3A6NC

The nucleosome containing a testis-specific histone variant, human h3t
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1t
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3a6nC00
5B24B 1M18D 5AVCC 3W99A 4J8WB 3MGRA 3AZMA 3AZHB 4Z2MG 1P3BC 3C1BB 4CAYA 5JRGA 1B6WA 1P3GB 2F8NB 5BNVA 1KX4A 3AYWD 3NQJA 3KXBD 3MNNA 5B2IA 3AFAA 1P34A 2AROB 5GSUC 3NQUB 5BO0B 2BYKA 4KUDC 5AV6A 3AV2D 1P3AC 1BH8B 5B0YC 5G49A 2YFVB 3WAAA 5DNMB 3AN2D 4R8PD 4YS3A 3MVDD 3AZGD 5E5AD 3VH5A 3AZLC 5AVBC 1S32D 3KWQB 4J8XB 3W99C 3AZMC 5B33B 4KHAA 4J8VD 3B6FA 1AOID 1TZYB 5JRGC 1M19A 1M1AD 3WKJA 3B0BA 3REJB 3KUYD 1KX4C 2IO5B 3REIC 1P3PC 5CPID 3WA9B 4CSRA 4ZBJC 1KX5B 4NE6A 3MNNC 5B2IC 3AFAC 3X1VA 5GT0C 3AZNA 3TU4A 5B2JC 5AV6C 4G91C 4YS3C 5B32D 1BH9B 3LELA 5B1MD 5B32G 1P3FA 4H9PA 5CHLB 4DRBA 3W97A 3MGPB 5GXQA 3AV2B 4JJNA 1P3KC 3X1TD 1HTAA 4R8PB 1EQZA 3AZGB 5E5AB 5BS7C 5B40A 1P3LD 4LD9A 3A6NB 4G92C 1M19C 1P3BD 4YM6D 2NZDD 3AV1A 4WU8D 5AY8A 1U35A 2JSSA 3X1VC 3AZEA 4XZQA 2NQBC 3WTPC 3AYWC 2RVQC 3UTAB 3O62A 5BNXB 4Z2MH 5GSUD 5AV8D 2HIOB 3KUYB 1F66A 4E44A 4KUDD 4WU9A 5CPIB 5B0YD 1P3AD 4Z5TB 1KX3A 1P3FC 3KSYA 5B1LB 1TAFA 5GXQC 5DNNC 4EO5C 1P3OA 3VH5T 5AVBD 1EQZC 4QLCB 3UTBB 1P3MA 3W99D 3LZ0A 3MGRD 3AZMD 3AZJA 4LD9C 1ZLAB 5AV9B 5JRGD 4H9OB 3AZFA 4XUJA 3UT9A 3AV1C 4H9SC 3AZKB 5AVCB 5AY8C 1U35C 3X1UA 1KX4D 3REID 5FUGA 3AZEC 3MNND 5B2ID 3AFAD 1F66C 3W98B 5B2JD 1P3IA 5AV6D 3WAAD 3RELC 1KX3C 4YS3D 5KDMB 1Q9CA 4H9NB 3R45B 3MGQA 5CPKA 4HGAC 5B1MC 5B31A 3VH6W 1F1EA 2PYOA 5B0YB 5CP6A 3LZ0C 2CV5A 4H9QB 3X1TC 3X1SB 2HUEC 3B6FD 3VH6T 3W96A 1M19D 3AZLB 4XUJC 3UT9C 1P3LC 4YM6C 2FJ7A 3X1UC 1HQ3C 2NZDC 4Z66B 4KGCB 3REHC 4X23A 4UUZA 4CAYB 5JRGB 4WU8C 2YFWB 3X1VD 4J8UB 3B6GA 2NQBD 3WTPD 2RVQD 5AV5A 3B0CW 4WNNA 1P3PB 3REIB 3LZ1A 3LJAA 5B24A 5AV8C 4J8WA 1P3FD 3AFAB 3MGQC 5GT0B 3W97D 3B0CT 5GXQD 5DNND 5B2JB 3C1BA 4JJND 1P3GA 3V9RA 2F8NA 