4H9NB

Complex structure 1 of daxx/h3.3(sub5)/h4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/apoptosis
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
total genus 27
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9nB00
5GT0C 3MNNB 3UTAB 5AY8A 3AZJA 5JRGD 3X1VC 1P34D 5B33A 3LJAA 3MGQC 1BH8A 4ZUXA 1KX5D 5CPKD 3WKJD 4WU9B 1P3PA 5GT0D 5GSUA 3W96D 2CV5A 3VH5A 5JA4B 3X1VD 3REIC 4H9RA 3MNNA 3UTAA 1ULYA 3MGQD 4LD9B 3AZLB 1B6WA 3REID 5JA4A 3X1SB 2IO5B 5B2JB 4Z66B 4H9NB 3AYWB 4LD9A 3VH5T 3REJB 3AZLA 4J8WA 1AOIB 4J8XC 3X1SA 1P3GB 5B2JA 3WAAD 5BNXB 4Z66A 3AZHB 4H9NA 3AYWA 2F8NG 4J8XD 3REJA 1AOIA 1P3GA 4YS3B 5DNNB 3MVDC 3KXBB 3W99C 2NQBB 5BNXA 3AZHA 1TZYC 4YM6C 3C1CC 1KX4C 2PYOB 3VH5W 3MVDD 5GXQB 5AY8C 5DNNA 4AWLB 3W99D 3KXBA 4WU8B 5B33C 4YS3A 5CPIB 1EQZB 2NQBA 5B1LA 1TZYD 4YM6D 2NZDC 4J8VB 3C1CD 3AZEC 3AZNB 3AZJD 5AY8D 1B67A 2HIOB 2PYOA 5B33D 3MNNC 4KHAB 3UTAC 1EQZA 5AV5B 5CPIA 3WKJC 4WU8A 3LJAD 1M18B 3UTBC 5B2IC 3AZMB 3VH6A 3AZED 2NZDD 3REKC 5C3IB 1P3AB 1P3PD 5GSUD 2CV5D 4WU9C 4CSRB 3AZNA 3MNND 3UTAD 2HIOA 4E44A 2HUEC 4KHAA 5CPJB 5BT1C 3REKD 1M18A 3AZMA 3X1VB 4WU9D 1P3AA 5B31B 2AROC 4LD9C 3AZLC 4CSRA 4X23B 4Z2MH 5CPJA 3MGPB 2IO5C 5AVCC 4HGAB 3VH6T 3REIB 4Z66C 3X1VA 4LD9D 3AZLD 3AYWC 5B31A 3REJC 1S32B 3X1TB 1AOIC 4X23A 2YFVB 3MGPA 5AVCD 4WZSB 5B2JD 3MGSB 1P3GC 4Z66D 3REIA 4H9OB 3AYWD 3REJD 3AZHC 1AOID 1S32A 1P3GD 2YFVA 3KUYC 3O62B 3MGSA 4YS3C 5DNNC 3KXBC 4H9OA 2NQBC 3AZHD 5BS7C 3VH6W 4KUDB 3LZ1B 4CAYB 1JFIB 2PYOC 4YS3D 5DNND 3KXBD 3O62A 4NFTA 5GXQC 5B32G 5CPIC 4AWLC 2NQBD 4WU8C 3UT9B 1P3IB 3LZ1A 4J8VC 4CAYA 1JFIA 2PYOD 3AZNC 5GXQD 3AV2B 5CPID 3AZKB 4WU8D 1HQ3B 5AV5C 3UT9A 1KX4B 1M18C 3AZMC 3MVDA 4J8VD 1P3BB 1P3IA 5C3IC 1P3AC 3AZND 2HIOD 5FUGB 1ZLAB 3AV2A 5AV5D 2NZDB 3AZKA 4YM6A 3AZEB 5CPJC 1HQ3A 3AZIB 3C1CA 1M18D 3AZMD 1KX4A 4J8UB 1P3AD 1P3BA 5B31C 5FUGA 3UTBB 5B2IB 5CPJD 3REKB 4X23C 2NZDA 1BH9B 3AZEA 3MGPC 3AZIA 5KDMB 4HGAC 4J8UA 2HUEB 3A6NB 3TU4B 5B31D 1S32C 4X23D 3UTBA 5B2IA 3X1TC 3MGPD 3REKA 2AROB 3MGSC 4WU9A 5KDMA 3A6NA 3TU4A 1S32D 3LZ0B 5AVCB 3X1TD 1P3KC 3MGSD 2AROA 3O62C 5AV6B 3LZ0A 5AVCA 1P3KD 4KUDC 3LZ1C 4G91C 2BYMB 3O62D 5CHLB 5B0YB 3UT9C 4KGCC 4NE5A 5DNMC 3KUYB 4KUDD 5AV6A 3LZ1D 2YFWB 1P3IC 1U35C 2BYMA 4JJNC 3AV2C 5B0YA 3AZKC 3UT9D 1HQ3C 1M19C 3X1UB 3KUYA 1P3ID 3AZFB 1U35D 1P3BC 2YFWA 5BS7A 3AV2D 3AZKD 3B6GC 1ZLAC 1HQ3D 1M19D 1KX4D 3AZIC 2JSSA 3X1UA 3B0CT 1P3BD 4J8UC 5BNVB 5GXQA 5F99C 3AZFA 3B6GD 1ZLAD 4WV4B 1ID3B 3AZID 4J8VA 4J8UD 1M1AB 5BNVA 3A6NC 4QLCB 3TU4C 5AV5A 3AV1B 3NQJB 4Z5TC 3UTBD 3V9RB 5B2ID 5B24B 3B6FB 1ID3A 3MGRB 5B1MB 1WWSA 3A6ND 1M1AA 3TU4D 3AV1A 4QLCA 5BT1D 3B0CW 3NQJA 3LZ0C 1P3OB 3V9RA 5B24A 3B6FA 3KWQC 2AROD 3KSYA 3MGRA 5AVBB 5B1MA 5CP6C 4H9PB 3AN2C 3W98B 3LZ0D 5AV6C 1P3OA 2BYKB 4DRAA 5CP6D 5AVBA 5B0YC 4H9PA 3X1TA 1P3KB 1P3MC 1HTAA 5AV6D 3W98A 5B32B 3AFAB 2BYKA 5B0YD 1P3MD 1P3KA 4G91B 4NE3A 3X1UC 3KUYD 5GT3C 3AZFC 5B32A 3WA9C 3AFAA 1P3LB 3W97B 4KGCB 5DNMB 1H3OB 4KUDA 3X1UD 1U35B 3REHC 4JJNB 3AZFD 4Z2MG 2CWEA 1M19B 2F8NK 3W97A 1P3LA 4KGCA 5DNMA 1ID3C 1H3OA 3B0DB 1U35A 5E5AC 1M1AC 3B6GB 4JJNA 4UUZB 3C1BB 4QLCC 3AV1C 1M19A 5B40B 1ID3D 5B24C 5F99B 3B6FC 3MGRC 5B1MC 1M1AD 1N1JB 3B6GA 3AV1D 4QLCD 5B0ZB 1ZLAA 4UUZA 3C1BA 5B40A 5B24D 4H9SA 1P3OC 3B6FD 3MGRD 5F99A 5B1MD 4Z5TB 5AVBC 1N1JA 5JRGC 5B0ZA 3WTPE 3R45B 1BH9A 3W98C 1P3OD 4ZUXB 2F8NH 1P3FB 5AVBD 4ZBJC 4Z5TA 4H9RB 3W96C 2LY8A 3KWQB 3W98D 2F8NB 3R45A 5CP6B 5B32C 3AFAC 3AN2B 1P3FA 3AZGB 3RELB 1R4VA 5BO0B 4EO5B 1BFMA 3KWQA 2F8NA 5B32D 3AFAD 5CP6A 1P3MB 3AN2A 4G92B 1P3LC 3W97C 4J8WB 3AZGA 3RELA 4WNNB 5BO0A 1A7WA 5G49B 3LELC 1F1EA 3B0BA 1P3LD 3W97D 4KGCD 3WAAC 5DNMD 1P3MA 3WTPB 5GT3B 3WA9B 4WNNA 5AV9C 3B0DC 3LELD 1KX3B 5G49A 4JJND 4R8PC 3C1BC 3WTPA 3REHB 5B40C 4H9SC 5AV9D 5GT3A 1TAFB 3WA9A 4NE6A 1KX3A 4R8PD 3C1BD 5B0ZC 5B1LB 1WWIA 5E5AB 5B40D 3REHA 5F99D 1TAFA 4XZQB 3AZJC 5AV8B 5B0ZD 1KU5A 1F66B 3LJAC 5E5AA 4ZUXC 1P3FC 1P3PC 4Z5TD 5GSUC 2CV5C 2FJ7B 4XZQA 4XUJB 5AV8A 3NQUB 1F66A 4ZUXD 1P3FD 5JRGB 1P34B 3AZGC 3RELC 2FJ7A 4XUJA 3KWQD 1KX5B 4EO5C 2F8ND 5CPKB 3WKJB 1Q9CA 4ZBJB 5GT0B 3NQUA 3W96B 3AN2D 5JRGA 3AZGD 3RELD 4G92C 1P34A 4J8WC 3MGQB 4H9QB 3X1SC 1KX5A 5CPKA 3WKJA 5B2JC 5GT0A 3W96A 4J8WD 5B31G 3WTPC 3MGQA 4H9QA 3X1SD 1KX3C 3WTPD 3LELB 5GT3D 3WA9D 1KX3D 3WAAB 4J8XB 5AV9B 5B1LC 3LELA 3REHD 4R8PB 4E45A 3WAAA 4XZQC 5AV8C 4J8XA 1EQZC 5B1LD 5AV9A 5E5AD 1F66C 3MVDB 4R8PA 3W99B 4XZQD 4M6BA 2RVQC 2FJ7C 2HIOC 5AV8D 1EQZD 1TZYB 4DRBA 2L5AA 4XUJC 4YM6B 3C1CB 1F66D 3AZJB 5AY8B 5B33B 1P34C 3W99A 2RVQD 2FJ7D 3LJAB 4XUJD 1BH8B 1TZYA 1KX5C 1P3PB 5GSUB 5CPKC 2CV5B
