4H9NB

Complex structure 1 of daxx/h3.3(sub5)/h4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 27
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9nB00
4YM6B 3WA9C 3O62A 3MGSA 5B32B 4R8PA 4X23B 5B32C 3REHA 4X23C 5B33D 5JRGA 3AZEB 3AZEC 3WTPE 4JJNB 4YS3D 4XUJA 4CAYA 4JJNC 1P3MA 5CP6D 1P3AA 4Z66A 1EQZB 3X1UA 3MGQD 1EQZC 3MVDD 3VH6W 1U35B 2NQBB 1U35C 2NQBC 4KUDA 1BH8B 5FUGA 5AY8D 3AN2B 3B0DB 3AN2C 3B0CT 2NZDA 1KX4B 3B0DC 3C1BB 3AZHD 1S32A 5CPJB 1AOIB 3UT9A 1TZYB 5JA4B 3REKC 5CPJC 1AOIC 5AVBB 3WTPA 3REJB 3REJC 5CPKD 3B6GB 3W98A 3LZ1D 4H9OB 1B67A 5BNVB 3B6GC 3UTAD 5BO0B 3AZND 4QLCB 3KUYD 5F99B 2F8NH 1KX3D 2L5AA 4J8VB 3KSYA 4QLCC 5AV5D 5F99C 1P34B 3AV2A 2PYOA 3NQJB 4J8VC 1N1JB 1M19C 3LJAA 4EO5B 5DNMA 4AWLB 4Z5TD 3AYWA 2BYMA 3MGPB 3AZGB 4AWLC 3MGPC 1TAFB 2FJ7A 3AZGC 1M1AB 2AROA 4UUZB 4Z2MH 3X1SB 5AVCD 1M1AC 3LZ0D 4J8UA 3X1SC 1ZLAC 2YFVB 1HTAA 2F8NK 2IO5B 3X1TA 4WU8A 5AV9A 2IO5C 1P3LA 4E45A 5B0YB 3MGRA 5B2JD 4WV4B 3WAAB 3AZKB 3WA9A 4J8XC 3WAAC 5AV8B 3AZKC 3AZFD 5B0ZB 3MGQB 3VH5W 5B32A 5AV8C 5B0ZC 4X23A 1P3FD 2RVQD 1P3OD 5CPID 3AZEA 5DNNB 1P3BD 4KGCB 4LD9D 3C1CD 5DNNC 4JJNA 1P3GD 4KGCC 1S32C 1EQZA 2F8NG 3W96D 1U35A 2NQBA 3A6NB 5B1LD 3A6NC 3W97B 5GT0D 3AZMB 3X1VB 1BH8A 3AN2A 3W97C 3MNND 3AZMC 3X1VC 1F66B 4Z2MG 2F8NB 3W99D 1P3PD 1F66C 3B6FB 4KHAB 3B6FC 1HQ3D 5G49B 5AV6D 5AV5B 3REKA 3LELD 5CPJA 1AOIA 5JA4A 5B40D 3AFAD 3REJA 3B6GA 4H9SC 1P3IB 4H9OA 3WKJD 5BNVA 3AV1D 4H9PB 1P3IC 1BH9B 5AVCB 1KX5B 5BO0A 2HIOD 2CV5B 4DRAA 4QLCA 5F99A 5E5AD 1KX5C 2HUEC 4J8VA 2CV5C 3TU4B 1M19A 4H9QA 3NQJA 3TU4C 1N1JA 5GSUD 4ZUXD 3KXBD 3MGPA 3AZLD 4YM6C 3AZGA 3AZFB 1TAFA 1M1AA 5B1MD 3UTBD 3X1SA 3AZID 1ZLAA 4NE6A 5B31B 2YFVA 5B31C 3RELB 4XZQD 4E44A 3RELC 4WU9D 4LD9B 3C1CB 5B0YA 5B24B 3VH6T 4J8XA 3WAAA 3AZKA 5B24C 3O62D 3MGSD 1JFIB 5AV8A 4R8PD 5B0ZA 3REHD 1M18B 1M18C 5JRGD 4DRBA 5BNXB 4WZSB 5GT3B 5DNNA 1KX4C 4KGCA 4XUJD 4J8WB 5GT3C 1P3MD 4H9RB 3C1BC 4Z66D 4J8WC 1P3AD 1H3OB 3X1UD 4ZBJB 1WWSA 5B2IB 3A6NA 1TZYC 3V9RA 4CSRB 5B2IC 5AVBC 3AZJB 5B40B 4KUDD 3W97A 3AZJC 3AZMA 1P3KB 3X1VA 2NZDD 1P3KC 3KWQB 3REIB 1F66A 5GXQB 2F8NA 3KWQC 3REIC 3B6FA 5GXQC 1S32D 1P34C 5KDMB 3UT9D 4H9NB 3WTPD 4EO5C 1ID3B 3W98D 4H9SA 3AZLB 1ID3C 1P3IA 4H9PA 5B33B 3NQUB 1KX5A 2CV5A 1F1EA 2PYOD 5B33C 3AV2D 1BFMA 3TU4A 4YS3B 5C3IB 3LJAD 4YS3C 5B0YC 5DNMD 5CP6B 3AYWD 4YM6A 3VH5T 5CP6C 3MVDB 2FJ7D 5BT1D 3MGQC 2AROD 2CWEA 3MVDC 4J8UD 5B31A 5AY8B 3RELA 5AY8C 3X1TD 4WU8D 5AV9D 1P3LD 3MGRD 3AZHB 5B24A 3AZHC 3WA9D 5B32D 4X23D 1B6WA 1M18A 1Q9CA 5CHLB 5CPKB 4KUDB 3AZED 4G91B 3LZ1B 5FUGB 5CPKC 3UTAB 4G91C 5BNXA 3LZ1C 1KX4A 2NZDB 5GT3A 4JJND 3UTAC 3AZNB 3C1BA 4J8WA 4G92B 2BYKB 3KUYB 3AZNC 1KX3B 4H9RA 1EQZD 4G92C 1H3OA 3KUYC 1KX3C 5AV5C 1U35D 2NQBD 1TZYA 5B2IA 5AVBA 4CSRA 4Z5TB 3WTPB 3B0BA 3AZJA 4Z5TC 3AN2D 5BS7C 1P3KA 4WNNB 3LZ0B 3KWQA 3REIA 5AVCC 5GXQA 3LZ0C 1P34A 2PYOB 3REKD 5KDMA 5CPJD 1AOID 5B2JB 3REJD 5B2JC 1ID3A 3B6GD 4UUZA 3AZFC 1P3FB 1P3OB 1P3FC 2RVQC 1P3OC 5CPIB 4QLCD 5F99D 3NQUA 5B33A 5CPIC 4J8VD 4NE3A 1M19D 3X1TB 1P3BB 4WU8B 5AV9B 1P3GB 4YS3A 1P3BC 4LD9C 3C1CC 1P3GC 5CP6A 3MGPD 3W96B 3AZGD 3MGQA 3R45B 3MVDA 3W96C 1M1AD 5B1LB 3X1SD 1ZLAD 5B1LC 5GT0B 5AY8A 4NE5A 5GT0C 3MNNB 3MNNC 1P3PB 3W99B 5B0YD 3W99C 1P3PC 3AZHA 4J8XD 1HQ3B 3WAAD 3AZKD 1KU5A 1HQ3C 5AV6B 5AV8D 4ZBJC 5B0ZD 5AV6C 3LELB 2YFWB 3AFAB 3LELC 3AFAC 5B40C 5CPKA 3LZ1A 3WKJB 3AV1B 5DNND 3UTAA 3WKJC 4KGCD 3AV1C 3B0CW 4KHAA 3AZNA 2HIOB 2BYKA 3KUYA 5E5AB 1KX3A 2HIOC 5G49A 4M6BA 5AV5A 5E5AC 3A6ND 3REKB 5GSUB 4ZUXB 3VH6A 4Z5TA 5GSUC 3KXBB 4ZUXC 3W97D 5BS7A 3AZMD 3KXBC 3AZLC 3X1VD 5B1MB 3UTBB 1BH9A 4WNNA 3AZIB 1F66D 5AVCA 3LZ0A 5B1MC 3UTBC 3AZIC 2F8ND 3B6FD 4XZQB 1ULYA 4WU9B 2LY8A 4XZQC 4WU9C 1M19B 4H9QB 5C3IC 2JSSA 5B2JA 1WWIA 3O62B 3MGSB 3AZFA 4R8PB 3O62C 3MGSC 1P3ID 4HGAB 4R8PC 3REHB 1P3FA 4HGAC 3REHC 1P3OA 1ZLAB 5JRGB 1KX5D 5CPIA 2CV5D 5JRGC 3TU4D 1P3BA 4LD9A 4XUJB 4CAYB 3C1CA 1P3GA 1P3MB 1P3AB 4XUJC 4Z66B 3X1UB 1P3MC 4YM6D 1P3AC 4J8XB 4Z66C 1JFIA 3X1UC 3W96A 3R45A 5B1LA 5B31D 3RELD 5GT0A 4KUDC 3MNNA 2NZDC 4NFTA 1R4VA 1P3PA 3W99A 1S32B 5B24D 1HQ3A 5AV6A 3UT9B 1A7WA 3LELA 3UT9C 2YFWA 1M18D 3V9RB 5B40A 3AFAA 3VH5A 3WTPC 3W98B 3W98C 1KX4D 3WKJA 3AV1A 5GT3D 3C1BD 4J8WD 2HIOA 5E5AA 3AV2B 2PYOC 3AV2C 1TZYD 5B2ID 4H9NA 5AVBD 3LJAB 5DNMB 5GSUA 3AYWB 2BYMB 4ZUXA 3LJAC 3AZJD 5DNMC 3AYWC 3KXBA 3AZLA 2FJ7B 2AROB 1P3KD 2FJ7C 5BT1C 2AROC 5B1MA 3KWQD 4J8UB 3REID 3UTBA 3AZIA 5GXQD 5B32G 4J8UC 4XZQA 1P34D 2HUEB 4WU9A 5B31G 3X1TC 1P3LB 4WU8C 5AV9C 3MGRB 1P3LC 3MGRC 3WA9B 1ID3D