1EQZD 5B40D 4LD9D 2L5AA 3MGRC 1P3KB 2AROA 4AWLC 3AV1D 3NQUA 5BO0A 5AY8D 1U35D 1BH8A 1N1JB 4X23C 1M18B 5DNMA 1ID3A 4ZUXA 3C1CA 5CPJA 3AZED 3B6GC 5BT1C 5GT3A 3O62D 5AV5C 1F66D 4NE3A 1P34C 4WU9D 3LZ1C 3MGSA 3RELD 4J8XA 1KX3D 4J8WC 4H9RB 3WAAC 2NQBB 3WTPB 3AYWB 1P3OD 1TZYA 3KXBB 1P3GC 3LZ0D 3AZJD 3REJA 3AN2B 4E45A 5GXQB 5DNNB 3WA9A 3MVDB 4EO5B 1KX5A 3VH6A 4XUJD 2AROC 3UT9D 3B6FC 3WKJC 3X1UD 1HQ3D 3REKA 1S32B 5DNMC 1ID3C 4ZUXC 1B67A 5F99A 3C1CC 1BH9A 3REHD 5CPJC 5GT3C 4J8VB 3AV1B 1AOIB 1A7WA 3MGPA 1M1AB 3AV2A 3MGSC 3AZNC 3TU4C 3B0DC 5E5AA 3AZIA 3MGQD 3A6NA 3LELC 1F66B 2PYOD 5B31G 5CP6D 3RELB 3W97C 4JJNC 2IO5C 5B32B 3W96D 5C3IB 5B1MB 5B40C 3UTAA 5BNXA 2FJ7D 3REKC 2HIOA 3X1TB 5CPIA 4Z5TA 2HUEB 5F99C 4X23D 5B1LA 4XUJB 3UT9B 1P3LB 3B6GD 5BT1D 1P3BB 4YM6B 5AV5D 1HQ3B 4XZQC 3X1UB 2NZDB 1H3OB 1P34D 4WV4B 3O62C 3LZ1D 5B24D 4QLCA 3REHB 3UTBA 4WU8B 4J8WD 1WWIA 3AZIC 4WU9C 3A6NC 1ZLAA 2BYMB 3C1BD 5AV9A 4H9OA 1P3GD 2F8ND 5GSUB 1P3OC 2F8NG 5AV8B 3AZKA 5AVCA 4KUDB 1P3AB 3MGQB 1JFIA 1P3MC 5B0ZA 4NFTA 3AZJC 2LY8A 2AROD 3AZFC 3WKJD 2HIOC 3W98A 5AVBB 4Z5TC 5DNMD 4WZSB 1ID3D 3AZMB 4NE5A 5B1LC 5KDMA 4ZUXD 5CPJD 3MGRB 3C1CD 4H9NA 5GT3D 5JA4A 5B0YA 4QLCC 3MGSD 4X23B 3AZND 3TU4D 1P3IC 5BNVB 4H9QA 1KX4B 3X1SA 1ZLAC 3NQJB 4ZBJB 5AV9C 3LELD 4M6BA 3AZLA 3MNNB 5B2IB 1P34B 3AZHA 5CPKC 3AZKC 2BYKB 5B31C 5AV6B 2PYOC 4G91B 3REJD 5G49B 5CP6C 3WAAB 4Z66A 3WA9D 2CV5C 4KGCA 5B0ZC 4YS3B 1KX5D 2CWEA 2YFWA 3V9RB 4J8UA 3W96C 3W98C 3REKD 1P3PA 3REIA 2FJ7C 5F99D 4KHAB 5GT0A 3B6FB 2YFVA 4G92B 1M19B 3MGPD 3WKJB 5B2JA 4XZQD 1ID3B 4ZUXB 3C1CB 5CPJB 3X1SC 3AZID 5GT3B 4CSRB 3LJAC 5B24C 3KWQA 3A6ND 3X1VB 3AZHC 3MGSB 5B33A 1P3KA 3AZNB 3TU4B 3C1BC 3B0DB 5BS7A 4Z66C 4KGCC 1N1JA 3LJAB 3LELB 1P3MD 1M18A 3W99B 1P3FB 4H9PB 4J8UC 3UTAD 3W97B 1ULYA 4JJNB 3AZFD 2HIOD 4Z5TD 1EQZB 5B40B 5B1LD 2F8NH 4H9RA 1BFMA 4LD9B 2NQBA 3WTPA 3AYWA 3REKB 3KXBA 