chains in the Genus database with same CATH superfamily
5GT0C 3MNNB 3UTAB 5AY8A 3AZJA 5JRGD 3X1VC 1P34D 5B33A 3LJAA 3MGQC 1BH8A 4ZUXA 1KX5D 5CPKD 3WKJD 4WU9B 1P3PA 5GT0D 5GSUA 2JE5A 2CV5A 3VH5A 3W96D 5JA4B 3X1VD 3REIC 4H9RA 3MNNA 3UTAA 1ULYA 3MGQD 3A1KA 4LD9B 3AZLB 1B6WA 3REID 5JA4A 3X1SB 2IO5B 5B2JB 4Z66B 4H9NB 3AYWB 4LD9A 3VH5T 3REJB 3AZLA 4J8WA 1AOIB 4J8XC 3X1SA 1P3GB 1PZRA 5B2JA 3WAAD 5BNXB 4Z66A 3AZHB 4H9NA 3AYWA 2F8NG 4J8XD 3REJA 1AOIA 1P3GA 4YS3B 5DNNB 3MVDC 3KXBB 3W99C 2NQBB 5BNXA 3AZHA 1TZYC 4YM6C 3C1CC 1KX4C 2PYOB 3VH5W 3MVDD 5GXQB 5AY8C 5DNNA 4AWLB 3W99D 3KXBA 4WU8B 5B33C 4YS3A 5CPIB 1EQZB 2NQBA 5B1LA 1TZYD 4YM6D 2NZDC 4J8VB 3P5JB 3C1CD 3AZEC 3AZNB 3AZJD 5AY8D 1B67A 2HIOB 2PYOA 5B33D 3MNNC 4KHAB 3UTAC 1EQZA 5AV5B 5CPIA 3WKJC 4WU8A 3LJAD 1M18B 3UTBC 5B2IC 3AZMB 3VH6A 3AZED 2NZDD 3REKC 5C3IB 1P3AB 1P3PD 5GSUD 2CV5D 4WU9C 4CSRB 3AZNA 3MNND 3UTAD 2HIOA 4E44A 2HUEC 4KHAA 5CPJB 1T3UA 2Y2IA 3EPLA 5BT1C 2XD5A 3REKD 1M18A 3AZMA 3X1VB 4WU9D 1P3AA 5B31B 2AROC 4LD9C 3AZLC 4CSRA 4X23B 4Z2MH 5CPJA 3MGPB 2IO5C 5AVCC 4HGAB 3VH6T 3REIB 4Z66C 3X1VA 4LD9D 2ZY4A 2Y2KA 3AZLD 3AYWC 5B31A 3REJC 1S32B 3X1TB 1AOIC 2Y2HA 2Y2GA 2YFVB 4X23A 3MGPA 5AVCD 4WZSB 5B2JD 3MGSB 1P3GC 2VQRA 4Z66D 3REIA 4H9OB 3AYWD 3H0RC 3REJD 3AZHC 1AOID 1S32A 2Y2OA 1P3GD 2YFVA 3KUYC 3O62B 3MGSA 4YS3C 5DNNC 3KXBC 4H9OA 2NQBC 3AZHD 5BS7C 3VH6W 4KUDB 3LZ1B 4CAYB 1JFIB 2PYOC 4YS3D 5DNND 3KXBD 3O62A 4NFTA 5GXQC 5B32G 5CPIC 4AWLC 2NQBD 4WU8C 3UT9B 1P3IB 3LZ1A 4J8VC 4CAYA 1JFIA 2PYOD 3AZNC 5GXQD 3AV2B 2ZY2A 5CPID 3AZKB 4WU8D 1HQ3B 2DF4C 5AV5C 3UT9A 1KX4B 1M18C 3AZMC 3MVDA 4J8VD 1P3BB 1P3IA 5C3IC 1P3AC 3AZND 2HIOD 5FUGB 1ZLAB 3AV2A 5AV5D 2NZDB 3AZKA 4YM6A 3AZEB 5CPJC 1HQ3A 3AZIB 3C1CA 1M18D 3AZMD 1KX4A 4J8UB 1P3AD 1P3BA 5B31C 5FUGA 3UTBB 5B2IB 5CPJD 3REKB 4X23C 2NZDA 1BH9B 3AZEA 3MGPC 3AZIA 5KDMB 4HGAC 4J8UA 2HUEB 3A6NB 3TU4B 5B31D 1S32C 2Y2JA 4X23D 5B2IA 3UTBA 3X1TC 3MGPD 3REKA 2AROB 3MGSC 4WU9A 5KDMA 3A6NA 3TU4A 1S32D 3LZ0B 5AVCB 3X1TD 1P3KC 3MGSD 1W2EA 2AROA 3O62C 5AV6B 3LZ0A 5AVCA 1P3KD 4KUDC 3LZ1C 4G91C 2BYMB 3O62D 5CHLB 5B0YB 2XD1A 3UT9C 4KGCC 4NE5A 5DNMC 3KUYB 4KUDD 5AV6A 3LZ1D 2YFWB 1P3IC 3KFUG 1U35C 2BYMA 4JJNC 3AV2C 5B0YA 3AZKC 3UT9D 1HQ3C 1M19C 3X1UB 2ZY5A 3KUYA 1P3ID 3AZFB 1U35D 1P3BC 2YFWA 5BS7A 3AV2D 3AZKD 3B6GC 1ZLAC 2UWXA 1HQ3D 1M19D 1KX4D 3AZIC 2JSSA 3X1UA 3B0CT 1P3BD 4J8UC 5BNVB 5GXQA 5F99C 3AZFA 3B6GD 1ZLAD 4WV4B 1ID3B 3AZID 4J8VA 4J8UD 1M1AB 5BNVA 3A6NC 4QLCB 3TU4C 5AV5A 3AV1B 3NQJB 2JCHA 4Z5TC 3UTBD 3V9RB 5B2ID 3EPJA 5B24B 3B6FB 1ID3A 3MGRB 5B1MB 1WWSA 3A6ND 1M1AA 3TU4D 3AV1A 4QLCA 5BT1D 3B0CW 3NQJA 3LZ0C 1P3OB 3V9RA 5B24A 3B6FA 3KWQC 2AROD 3KSYA 3MGRA 5AVBB 5B1MA 5CP6C 4H9PB 3AN2C 3W98B 3LZ0D 5AV6C 1P3OA 3AL0C 2BYKB 4DRAA 5CP6D 5AVBA 5B0YC 4H9PA 3X1TA 1P3KB 1P3MC 1HTAA 5AV6D 3W98A 5B32B 3A1IA 3AFAB 2BYKA 5B0YD 1P3MD 1P3KA 4G91B 4NE3A 3X1UC 3KUYD 5GT3C 3AZFC 5B32A 3WA9C 3AFAA 1P3LB 3W97B 4KGCB 5DNMB 1H3OB 4KUDA 3X1UD 1U35B 3REHC 4JJNB 3AZFD 4Z2MG 2CWEA 1M19B 2F8NK 3W97A 1P3LA 4KGCA 5DNMA 2W8SA 1ID3C 1H3OA 3B0DB 2BG1A 1U35A 5E5AC 1M1AC 3B6GB 4JJNA 4UUZB 3C1BB 4QLCC 3AV1C 1M19A 5B40B 1ID3D 5B24C 5F99B 3B6FC 3MGRC 5B1MC 1M1AD 1N1JB 3B6GA 3AV1D 4QLCD 5B0ZB 1ZLAA 4UUZA 3C1BA 2G5IC 5B40A 5B24D 4H9SA 1P3OC 3B6FD 3MGRD 5F99A 5B1MD 4UPKA 4Z5TB 5AVBC 1N1JA 5JRGC 5B0ZA 3WTPE 3R45B 1BH9A 3W98C 4DQYB 1P3OD 4ZUXB 2F8NH 1P3FB 5AVBD 4ZBJC 4Z5TA 4H9RB 3W96C 2LY8A 3KWQB 3W98D 2F8NB 2G5HC 3R45A 5CP6B 5B32C 3AFAC 3AN2B 1P3FA 3AZGB 3RELB 1R4VA 5BO0B 4EO5B 3H0MC 1BFMA 3KWQA 2F8NA 5B32D 3AFAD 5CP6A 1P3MB 3AN2A 4G92B 1P3LC 3W97C 4J8WB 3AZGA 3RELA 4WNNB 5BO0A 1A7WA 3FDDA 5G49B 3LELC 3F6TA 2DQNC 1F1EA 3B0BA 1P3LD 3W97D 4KGCD 3WAAC 5DNMD 1P3MA 3WTPB 5GT3B 2Y2NA 3WA9B 4WNNA 5AV9C 3B0DC 3LELD 1KX3B 5G49A 4JJND 4R8PC 3C1BC 3WTPA 3REHB 5B40C 4H9SC 5AV9D 5GT3A 1TAFB 2Y2MA 3WA9A 4NE6A 2ZY3A 1KX3A 1Z2CB 4R8PD 3EPKA 3C1BD 5B0ZC 2FFFB 5B1LB 1WWIA 5E5AB 5B40D 2ZM5A 3REHA 5F99D 1TAFA 4XZQB 3AZJC 5AV8B 5B0ZD 1KU5A 1F66B 3LJAC 5E5AA 4ZUXC 1P3FC 1P3PC 2Y2LA 4Z5TD 5GSUC 2CV5C 2FJ7B 4XZQA 4XUJB 5AV8A 3NQUB 1F66A 2J8PA 4ZUXD 3EG5B 1P3FD 5JRGB 1P34B 3AZGC 3RELC 2FJ7A 4XUJA 3KWQD 1KX5B 4EO5C 2F8ND 5CPKB 3WKJB 1Q9CA 4ZBJB 5GT0B 3NQUA 3W96B 3AN2D 5JRGA 3AZGD 3RELD 4G92C 1P34A 4J8WC 3MGQB 4H9QB 3X1SC 1KX5A 5CPKA 3WKJA 5B2JC 5GT0A 3W96A 2Y2PA 4J8WD 5B31G 3WTPC 3MGQA 4H9QA 3IP4C 3X1SD 1KX3C 4WJ3C 3WTPD 3LELB 5GT3D 2F2AC 3WA9D 3H0LC 1KX3D 3WAAB 4J8XB 5AV9B 5B1LC 3LELA 3REHD 4R8PB 4E45A 3WAAA 4XZQC 5AV8C 4J8XA 1EQZC 5B1LD 5AV9A 5E5AD 1F66C 3MVDB 4R8PA 3W99B 2Y2QA 4XZQD 3EPHA 4M6BA 2RVQC 2FJ7C 2HIOC 5AV8D 1EQZD 1TZYB 4DRBA 2L5AA 4XUJC 4YM6B 3C1CB 1F66D 3AZJB 5AY8B 5B33B 1P34C 2RIQA 3W99A 2RVQD 2FJ7D 3LJAB 4XUJD 1BH8B 1TZYA 1KX5C 1P3PB 5GSUB 5CPKC 2CV5B