chains in the Genus database with same CATH superfamily
4YM6B 3WA9C 3O62A 3MGSA 5B32B 4R8PA 2Y2OA 4X23B 5B32C 3REHA 4X23C 5B33D 5JRGA 3AZEB 3A1KA 3AZEC 3WTPE 4JJNB 4YS3D 4XUJA 4CAYA 4JJNC 1P3MA 5CP6D 1P3AA 4Z66A 1EQZB 2ZM5A 3X1UA 3MGQD 1EQZC 3MVDD 3VH6W 1U35B 2NQBB 3H0MC 1U35C 2NQBC 4KUDA 1BH8B 5FUGA 3A1IA 5AY8D 3AN2B 3B0DB 3AN2C 3B0CT 2NZDA 1KX4B 3B0DC 3C1BB 3AZHD 1S32A 5CPJB 1AOIB 3UT9A 1TZYB 5JA4B 3REKC 5CPJC 1AOIC 5AVBB 3WTPA 3REJB 2Y2MA 3REJC 5CPKD 3B6GB 3W98A 3LZ1D 4H9OB 1B67A 5BNVB 3B6GC 3UTAD 5BO0B 3AZND 2BG1A 4QLCB 3KUYD 5F99B 2F8NH 1KX3D 2L5AA 4J8VB 3KSYA 4QLCC 5AV5D 5F99C 1P34B 3AV2A 2PYOA 3NQJB 4J8VC 1N1JB 1M19C 3LJAA 4EO5B 5DNMA 4AWLB 4Z5TD 3AYWA 2BYMA 3MGPB 3AZGB 4AWLC 3MGPC 1TAFB 2FJ7A 3AZGC 1Z2CB 1M1AB 2AROA 4UUZB 4Z2MH 3X1SB 5AVCD 1M1AC 3LZ0D 4J8UA 3X1SC 1ZLAC 2YFVB 1HTAA 2F8NK 2Y2PA 2IO5B 3X1TA 4WU8A 5AV9A 2ZY4A 2IO5C 1P3LA 4E45A 5B0YB 3MGRA 5B2JD 4WV4B 3WAAB 3AZKB 3WA9A 4J8XC 3WAAC 5AV8B 3AZKC 3AZFD 5B0ZB 3MGQB 2Y2IA 3VH5W 5B32A 5AV8C 5B0ZC 4X23A 1P3FD 2RVQD 1P3OD 5CPID 3AZEA 5DNNB 3F6TA 1P3BD 4KGCB 4LD9D 3C1CD 5DNNC 4JJNA 1P3GD 4KGCC 1S32C 1EQZA 2F8NG 3W96D 1U35A 2NQBA 3A6NB 5B1LD 3A6NC 3W97B 5GT0D 3AZMB 2J8PA 3X1VB 1BH8A 3AN2A 3W97C 3MNND 3AZMC 3X1VC 1F66B 4UPKA 4Z2MG 2F8NB 3W99D 1P3PD 1F66C 3B6FB 4KHAB 2DQNC 3B6FC 1HQ3D 5G49B 5AV6D 5AV5B 3REKA 3FDDA 3LELD 2DF4C 5CPJA 1AOIA 5JA4A 5B40D 3AFAD 3REJA 3B6GA 4H9SC 1P3IB 4H9OA 3WKJD 5BNVA 3AV1D 4H9PB 1P3IC 1BH9B 5AVCB 1KX5B 5BO0A 2HIOD 2CV5B 4DRAA 4QLCA 5F99A 3P5JB 5E5AD 1KX5C 2HUEC 4J8VA 2CV5C 3TU4B 1M19A 4H9QA 3NQJA 3TU4C 1N1JA 5GSUD 4ZUXD 3KXBD 3MGPA 3AZLD 4YM6C 3AZGA 3AZFB 1TAFA 1M1AA 5B1MD 3UTBD 3X1SA 3AZID 1ZLAA 4NE6A 5B31B 2YFVA 5B31C 3H0LC 3RELB 4XZQD 4E44A 3RELC 4WU9D 4LD9B 3C1CB 2FFFB 5B0YA 5B24B 3VH6T 4J8XA 3WAAA 3AZKA 5B24C 3O62D 3MGSD 1JFIB 5AV8A 4R8PD 5B0ZA 3REHD 1M18B 1M18C 5JRGD 4DRBA 5BNXB 4WZSB 5GT3B 5DNNA 1KX4C 4KGCA 4XUJD 4J8WB 5GT3C 1P3MD 4H9RB 3C1BC 4Z66D 4J8WC 1P3AD 1H3OB 3X1UD 4ZBJB 1WWSA 5B2IB 3A6NA 5B2IC 1TZYC 3V9RA 4CSRB 5AVBC 2XD5A 3AZJB 5B40B 4KUDD 3W97A 3AZJC 3AZMA 1P3KB 3X1VA 2NZDD 1P3KC 3KWQB 3REIB 1F66A 5GXQB 2F8NA 3KWQC 3REIC 2Y2KA 3B6FA 5GXQC 2UWXA 1S32D 1P34C 5KDMB 3UT9D 2G5IC 4H9NB 3WTPD 4EO5C 1ID3B 3W98D 4H9SA 3AZLB 1ID3C 1P3IA 4H9PA 3EPLA 2W8SA 5B33B 3NQUB 1KX5A 2CV5A 1F1EA 2PYOD 5B33C 3AV2D 1BFMA 1W2EA 3TU4A 4YS3B 5C3IB 3LJAD 4YS3C 5B0YC 2Y2GA 5DNMD 5CP6B 4DQYB 3AYWD 2ZY3A 4YM6A 3VH5T 5CP6C 3MVDB 2FJ7D 5BT1D 3H0RC 2AROD 2CWEA 3MVDC 3MGQC 4J8UD 5B31A 5AY8B 3RELA 5AY8C 3X1TD 4WU8D 5AV9D 1P3LD 3MGRD 3AZHB 5B24A 3AZHC 3WA9D 5B32D 4X23D 2Y2LA 1B6WA 1M18A 3AL0C 1Q9CA 5CHLB 5CPKB 4KUDB 3AZED 4G91B 3LZ1B 5FUGB 5CPKC 3UTAB 4G91C 5BNXA 3LZ1C 1KX4A 2NZDB 5GT3A 4JJND 3UTAC 3AZNB 3C1BA 4J8WA 4G92B 2BYKB 3KUYB 3AZNC 1KX3B 4H9RA 1EQZD 4G92C 3IP4C 1H3OA 3KUYC 1KX3C 5AV5C 1U35D 2NQBD 1TZYA 5B2IA 5AVBA 4CSRA 4Z5TB 3WTPB 3B0BA 3AZJA 4Z5TC 3AN2D 5BS7C 1P3KA 4WNNB 3LZ0B 3KWQA 3REIA 5AVCC 5GXQA 3LZ0C 1P34A 2PYOB 3REKD 5KDMA 5CPJD 1AOID 5B2JB 3REJD 2ZY5A 5B2JC 1ID3A 3B6GD 4UUZA 3AZFC 1P3FB 1P3OB 1P3FC 2RVQC 1P3OC 5CPIB 4QLCD 5F99D 3NQUA 5B33A 5CPIC 4J8VD 4NE3A 1M19D 3X1TB 1P3BB 4WU8B 5AV9B 1P3GB 4YS3A 1P3BC 4LD9C 3C1CC 1P3GC 5CP6A 3MGPD 3W96B 3AZGD 3MGQA 3R45B 3MVDA 3W96C 1M1AD 5B1LB 3X1SD 1ZLAD 5B1LC 5GT0B 5AY8A 4NE5A 5GT0C 3MNNB 3MNNC 1P3PB 3W99B 5B0YD 3W99C 1P3PC 3AZHA 4J8XD 1HQ3B 3WAAD 3AZKD 1KU5A 1HQ3C 5AV6B 5AV8D 4ZBJC 5B0ZD 5AV6C 3LELB 2YFWB 3AFAB 3LELC 3AFAC 5B40C 5CPKA 3LZ1A 3WKJB 3AV1B 5DNND 3UTAA 3WKJC 4KGCD 3AV1C 2ZY2A 3B0CW 4KHAA 2Y2HA 3AZNA 2HIOB 2BYKA 3KUYA 5E5AB 1KX3A 2HIOC 2Y2QA 5G49A 4M6BA 5AV5A 5E5AC 2XD1A 3A6ND 3REKB 5GSUB 4ZUXB 3VH6A 4Z5TA 5GSUC 3KXBB 4ZUXC 3W97D 5BS7A 3AZMD 3KXBC 2VQRA 3AZLC 3X1VD 5B1MB 3UTBB 1BH9A 4WNNA 3AZIB 1F66D 5AVCA 3LZ0A 5B1MC 3UTBC 3AZIC 2F8ND 3B6FD 3EPHA 4XZQB 1ULYA 4WU9B 2LY8A 4XZQC 4WU9C 1M19B 4H9QB 5C3IC 2JSSA 5B2JA 1WWIA 3O62B 3MGSB 3AZFA 4R8PB 3KFUG 2RIQA 3O62C 3MGSC 1P3ID 4HGAB 4R8PC 3REHB 1P3FA 4HGAC 3REHC 1P3OA 1ZLAB 5JRGB 1KX5D 5CPIA 2CV5D 5JRGC 3TU4D 1P3BA 4LD9A 4XUJB 4CAYB 3C1CA 1P3GA 1P3MB 1P3AB 4XUJC 4Z66B 3X1UB 1P3MC 4YM6D 1P3AC 4J8XB 4Z66C 1JFIA 4WJ3C 3X1UC 3W96A 3R45A 2F2AC 5B1LA 5B31D 3RELD 5GT0A 4KUDC 3EG5B 3MNNA 2JE5A 2NZDC 4NFTA 1R4VA 1P3PA 3W99A 1S32B 5B24D 1HQ3A 5AV6A 3EPJA 3UT9B 1A7WA 3LELA 3UT9C 2YFWA 1M18D 3V9RB 5B40A 3AFAA 3VH5A 3WTPC 3W98B 3W98C 1KX4D 3WKJA 2G5HC 3AV1A 5GT3D 3C1BD 4J8WD 2HIOA 5E5AA 3AV2B 2PYOC 3AV2C 2Y2JA 1TZYD 5B2ID 4H9NA 3EPKA 5AVBD 3LJAB 5DNMB 5GSUA 3AYWB 2BYMB 4ZUXA 3LJAC 3AZJD 5DNMC 3AYWC 3KXBA 3AZLA 2FJ7B 2AROB 1P3KD 2FJ7C 5BT1C 2AROC 5B1MA 3KWQD 4J8UB 3REID 3UTBA 3AZIA 5GXQD 2Y2NA 5B32G 4J8UC 4XZQA 1P34D 2HUEB 1PZRA 4WU9A 1T3UA 5B31G 3X1TC 1P3LB 4WU8C 5AV9C 3MGRB 1P3LC 2JCHA 3MGRC 3WA9B 1ID3D