4QLCD 5F99B 3UTBD 1P3ID 5AY8B 1U35B 3KWQC 4J8XC 1ZLAD 3AN2A 4R8PA 5DNNA 1KU5A 3MVDA 3AZGA 5AV9D 4XZQB 5B33C 3AZEB 1R4VA 3O62B 5CPKD 1TZYC 3AZKD 5B31D 5AVCD 3AZIB 4WU9B 1S32A 1M18C 1KX3B 2CV5D 5B0ZD 3REJC 1TAFB 3WA9C 4J8VA 4HGAB 1P3OB 1M1AA 4H9SA 1KX5C 1AOIA 3W98D 1P3MB 3LZ0B 3AZJB 3KUYA 3AZFB 3KXBC 3VH5W 3RELA 3MGPC 3AV2C 3X1SD 3AN2C 4R8PC 3LJAD 5FUGB 3MVDC 5B32A 3AZGC 5E5AC 3AZLD 5B1MA 2F8NK 4DRAA 3AZHD 1P3IB 1S32C 3X1TA 4Z66D 4KGCD 4J8VC 4J8UD 5CPKB 1P3LA 1AOIC 1M1AC 5B31B 1P3BA 4YM6A 2PYOB 1HQ3A 5CP6B 1JFIB 3UTAC 1P3PD 1H3OA 2NZDA 2CV5B 5B0ZB 3REHA 3KUYC 4WU8A 1WWSA 3WTPE 5CPIC 5GT0D 3W96B 2BYMA 3R45A 2FJ7B 5GSUA 4AWLB 5AV8A 4KUDA 1P3AA 5JA4B 5B32C 3KWQD 4UUZB 5C3IC 4J8XD 3UTBC 5B33D 3B6GB 1P3KD 5AV5B 1TZYD 4WNNB 5AVBA 3LZ1B
chains in the Genus database with same CATH superfamily
5B24B 1M18D 5AVCC 3W99A 4J8WB 3MGRA 3AZMA 3AZHB 4Z2MG 1P3BC 3C1BB 4CAYA 5JRGA 1B6WA 1P3GB 2F8NB 5BNVA 1KX4A 3AYWD 3NQJA 3P5JB 3MNNA 3KXBD 5B2IA 3AFAA 1P34A 2AROB 2XD1A 5GSUC 3NQUB 5BO0B 2BYKA 2BG1A 4KUDC 5AV6A 3AV2D 1P3AC 1BH8B 5B0YC 5G49A 2YFVB 3WAAA 5DNMB 3AN2D 4R8PD 4YS3A 3MVDD 3AZGD 5E5AD 3VH5A 3AZLC 5AVBC 2XD5A 1S32D 3KWQB 4J8XB 3W99C 3AZMC 3EG5B 5B33B 2Y2MA 4KHAA 2ZY5A 4J8VD 3B6FA 1AOID 1TZYB 5JRGC 1M19A 1M1AD 3WKJA 3B0BA 3REJB 3KUYD 1KX4C 2IO5B 3REIC 1P3PC 5CPID 3WA9B 4CSRA 4ZBJC 1KX5B 4NE6A 3MNNC 5B2IC 3AFAC 3X1VA 2Y2JA 5GT0C 3AZNA 3TU4A 5B2JC 5AV6C 4G91C 2FFFB 4YS3C 5B32D 1BH9B 3LELA 5B1MD 5B32G 2Y2HA 1P3FA 4H9PA 5CHLB 4DRBA 3W97A 3MGPB 5GXQA 3AV2B 4JJNA 1P3KC 3X1TD 1HTAA 4R8PB 1EQZA 3AZGB 5E5AB 5BS7C 5B40A 1P3LD 4LD9A 3A6NB 4G92C 1M19C 1P3BD 4YM6D 2RIQA 2NZDD 3AV1A 3FDDA 4WU8D 5AY8A 1U35A 2JSSA 3X1VC 3AZEA 4XZQA 2NQBC 3WTPC 2G5HC 2RVQC 3UTAB 3AYWC 3O62A 5BNXB 4Z2MH 5GSUD 5AV8D 2HIOB 3KUYB 1F66A 4E44A 4KUDD 4WU9A 5CPIB 5B0YD 1P3AD 4Z5TB 1KX3A 1P3FC 3KSYA 5B1LB 1TAFA 5GXQC 5DNNC 4EO5C 1P3OA 3VH5T 