chains in the Genus database with same CATH topology
5GT0C 3MNNB 3UTAB 5AY8A 3AZJA 5JRGD 3X1VC 1P34D 5B33A 3LJAA 3MGQC 1BH8A 4ZUXA 1KX5D 5CPKD 3WKJD 4WU9B 1P3PA 5GT0D 5GSUA 2JE5A 2CV5A 3VH5A 3W96D 5JA4B 3X1VD 3REIC 4H9RA 3MNNA 3UTAA 1ULYA 3MGQD 3A1KA 4LD9B 3AZLB 1B6WA 3REID 5JA4A 3X1SB 2IO5B 5B2JB 4Z66B 4H9NB 3AYWB 4LD9A 3VH5T 3REJB 3AZLA 4J8WA 1AOIB 4J8XC 3X1SA 1P3GB 1PZRA 5B2JA 3WAAD 5BNXB 4Z66A 3AZHB 4H9NA 3AYWA 2F8NG 4J8XD 3REJA 1AOIA 1P3GA 4YS3B 5DNNB 3MVDC 3KXBB 3W99C 2NQBB 5BNXA 3AZHA 1TZYC 4YM6C 3C1CC 1KX4C 2PYOB 3VH5W 3MVDD 5GXQB 5AY8C 5DNNA 4AWLB 3W99D 3KXBA 4WU8B 5B33C 4YS3A 5CPIB 1EQZB 2NQBA 5B1LA 1TZYD 4YM6D 2NZDC 4J8VB 3P5JB 3C1CD 3AZEC 3AZNB 3AZJD 5AY8D 1B67A 2HIOB 2PYOA 5B33D 3MNNC 4KHAB 3UTAC 1EQZA 5AV5B 5CPIA 3WKJC 4WU8A 3LJAD 1M18B 3UTBC 5B2IC 3AZMB 3VH6A 3AZED 2NZDD 3REKC 5C3IB 1P3AB 1P3PD 5GSUD 2CV5D 4WU9C 4CSRB 3AZNA 3MNND 3UTAD 2HIOA 4E44A 2HUEC 4KHAA 5CPJB 1T3UA 2Y2IA 3EPLA 5BT1C 2XD5A 3REKD 1M18A 3AZMA 3X1VB 4WU9D 1P3AA 5B31B 2AROC 4LD9C 3AZLC 4CSRA 4X23B 4Z2MH 5CPJA 3MGPB 2IO5C 5AVCC 4HGAB 3VH6T 3REIB 4Z66C 3X1VA 4LD9D 2ZY4A 2Y2KA 3AZLD 3AYWC 5B31A 3REJC 1S32B 3X1TB 1AOIC 2Y2HA 2Y2GA 2YFVB 4X23A 3MGPA 5AVCD 4WZSB 5B2JD 3MGSB 1P3GC 2VQRA 4Z66D 3REIA 4H9OB 3AYWD 3H0RC 3REJD 3AZHC 1AOID 1S32A 2Y2OA 1P3GD 2YFVA 3KUYC 3O62B 3MGSA 4YS3C 5DNNC 3KXBC 4H9OA 2NQBC 3AZHD 5BS7C 3VH6W 4KUDB 3LZ1B 4CAYB 1JFIB 2PYOC 4YS3D 5DNND 3KXBD 3O62A 4NFTA 5GXQC 5B32G 5CPIC 4AWLC 2NQBD 4WU8C 3UT9B 1P3IB 3LZ1A 4J8VC 4CAYA 1JFIA 2PYOD 3AZNC 5GXQD 3AV2B 2ZY2A 5CPID 3AZKB 4WU8D 1HQ3B 2DF4C 5AV5C 3UT9A 1KX4B 1M18C 3AZMC 3MVDA 4J8VD 1P3BB 1P3IA 5C3IC 1P3AC 3AZND 2HIOD 5FUGB 1ZLAB 3AV2A 5AV5D 2NZDB 3AZKA 4YM6A 3AZEB 5CPJC 1HQ3A 3AZIB 3C1CA 1M18D 3AZMD 1KX4A 4J8UB 1P3AD 1P3BA 5B31C 5FUGA 3UTBB 5B2IB 5CPJD 3REKB 4X23C 2NZDA 1BH9B 3AZEA 3MGPC 3AZIA 5KDMB 4HGAC 4J8UA 2HUEB 3A6NB 3TU4B 5B31D 1S32C 2Y2JA 4X23D 5B2IA 3UTBA 3X1TC 3MGPD 3REKA 2AROB 3MGSC 4WU9A 5KDMA 3A6NA 3TU4A 1S32D 3LZ0B 5AVCB 3X1TD 1P3KC 3MGSD 1W2EA 2AROA 3O62C 5AV6B 3LZ0A 5AVCA 1P3KD 4KUDC 3LZ1C 4G91C 2BYMB 3O62D 5CHLB 5B0YB 2XD1A 3UT9C 4KGCC 4NE5A 5DNMC 3KUYB 4KUDD 5AV6A 3LZ1D 2YFWB 1P3IC 3KFUG 1U35C 2BYMA 4JJNC 3AV2C 5B0YA 3AZKC 3UT9D 1HQ3C 1M19C 3X1UB 2ZY5A 3KUYA 1P3ID 3AZFB 1U35D 1P3BC 2YFWA 5BS7A 3AV2D 3AZKD 3B6GC 1ZLAC 2UWXA 1HQ3D 1M19D 1KX4D 3AZIC 2JSSA 3X1UA 3B0CT 1P3BD 4J8UC 5BNVB 5GXQA 5F99C 3AZFA 3B6GD 1ZLAD 4WV4B 1ID3B 3AZID 4J8VA 4J8UD 1M1AB 5BNVA 3A6NC 4QLCB 3TU4C 5AV5A 3AV1B 3NQJB 2JCHA 4Z5TC 3UTBD 3V9RB 5B2ID 3EPJA 5B24B 3B6FB 1ID3A 3MGRB 5B1MB 1WWSA 3A6ND 1M1AA 3TU4D 3AV1A 4QLCA 5BT1D 3B0CW 3NQJA 3LZ0C 1P3OB 3V9RA 5B24A 3B6FA 3KWQC 2AROD 3KSYA 3MGRA 5AVBB 5B1MA 5CP6C 4H9PB 3AN2C 3W98B 3LZ0D 5AV6C 1P3OA 3AL0C 2BYKB 4DRAA 5CP6D 5AVBA 5B0YC 4H9PA 3X1TA 1P3KB 1P3MC 1HTAA 5AV6D 3W98A 5B32B 3A1IA 3AFAB 2BYKA 5B0YD 1P3MD 1P3KA 4G91B 4NE3A 3X1UC 3KUYD 5GT3C 3AZFC 5B32A 3WA9C 3AFAA 1P3LB 3W97B 4KGCB 5DNMB 1H3OB 4KUDA 3X1UD 1U35B 3REHC 4JJNB 3AZFD 4Z2MG 2CWEA 1M19B 2F8NK 3W97A 1P3LA 4KGCA 5DNMA 2W8SA 1ID3C 1H3OA 3B0DB 2BG1A 1U35A 5E5AC 1M1AC 3B6GB 4JJNA 4UUZB 3C1BB 4QLCC 3AV1C 1M19A 5B40B 1ID3D 5B24C 5F99B 3B6FC 3MGRC 5B1MC 1M1AD 1N1JB 3B6GA 3AV1D 4QLCD 5B0ZB 1ZLAA 4UUZA 3C1BA 2G5IC 5B40A 5B24D 4H9SA 1P3OC 3B6FD 3MGRD 5F99A 5B1MD 4UPKA 4Z5TB 5AVBC 1N1JA 5JRGC 5B0ZA 3WTPE 3R45B 1BH9A 3W98C 4DQYB 1P3OD 4ZUXB 2F8NH 1P3FB 5AVBD 4ZBJC 4Z5TA 4H9RB 3W96C 2LY8A 3KWQB 3W98D 2F8NB 2G5HC 3R45A 5CP6B 5B32C 3AFAC 3AN2B 1P3FA 3AZGB 3RELB 1R4VA 5BO0B 4EO5B 3H0MC 1BFMA 3KWQA 2F8NA 5B32D 3AFAD 5CP6A 1P3MB 3AN2A 4G92B 1P3LC 3W97C 4J8WB 3AZGA 3RELA 4WNNB 5BO0A 1A7WA 3FDDA 5G49B 3LELC 3F6TA 2DQNC 1F1EA 3B0BA 1P3LD 3W97D 4KGCD 3WAAC 5DNMD 1P3MA 3WTPB 5GT3B 2Y2NA 3WA9B 4WNNA 5AV9C 3B0DC 