chains in the Genus database with same CATH topology
4YM6B 3WA9C 3O62A 3MGSA 5B32B 4R8PA 2Y2OA 4X23B 5B32C 3REHA 4X23C 5B33D 5JRGA 3AZEB 3A1KA 3AZEC 3WTPE 4JJNB 4YS3D 4XUJA 4CAYA 4JJNC 1P3MA 5CP6D 1P3AA 4Z66A 1EQZB 2ZM5A 3X1UA 3MGQD 1EQZC 3MVDD 3VH6W 1U35B 2NQBB 3H0MC 1U35C 2NQBC 4KUDA 1BH8B 5FUGA 3A1IA 5AY8D 3AN2B 3B0DB 3AN2C 3B0CT 2NZDA 1KX4B 3B0DC 3C1BB 3AZHD 1S32A 5CPJB 1AOIB 3UT9A 1TZYB 5JA4B 3REKC 5CPJC 1AOIC 5AVBB 3WTPA 3REJB 2Y2MA 3REJC 5CPKD 3B6GB 3W98A 3LZ1D 4H9OB 1B67A 5BNVB 3B6GC 3UTAD 5BO0B 3AZND 2BG1A 4QLCB 3KUYD 5F99B 2F8NH 1KX3D 2L5AA 4J8VB 3KSYA 4QLCC 5AV5D 5F99C 1P34B 3AV2A 2PYOA 3NQJB 4J8VC 1N1JB 1M19C 3LJAA 4EO5B 5DNMA 4AWLB 4Z5TD 3AYWA 2BYMA 3MGPB 3AZGB 4AWLC 3MGPC 1TAFB 2FJ7A 3AZGC 1Z2CB 1M1AB 2AROA 4UUZB 4Z2MH 3X1SB 5AVCD 1M1AC 3LZ0D 4J8UA 3X1SC 1ZLAC 2YFVB 1HTAA 2F8NK 2Y2PA 2IO5B 3X1TA 4WU8A 5AV9A 2ZY4A 2IO5C 1P3LA 4E45A 5B0YB 3MGRA 5B2JD 4WV4B 3WAAB 3AZKB 3WA9A 4J8XC 3WAAC 5AV8B 3AZKC 3AZFD 5B0ZB 3MGQB 2Y2IA 3VH5W 5B32A 5AV8C 5B0ZC 4X23A 1P3FD 2RVQD 1P3OD 5CPID 3AZEA 5DNNB 3F6TA 1P3BD 4KGCB 4LD9D 3C1CD 5DNNC 4JJNA 1P3GD 4KGCC 1S32C 1EQZA 2F8NG 3W96D 1U35A 2NQBA 3A6NB 5B1LD 3A6NC 3W97B 5GT0D 3AZMB 2J8PA 3X1VB 1BH8A 3AN2A 3W97C 3MNND 3AZMC 3X1VC 1F66B 4UPKA 4Z2MG 2F8NB 3W99D 1P3PD 1F66C 3B6FB 4KHAB 2DQNC 3B6FC 1HQ3D 5G49B 5AV6D 5AV5B 3REKA 3FDDA 3LELD 2DF4C 5CPJA 1AOIA 5JA4A 5B40D 3AFAD 3REJA 3B6GA 4H9SC 1P3IB 4H9OA 3WKJD 5BNVA 3AV1D 4H9PB 1P3IC 1BH9B 5AVCB 1KX5B 5BO0A 2HIOD 2CV5B 4DRAA 4QLCA 5F99A 3P5JB 5E5AD 1KX5C 2HUEC 4J8VA 2CV5C 3TU4B 1M19A 4H9QA 3NQJA 3TU4C 1N1JA 5GSUD 4ZUXD 3KXBD 3MGPA 3AZLD 4YM6C 3AZGA 3AZFB 1TAFA 1M1AA 5B1MD 3UTBD 3X1SA 3AZID 1ZLAA 4NE6A 5B31B 2YFVA 5B31C 3H0LC 3RELB 4XZQD 4E44A 3RELC 4WU9D 4LD9B 3C1CB 2FFFB 5B0YA 5B24B 3VH6T 4J8XA 3WAAA 3AZKA 5B24C 3O62D 3MGSD 1JFIB 5AV8A 4R8PD 5B0ZA 3REHD 1M18B 1M18C 5JRGD 4DRBA 5BNXB 4WZSB 5GT3B 5DNNA 1KX4C 4KGCA 4XUJD 4J8WB 5GT3C 1P3MD 4H9RB 3C1BC 4Z66D 4J8WC 1P3AD 1H3OB 3X1UD 4ZBJB 1WWSA 5B2IB 3A6NA 5B2IC 1TZYC 3V9RA 4CSRB 5AVBC 2XD5A 3AZJB 5B40B 4KUDD 3W97A 3AZJC 3AZMA 1P3KB 3X1VA 2NZDD 1P3KC 3KWQB 3REIB 1F66A 5GXQB 2F8NA 3KWQC 3REIC 2Y2KA 3B6FA 5GXQC 2UWXA 1S32D 1P34C 5KDMB 3UT9D 2G5IC 4H9NB 3WTPD 4EO5C 1ID3B 3W98D 4H9SA 3AZLB 1ID3C 1P3IA 4H9PA 3EPLA 2W8SA 5B33B 3NQUB 1KX5A 2CV5A 1F1EA 2PYOD 5B33C 3AV2D 1BFMA 1W2EA 3TU4A 4YS3B 5C3IB 3LJAD 4YS3C 5B0YC 2Y2GA 5DNMD 5CP6B 4DQYB 3AYWD 2ZY3A 4YM6A 3VH5T 5CP6C 3MVDB 2FJ7D 5BT1D 3H0RC 2AROD 2CWEA 3MVDC 3MGQC 4J8UD 5B31A 5AY8B 3RELA 5AY8C 3X1TD 4WU8D 5AV9D 1P3LD 3MGRD 3AZHB 5B24A 3AZHC 3WA9D 5B32D 4X23D 2Y2LA 1B6WA 1M18A 3AL0C 1Q9CA 5CHLB 5CPKB 4KUDB 3AZED 4G91B 3LZ1B 5FUGB 5CPKC 3UTAB 4G91C 5BNXA 3LZ1C 1KX4A 2NZDB 5GT3A 4JJND 3UTAC 3AZNB 3C1BA 4J8WA 4G92B 2BYKB 3KUYB 3AZNC 1KX3B 4H9RA 1EQZD 4G92C 3IP4C 1H3OA 3KUYC 1KX3C 5AV5C 1U35D 2NQBD 1TZYA 5B2IA 5AVBA 4CSRA 4Z5TB 3WTPB 3B0BA 3AZJA 4Z5TC 3AN2D 5BS7C 1P3KA 4WNNB 3LZ0B 3KWQA 3REIA 5AVCC 5GXQA 3LZ0C 1P34A 2PYOB 3REKD 5KDMA 5CPJD 1AOID 5B2JB 3REJD 2ZY5A 5B2JC 1ID3A 3B6GD 4UUZA 3AZFC 1P3FB 1P3OB 1P3FC 2RVQC 1P3OC 5CPIB 4QLCD 5F99D 3NQUA 5B33A 5CPIC 4J8VD 4NE3A 1M19D 3X1TB 1P3BB 4WU8B 5AV9B 1P3GB 4YS3A 1P3BC 4LD9C 3C1CC 1P3GC 5CP6A 3MGPD 3W96B 3AZGD 3MGQA 3R45B 3MVDA 3W96C 1M1AD 5B1LB 3X1SD 1ZLAD 5B1LC 5GT0B 5AY8A 4NE5A 5GT0C 3MNNB 3MNNC 1P3PB 3W99B 5B0YD 3W99C 1P3PC 3AZHA 4J8XD 1HQ3B 3WAAD 3AZKD 1KU5A 1HQ3C 5AV6B 5AV8D 4ZBJC 5B0ZD 5AV6C 3LELB 2YFWB 3AFAB 3LELC 3AFAC 5B40C 5CPKA 3LZ1A 3WKJB 3AV1B 5DNND 3UTAA 3WKJC 4KGCD 3AV1C 2ZY2A 3B0CW 4KHAA 2Y2HA 3AZNA 2HIOB 2BYKA 3KUYA 5E5AB 1KX3A 2HIOC 2Y2QA 5G49A 4M6BA 5AV5A 5E5AC 2XD1A 3A6ND 3REKB 5GSUB 4ZUXB 3VH6A 4Z5TA 5GSUC 3KXBB 4ZUXC 3W97D 5BS7A 3AZMD 3KXBC 2VQRA 3AZLC 3X1VD 5B1MB 3UTBB 1BH9A 4WNNA 3AZIB 1F66D 5AVCA 3LZ0A 5B1MC 3UTBC 3AZIC 2F8ND 3B6FD 