5AVBD 1EQZC 4QLCB 3UTBB 1P3MA 3W99D 3LZ0A 3MGRD 3AZMD 3AZJA 4LD9C 1ZLAB 2VQRA 2ZM5A 5AV9B 5JRGD 4H9OB 3AZFA 2Y2QA 4XUJA 3UT9A 3AV1C 4H9SC 3AZKB 2Y2NA 5AY8C 5AVCB 1U35C 3AL0C 3X1UA 1KX4D 3REID 5FUGA 3AZEC 3MNND 5B2ID 3AFAD 1F66C 3W98B 5B2JD 1P3IA 5AV6D 2Y2GA 3WAAD 3RELC 1KX3C 4YS3D 5KDMB 1Q9CA 4H9NB 3R45B 1T3UA 3MGQA 5CPKA 4HGAC 5B1MC 5B31A 3VH6W 1F1EA 2PYOA 5B0YB 5CP6A 3LZ0C 2CV5A 4H9QB 3X1TC 3X1SB 2DF4C 2HUEC 3VH6T 3W96A 3B6FD 1M19D 3AZLB 4XUJC 3UT9C 1P3LC 2ZY4A 4YM6C 2FJ7A 3X1UC 1HQ3C 2NZDC 4Z66B 2JE5A 4KGCB 3REHC 4X23A 4UUZA 4CAYB 5JRGB 4WU8C 2YFWB 3X1VD 4J8UB 2J8PA 3B6GA 2NQBD 3WTPD 3KFUG 2RVQD 3A1KA 5AV5A 3B0CW 4WNNA 1P3PB 3REIB 3LZ1A 3LJAA 5B24A 5AV8C 4J8WA 1P3FD 3AFAB 3MGQC 5GT0B 3W97D 3B0CT 5GXQD 5DNND 5B2JB 3C1BA 4JJND 1P3GA 3V9RA 2F8NA 1EQZD 5B40D 4LD9D 2UWXA 2L5AA 3MGRC 2Y2KA 1P3KB 2AROA 4AWLC 3AV1D 3NQUA 5BO0A 5AY8D 1U35D 1BH8A 1N1JB 4X23C 1M18B 5DNMA 1ID3A 4ZUXA 3C1CA 5CPJA 3AZED 3B6GC 5BT1C 5GT3A 3O62D 5AV5C 1F66D 4NE3A 1P34C 4WU9D 3LZ1C 3MGSA 3RELD 4J8XA 1KX3D 2ZY2A 4J8WC 4H9RB 3WAAC 2NQBB 3WTPB 3AYWB 1P3OD 1TZYA 3KXBB 1P3GC 1PZRA 3H0LC 3LZ0D 3AZJD 3REJA 3AN2B 4E45A 5GXQB 5DNNB 3WA9A 3MVDB 4EO5B 1KX5A 3VH6A 4XUJD 2AROC 3UT9D 3B6FC 2ZY3A 3WKJC 3X1UD 1HQ3D 3REKA 1S32B 3EPJA 5DNMC 1ID3C 4ZUXC 1B67A 5F99A 3C1CC 1BH9A 3REHD 5CPJC 5GT3C 4J8VB 3AV1B 1AOIB 1A7WA 3MGPA 1M1AB 3AV2A 3MGSC 3AZNC 3TU4C 2Y2LA 3B0DC 5E5AA 3AZIA 3MGQD 3A6NA 3LELC 1F66B 2PYOD 5B31G 5CP6D 3RELB 3W97C 4JJNC 2IO5C 5B32B 3W96D 5C3IB 5B1MB 5B40C 4WJ3C 3UTAA 5BNXA 2FJ7D 3REKC 2HIOA 3X1TB 5CPIA 4Z5TA 2HUEB 5F99C 4X23D 1W2EA 5B1LA 4XUJB 3UT9B 1P3LB 3B6GD 5BT1D 1P3BB 4YM6B 5AV5D 1HQ3B 4XZQC 3X1UB 2NZDB 1H3OB 1P34D 4WV4B 3O62C 3LZ1D 5B24D 4QLCA 3REHB 3UTBA 4WU8B 4J8WD 1WWIA 3AZIC 4WU9C 2G5IC 3A6NC 1ZLAA 2BYMB 3C1BD 5AV9A 4H9OA 1P3GD 2Y2PA 2F8ND 5GSUB 1P3OC 2F8NG 5AV8B 3AZKA 5AVCA 4KUDB 1P3AB 3MGQB 1Z2CB 1JFIA 