3LELD 1KX3B 5G49A 4JJND 4R8PC 3C1BC 3WTPA 3REHB 5B40C 4H9SC 5AV9D 5GT3A 1TAFB 2Y2MA 3WA9A 4NE6A 2ZY3A 1KX3A 1Z2CB 4R8PD 3EPKA 3C1BD 5B0ZC 2FFFB 5B1LB 1WWIA 5E5AB 5B40D 2ZM5A 3REHA 5F99D 1TAFA 4XZQB 3AZJC 5AV8B 5B0ZD 1KU5A 1F66B 3LJAC 5E5AA 4ZUXC 1P3FC 1P3PC 2Y2LA 4Z5TD 5GSUC 2CV5C 2FJ7B 4XZQA 4XUJB 5AV8A 3NQUB 1F66A 2J8PA 4ZUXD 3EG5B 1P3FD 5JRGB 1P34B 3AZGC 3RELC 2FJ7A 4XUJA 3KWQD 1KX5B 4EO5C 2F8ND 5CPKB 3WKJB 1Q9CA 4ZBJB 5GT0B 3NQUA 3W96B 3AN2D 5JRGA 3AZGD 3RELD 4G92C 1P34A 4J8WC 3MGQB 4H9QB 3X1SC 1KX5A 5CPKA 3WKJA 5B2JC 5GT0A 3W96A 2Y2PA 4J8WD 5B31G 3WTPC 3MGQA 4H9QA 3IP4C 3X1SD 1KX3C 4WJ3C 3WTPD 3LELB 5GT3D 2F2AC 3WA9D 3H0LC 1KX3D 3WAAB 4J8XB 5AV9B 5B1LC 3LELA 3REHD 4R8PB 4E45A 3WAAA 4XZQC 5AV8C 4J8XA 1EQZC 5B1LD 5AV9A 5E5AD 1F66C 3MVDB 4R8PA 3W99B 2Y2QA 4XZQD 3EPHA 4M6BA 2RVQC 2FJ7C 2HIOC 5AV8D 1EQZD 1TZYB 4DRBA 2L5AA 4XUJC 4YM6B 3C1CB 1F66D 3AZJB 5AY8B 5B33B 1P34C 2RIQA 3W99A 2RVQD 2FJ7D 3LJAB 4XUJD 1BH8B 1TZYA 1KX5C 1P3PB 5GSUB 5CPKC 2CV5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT0 C;  3MNN B;  3UTA B;  5AY8 A;  3AZJ A;  5JRG D;  3X1V C;  1P34 D;  5B33 A;  3LJA A;  3MGQ C;  1BH8 A;  4ZUX A;  1KX5 D;  5CPK D;  3WKJ D;  4WU9 B;  1P3P A;  5GT0 D;  5GSU A;  3W96 D;  2CV5 A;  3VH5 A;  5JA4 B;  3X1V D;  3REI C;  4H9R A;  3MNN A;  3UTA A;  1ULY A;  3MGQ D;  4LD9 B;  3AZL B;  1B6W A;  3REI D;  5JA4 A;  3X1S B;  2IO5 B;  5B2J B;  4Z66 B;  4H9N B;  3AYW B;  4LD9 A;  3VH5 T;  3REJ B;  3AZL A;  4J8W A;  1AOI B;  4J8X C;  3X1S A;  1P3G B;  5B2J A;  3WAA D;  5BNX B;  4Z66 A;  3AZH B;  4H9N A;  3AYW A;  2F8N G;  4J8X D;  3REJ A;  1AOI A;  1P3G A;  4YS3 B;  5DNN B;  3MVD C;  3KXB B;  3W99 C;  2NQB B;  5BNX A;  3AZH A;  1TZY C;  4YM6 C;  3C1C C;  1KX4 C;  2PYO B;  3VH5 W;  3MVD D;  5GXQ B;  5AY8 C;  5DNN A;  4AWL B;  3W99 D;  3KXB A;  4WU8 B;  5B33 C;  4YS3 A;  5CPI B;  1EQZ B;  2NQB A;  5B1L A;  1TZY D;  4YM6 D;  2NZD C;  4J8V B;  3C1C D;  3AZE C;  3AZN B;  3AZJ D;  5AY8 D;  1B67 A;  2HIO B;  2PYO A;  5B33 D;  3MNN C;  4KHA B;  3UTA C;  1EQZ A;  5AV5 B;  5CPI A;  3WKJ C;  4WU8 A;  3LJA D;  1M18 B;  3UTB C;  5B2I C;  3AZM B;  3VH6 A;  3AZE D;  2NZD D;  3REK C;  5C3I B;  1P3A B;  1P3P D;  5GSU D;  2CV5 D;  4WU9 C;  4CSR B;  3AZN A;  3MNN D;  3UTA D;  2HIO A;  4E44 A;  2HUE C;  4KHA A;  5CPJ B;  5BT1 C;  3REK D;  1M18 A;  3AZM A;  3X1V B;  4WU9 D;  1P3A A;  5B31 B;  2ARO C;  4LD9 C;  3AZL C;  4CSR A;  4X23 B;  4Z2M H;  5CPJ A;  3MGP B;  2IO5 C;  5AVC C;  4HGA B;  3VH6 T;  3REI B;  4Z66 C;  3X1V A;  4LD9 D;  3AZL D;  3AYW C;  5B31 A;  3REJ C;  1S32 B;  3X1T B;  1AOI C;  4X23 A;  2YFV B;  3MGP A;  5AVC D;  4WZS B;  5B2J D;  3MGS B;  1P3G C;  4Z66 D;  3REI A;  4H9O B;  3AYW D;  3REJ D;  3AZH C;  1AOI D;  1S32 A;  1P3G D;  2YFV A;  3KUY C;  3O62 B;  3MGS A;  4YS3 C;  5DNN C;  3KXB C;  4H9O A;  2NQB C;  3AZH D;  5BS7 C;  3VH6 W;  4KUD B;  3LZ1 B;  4CAY B;  1JFI B;  2PYO C;  4YS3 D;  5DNN D;  3KXB D;  3O62 A;  4NFT A;  5GXQ C;  5B32 G;  5CPI C;  4AWL C;  2NQB D;  4WU8 C;  3UT9 B;  1P3I B;  3LZ1 A;  4J8V C;  4CAY A;  1JFI A;  2PYO D;  3AZN C;  5GXQ D;  3AV2 B;  5CPI D;  3AZK B;  4WU8 D;  1HQ3 B;  5AV5 C;  3UT9 A;  1KX4 B;  1M18 C;  3AZM C;  3MVD A;  4J8V D;  1P3B B;  1P3I A;  5C3I C;  1P3A C;  3AZN D;  2HIO D;  5FUG B;  1ZLA B;  3AV2 A;  5AV5 D;  2NZD B;  3AZK A;  4YM6 A;  3AZE B;  5CPJ C;  1HQ3 A;  3AZI B;  3C1C A;  1M18 D;  3AZM D;  1KX4 A;  4J8U B;  1P3A D;  1P3B A;  5B31 C;  5FUG A;  3UTB B;  5B2I B;  5CPJ D;  3REK B;  4X23 C;  2NZD A;  1BH9 B;  3AZE A;  3MGP C;  3AZI A;  5KDM B;  4HGA C;  4J8U A;  2HUE B;  3A6N B;  3TU4 B;  5B31 D;  1S32 C;  4X23 D;  3UTB A;  5B2I A;  3X1T C;  3MGP D;  3REK A;  2ARO B;  3MGS C;  4WU9 A;  5KDM A;  3A6N A;  3TU4 A;  1S32 D;  3LZ0 B;  5AVC B;  3X1T D;  1P3K C;  3MGS D;  2ARO A;  3O62 C;  5AV6 B;  3LZ0 A;  5AVC A;  1P3K D;  4KUD C;  3LZ1 C;  4G91 C;  2BYM B;  3O62 D;  5CHL B;  5B0Y B;  3UT9 C;  4KGC C;  4NE5 A;  5DNM C;  3KUY B;  4KUD D;  5AV6 A;  3LZ1 D;  2YFW B;  1P3I C;  1U35 C;  2BYM A;  4JJN C;  3AV2 C;  5B0Y A;  3AZK C;  3UT9 D;  1HQ3 C;  1M19 C;  3X1U B;  3KUY A;  1P3I D;  3AZF B;  1U35 D;  1P3B C;  2YFW A;  5BS7 A;  3AV2 D;  3AZK D;  3B6G C;  1ZLA C;  1HQ3 D;  1M19 D;  1KX4 D;  3AZI C;  2JSS A;  3X1U A;  3B0C T;  1P3B D;  4J8U C;  5BNV B;  5GXQ A;  5F99 C;  3AZF A;  3B6G