3EPHA 4XZQB 1ULYA 4WU9B 2LY8A 4XZQC 4WU9C 1M19B 4H9QB 5C3IC 2JSSA 5B2JA 1WWIA 3O62B 3MGSB 3AZFA 4R8PB 3KFUG 2RIQA 3O62C 3MGSC 1P3ID 4HGAB 4R8PC 3REHB 1P3FA 4HGAC 3REHC 1P3OA 1ZLAB 5JRGB 1KX5D 5CPIA 2CV5D 5JRGC 3TU4D 1P3BA 4LD9A 4XUJB 4CAYB 3C1CA 1P3GA 1P3MB 1P3AB 4XUJC 4Z66B 3X1UB 1P3MC 4YM6D 1P3AC 4J8XB 4Z66C 1JFIA 4WJ3C 3X1UC 3W96A 3R45A 2F2AC 5B1LA 5B31D 3RELD 5GT0A 4KUDC 3EG5B 3MNNA 2JE5A 2NZDC 4NFTA 1R4VA 1P3PA 3W99A 1S32B 5B24D 1HQ3A 5AV6A 3EPJA 3UT9B 1A7WA 3LELA 3UT9C 2YFWA 1M18D 3V9RB 5B40A 3AFAA 3VH5A 3WTPC 3W98B 3W98C 1KX4D 3WKJA 2G5HC 3AV1A 5GT3D 3C1BD 4J8WD 2HIOA 5E5AA 3AV2B 2PYOC 3AV2C 2Y2JA 1TZYD 5B2ID 4H9NA 3EPKA 5AVBD 3LJAB 5DNMB 5GSUA 3AYWB 2BYMB 4ZUXA 3LJAC 3AZJD 5DNMC 3AYWC 3KXBA 3AZLA 2FJ7B 2AROB 1P3KD 2FJ7C 5BT1C 2AROC 5B1MA 3KWQD 4J8UB 3REID 3UTBA 3AZIA 5GXQD 2Y2NA 5B32G 4J8UC 4XZQA 1P34D 2HUEB 1PZRA 4WU9A 1T3UA 5B31G 3X1TC 1P3LB 4WU8C 5AV9C 3MGRB 1P3LC 2JCHA 3MGRC 3WA9B 1ID3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YM6 B;  3WA9 C;  3O62 A;  3MGS A;  5B32 B;  4R8P A;  4X23 B;  5B32 C;  3REH A;  4X23 C;  5B33 D;  5JRG A;  3AZE B;  3AZE C;  3WTP E;  4JJN B;  4YS3 D;  4XUJ A;  4CAY A;  4JJN C;  1P3M A;  5CP6 D;  1P3A A;  4Z66 A;  1EQZ B;  3X1U A;  3MGQ D;  1EQZ C;  3MVD D;  3VH6 W;  1U35 B;  2NQB B;  1U35 C;  2NQB C;  4KUD A;  1BH8 B;  5FUG A;  5AY8 D;  3AN2 B;  3B0D B;  3AN2 C;  3B0C T;  2NZD A;  1KX4 B;  3B0D C;  3C1B B;  3AZH D;  1S32 A;  5CPJ B;  1AOI B;  3UT9 A;  1TZY B;  5JA4 B;  3REK C;  5CPJ C;  1AOI C;  5AVB B;  3WTP A;  3REJ B;  3REJ C;  5CPK D;  3B6G B;  3W98 A;  3LZ1 D;  4H9O B;  1B67 A;  5BNV B;  3B6G C;  3UTA D;  5BO0 B;  3AZN D;  4QLC B;  3KUY D;  5F99 B;  2F8N H;  1KX3 D;  2L5A A;  4J8V B;  3KSY A;  4QLC C;  5AV5 D;  5F99 C;  1P34 B;  3AV2 A;  2PYO A;  3NQJ B;  4J8V C;  1N1J B;  1M19 C;  3LJA A;  4EO5 B;  5DNM A;  4AWL B;  4Z5T D;  3AYW A;  2BYM A;  3MGP B;  3AZG B;  4AWL C;  3MGP C;  1TAF B;  2FJ7 A;  3AZG C;  1M1A B;  2ARO A;  4UUZ B;  4Z2M H;  3X1S B;  5AVC D;  1M1A C;  3LZ0 D;  4J8U A;  3X1S C;  1ZLA C;  2YFV B;  1HTA A;  2F8N K;  2IO5 B;  3X1T A;  4WU8 A;  5AV9 A;  2IO5 C;  1P3L A;  4E45 A;  5B0Y B;  3MGR A;  5B2J D;  4WV4 B;  3WAA B;  3AZK B;  3WA9 A;  4J8X C;  3WAA C;  5AV8 B;  3AZK C;  3AZF D;  5B0Z B;  3MGQ B;  3VH5 W;  5B32 A;  5AV8 C;  5B0Z C;  4X23 A;  1P3F D;  2RVQ D;  1P3O D;  5CPI D;  3AZE A;  5DNN B;  1P3B D;  4KGC B;  4LD9 D;  3C1C D;  5DNN C;  4JJN A;  1P3G D;  4KGC C;  1S32 C;  1EQZ A;  2F8N G;  3W96 D;  1U35 A;  2NQB A;  3A6N B;  5B1L D;  3A6N C;  3W97 B;  5GT0 D;  3AZM B;  3X1V B;  1BH8 A;  3AN2 A;  3W97 C;  3MNN D;  3AZM C;  3X1V C;  1F66 B;  4Z2M G;  2F8N B;  3W99 D;  1P3P D;  1F66 C;  3B6F B;  4KHA B;  3B6F C;  1HQ3 D;  5G49 B;  5AV6 D;  5AV5 B;  3REK A;  3LEL D;  5CPJ A;  1AOI A;  5JA4 A;  5B40 D;  3AFA D;  3REJ A;  3B6G A;  4H9S C;  1P3I B;  4H9O A;  3WKJ D;  5BNV A;  3AV1 D;  4H9P B;  1P3I C;  1BH9 B;  5AVC B;  1KX5 B;  5BO0 A;  2HIO D;  2CV5 B;  4DRA A;  4QLC A;  5F99 A;  5E5A D;  1KX5 C;  2HUE C;  4J8V A;  2CV5 C;  3TU4 B;  1M19 A;  4H9Q A;  3NQJ A;  3TU4 C;  1N1J A;  5GSU D;  4ZUX D;  3KXB D;  3MGP A;  3AZL D;  4YM6 C;  3AZG A;  3AZF B;  1TAF A;  1M1A A;  5B1M D;  3UTB D;  3X1S A;  3AZI D;  1ZLA A;  4NE6 A;  5B31 B;  2YFV A;  5B31 C;  3REL B;  4XZQ D;  4E44 A;  3REL C;  4WU9 D;  4LD9 B;  3C1C B;  5B0Y A;  5B24 B;  3VH6 T;  4J8X A;  3WAA A;  3AZK A;  5B24 C;  3O62 D;  3MGS D;  1JFI B;  5AV8 A;  4R8P D;  5B0Z A;  3REH D;  1M18 B;  1M18 C;  5JRG D;  4DRB A;  5BNX B;  4WZS B;  5GT3 B;  5DNN A;  1KX4 C;  4KGC A;  4XUJ D;  4J8W B;  5GT3 C;  1P3M D;  4H9R B;  3C1B C;  4Z66 D;  4J8W C;  1P3A D;  1H3O B;  3X1U D;  4ZBJ B;  1WWS A;  5B2I B;  3A6N A;  1TZY C;  3V9R A;  4CSR B;  5B2I C;  5AVB C;  3AZJ B;  5B40 B;  4KUD D;  3W97 A;  3AZJ C;  3AZM A;  1P3K B;  3X1V A;  2NZD D;  1P3K C;  3KWQ B;  3REI B;  1F66 A;  5GXQ B;  2F8N A;  3KWQ C;  3REI C;  3B6F A;  5GXQ C;  1S32 D;  1P34 C;  5KDM B;  3UT9 D;  4H9N B;  3WTP D;  4EO5 C;  1ID3 B;  3W98 D;  4H9S A;  3AZL B;  1ID3 C;  1P3I A;  4H9P A;  5B33 B;  3NQU B;  1KX5 A;  2CV5 A;  1F1E A;  2PYO D;  5B33 C;  3AV2 D;  1BFM A;  3TU4 A;  4YS3 B;  5C3I B;  3LJA D;  4YS3 C;  5B0Y C;  5DNM D;  5CP6 B;  3AYW D;  4YM6 A;  3VH5 T;  5CP6 C;  3MVD B;  2FJ7 D;  5BT1 D;  3MGQ C;  2ARO D;  2CWE A;  3MVD C;  