWL C;  3AZG B;  5B32 G;  4E45 A;  4Z66 B;  3WTP B;  1ID3 C;  4J8W A;  4EO5 B;  3X1T B;  4XZQ A;  4DQY B;  4HGA B;  3X1U B;  3LZ0 A;  2ZY2 A;  3AV2 B;  5CPI A;  3AZL B;  4WU9 A;  5CP6 A;  1TZY A;  3MGR A;  5GT3 B;  5B40 C;  3AYW A;  3NQJ A;  1N1J B;  5B24 B;  4KUD A;  5B40 D;  5GT0 A;  4WV4 B;  5AV6 D;  3AZF B;  3VH6 W;  4UUZ A;  1KX4 B;  2BYM B;  4E44 A;  4X23 C;  4H9R A;  4R8P C;  3X1V C;  4X23 D;  3AV1 B;  4LD9 A;  1M19 B;  3X1V D;  1M1A C;  5DNM C;  1P3O D;  3W96 A;  5DNM D;  1P3B C;  1F66 C;  4XZQ B;  1F66 D;  2FJ7 D;  4J8V A;  3MGS D;  3MVD B;  2Y2K A;  5B0Z D;  3C1C A;  3UTA B;  5CPI B;  1P3L C;  4WU9 B;  1TZY B;  3MGR B;  4JJN C;  4DRA A;  1P3B B;  3AN2 A;  2JCH A;  5B1M D;  3A1K A;  1W2E A;  5KDM B;  3WKJ C;  5JRG A;  4KHA B;  4UUZ B;  2CV5 A;  3FDD A;  5C3I B;  3UTB B;  4QLC A;  4G92 B;  1P3M C;  3LEL D;  4LD9 B;  1P3F D;  2YFV B;  3AZJ B;  3WKJ B;  3B0C T;  1H3O A;  3EG5 B;  3WAA B;  3LJA A;  5B2J B;  2HUE B;  1P3K A;  2F8N D;  3REL A;  3C1C B;  4YS3 A;  1P3M B;  4H9O B;  1ZLA B;  1JFI B;  4YM6 A;  5AVB D;  3AZN B;  5GXQ A;  2Y2M A;  4J8U C;  1P3G A;  3AN2 B;  4J8X C;  1R4V A;  4G91 C;  2NQB C;  4J8X D;  3B0C W;  4WU8 B;  2Y2N A;  1M18 C;  1P3P C;  3REJ A;  3MNN A;  3KWQ A;  3AZI D;  4CSR A;  2Y2G A;  5CPJ D;  1P3A D;  1P3P D;  4KGC B;  3B6F A;  3W98 B;  2NQB B;  1Z2C B;  1S32 D;  1KX3 A;  3REH A;  5F99 A;  3B6G C;  3LJA B;  1M18 B;  4H9P A;  1P3K B;  2PYO B;  3B6G D;  3VH6 A;  1B6W A;  4YM6 B;  5B33 A;  3AFA B;  5GXQ B;  3KUY A;  3NQU A;  1HQ3 B;  3P5J B;  5B0Y C;  3LZ1 C;  3W97 A;  5B0Y D;  1U35 C;  5AY8 D;  2J8P A;  1U35 D;  5CPK B;  3TU4 C;  3UT9 B;  3WA9 B;  3TU4 D;  5BO0 A;  5GSU A;  1EQZ C;  2IO5 B;  3AZK B;  2F8N H;  2F8N K;  4Z5T C;  5BNV A;  3AZE C;  1AOI A;  3O62 A;  1KX3 B;  3KSY A;  3KXB A;  5B32 C;  1P34 C;  1P3I C;  5E5A A;  1P34 D;  1EQZ B;  5B1L A;  1KX5 C;  3C1B C;  3X1S D;  1KX5 D;  3C1B D;  5B33 B;  3A6N D;  3MGP C;  5JA4 A;  3MGP D;  3AZE B;  5B2I C;  2ARO D;  3AZH D;  3AZG C;  4H9N B;  3AZG D;  3AZM D;  4Z66 C;  3WTP C;  3MGQ D;  5AVC A;  4Z66 D;  3WTP D;  3X1T C;  3W99 A;  2NZD A;  5BO0 B;  5B2I B;  4HGA C;  5DNN D;  3X1U C;  3REK D;  2Y2O A;  3X1U D;  3AV2 C;  4ZUX A;  3REI B;  5AV8 B;  3AZL C;  3VH6 T;  4NFT A;  4XUJ A;  5GT3 C;  2BG1 A;  5B24 C;  5GT3 D;  1ID3 D;  5B24 D;  2JE5 A;  5CHL B;  5B1L B;  4NE6 A;  3AZF C;  4WJ3 C;  3AZF D;  4H9O A;  1KX4 C;  3AV1 C;  1M19 C;  4H9S C;  3AV1 D;  5B40 A;  1M19 D;  1BH8 B;  5AVC B;  5AV6 A;  2Y2I A;  4XZQ C;  3MVD C;  3MVD D;  3LZ0 C;  3UTA C;  5BT1 C;  2HIO B;  5B31 B;  