D;  1ZLA D;  4WV4 B;  1ID3 B;  3AZI D;  4J8V A;  4J8U D;  1M1A B;  5BNV A;  3A6N C;  4QLC B;  3TU4 C;  5AV5 A;  3AV1 B;  3NQJ B;  4Z5T C;  3UTB D;  3V9R B;  5B2I D;  5B24 B;  3B6F B;  1ID3 A;  3MGR B;  5B1M B;  1WWS A;  3A6N D;  1M1A A;  3TU4 D;  3AV1 A;  4QLC A;  5BT1 D;  3B0C W;  3NQJ A;  3LZ0 C;  1P3O B;  3V9R A;  5B24 A;  3B6F A;  3KWQ C;  2ARO D;  3KSY A;  3MGR A;  5AVB B;  5B1M A;  5CP6 C;  4H9P B;  3AN2 C;  3W98 B;  3LZ0 D;  5AV6 C;  1P3O A;  2BYK B;  4DRA A;  5CP6 D;  5AVB A;  5B0Y C;  4H9P A;  3X1T A;  1P3K B;  1P3M C;  1HTA A;  5AV6 D;  3W98 A;  5B32 B;  3AFA B;  2BYK A;  5B0Y D;  1P3M D;  1P3K A;  4G91 B;  4NE3 A;  3X1U C;  3KUY D;  5GT3 C;  3AZF C;  5B32 A;  3WA9 C;  3AFA A;  1P3L B;  3W97 B;  4KGC B;  5DNM B;  1H3O B;  4KUD A;  3X1U D;  1U35 B;  3REH C;  4JJN B;  3AZF D;  4Z2M G;  2CWE A;  1M19 B;  2F8N K;  3W97 A;  1P3L A;  4KGC A;  5DNM A;  1ID3 C;  1H3O A;  3B0D B;  1U35 A;  5E5A C;  1M1A C;  3B6G B;  4JJN A;  4UUZ B;  3C1B B;  4QLC C;  3AV1 C;  1M19 A;  5B40 B;  1ID3 D;  5B24 C;  5F99 B;  3B6F C;  3MGR C;  5B1M C;  1M1A D;  1N1J B;  3B6G A;  3AV1 D;  4QLC D;  5B0Z B;  1ZLA A;  4UUZ A;  3C1B A;  5B40 A;  5B24 D;  4H9S A;  1P3O C;  3B6F D;  3MGR D;  5F99 A;  5B1M D;  4Z5T B;  5AVB C;  1N1J A;  5JRG C;  5B0Z A;  3WTP E;  3R45 B;  1BH9 A;  3W98 C;  1P3O D;  4ZUX B;  2F8N H;  1P3F B;  5AVB D;  4ZBJ C;  4Z5T A;  4H9R B;  3W96 C;  2LY8 A;  3KWQ B;  3W98 D;  2F8N B;  3R45 A;  5CP6 B;  5B32 C;  3AFA C;  3AN2 B;  1P3F A;  3AZG B;  3REL B;  1R4V A;  5BO0 B;  4EO5 B;  1BFM A;  3KWQ A;  2F8N A;  5B32 D;  3AFA D;  5CP6 A;  1P3M B;  3AN2 A;  4G92 B;  1P3L C;  3W97 C;  4J8W B;  3AZG A;  3REL A;  4WNN B;  5BO0 A;  1A7W A;  5G49 B;  3LEL C;  1F1E A;  3B0B A;  1P3L D;  3W97 D;  4KGC D;  3WAA C;  5DNM D;  1P3M A;  3WTP B;  5GT3 B;  3WA9 B;  4WNN A;  5AV9 C;  3B0D C;  3LEL D;  1KX3 B;  5G49 A;  4JJN D;  4R8P C;  3C1B C;  3WTP A;  3REH B;  5B40 C;  4H9S C;  5AV9 D;  5GT3 A;  1TAF B;  3WA9 A;  4NE6 A;  1KX3 A;  4R8P D;  3C1B D;  5B0Z C;  5B1L B;  1WWI A;  5E5A B;  5B40 D;  3REH A;  5F99 D;  1TAF A;  4XZQ B;  3AZJ C;  5AV8 B;  5B0Z D;  1KU5 A;  1F66 B;  3LJA C;  5E5A A;  4ZUX C;  1P3F C;  1P3P C;  4Z5T D;  5GSU C;  2CV5 C;  2FJ7 B;  4XZQ A;  4XUJ B;  5AV8 A;  3NQU B;  1F66 A;  4ZUX D;  1P3F D;  5JRG B;  1P34 B;  3AZG C;  3REL C;  2FJ7 A;  4XUJ A;  3KWQ D;  1KX5 B;  4EO5 C;  2F8N D;  5CPK B;  3WKJ B;  1Q9C A;  4ZBJ B;  5GT0 B;  3NQU A;  3W96 B;  3AN2 D;  5JRG A;  3AZG D;  3REL D;  4G92 C;  1P34 A;  4J8W C;  3MGQ B;  4H9Q B;  3X1S C;  1KX5 A;  5CPK A;  3WKJ A;  5B2J C;  5GT0 A;  3W96 A;  4J8W D;  5B31 G;  3WTP C;  3MGQ A;  4H9Q A;  3X1S D;  1KX3 C;  3WTP D;  3LEL B;  5GT3 D;  3WA9 D;  1KX3 D;  3WAA B;  4J8X B;  5AV9 B;  5B1L C;  3LEL A;  3REH D;  4R8P B;  4E45 A;  3WAA A;  4XZQ C;  5AV8 C;  4J8X A;  1EQZ C;  5B1L D;  5AV9 A;  5E5A D;  1F66 C;  3MVD B;  4R8P A;  3W99 B;  4XZQ D;  4M6B A;  2RVQ C;  2FJ7 C;  2HIO C;  5AV8 D;  1EQZ D;  1TZY B;  4DRB A;  2L5A A;  4XUJ C;  4YM6 B;  3C1C B;  1F66 D;  3AZJ B;  5AY8 B;  5B33 B;  1P34 C;  3W99 A;  2RVQ D;  2FJ7 D;  3LJA B;  4XUJ D;  1BH8 B;  1TZY A;  1KX5 C;  1P3P B;  5GSU B;  5CPK C;  2CV5 B; 
#chains in the Genus database with same CATH topology
 5GT0 C;  3MNN B;  3UTA B;  5AY8 A;  3AZJ A;  5JRG D;  3X1V C;  1P34 D;  5B33 A;  3LJA A;  3MGQ C;  1BH8 A;  4ZUX A;  1KX5 D;  5CPK D;  3WKJ D;  4WU9 B;  1P3P A;  5GT0 D;  5GSU A;  2JE5 A;  2CV5 A;  3VH5 A;  3W96 D;  5JA4 B;  3X1V D;  3REI C;  4H9R A;  3MNN A;  3UTA A;  1ULY A;  3MGQ D;  3A1K A;  4LD9 B;  3AZL B;  1B6W A;  3REI D;  5JA4 A;  3X1S B;  2IO5 B;  5B2J B;  4Z66 B;  4H9N B;  3AYW B;  4LD9 A;  3VH5 T;  3REJ B;  3AZL A;  4J8W A;  1AOI B;  4J8X C;  3X1S A;  1P3G B;  1PZR A;  5B2J A;  3WAA D;  5BNX B;  4Z66 A;  3AZH B;  4H9N A;  3AYW A;  2F8N G;  4J8X D;  3REJ A;  1AOI A;  1P3G A;  4YS3 B;  5DNN B;  3MVD C;  3KXB B;  3W99 C;  2NQB B;  5BNX A;  3AZH A;  1TZY C;  4YM6 C;  3C1C C;  1KX4 C;  2PYO B;  3VH5 W;  3MVD D;  5GXQ B;  5AY8 C;  5DNN A;  4AWL B;  3W99 D;  3KXB A;  4WU8 B;  5B33 C;  4YS3 A;  5CPI B;  1EQZ B;  2NQB A;  5B1L A;  1TZY D;  4YM6 D;  2NZD C;  4J8V B;  3P5J B;  3C1C D;  3AZE C;  3AZN B;  3AZJ D;  5AY8 D;  1B67 A;  2HIO B;  2PYO A;  5B33 D;  3MNN C;  4KHA B;  3UTA C;  1EQZ A;  5AV5 B;  5CPI A;  3WKJ C;  4WU8 A;  3LJA