4J8U D;  5B31 A;  5AY8 B;  3REL A;  5AY8 C;  3X1T D;  4WU8 D;  5AV9 D;  1P3L D;  3MGR D;  3AZH B;  5B24 A;  3AZH C;  3WA9 D;  5B32 D;  4X23 D;  1B6W A;  1M18 A;  1Q9C A;  5CHL B;  5CPK B;  4KUD B;  3AZE D;  4G91 B;  3LZ1 B;  5FUG B;  5CPK C;  3UTA B;  4G91 C;  5BNX A;  3LZ1 C;  1KX4 A;  2NZD B;  5GT3 A;  4JJN D;  3UTA C;  3AZN B;  3C1B A;  4J8W A;  4G92 B;  2BYK B;  3KUY B;  3AZN C;  1KX3 B;  4H9R A;  1EQZ D;  4G92 C;  1H3O A;  3KUY C;  1KX3 C;  5AV5 C;  1U35 D;  2NQB D;  1TZY A;  5B2I A;  5AVB A;  4CSR A;  4Z5T B;  3WTP B;  3B0B A;  3AZJ A;  4Z5T C;  3AN2 D;  5BS7 C;  1P3K A;  4WNN B;  3LZ0 B;  3KWQ A;  3REI A;  5AVC C;  5GXQ A;  3LZ0 C;  1P34 A;  2PYO B;  3REK D;  5KDM A;  5CPJ D;  1AOI D;  5B2J B;  3REJ D;  5B2J C;  1ID3 A;  3B6G D;  4UUZ A;  3AZF C;  1P3F B;  1P3O B;  1P3F C;  2RVQ C;  1P3O C;  5CPI B;  4QLC D;  5F99 D;  3NQU A;  5B33 A;  5CPI C;  4J8V D;  4NE3 A;  1M19 D;  3X1T B;  1P3B B;  4WU8 B;  5AV9 B;  1P3G B;  4YS3 A;  1P3B C;  4LD9 C;  3C1C C;  1P3G C;  5CP6 A;  3MGP D;  3W96 B;  3AZG D;  3MGQ A;  3R45 B;  3MVD A;  3W96 C;  1M1A D;  5B1L B;  3X1S D;  1ZLA D;  5B1L C;  5GT0 B;  5AY8 A;  4NE5 A;  5GT0 C;  3MNN B;  3MNN C;  1P3P B;  3W99 B;  5B0Y D;  3W99 C;  1P3P C;  3AZH A;  4J8X D;  1HQ3 B;  3WAA D;  3AZK D;  1KU5 A;  1HQ3 C;  5AV6 B;  5AV8 D;  4ZBJ C;  5B0Z D;  5AV6 C;  3LEL B;  2YFW B;  3AFA B;  3LEL C;  3AFA C;  5B40 C;  5CPK A;  3LZ1 A;  3WKJ B;  3AV1 B;  5DNN D;  3UTA A;  3WKJ C;  4KGC D;  3AV1 C;  3B0C W;  4KHA A;  3AZN A;  2HIO B;  2BYK A;  3KUY A;  5E5A B;  1KX3 A;  2HIO C;  5G49 A;  4M6B A;  5AV5 A;  5E5A C;  3A6N D;  3REK B;  5GSU B;  4ZUX B;  3VH6 A;  4Z5T A;  5GSU C;  3KXB B;  4ZUX C;  3W97 D;  5BS7 A;  3AZM D;  3KXB C;  3AZL C;  3X1V D;  5B1M B;  3UTB B;  1BH9 A;  4WNN A;  3AZI B;  1F66 D;  5AVC A;  3LZ0 A;  5B1M C;  3UTB C;  3AZI C;  2F8N D;  3B6F D;  4XZQ B;  1ULY A;  4WU9 B;  2LY8 A;  4XZQ C;  4WU9 C;  1M19 B;  4H9Q B;  5C3I C;  2JSS A;  5B2J A;  1WWI A;  3O62 B;  3MGS B;  3AZF A;  4R8P B;  3O62 C;  3MGS C;  1P3I D;  4HGA B;  4R8P C;  3REH B;  1P3F A;  4HGA C;  3REH C;  1P3O A;  1ZLA B;  5JRG B;  1KX5 D;  5CPI A;  2CV5 D;  5JRG C;  3TU4 D;  1P3B A;  4LD9 A;  4XUJ B;  4CAY B;  3C1C A;  1P3G A;  1P3M B;  1P3A B;  4XUJ C;  4Z66 B;  3X1U B;  1P3M C;  4YM6 D;  1P3A C;  4J8X B;  4Z66 C;  1JFI A;  3X1U C;  3W96 A;  3R45 A;  5B1L A;  5B31 D;  3REL D;  5GT0 A;  4KUD C;  3MNN A;  2NZD C;  4NFT A;  1R4V A;  1P3P A;  3W99 A;  1S32 B;  5B24 D;  1HQ3 A;  5AV6 A;  3UT9 B;  1A7W A;  3LEL A;  3UT9 C;  2YFW A;  1M18 D;  3V9R B;  5B40 A;  3AFA A;  3VH5 A;  3WTP C;  3W98 B;  3W98 C;  1KX4 D;  3WKJ A;  3AV1 A;  5GT3 D;  3C1B D;  4J8W D;  2HIO A;  5E5A A;  3AV2 B;  2PYO C;  3AV2 C;  1TZY D;  5B2I D;  4H9N A;  5AVB D;  3LJA B;  5DNM B;  5GSU A;  3AYW B;  2BYM B;  4ZUX A;  3LJA C;  3AZJ D;  5DNM C;  3AYW C;  3KXB A;  3AZL A;  2FJ7 B;  2ARO B;  1P3K D;  2FJ7 C;  5BT1 C;  2ARO C;  5B1M A;  3KWQ D;  4J8U B;  3REI D;  3UTB A;  3AZI A;  5GXQ D;  5B32 G;  4J8U C;  4XZQ A;  1P34 D;  2HUE B;  4WU9 A;  5B31 G;  3X1T C;  1P3L B;  4WU8 C;  5AV9 C;  3MGR B;  1P3L C;  3MGR C;  3WA9 B;  1ID3 D; 
#chains in the Genus database with same CATH topology
 4YM6 B;  3WA9 C;  3O62 A;  3MGS A;  5B32 B;  4R8P A;  2Y2O A;  4X23 B;  5B32 C;  3REH A;  4X23 C;  5B33 D;  5JRG A;  3AZE B;  3A1K A;  3AZE C;  3WTP E;  4JJN B;  4YS3 D;  4XUJ A;  4CAY A;  4JJN C;  1P3M A;  5CP6 D;  1P3A A;  4Z66 A;  1EQZ B;  2ZM5 A;  3X1U A;  3MGQ D;  1EQZ C;  3MVD D;  3VH6 W;  1U35 B;  2NQB B;  3H0M C;  1U35 C;  2NQB C;  4KUD A;  1BH8 B;  5FUG A;  3A1I A;  5AY8 D;  3AN2 B;  3B0D B;  3AN2 C;  3B0C T;  2NZD A;  1KX4 B;  3B0D C;  3C1B B;  3AZH D;  1S32 A;  5CPJ B;  1AOI B;  3UT9 A;  1TZY B;  5JA4 B;  3REK C;  5CPJ C;  1AOI C;  5AVB B;  3WTP A;  3REJ B;  2Y2M A;  3REJ C;  5CPK D;  3B6G B;  3W98 A;  3LZ1 D;  4H9O B;  1B67 A;  5BNV B;  3B6G C;  3UTA D;  5BO0 B;  3AZN D;  2BG1 A;  4QLC B;  3KUY D;  5F99 B;  2F8N H;  1KX3 D;  2L5A A;  4J8V B;  3KSY A;  4QLC C;  5AV5 D;  5F99 C;  1P34 B;  3AV2 A;  2PYO A;  3NQJ B;  4J8V C;  1N1J B;  1M19 C;  3LJA A;  4EO5 B;  5DNM A;  4AWL B;  4Z5T D;  3AYW A;  2BYM A;  3MGP B;  3AZG B;  4AWL C;  3MGP C;  1TAF B;  2FJ7 A;  3AZG C;  1Z2C B;  1M1A B;  2ARO A;  4UUZ B;  4Z2M H;  3X1S B;  5AVC D;  1M1A C;  3LZ0 D;  4J8U