1P3MC 2Y2IA 4UPKA 5B0ZA 4NFTA 3AZJC 2LY8A 2AROD 3AZFC 3WKJD 2HIOC 3W98A 5AVBB 4Z5TC 5DNMD 4WZSB 1ID3D 3AZMB 4NE5A 5B1LC 5KDMA 4ZUXD 5CPJD 3MGRB 3C1CD 4H9NA 5GT3D 5JA4A 2Y2OA 5B0YA 4QLCC 3MGSD 4X23B 3AZND 3TU4D 1P3IC 5BNVB 4H9QA 1KX4B 3X1SA 1ZLAC 2DQNC 3NQJB 4ZBJB 5AV9C 3LELD 4M6BA 3AZLA 3MNNB 5B2IB 1P34B 3AZHA 5CPKC 3AZKC 2BYKB 5B31C 5AV6B 2PYOC 4G91B 3REJD 5G49B 2W8SA 5CP6C 3WAAB 4Z66A 3WA9D 2CV5C 4KGCA 5B0ZC 4YS3B 1KX5D 2CWEA 2YFWA 3V9RB 4J8UA 3W96C 3W98C 3REKD 1P3PA 3REIA 2FJ7C 5F99D 3IP4C 4KHAB 5GT0A 3B6FB 2YFVA 4G92B 1M19B 3MGPD 3WKJB 5B2JA 3H0MC 4XZQD 1ID3B 4ZUXB 3C1CB 5CPJB 3X1SC 3AZID 5GT3B 4CSRB 3LJAC 5B24C 3KWQA 3A6ND 3X1VB 3AZHC 3MGSB 5B33A 1P3KA 3AZNB 3TU4B 3C1BC 3B0DB 5BS7A 4Z66C 4KGCC 1N1JA 3LJAB 3LELB 1P3MD 1M18A 3W99B 1P3FB 4H9PB 2F2AC 4J8UC 3UTAD 3W97B 1ULYA 4JJNB 3AZFD 2HIOD 4DQYB 4Z5TD 1EQZB 5B40B 5B1LD 2F8NH 4H9RA 1BFMA 4LD9B 2NQBA 3WTPA 3AYWA 3REKB 3KXBA 4QLCD 5F99B 3UTBD 3F6TA 1P3ID 5AY8B 1U35B 3KWQC 2JCHA 4J8XC 1ZLAD 3AN2A 4R8PA 5DNNA 1KU5A 3MVDA 3AZGA 5AV9D 4XZQB 5B33C 3AZEB 1R4VA 3O62B 5CPKD 1TZYC 3AZKD 5B31D 5AVCD 3AZIB 4WU9B 1S32A 1M18C 1KX3B 2CV5D 5B0ZD 3REJC 1TAFB 3WA9C 4J8VA 4HGAB 1P3OB 1M1AA 4H9SA 1KX5C 1AOIA 3W98D 1P3MB 3LZ0B 3AZJB 3KUYA 3AZFB 3KXBC 3VH5W 3RELA 3MGPC 3AV2C 3X1SD 3AN2C 4R8PC 3LJAD 5FUGB 3MVDC 5B32A 3AZGC 3EPHA 5E5AC 3AZLD 5B1MA 2F8NK 4DRAA 3AZHD 1P3IB 1S32C 3X1TA 4Z66D 4KGCD 3A1IA 4J8VC 4J8UD 3H0RC 5CPKB 1P3LA 1AOIC 1M1AC 5B31B 1P3BA 4YM6A 2PYOB 1HQ3A 5CP6B 1JFIB 3UTAC 1P3PD 1H3OA 2NZDA 2CV5B 5B0ZB 3REHA 3KUYC 4WU8A 1WWSA 3WTPE 5CPIC 5GT0D 3W96B 2BYMA 3R45A 2FJ7B 3EPLA 5GSUA 4AWLB 5AV8A 4KUDA 1P3AA 5JA4B 5B32C 3KWQD 4UUZB 5C3IC 4J8XD 3EPKA 3UTBC 5B33D 3B6GB 1P3KD 5AV5B 1TZYD 4WNNB 5AVBA 3LZ1B
chains in the Genus database with same CATH topology