D;  1M18 B;  3UTB C;  5B2I C;  3AZM B;  3VH6 A;  3AZE D;  2NZD D;  3REK C;  5C3I B;  1P3A B;  1P3P D;  5GSU D;  2CV5 D;  4WU9 C;  4CSR B;  3AZN A;  3MNN D;  3UTA D;  2HIO A;  4E44 A;  2HUE C;  4KHA A;  5CPJ B;  1T3U A;  2Y2I A;  3EPL A;  5BT1 C;  2XD5 A;  3REK D;  1M18 A;  3AZM A;  3X1V B;  4WU9 D;  1P3A A;  5B31 B;  2ARO C;  4LD9 C;  3AZL C;  4CSR A;  4X23 B;  4Z2M H;  5CPJ A;  3MGP B;  2IO5 C;  5AVC C;  4HGA B;  3VH6 T;  3REI B;  4Z66 C;  3X1V A;  4LD9 D;  2ZY4 A;  2Y2K A;  3AZL D;  3AYW C;  5B31 A;  3REJ C;  1S32 B;  3X1T B;  1AOI C;  2Y2H A;  2Y2G A;  2YFV B;  4X23 A;  3MGP A;  5AVC D;  4WZS B;  5B2J D;  3MGS B;  1P3G C;  2VQR A;  4Z66 D;  3REI A;  4H9O B;  3AYW D;  3H0R C;  3REJ D;  3AZH C;  1AOI D;  1S32 A;  2Y2O A;  1P3G D;  2YFV A;  3KUY C;  3O62 B;  3MGS A;  4YS3 C;  5DNN C;  3KXB C;  4H9O A;  2NQB C;  3AZH D;  5BS7 C;  3VH6 W;  4KUD B;  3LZ1 B;  4CAY B;  1JFI B;  2PYO C;  4YS3 D;  5DNN D;  3KXB D;  3O62 A;  4NFT A;  5GXQ C;  5B32 G;  5CPI C;  4AWL C;  2NQB D;  4WU8 C;  3UT9 B;  1P3I B;  3LZ1 A;  4J8V C;  4CAY A;  1JFI A;  2PYO D;  3AZN C;  5GXQ D;  3AV2 B;  2ZY2 A;  5CPI D;  3AZK B;  4WU8 D;  1HQ3 B;  2DF4 C;  5AV5 C;  3UT9 A;  1KX4 B;  1M18 C;  3AZM C;  3MVD A;  4J8V D;  1P3B B;  1P3I A;  5C3I C;  1P3A C;  3AZN D;  2HIO D;  5FUG B;  1ZLA B;  3AV2 A;  5AV5 D;  2NZD B;  3AZK A;  4YM6 A;  3AZE B;  5CPJ C;  1HQ3 A;  3AZI B;  3C1C A;  1M18 D;  3AZM D;  1KX4 A;  4J8U B;  1P3A D;  1P3B A;  5B31 C;  5FUG A;  3UTB B;  5B2I B;  5CPJ D;  3REK B;  4X23 C;  2NZD A;  1BH9 B;  3AZE A;  3MGP C;  3AZI A;  5KDM B;  4HGA C;  4J8U A;  2HUE B;  3A6N B;  3TU4 B;  5B31 D;  1S32 C;  2Y2J A;  4X23 D;  5B2I A;  3UTB A;  3X1T C;  3MGP D;  3REK A;  2ARO B;  3MGS C;  4WU9 A;  5KDM A;  3A6N A;  3TU4 A;  1S32 D;  3LZ0 B;  5AVC B;  3X1T D;  1P3K C;  3MGS D;  1W2E A;  2ARO A;  3O62 C;  5AV6 B;  3LZ0 A;  5AVC A;  1P3K D;  4KUD C;  3LZ1 C;  4G91 C;  2BYM B;  3O62 D;  5CHL B;  5B0Y B;  2XD1 A;  3UT9 C;  4KGC C;  4NE5 A;  5DNM C;  3KUY B;  4KUD D;  5AV6 A;  3LZ1 D;  2YFW B;  1P3I C;  3KFU G;  1U35 C;  2BYM A;  4JJN C;  3AV2 C;  5B0Y A;  3AZK C;  3UT9 D;  1HQ3 C;  1M19 C;  3X1U B;  2ZY5 A;  3KUY A;  1P3I D;  3AZF B;  1U35 D;  1P3B C;  2YFW A;  5BS7 A;  3AV2 D;  3AZK D;  3B6G C;  1ZLA C;  2UWX A;  1HQ3 D;  1M19 D;  1KX4 D;  3AZI C;  2JSS A;  3X1U A;  3B0C T;  1P3B D;  4J8U C;  5BNV B;  5GXQ A;  5F99 C;  3AZF A;  3B6G D;  1ZLA D;  4WV4 B;  1ID3 B;  3AZI D;  4J8V A;  4J8U D;  1M1A B;  5BNV A;  3A6N C;  4QLC B;  3TU4 C;  5AV5 A;  3AV1 B;  3NQJ B;  2JCH A;  4Z5T C;  3UTB D;  3V9R B;  5B2I D;  3EPJ A;  5B24 B;  3B6F B;  1ID3 A;  3MGR B;  5B1M B;  1WWS A;  3A6N D;  1M1A A;  3TU4 D;  3AV1 A;  4QLC A;  5BT1 D;  3B0C W;  3NQJ A;  3LZ0 C;  1P3O B;  3V9R A;  5B24 A;  3B6F A;  3KWQ C;  2ARO D;  3KSY A;  3MGR A;  5AVB B;  5B1M A;  5CP6 C;  4H9P B;  3AN2 C;  3W98 B;  3LZ0 D;  5AV6 C;  1P3O A;  3AL0 C;  2BYK B;  4DRA A;  5CP6 D;  5AVB A;  5B0Y C;  4H9P A;  3X1T A;  1P3K B;  1P3M C;  1HTA A;  5AV6 D;  3W98 A;  5B32 B;  3A1I A;  3AFA B;  2BYK A;  5B0Y D;  1P3M D;  1P3K A;  4G91 B;  4NE3 A;  3X1U C;  3KUY D;  5GT3 C;  3AZF C;  5B32 A;  3WA9 C;  3AFA A;  1P3L B;  3W97 B;  4KGC B;  5DNM B;  1H3O B;  4KUD A;  3X1U D;  1U35 B;  3REH C;  4JJN B;  3AZF D;  4Z2M G;  2CWE A;  1M19 B;  2F8N K;  3W97 A;  1P3L A;  4KGC A;  5DNM A;  2W8S A;  1ID3 C;  1H3O A;  3B0D B;  2BG1 A;  1U35 A;  5E5A C;  1M1A C;  3B6G B;  4JJN A;  4UUZ B;  3C1B B;  4QLC C;  3AV1 C;  1M19 A;  5B40 B;  1ID3 D;  5B24 C;  5F99 B;  3B6F C;  3MGR C;  5B1M C;  1M1A D;  1N1J B;  3B6G A;  3AV1 D;  4QLC D;  5B0Z B;  1ZLA A;  4UUZ A;  3C1B A;  2G5I C;  5B40 A;  5B24 D;  4H9S A;  1P3O C;  3B6F D;  3MGR D;  5F99 A;  5B1M D;  4UPK A;  4Z5T B;  5AVB C;  1N1J A;  5JRG C;  5B0Z A;  3WTP E;  3R45 B;  1BH9 A;  3W98 C;  4DQY B;  1P3O D;  4ZUX B;  2F8N H;  1P3F B;  5AVB D;  4ZBJ C;  4Z5T A;  4H9R B;  3W96 C;  2LY8 A;  3KWQ B;  3W98 D;  2F8N B;  2G5H C;  3R45 A;  5CP6 B;  5B32 C;  3AFA C;  3AN2 B;  1P3F A;  3AZG B;  3REL B;  1R4V A;  5BO0 B;  4EO5 B;  3H0M C;  1BFM A;  3KWQ A;  2F8N A;  5B32 D;  3AFA D;  5CP6 A;  1P3M B;  3AN2 A;  4G92 B;  1P3L C;  3W97 C;  4J8W B;  3AZG A;  3REL A;  4WNN B;  5BO0 A;  1A7W A;  3FDD A;  5G49 B;  3LEL C;  3F6T A;  2DQN C;  1F1E A;  3B0B A;  1P3L D;  3W97 D;  4KGC D;  3WAA C;  5DNM