3H0M C;  3UTA D;  4R8P D;  5CPI C;  4WU9 C;  1TZY C;  3MGR C;  3V9R A;  1M1A D;  4X23 A;  4J8W B;  1F1E A;  3X1V A;  1P3B D;  1P3O A;  4M6B A;  4DRB A;  5DNM A;  3AL0 C;  3KFU G;  3LZ0 B;  2UWX A;  1F66 A;  2FJ7 A;  2Y2L A;  5AV9 A;  3MGS A;  5B0Z A;  4Z2M G;  5C3I C;  4Z2M H;  2W8S A;  5CP6 B;  3UTB C;  3AYW B;  1P3L D;  5B31 G;  3NQJ B;  4KUD B;  4G92 C;  3UTB D;  4JJN D;  5GT0 B;  4LD9 C;  5BNX A;  3AZJ C;  3WAA C;  3AZJ D;  3WKJ D;  5B2J C;  5B1M A;  2HUE C;  2FFF B;  5AV6 B;  3WAA D;  5B2J D;  3C1C C;  5BS7 A;  1ZLA C;  4H9R B;  1P3M D;  1ZLA D;  3AZN C;  3WTP E;  3LEL A;  3AZN D;  3V9R B;  3W96 B;  1P3F A;  3AN2 C;  2VQR A;  1P3O B;  4J8V B;  4WU8 C;  2FJ7 B;  2F8N A;  5AV9 B;  3MGS B;  4WU8 D;  4KGC C;  4CAY A;  4QLC C;  5AVB A;  4J8U D;  4KGC D;  3W98 C;  3W98 D;  2NQB D;  5JRG B;  3LJA C;  5B1M B;  2CV5 B;  4J8X A;  1P3K C;  2PYO C;  1M18 D;  1BFM A;  2JSS A;  2PYO D;  4QLC B;  4YM6 C;  3AZI A;  1P3A A;  5CPJ A;  3AFA C;  5GXQ C;  1HQ3 C;  1H3O B;  3AFA D;  5GXQ D;  3LEL B;  1HQ3 D;  1P3G C;  1S32 A;  3REL B;  4YS3 B;  5CPK C;  3B6G A;  3B0D B;  3UT9 C;  5CPK D;  2F8N B;  3WA9 C;  2BYK A;  3UT9 D;  3WA9 D;  2IO5 C;  4ZBJ B;  3KWQ C;  3AZK C;  5AVB B;  1P3G B;  3AZK D;  3B6F C;  3LZ1 D;  2G5H C;  5B0Y A;  1KX3 C;  5AY8 A;  1U35 A;  3REJ B;  3MNN B;  3KWQ B;  1EQZ D;  4CSR B;  3TU4 A;  2F8N G;  3H0L C;  3B6F B;  5B33 C;  3AZI B;  1WWI A;  4H9Q A;  4Z5T D;  5CPJ B;  1P3A B;  3REH B;  5F99 B;  3AZE D;  1TAF A;  4H9P B;  5B32 D;  1P3I D;  1S32 B;  1T3U A;  1P34 A;  2ZY5 A;  5GSU C;  3X1S A;  3KUY B;  1KX5 A;  3NQU B;  1A7W A;  5AV5 A;  3C1B A;  3A6N A;  5B2I D;  3W97 B;  3MGP A;  3REI C;  5AV8 C;  2ARO A;  3AZH A;  3REI D;  5AV8 D;  3AZG A;  3AZM A;  5GSU B;  3X1T D;  5B1L C;  3MGQ A;  4Z66 A;  3WTP A;  5BNV B;  3AV2 D;  2YFW A;  5DNN A;  3REK A;  3AZL D;  1AOI B;  3O62 B;  3KXB B;  1TAF B;  5E5A B;  5GT3 A;  2RVQ C;  1ID3 A;  5B24 A;  2RVQ D;  2G5I C;  5AVC C;  5JA4 B;  1KX4 D;  3AZF A;  5AV5 B;  1HTA A;  2Y2J A;  2XD1 A;  3A6N B;  2HIO C;  5B31 C;  4ZUX C;  2HIO D;  2BYM A;  2ARO B;  5B31 D;  3AZH B;  2DQN C;  4J8W C;  3AV1 A;  3W99 B;  5FUG A;  3AZM B;  4H9S A;  1M19 A;  4J8W D;  2NZD B;  4XZQ D;  3MGQ B;  4WZS B;  3EPH A;  4NE5 A;  4ZUX B;  3LZ0 D;  5BT1 D;  2YFW B;  5DNN B;  3MVD A;  5CP6 C;  4XUJ B;  3REK B;  3AYW C;  5CPI D;  4WU9 D;  5CP6 D;  3UTA A;  1TZY D;  4R8P A;  3MGR D;  3AYW D;  4AWL B;  4KUD C;  5GT0 C;  4KUD D;  1M1A A;  5GT0 D;  1ID3 B;  1P3B A;  5AV6 C;  3VH5 T;  2CWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...