5B24B 1M18D 5AVCC 3W99A 4J8WB 3MGRA 3AZMA 3AZHB 4Z2MG 1P3BC 3C1BB 4CAYA 5JRGA 1B6WA 1P3GB 2F8NB 5BNVA 1KX4A 3AYWD 3NQJA 3P5JB 3MNNA 3KXBD 5B2IA 3AFAA 1P34A 2AROB 2XD1A 5GSUC 3NQUB 5BO0B 2BYKA 2BG1A 4KUDC 5AV6A 3AV2D 1P3AC 1BH8B 5B0YC 5G49A 2YFVB 3WAAA 5DNMB 3AN2D 4R8PD 4YS3A 3MVDD 3AZGD 5E5AD 3VH5A 3AZLC 5AVBC 2XD5A 1S32D 3KWQB 4J8XB 3W99C 3AZMC 3EG5B 5B33B 2Y2MA 4KHAA 2ZY5A 4J8VD 3B6FA 1AOID 1TZYB 5JRGC 1M19A 1M1AD 3WKJA 3B0BA 3REJB 3KUYD 1KX4C 2IO5B 3REIC 1P3PC 5CPID 3WA9B 4CSRA 4ZBJC 1KX5B 4NE6A 3MNNC 5B2IC 3AFAC 3X1VA 2Y2JA 5GT0C 3AZNA 3TU4A 5B2JC 5AV6C 4G91C 2FFFB 4YS3C 5B32D 1BH9B 3LELA 5B1MD 5B32G 2Y2HA 1P3FA 4H9PA 5CHLB 4DRBA 3W97A 3MGPB 5GXQA 3AV2B 4JJNA 1P3KC 3X1TD 1HTAA 4R8PB 1EQZA 3AZGB 5E5AB 5BS7C 5B40A 1P3LD 4LD9A 3A6NB 4G92C 1M19C 1P3BD 4YM6D 2RIQA 2NZDD 3AV1A 3FDDA 4WU8D 5AY8A 1U35A 2JSSA 3X1VC 3AZEA 4XZQA 2NQBC 3WTPC 2G5HC 2RVQC 3UTAB 3AYWC 3O62A 5BNXB 4Z2MH 5GSUD 5AV8D 2HIOB 3KUYB 1F66A 4E44A 4KUDD 4WU9A 5CPIB 5B0YD 1P3AD 4Z5TB 1KX3A 1P3FC 3KSYA 5B1LB 1TAFA 5GXQC 5DNNC 4EO5C 1P3OA 3VH5T 5AVBD 1EQZC 4QLCB 3UTBB 1P3MA 3W99D 3LZ0A 3MGRD 3AZMD 3AZJA 4LD9C 1ZLAB 2VQRA 2ZM5A 5AV9B 5JRGD 4H9OB 3AZFA 2Y2QA 4XUJA 3UT9A 3AV1C 4H9SC 3AZKB 2Y2NA 5AY8C 5AVCB 1U35C 3AL0C 3X1UA 1KX4D 3REID 5FUGA 3AZEC 3MNND 5B2ID 3AFAD 1F66C 3W98B 5B2JD 1P3IA 5AV6D 2Y2GA 3WAAD 3RELC 1KX3C 4YS3D 5KDMB 1Q9CA 4H9NB 3R45B 1T3UA 3MGQA 5CPKA 4HGAC 5B1MC 5B31A 3VH6W 1F1EA 2PYOA 5B0YB 5CP6A 3LZ0C 2CV5A 4H9QB 3X1TC 3X1SB 2DF4C 2HUEC 3VH6T 3W96A 3B6FD 1M19D 3AZLB 4XUJC 3UT9C 1P3LC 2ZY4A 4YM6C 2FJ7A 3X1UC 1HQ3C 2NZDC 4Z66B 2JE5A 4KGCB 3REHC 4X23A 4UUZA 4CAYB 5JRGB 4WU8C 2YFWB 3X1VD 4J8UB 2J8PA 3B6GA 2NQBD 3WTPD 3KFUG 2RVQD 3A1KA 5AV5A 3B0CW 4WNNA 1P3PB 3REIB 3LZ1A 3LJAA 5B24A 5AV8C 4J8WA 1P3FD 3AFAB 3MGQC 5GT0B 3W97D 3B0CT 5GXQD 5DNND 5B2JB 3C1BA 4JJND 1P3GA 3V9RA 2F8NA 1EQZD 5B40D 4LD9D 2UWXA 2L5AA 3MGRC 2Y2KA 1P3KB 2AROA 4AWLC 3AV1D 3NQUA 5BO0A 5AY8D 1U35D 1BH8A 1N1JB 4X23C 1M18B 5DNMA 1ID3A 