A;  3X1S C;  1ZLA C;  2YFV B;  1HTA A;  2F8N K;  2Y2P A;  2IO5 B;  3X1T A;  4WU8 A;  5AV9 A;  2ZY4 A;  2IO5 C;  1P3L A;  4E45 A;  5B0Y B;  3MGR A;  5B2J D;  4WV4 B;  3WAA B;  3AZK B;  3WA9 A;  4J8X C;  3WAA C;  5AV8 B;  3AZK C;  3AZF D;  5B0Z B;  3MGQ B;  2Y2I A;  3VH5 W;  5B32 A;  5AV8 C;  5B0Z C;  4X23 A;  1P3F D;  2RVQ D;  1P3O D;  5CPI D;  3AZE A;  5DNN B;  3F6T A;  1P3B D;  4KGC B;  4LD9 D;  3C1C D;  5DNN C;  4JJN A;  1P3G D;  4KGC C;  1S32 C;  1EQZ A;  2F8N G;  3W96 D;  1U35 A;  2NQB A;  3A6N B;  5B1L D;  3A6N C;  3W97 B;  5GT0 D;  3AZM B;  2J8P A;  3X1V B;  1BH8 A;  3AN2 A;  3W97 C;  3MNN D;  3AZM C;  3X1V C;  1F66 B;  4UPK A;  4Z2M G;  2F8N B;  3W99 D;  1P3P D;  1F66 C;  3B6F B;  4KHA B;  2DQN C;  3B6F C;  1HQ3 D;  5G49 B;  5AV6 D;  5AV5 B;  3REK A;  3FDD A;  3LEL D;  2DF4 C;  5CPJ A;  1AOI A;  5JA4 A;  5B40 D;  3AFA D;  3REJ A;  3B6G A;  4H9S C;  1P3I B;  4H9O A;  3WKJ D;  5BNV A;  3AV1 D;  4H9P B;  1P3I C;  1BH9 B;  5AVC B;  1KX5 B;  5BO0 A;  2HIO D;  2CV5 B;  4DRA A;  4QLC A;  5F99 A;  3P5J B;  5E5A D;  1KX5 C;  2HUE C;  4J8V A;  2CV5 C;  3TU4 B;  1M19 A;  4H9Q A;  3NQJ A;  3TU4 C;  1N1J A;  5GSU D;  4ZUX D;  3KXB D;  3MGP A;  3AZL D;  4YM6 C;  3AZG A;  3AZF B;  1TAF A;  1M1A A;  5B1M D;  3UTB D;  3X1S A;  3AZI D;  1ZLA A;  4NE6 A;  5B31 B;  2YFV A;  5B31 C;  3H0L C;  3REL B;  4XZQ D;  4E44 A;  3REL C;  4WU9 D;  4LD9 B;  3C1C B;  2FFF B;  5B0Y A;  5B24 B;  3VH6 T;  4J8X A;  3WAA A;  3AZK A;  5B24 C;  3O62 D;  3MGS D;  1JFI B;  5AV8 A;  4R8P D;  5B0Z A;  3REH D;  1M18 B;  1M18 C;  5JRG D;  4DRB A;  5BNX B;  4WZS B;  5GT3 B;  5DNN A;  1KX4 C;  4KGC A;  4XUJ D;  4J8W B;  5GT3 C;  1P3M D;  4H9R B;  3C1B C;  4Z66 D;  4J8W C;  1P3A D;  1H3O B;  3X1U D;  4ZBJ B;  1WWS A;  5B2I B;  3A6N A;  5B2I C;  1TZY C;  3V9R A;  4CSR B;  5AVB C;  2XD5 A;  3AZJ B;  5B40 B;  4KUD D;  3W97 A;  3AZJ C;  3AZM A;  1P3K B;  3X1V A;  2NZD D;  1P3K C;  3KWQ B;  3REI B;  1F66 A;  5GXQ B;  2F8N A;  3KWQ C;  3REI C;  2Y2K A;  3B6F A;  5GXQ C;  2UWX A;  1S32 D;  1P34 C;  5KDM B;  3UT9 D;  2G5I C;  4H9N B;  3WTP D;  4EO5 C;  1ID3 B;  3W98 D;  4H9S A;  3AZL B;  1ID3 C;  1P3I A;  4H9P A;  3EPL A;  2W8S A;  5B33 B;  3NQU B;  1KX5 A;  2CV5 A;  1F1E A;  2PYO D;  5B33 C;  3AV2 D;  1BFM A;  1W2E A;  3TU4 A;  4YS3 B;  5C3I B;  3LJA D;  4YS3 C;  5B0Y C;  2Y2G A;  5DNM D;  5CP6 B;  4DQY B;  3AYW D;  2ZY3 A;  4YM6 A;  3VH5 T;  5CP6 C;  3MVD B;  2FJ7 D;  5BT1 D;  3H0R C;  2ARO D;  2CWE A;  3MVD C;  3MGQ C;  4J8U D;  5B31 A;  5AY8 B;  3REL A;  5AY8 C;  3X1T D;  4WU8 D;  5AV9 D;  1P3L D;  3MGR D;  3AZH B;  5B24 A;  3AZH C;  3WA9 D;  5B32 D;  4X23 D;  2Y2L A;  1B6W A;  1M18 A;  3AL0 C;  1Q9C A;  5CHL B;  5CPK B;  4KUD B;  3AZE D;  4G91 B;  3LZ1 B;  5FUG B;  5CPK C;  3UTA B;  4G91 C;  5BNX A;  3LZ1 C;  1KX4 A;  2NZD B;  5GT3 A;  4JJN D;  3UTA C;  3AZN B;  3C1B A;  4J8W A;  4G92 B;  2BYK B;  3KUY B;  3AZN C;  1KX3 B;  4H9R A;  1EQZ D;  4G92 C;  3IP4 C;  1H3O A;  3KUY C;  1KX3 C;  5AV5 C;  1U35 D;  2NQB D;  1TZY A;  5B2I A;  5AVB A;  4CSR A;  4Z5T B;  3WTP B;  3B0B A;  3AZJ A;  4Z5T C;  3AN2 D;  5BS7 C;  1P3K A;  4WNN B;  3LZ0 B;  3KWQ A;  3REI A;  5AVC C;  5GXQ A;  3LZ0 C;  1P34 A;  2PYO B;  3REK D;  5KDM A;  5CPJ D;  1AOI D;  5B2J B;  3REJ D;  2ZY5 A;  5B2J C;  1ID3 A;  3B6G D;  4UUZ A;  3AZF C;  1P3F B;  1P3O B;  1P3F C;  2RVQ C;  1P3O C;  5CPI B;  4QLC D;  5F99 D;  3NQU A;  5B33 A;  5CPI C;  4J8V D;  4NE3 A;  1M19 D;  3X1T B;  1P3B B;  4WU8 B;  5AV9 B;  1P3G B;  4YS3 A;  1P3B C;  4LD9 C;  3C1C C;  1P3G C;  5CP6 A;  3MGP D;  3W96 B;  3AZG D;  3MGQ A;  3R45 B;  3MVD A;  3W96 C;  1M1A D;  5B1L B;  3X1S D;  1ZLA D;  5B1L C;  5GT0 B;  5AY8 A;  4NE5 A;  5GT0 C;  3MNN B;  3MNN C;  1P3P B;  3W99 B;  5B0Y D;  3W99 C;  1P3P C;  3AZH A;  4J8X D;  1HQ3 B;  3WAA D;  3AZK D;  1KU5 A;  1HQ3 C;  5AV6 B;  5AV8 D;  4ZBJ C;  5B0Z D;  5AV6 C;  3LEL B;  2YFW B;  3AFA B;  3LEL C;  3AFA C;  5B40 C;  5CPK A;  3LZ1 A;  3WKJ B;  3AV1 B;  5DNN D;  3UTA A;  3WKJ C;  4KGC D;  3AV1 C;  2ZY2 A;  3B0C W;  4KHA A;  2Y2H A;  3AZN A;  2HIO B;  2BYK A;  3KUY A;  5E5A B;  1KX3 A;  2HIO C;  2Y2Q A;  5G49 A;  4M6B A;  5AV5 A;  5E5A C;  2XD1 A;  3A6N D;  3REK B;  5GSU B;  4ZUX B;  3VH6 A;  4Z5T A;  5GSU C;  3KXB B;  4ZUX C;  3W97 D;  5BS7 A;  3AZM D;  3KXB C;  2VQR A;  3AZL