D;  1P3M A;  3WTP B;  5GT3 B;  2Y2N A;  3WA9 B;  4WNN A;  5AV9 C;  3B0D C;  3LEL D;  1KX3 B;  5G49 A;  4JJN D;  4R8P C;  3C1B C;  3WTP A;  3REH B;  5B40 C;  4H9S C;  5AV9 D;  5GT3 A;  1TAF B;  2Y2M A;  3WA9 A;  4NE6 A;  2ZY3 A;  1KX3 A;  1Z2C B;  4R8P D;  3EPK A;  3C1B D;  5B0Z C;  2FFF B;  5B1L B;  1WWI A;  5E5A B;  5B40 D;  2ZM5 A;  3REH A;  5F99 D;  1TAF A;  4XZQ B;  3AZJ C;  5AV8 B;  5B0Z D;  1KU5 A;  1F66 B;  3LJA C;  5E5A A;  4ZUX C;  1P3F C;  1P3P C;  2Y2L A;  4Z5T D;  5GSU C;  2CV5 C;  2FJ7 B;  4XZQ A;  4XUJ B;  5AV8 A;  3NQU B;  1F66 A;  2J8P A;  4ZUX D;  3EG5 B;  1P3F D;  5JRG B;  1P34 B;  3AZG C;  3REL C;  2FJ7 A;  4XUJ A;  3KWQ D;  1KX5 B;  4EO5 C;  2F8N D;  5CPK B;  3WKJ B;  1Q9C A;  4ZBJ B;  5GT0 B;  3NQU A;  3W96 B;  3AN2 D;  5JRG A;  3AZG D;  3REL D;  4G92 C;  1P34 A;  4J8W C;  3MGQ B;  4H9Q B;  3X1S C;  1KX5 A;  5CPK A;  3WKJ A;  5B2J C;  5GT0 A;  3W96 A;  2Y2P A;  4J8W D;  5B31 G;  3WTP C;  3MGQ A;  4H9Q A;  3IP4 C;  3X1S D;  1KX3 C;  4WJ3 C;  3WTP D;  3LEL B;  5GT3 D;  2F2A C;  3WA9 D;  3H0L C;  1KX3 D;  3WAA B;  4J8X B;  5AV9 B;  5B1L C;  3LEL A;  3REH D;  4R8P B;  4E45 A;  3WAA A;  4XZQ C;  5AV8 C;  4J8X A;  1EQZ C;  5B1L D;  5AV9 A;  5E5A D;  1F66 C;  3MVD B;  4R8P A;  3W99 B;  2Y2Q A;  4XZQ D;  3EPH A;  4M6B A;  2RVQ C;  2FJ7 C;  2HIO C;  5AV8 D;  1EQZ D;  1TZY B;  4DRB A;  2L5A A;  4XUJ C;  4YM6 B;  3C1C B;  1F66 D;  3AZJ B;  5AY8 B;  5B33 B;  1P34 C;  2RIQ A;  3W99 A;  2RVQ D;  2FJ7 D;  3LJA B;  4XUJ D;  1BH8 B;  1TZY A;  1KX5 C;  1P3P B;  5GSU B;  5CPK C;  2CV5 B; 
#chains in the Genus database with same CATH homology
 5GT0 C;  3MNN B;  3UTA B;  5AY8 A;  3AZJ A;  5JRG D;  3X1V C;  1P34 D;  5B33 A;  3LJA A;  3MGQ C;  1BH8 A;  4ZUX A;  1KX5 D;  5CPK D;  3WKJ D;  4WU9 B;  1P3P A;  5GT0 D;  5GSU A;  2JE5 A;  2CV5 A;  3VH5 A;  3W96 D;  5JA4 B;  3X1V D;  3REI C;  4H9R A;  3MNN A;  3UTA A;  1ULY A;  3MGQ D;  3A1K A;  4LD9 B;  3AZL B;  1B6W A;  3REI D;  5JA4 A;  3X1S B;  2IO5 B;  5B2J B;  4Z66 B;  4H9N B;  3AYW B;  4LD9 A;  3VH5 T;  3REJ B;  3AZL A;  4J8W A;  1AOI B;  4J8X C;  3X1S A;  1P3G B;  1PZR A;  5B2J A;  3WAA D;  5BNX B;  4Z66 A;  3AZH B;  4H9N A;  3AYW A;  2F8N G;  4J8X D;  3REJ A;  1AOI A;  1P3G A;  4YS3 B;  5DNN B;  3MVD C;  3KXB B;  3W99 C;  2NQB B;  5BNX A;  3AZH A;  1TZY C;  4YM6 C;  3C1C C;  1KX4 C;  2PYO B;  3VH5 W;  3MVD D;  5GXQ B;  5AY8 C;  5DNN A;  4AWL B;  3W99 D;  3KXB A;  4WU8 B;  5B33 C;  4YS3 A;  5CPI B;  1EQZ B;  2NQB A;  5B1L A;  1TZY D;  4YM6 D;  2NZD C;  4J8V B;  3P5J B;  3C1C D;  3AZE C;  3AZN B;  3AZJ D;  5AY8 D;  1B67 A;  2HIO B;  2PYO A;  5B33 D;  3MNN C;  4KHA B;  3UTA C;  1EQZ A;  5AV5 B;  5CPI A;  3WKJ C;  4WU8 A;  3LJA D;  1M18 B;  3UTB C;  5B2I C;  3AZM B;  3VH6 A;  3AZE D;  2NZD D;  3REK C;  5C3I B;  1P3A B;  1P3P D;  5GSU D;  2CV5 D;  4WU9 C;  4CSR B;  3AZN A;  3MNN D;  3UTA D;  2HIO A;  4E44 A;  2HUE C;  4KHA A;  5CPJ B;  1T3U A;  2Y2I A;  3EPL A;  5BT1 C;  2XD5 A;  3REK D;  1M18 A;  3AZM A;  3X1V B;  4WU9 D;  1P3A A;  5B31 B;  2ARO C;  4LD9 C;  3AZL C;  4CSR A;  4X23 B;  4Z2M H;  5CPJ A;  3MGP B;  2IO5 C;  5AVC C;  4HGA B;  3VH6 T;  3REI B;  4Z66 C;  3X1V A;  4LD9 D;  2ZY4 A;  2Y2K A;  3AZL D;  3AYW C;  5B31 A;  3REJ C;  1S32 B;  3X1T B;  1AOI C;  2Y2H A;  2Y2G A;  2YFV B;  4X23 A;  3MGP A;  5AVC D;  4WZS B;  5B2J D;  3MGS B;  1P3G C;  2VQR A;  4Z66 D;  3REI A;  4H9O B;  3AYW D;  3H0R C;  3REJ D;  3AZH C;  1AOI D;  1S32 A;  2Y2O A;  1P3G D;  2YFV A;  3KUY C;  3O62 B;  3MGS A;  4YS3 C;  5DNN C;  3KXB C;  4H9O A;  2NQB C;  3AZH D;  5BS7 C;  3VH6 W;  4KUD B;  3LZ1 B;  4CAY B;  1JFI B;  2PYO C;  4YS3 D;  5DNN D;  3KXB D;  3O62 A;  4NFT A;  5GXQ C;  5B32 G;  5CPI C;  4AWL C;  2NQB D;  4WU8 C;  3UT9 B;  1P3I B;  3LZ1 A;  4J8V C;  4CAY A;  1JFI A;  2PYO D;  3AZN C;  5GXQ D;  3AV2 B;  2ZY2 A;  5CPI D;  3AZK B;  4WU8 D;  1HQ3 B;  2DF4 C;  5AV5 C;  3UT9 A;  1KX4 B;  1M18 C;  3AZM C;  3MVD A;  4J8V D;  1P3B B;  1P3I A;  5C3I C;  1P3A C;  3AZN D;  2HIO D;  5FUG B;  1ZLA B;  3AV2 A;  5AV5 D;  2NZD B;  3AZK A;  4YM6 A;  3AZE B;  5CPJ C;  1HQ3 A;  3AZI B;  3C1C A;  1M18 D;  3AZM D;  1KX4 A;  4J8U B;  1P3A D;  1P3B A;  5B31 C;  5FUG A;  3UTB B;  5B2I B;  5CPJ D;  3REK B;  4X23 C;  2NZD A;  1BH9 B;  3AZE A;  3MGP C;  3AZI A;  5KDM B;  4HGA C;  4J8U A;  2HUE B;  3A6N