4ZUXA 3C1CA 5CPJA 3AZED 3B6GC 5BT1C 5GT3A 3O62D 5AV5C 1F66D 4NE3A 1P34C 4WU9D 3LZ1C 3MGSA 3RELD 4J8XA 1KX3D 2ZY2A 4J8WC 4H9RB 3WAAC 2NQBB 3WTPB 3AYWB 1P3OD 1TZYA 3KXBB 1P3GC 1PZRA 3H0LC 3LZ0D 3AZJD 3REJA 3AN2B 4E45A 5GXQB 5DNNB 3WA9A 3MVDB 4EO5B 1KX5A 3VH6A 4XUJD 2AROC 3UT9D 3B6FC 2ZY3A 3WKJC 3X1UD 1HQ3D 3REKA 1S32B 3EPJA 5DNMC 1ID3C 4ZUXC 1B67A 5F99A 3C1CC 1BH9A 3REHD 5CPJC 5GT3C 4J8VB 3AV1B 1AOIB 1A7WA 3MGPA 1M1AB 3AV2A 3MGSC 3AZNC 3TU4C 2Y2LA 3B0DC 5E5AA 3AZIA 3MGQD 3A6NA 3LELC 1F66B 2PYOD 5B31G 5CP6D 3RELB 3W97C 4JJNC 2IO5C 5B32B 3W96D 5C3IB 5B1MB 5B40C 4WJ3C 3UTAA 5BNXA 2FJ7D 3REKC 2HIOA 3X1TB 5CPIA 4Z5TA 2HUEB 5F99C 4X23D 1W2EA 5B1LA 4XUJB 3UT9B 1P3LB 3B6GD 5BT1D 1P3BB 4YM6B 5AV5D 1HQ3B 4XZQC 3X1UB 2NZDB 1H3OB 1P34D 4WV4B 3O62C 3LZ1D 5B24D 4QLCA 3REHB 3UTBA 4WU8B 4J8WD 1WWIA 3AZIC 4WU9C 2G5IC 3A6NC 1ZLAA 2BYMB 3C1BD 5AV9A 4H9OA 1P3GD 2Y2PA 2F8ND 5GSUB 1P3OC 2F8NG 5AV8B 3AZKA 5AVCA 4KUDB 1P3AB 3MGQB 1Z2CB 1JFIA 1P3MC 2Y2IA 4UPKA 5B0ZA 4NFTA 3AZJC 2LY8A 2AROD 3AZFC 3WKJD 2HIOC 3W98A 5AVBB 4Z5TC 5DNMD 4WZSB 1ID3D 3AZMB 4NE5A 5B1LC 5KDMA 4ZUXD 5CPJD 3MGRB 3C1CD 4H9NA 5GT3D 5JA4A 2Y2OA 5B0YA 4QLCC 3MGSD 4X23B 3AZND 3TU4D 1P3IC 5BNVB 4H9QA 1KX4B 3X1SA 1ZLAC 2DQNC 3NQJB 4ZBJB 5AV9C 3LELD 4M6BA 3AZLA 3MNNB 5B2IB 1P34B 3AZHA 5CPKC 3AZKC 2BYKB 5B31C 5AV6B 2PYOC 4G91B 3REJD 5G49B 2W8SA 5CP6C 3WAAB 4Z66A 3WA9D 2CV5C 4KGCA 5B0ZC 4YS3B 1KX5D 2CWEA 2YFWA 3V9RB 4J8UA 3W96C 3W98C 3REKD 1P3PA 3REIA 2FJ7C 5F99D 3IP4C 4KHAB 5GT0A 3B6FB 2YFVA 4G92B 1M19B 3MGPD 3WKJB 5B2JA 3H0MC 4XZQD 1ID3B 4ZUXB 3C1CB 5CPJB 3X1SC 3AZID 5GT3B 4CSRB 3LJAC 5B24C 3KWQA 3A6ND 3X1VB 3AZHC 3MGSB 5B33A 1P3KA 3AZNB 3TU4B 3C1BC 3B0DB 5BS7A 4Z66C 4KGCC 1N1JA 3LJAB 3LELB 1P3MD 1M18A 3W99B 1P3FB 4H9PB 2F2AC 4J8UC 3UTAD 3W97B 1ULYA 4JJNB 3AZFD 2HIOD 4DQYB 4Z5TD 1EQZB 5B40B 5B1LD 2F8NH 4H9RA 1BFMA 4LD9B 2NQBA 3WTPA 3AYWA 3REKB 3KXBA 