C;  3X1V D;  5B1M B;  3UTB B;  1BH9 A;  4WNN A;  3AZI B;  1F66 D;  5AVC A;  3LZ0 A;  5B1M C;  3UTB C;  3AZI C;  2F8N D;  3B6F D;  3EPH A;  4XZQ B;  1ULY A;  4WU9 B;  2LY8 A;  4XZQ C;  4WU9 C;  1M19 B;  4H9Q B;  5C3I C;  2JSS A;  5B2J A;  1WWI A;  3O62 B;  3MGS B;  3AZF A;  4R8P B;  3KFU G;  2RIQ A;  3O62 C;  3MGS C;  1P3I D;  4HGA B;  4R8P C;  3REH B;  1P3F A;  4HGA C;  3REH C;  1P3O A;  1ZLA B;  5JRG B;  1KX5 D;  5CPI A;  2CV5 D;  5JRG C;  3TU4 D;  1P3B A;  4LD9 A;  4XUJ B;  4CAY B;  3C1C A;  1P3G A;  1P3M B;  1P3A B;  4XUJ C;  4Z66 B;  3X1U B;  1P3M C;  4YM6 D;  1P3A C;  4J8X B;  4Z66 C;  1JFI A;  4WJ3 C;  3X1U C;  3W96 A;  3R45 A;  2F2A C;  5B1L A;  5B31 D;  3REL D;  5GT0 A;  4KUD C;  3EG5 B;  3MNN A;  2JE5 A;  2NZD C;  4NFT A;  1R4V A;  1P3P A;  3W99 A;  1S32 B;  5B24 D;  1HQ3 A;  5AV6 A;  3EPJ A;  3UT9 B;  1A7W A;  3LEL A;  3UT9 C;  2YFW A;  1M18 D;  3V9R B;  5B40 A;  3AFA A;  3VH5 A;  3WTP C;  3W98 B;  3W98 C;  1KX4 D;  3WKJ A;  2G5H C;  3AV1 A;  5GT3 D;  3C1B D;  4J8W D;  2HIO A;  5E5A A;  3AV2 B;  2PYO C;  3AV2 C;  2Y2J A;  1TZY D;  5B2I D;  4H9N A;  3EPK A;  5AVB D;  3LJA B;  5DNM B;  5GSU A;  3AYW B;  2BYM B;  4ZUX A;  3LJA C;  3AZJ D;  5DNM C;  3AYW C;  3KXB A;  3AZL A;  2FJ7 B;  2ARO B;  1P3K D;  2FJ7 C;  5BT1 C;  2ARO C;  5B1M A;  3KWQ D;  4J8U B;  3REI D;  3UTB A;  3AZI A;  5GXQ D;  2Y2N A;  5B32 G;  4J8U C;  4XZQ A;  1P34 D;  2HUE B;  1PZR A;  4WU9 A;  1T3U A;  5B31 G;  3X1T C;  1P3L B;  4WU8 C;  5AV9 C;  3MGR B;  1P3L C;  2JCH A;  3MGR C;  3WA9 B;  1ID3 D; 
#chains in the Genus database with same CATH homology
 4YM6 B;  3WA9 C;  3O62 A;  3MGS A;  5B32 B;  4R8P A;  2Y2O A;  4X23 B;  5B32 C;  3REH A;  4X23 C;  5B33 D;  5JRG A;  3AZE B;  3A1K A;  3AZE C;  3WTP E;  4JJN B;  4YS3 D;  4XUJ A;  4CAY A;  4JJN C;  1P3M A;  5CP6 D;  1P3A A;  4Z66 A;  1EQZ B;  2ZM5 A;  3X1U A;  3MGQ D;  1EQZ C;  3MVD D;  3VH6 W;  1U35 B;  2NQB B;  3H0M C;  1U35 C;  2NQB C;  4KUD A;  1BH8 B;  5FUG A;  3A1I A;  5AY8 D;  3AN2 B;  3B0D B;  3AN2 C;  3B0C T;  2NZD A;  1KX4 B;  3B0D C;  3C1B B;  3AZH D;  1S32 A;  5CPJ B;  1AOI B;  3UT9 A;  1TZY B;  5JA4 B;  3REK C;  5CPJ C;  1AOI C;  5AVB B;  3WTP A;  3REJ B;  2Y2M A;  3REJ C;  5CPK D;  3B6G B;  3W98 A;  3LZ1 D;  4H9O B;  1B67 A;  5BNV B;  3B6G C;  3UTA D;  5BO0 B;  3AZN D;  2BG1 A;  4QLC B;  3KUY D;  5F99 B;  2F8N H;  1KX3 D;  2L5A A;  4J8V B;  3KSY A;  4QLC C;  5AV5 D;  5F99 C;  1P34 B;  3AV2 A;  2PYO A;  3NQJ B;  4J8V C;  1N1J B;  1M19 C;  3LJA A;  4EO5 B;  5DNM A;  4AWL B;  4Z5T D;  3AYW A;  2BYM A;  3MGP B;  3AZG B;  4AWL C;  3MGP C;  1TAF B;  2FJ7 A;  3AZG C;  1Z2C B;  1M1A B;  2ARO A;  4UUZ B;  4Z2M H;  3X1S B;  5AVC D;  1M1A C;  3LZ0 D;  4J8U A;  3X1S C;  1ZLA C;  2YFV B;  1HTA A;  2F8N K;  2Y2P A;  2IO5 B;  3X1T A;  4WU8 A;  5AV9 A;  2ZY4 A;  2IO5 C;  1P3L A;  4E45 A;  5B0Y B;  3MGR A;  5B2J D;  4WV4 B;  3WAA B;  3AZK B;  3WA9 A;  4J8X C;  3WAA C;  5AV8 B;  3AZK C;  3AZF D;  5B0Z B;  3MGQ B;  2Y2I A;  3VH5 W;  5B32 A;  5AV8 C;  5B0Z C;  4X23 A;  1P3F D;  2RVQ D;  1P3O D;  5CPI D;  3AZE A;  5DNN B;  3F6T A;  1P3B D;  4KGC B;  4LD9 D;  3C1C D;  5DNN C;  4JJN A;  1P3G D;  4KGC C;  1S32 C;  1EQZ A;  2F8N G;  3W96 D;  1U35 A;  2NQB A;  3A6N B;  5B1L D;  3A6N C;  3W97 B;  5GT0 D;  3AZM B;  2J8P A;  3X1V B;  1BH8 A;  3AN2 A;  3W97 C;  3MNN D;  3AZM C;  3X1V C;  1F66 B;  4UPK A;  4Z2M G;  2F8N B;  3W99 D;  1P3P D;  1F66 C;  3B6F B;  4KHA B;  2DQN C;  3B6F C;  1HQ3 D;  5G49 B;  5AV6 D;  5AV5 B;  3REK A;  3FDD A;  3LEL D;  2DF4 C;  5CPJ A;  1AOI A;  5JA4 A;  5B40 D;  3AFA D;  3REJ A;  3B6G A;  4H9S C;  1P3I B;  4H9O A;  3WKJ D;  5BNV A;  3AV1 D;  4H9P B;  1P3I C;  1BH9 B;  5AVC B;  1KX5 B;  5BO0 A;  2HIO D;  2CV5 B;  4DRA A;  4QLC A;  5F99 A;  3P5J B;  5E5A D;  1KX5 C;  2HUE C;  4J8V A;  2CV5 C;  3TU4 B;  1M19 A;  4H9Q A;  3NQJ A;  3TU4 C;  1N1J A;  5GSU D;  4ZUX D;  3KXB D;  3MGP A;  3AZL D;  4YM6 C;  3AZG A;  3AZF B;  1TAF A;  1M1A A;  5B1M D;  3UTB D;  3X1S A;  3AZI D;  1ZLA A;  4NE6 A;  5B31 B;  2YFV A;  5B31 C;  3H0L C;  3REL B;  4XZQ D;  4E44 A;  3REL C;  4WU9 D;  4LD9 B;  3C1C B;  2FFF B;  5B0Y A;  5B24 B;  3VH6 T;  4J8X A;  3WAA A;  3AZK A;  5B24 C;  3O62 D;  3MGS D;  1JFI B;  5AV8 A;  4R8P D;  5B0Z A;  3REH D;  1M18 B;  1M18 C;  5JRG D;  4DRB A;  5BNX B;  4WZS