B;  3TU4 B;  5B31 D;  1S32 C;  2Y2J A;  4X23 D;  5B2I A;  3UTB A;  3X1T C;  3MGP D;  3REK A;  2ARO B;  3MGS C;  4WU9 A;  5KDM A;  3A6N A;  3TU4 A;  1S32 D;  3LZ0 B;  5AVC B;  3X1T D;  1P3K C;  3MGS D;  1W2E A;  2ARO A;  3O62 C;  5AV6 B;  3LZ0 A;  5AVC A;  1P3K D;  4KUD C;  3LZ1 C;  4G91 C;  2BYM B;  3O62 D;  5CHL B;  5B0Y B;  2XD1 A;  3UT9 C;  4KGC C;  4NE5 A;  5DNM C;  3KUY B;  4KUD D;  5AV6 A;  3LZ1 D;  2YFW B;  1P3I C;  3KFU G;  1U35 C;  2BYM A;  4JJN C;  3AV2 C;  5B0Y A;  3AZK C;  3UT9 D;  1HQ3 C;  1M19 C;  3X1U B;  2ZY5 A;  3KUY A;  1P3I D;  3AZF B;  1U35 D;  1P3B C;  2YFW A;  5BS7 A;  3AV2 D;  3AZK D;  3B6G C;  1ZLA C;  2UWX A;  1HQ3 D;  1M19 D;  1KX4 D;  3AZI C;  2JSS A;  3X1U A;  3B0C T;  1P3B D;  4J8U C;  5BNV B;  5GXQ A;  5F99 C;  3AZF A;  3B6G D;  1ZLA D;  4WV4 B;  1ID3 B;  3AZI D;  4J8V A;  4J8U D;  1M1A B;  5BNV A;  3A6N C;  4QLC B;  3TU4 C;  5AV5 A;  3AV1 B;  3NQJ B;  2JCH A;  4Z5T C;  3UTB D;  3V9R B;  5B2I D;  3EPJ A;  5B24 B;  3B6F B;  1ID3 A;  3MGR B;  5B1M B;  1WWS A;  3A6N D;  1M1A A;  3TU4 D;  3AV1 A;  4QLC A;  5BT1 D;  3B0C W;  3NQJ A;  3LZ0 C;  1P3O B;  3V9R A;  5B24 A;  3B6F A;  3KWQ C;  2ARO D;  3KSY A;  3MGR A;  5AVB B;  5B1M A;  5CP6 C;  4H9P B;  3AN2 C;  3W98 B;  3LZ0 D;  5AV6 C;  1P3O A;  3AL0 C;  2BYK B;  4DRA A;  5CP6 D;  5AVB A;  5B0Y C;  4H9P A;  3X1T A;  1P3K B;  1P3M C;  1HTA A;  5AV6 D;  3W98 A;  5B32 B;  3A1I A;  3AFA B;  2BYK A;  5B0Y D;  1P3M D;  1P3K A;  4G91 B;  4NE3 A;  3X1U C;  3KUY D;  5GT3 C;  3AZF C;  5B32 A;  3WA9 C;  3AFA A;  1P3L B;  3W97 B;  4KGC B;  5DNM B;  1H3O B;  4KUD A;  3X1U D;  1U35 B;  3REH C;  4JJN B;  3AZF D;  4Z2M G;  2CWE A;  1M19 B;  2F8N K;  3W97 A;  1P3L A;  4KGC A;  5DNM A;  2W8S A;  1ID3 C;  1H3O A;  3B0D B;  2BG1 A;  1U35 A;  5E5A C;  1M1A C;  3B6G B;  4JJN A;  4UUZ B;  3C1B B;  4QLC C;  3AV1 C;  1M19 A;  5B40 B;  1ID3 D;  5B24 C;  5F99 B;  3B6F C;  3MGR C;  5B1M C;  1M1A D;  1N1J B;  3B6G A;  3AV1 D;  4QLC D;  5B0Z B;  1ZLA A;  4UUZ A;  3C1B A;  2G5I C;  5B40 A;  5B24 D;  4H9S A;  1P3O C;  3B6F D;  3MGR D;  5F99 A;  5B1M D;  4UPK A;  4Z5T B;  5AVB C;  1N1J A;  5JRG C;  5B0Z A;  3WTP E;  3R45 B;  1BH9 A;  3W98 C;  4DQY B;  1P3O D;  4ZUX B;  2F8N H;  1P3F B;  5AVB D;  4ZBJ C;  4Z5T A;  4H9R B;  3W96 C;  2LY8 A;  3KWQ B;  3W98 D;  2F8N B;  2G5H C;  3R45 A;  5CP6 B;  5B32 C;  3AFA C;  3AN2 B;  1P3F A;  3AZG B;  3REL B;  1R4V A;  5BO0 B;  4EO5 B;  3H0M C;  1BFM A;  3KWQ A;  2F8N A;  5B32 D;  3AFA D;  5CP6 A;  1P3M B;  3AN2 A;  4G92 B;  1P3L C;  3W97 C;  4J8W B;  3AZG A;  3REL A;  4WNN B;  5BO0 A;  1A7W A;  3FDD A;  5G49 B;  3LEL C;  3F6T A;  2DQN C;  1F1E A;  3B0B A;  1P3L D;  3W97 D;  4KGC D;  3WAA C;  5DNM D;  1P3M A;  3WTP B;  5GT3 B;  2Y2N A;  3WA9 B;  4WNN A;  5AV9 C;  3B0D C;  3LEL D;  1KX3 B;  5G49 A;  4JJN D;  4R8P C;  3C1B C;  3WTP A;  3REH B;  5B40 C;  4H9S C;  5AV9 D;  5GT3 A;  1TAF B;  2Y2M A;  3WA9 A;  4NE6 A;  2ZY3 A;  1KX3 A;  1Z2C B;  4R8P D;  3EPK A;  3C1B D;  5B0Z C;  2FFF B;  5B1L B;  1WWI A;  5E5A B;  5B40 D;  2ZM5 A;  3REH A;  5F99 D;  1TAF A;  4XZQ B;  3AZJ C;  5AV8 B;  5B0Z D;  1KU5 A;  1F66 B;  3LJA C;  5E5A A;  4ZUX C;  1P3F C;  1P3P C;  2Y2L A;  4Z5T D;  5GSU C;  2CV5 C;  2FJ7 B;  4XZQ A;  4XUJ B;  5AV8 A;  3NQU B;  1F66 A;  2J8P A;  4ZUX D;  3EG5 B;  1P3F D;  5JRG B;  1P34 B;  3AZG C;  3REL C;  2FJ7 A;  4XUJ A;  3KWQ D;  1KX5 B;  4EO5 C;  2F8N D;  5CPK B;  3WKJ B;  1Q9C A;  4ZBJ B;  5GT0 B;  3NQU A;  3W96 B;  3AN2 D;  5JRG A;  3AZG D;  3REL D;  4G92 C;  1P34 A;  4J8W C;  3MGQ B;  4H9Q B;  3X1S C;  1KX5 A;  5CPK A;  3WKJ A;  5B2J C;  5GT0 A;  3W96 A;  2Y2P A;  4J8W D;  5B31 G;  3WTP C;  3MGQ A;  4H9Q A;  3IP4 C;  3X1S D;  1KX3 C;  4WJ3 C;  3WTP D;  3LEL B;  5GT3 D;  2F2A C;  3WA9 D;  3H0L C;  1KX3 D;  3WAA B;  4J8X B;  5AV9 B;  5B1L C;  3LEL A;  3REH D;  4R8P B;  4E45 A;  3WAA A;  4XZQ C;  5AV8 C;  4J8X A;  1EQZ C;  5B1L D;  5AV9 A;  5E5A D;  1F66 C;  3MVD B;  4R8P A;  3W99 B;  2Y2Q A;  4XZQ D;  3EPH A;  4M6B A;  2RVQ C;  2FJ7 C;  2HIO C;  5AV8 D;  1EQZ D;  1TZY B;  4DRB A;  2L5A A;  4XUJ C;  4YM6 B;  3C1C B;  1F66 D;  3AZJ B;  5AY8 B;  5B33 B;  1P34 C;  2RIQ A;  3W99 A;  2RVQ D;  2FJ7 D;  3LJA B;  4XUJ D;  1BH8 B;  1TZY A;  1KX5 C;  1P3P B;  5GSU B;  5CPK C;  2CV5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...