B;  5GT3 B;  5DNN A;  1KX4 C;  4KGC A;  4XUJ D;  4J8W B;  5GT3 C;  1P3M D;  4H9R B;  3C1B C;  4Z66 D;  4J8W C;  1P3A D;  1H3O B;  3X1U D;  4ZBJ B;  1WWS A;  5B2I B;  3A6N A;  5B2I C;  1TZY C;  3V9R A;  4CSR B;  5AVB C;  2XD5 A;  3AZJ B;  5B40 B;  4KUD D;  3W97 A;  3AZJ C;  3AZM A;  1P3K B;  3X1V A;  2NZD D;  1P3K C;  3KWQ B;  3REI B;  1F66 A;  5GXQ B;  2F8N A;  3KWQ C;  3REI C;  2Y2K A;  3B6F A;  5GXQ C;  2UWX A;  1S32 D;  1P34 C;  5KDM B;  3UT9 D;  2G5I C;  4H9N B;  3WTP D;  4EO5 C;  1ID3 B;  3W98 D;  4H9S A;  3AZL B;  1ID3 C;  1P3I A;  4H9P A;  3EPL A;  2W8S A;  5B33 B;  3NQU B;  1KX5 A;  2CV5 A;  1F1E A;  2PYO D;  5B33 C;  3AV2 D;  1BFM A;  1W2E A;  3TU4 A;  4YS3 B;  5C3I B;  3LJA D;  4YS3 C;  5B0Y C;  2Y2G A;  5DNM D;  5CP6 B;  4DQY B;  3AYW D;  2ZY3 A;  4YM6 A;  3VH5 T;  5CP6 C;  3MVD B;  2FJ7 D;  5BT1 D;  3H0R C;  2ARO D;  2CWE A;  3MVD C;  3MGQ C;  4J8U D;  5B31 A;  5AY8 B;  3REL A;  5AY8 C;  3X1T D;  4WU8 D;  5AV9 D;  1P3L D;  3MGR D;  3AZH B;  5B24 A;  3AZH C;  3WA9 D;  5B32 D;  4X23 D;  2Y2L A;  1B6W A;  1M18 A;  3AL0 C;  1Q9C A;  5CHL B;  5CPK B;  4KUD B;  3AZE D;  4G91 B;  3LZ1 B;  5FUG B;  5CPK C;  3UTA B;  4G91 C;  5BNX A;  3LZ1 C;  1KX4 A;  2NZD B;  5GT3 A;  4JJN D;  3UTA C;  3AZN B;  3C1B A;  4J8W A;  4G92 B;  2BYK B;  3KUY B;  3AZN C;  1KX3 B;  4H9R A;  1EQZ D;  4G92 C;  3IP4 C;  1H3O A;  3KUY C;  1KX3 C;  5AV5 C;  1U35 D;  2NQB D;  1TZY A;  5B2I A;  5AVB A;  4CSR A;  4Z5T B;  3WTP B;  3B0B A;  3AZJ A;  4Z5T C;  3AN2 D;  5BS7 C;  1P3K A;  4WNN B;  3LZ0 B;  3KWQ A;  3REI A;  5AVC C;  5GXQ A;  3LZ0 C;  1P34 A;  2PYO B;  3REK D;  5KDM A;  5CPJ D;  1AOI D;  5B2J B;  3REJ D;  2ZY5 A;  5B2J C;  1ID3 A;  3B6G D;  4UUZ A;  3AZF C;  1P3F B;  1P3O B;  1P3F C;  2RVQ C;  1P3O C;  5CPI B;  4QLC D;  5F99 D;  3NQU A;  5B33 A;  5CPI C;  4J8V D;  4NE3 A;  1M19 D;  3X1T B;  1P3B B;  4WU8 B;  5AV9 B;  1P3G B;  4YS3 A;  1P3B C;  4LD9 C;  3C1C C;  1P3G C;  5CP6 A;  3MGP D;  3W96 B;  3AZG D;  3MGQ A;  3R45 B;  3MVD A;  3W96 C;  1M1A D;  5B1L B;  3X1S D;  1ZLA D;  5B1L C;  5GT0 B;  5AY8 A;  4NE5 A;  5GT0 C;  3MNN B;  3MNN C;  1P3P B;  3W99 B;  5B0Y D;  3W99 C;  1P3P C;  3AZH A;  4J8X D;  1HQ3 B;  3WAA D;  3AZK D;  1KU5 A;  1HQ3 C;  5AV6 B;  5AV8 D;  4ZBJ C;  5B0Z D;  5AV6 C;  3LEL B;  2YFW B;  3AFA B;  3LEL C;  3AFA C;  5B40 C;  5CPK A;  3LZ1 A;  3WKJ B;  3AV1 B;  5DNN D;  3UTA A;  3WKJ C;  4KGC D;  3AV1 C;  2ZY2 A;  3B0C W;  4KHA A;  2Y2H A;  3AZN A;  2HIO B;  2BYK A;  3KUY A;  5E5A B;  1KX3 A;  2HIO C;  2Y2Q A;  5G49 A;  4M6B A;  5AV5 A;  5E5A C;  2XD1 A;  3A6N D;  3REK B;  5GSU B;  4ZUX B;  3VH6 A;  4Z5T A;  5GSU C;  3KXB B;  4ZUX C;  3W97 D;  5BS7 A;  3AZM D;  3KXB C;  2VQR A;  3AZL C;  3X1V D;  5B1M B;  3UTB B;  1BH9 A;  4WNN A;  3AZI B;  1F66 D;  5AVC A;  3LZ0 A;  5B1M C;  3UTB C;  3AZI C;  2F8N D;  3B6F D;  3EPH A;  4XZQ B;  1ULY A;  4WU9 B;  2LY8 A;  4XZQ C;  4WU9 C;  1M19 B;  4H9Q B;  5C3I C;  2JSS A;  5B2J A;  1WWI A;  3O62 B;  3MGS B;  3AZF A;  4R8P B;  3KFU G;  2RIQ A;  3O62 C;  3MGS C;  1P3I D;  4HGA B;  4R8P C;  3REH B;  1P3F A;  4HGA C;  3REH C;  1P3O A;  1ZLA B;  5JRG B;  1KX5 D;  5CPI A;  2CV5 D;  5JRG C;  3TU4 D;  1P3B A;  4LD9 A;  4XUJ B;  4CAY B;  3C1C A;  1P3G A;  1P3M B;  1P3A B;  4XUJ C;  4Z66 B;  3X1U B;  1P3M C;  4YM6 D;  1P3A C;  4J8X B;  4Z66 C;  1JFI A;  4WJ3 C;  3X1U C;  3W96 A;  3R45 A;  2F2A C;  5B1L A;  5B31 D;  3REL D;  5GT0 A;  4KUD C;  3EG5 B;  3MNN A;  2JE5 A;  2NZD C;  4NFT A;  1R4V A;  1P3P A;  3W99 A;  1S32 B;  5B24 D;  1HQ3 A;  5AV6 A;  3EPJ A;  3UT9 B;  1A7W A;  3LEL A;  3UT9 C;  2YFW A;  1M18 D;  3V9R B;  5B40 A;  3AFA A;  3VH5 A;  3WTP C;  3W98 B;  3W98 C;  1KX4 D;  3WKJ A;  2G5H C;  3AV1 A;  5GT3 D;  3C1B D;  4J8W D;  2HIO A;  5E5A A;  3AV2 B;  2PYO C;  3AV2 C;  2Y2J A;  1TZY D;  5B2I D;  4H9N A;  3EPK A;  5AVB D;  3LJA B;  5DNM B;  5GSU A;  3AYW B;  2BYM B;  4ZUX A;  3LJA C;  3AZJ D;  5DNM C;  3AYW C;  3KXB A;  3AZL A;  2FJ7 B;  2ARO B;  1P3K D;  2FJ7 C;  5BT1 C;  2ARO C;  5B1M A;  3KWQ D;  4J8U B;  3REI D;  3UTB A;  3AZI A;  5GXQ D;  2Y2N A;  5B32 G;  4J8U C;  4XZQ A;  1P34 D;  2HUE B;  1PZR A;  4WU9 A;  1T3U A;  5B31 G;  3X1T C;  1P3L B;  4WU8 C;  5AV9 C;  3MGR B;  1P3L C;  2JCH A;  3MGR C;  3WA9 B;  1ID3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...