4QLCD 5F99B 3UTBD 3F6TA 1P3ID 5AY8B 1U35B 3KWQC 2JCHA 4J8XC 1ZLAD 3AN2A 4R8PA 5DNNA 1KU5A 3MVDA 3AZGA 5AV9D 4XZQB 5B33C 3AZEB 1R4VA 3O62B 5CPKD 1TZYC 3AZKD 5B31D 5AVCD 3AZIB 4WU9B 1S32A 1M18C 1KX3B 2CV5D 5B0ZD 3REJC 1TAFB 3WA9C 4J8VA 4HGAB 1P3OB 1M1AA 4H9SA 1KX5C 1AOIA 3W98D 1P3MB 3LZ0B 3AZJB 3KUYA 3AZFB 3KXBC 3VH5W 3RELA 3MGPC 3AV2C 3X1SD 3AN2C 4R8PC 3LJAD 5FUGB 3MVDC 5B32A 3AZGC 3EPHA 5E5AC 3AZLD 5B1MA 2F8NK 4DRAA 3AZHD 1P3IB 1S32C 3X1TA 4Z66D 4KGCD 3A1IA 4J8VC 4J8UD 3H0RC 5CPKB 1P3LA 1AOIC 1M1AC 5B31B 1P3BA 4YM6A 2PYOB 1HQ3A 5CP6B 1JFIB 3UTAC 1P3PD 1H3OA 2NZDA 2CV5B 5B0ZB 3REHA 3KUYC 4WU8A 1WWSA 3WTPE 5CPIC 5GT0D 3W96B 2BYMA 3R45A 2FJ7B 3EPLA 5GSUA 4AWLB 5AV8A 4KUDA 1P3AA 5JA4B 5B32C 3KWQD 4UUZB 5C3IC 4J8XD 3EPKA 3UTBC 5B33D 3B6GB 1P3KD 5AV5B 1TZYD 4WNNB 5AVBA 3LZ1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B24 B;  1M18 D;  5AVC C;  3W99 A;  4J8W B;  3MGR A;  3AZM A;  3AZH B;  4Z2M G;  1P3B C;  3C1B B;  4CAY A;  5JRG A;  1B6W A;  1P3G B;  2F8N B;  5BNV A;  1KX4 A;  3AYW D;  3NQJ A;  3KXB D;  3MNN A;  5B2I A;  3AFA A;  1P34 A;  2ARO B;  5GSU C;  3NQU B;  5BO0 B;  2BYK A;  4KUD C;  5AV6 A;  3AV2 D;  1P3A C;  1BH8 B;  5B0Y C;  5G49 A;  2YFV B;  3WAA A;  5DNM B;  3AN2 D;  4R8P D;  4YS3 A;  3MVD D;  3AZG D;  5E5A D;  3VH5 A;  3AZL C;  5AVB C;  1S32 D;  3KWQ B;  4J8X B;  3W99 C;  3AZM C;  5B33 B;  4KHA A;  4J8V D;  3B6F A;  1AOI D;  1TZY B;  5JRG C;  1M19 A;  1M1A D;  3WKJ A;  3B0B A;  3REJ B;  3KUY D;  1KX4 C;  2IO5 B;  3REI C;  1P3P C;  5CPI D;  3WA9 B;  4CSR A;  4ZBJ C;  1KX5 B;  4NE6 A;  3MNN C;  5B2I C;  3AFA C;  3X1V A;  5GT0 C;  3AZN A;  3TU4 A;  5B2J C;  5AV6 C;  4G91 C;  4YS3 C;  5B32 D;  1BH9 B;  3LEL A;  5B1M D;  5B32 G;  1P3F A;  4H9P A;  5CHL B;  4DRB A;  3W97 A;  3MGP B;  5GXQ A;  3AV2 B;  4JJN A;  1P3K C;  3X1T D;  1HTA A;  4R8P B;  1EQZ A;  3AZG B;  5E5A B;  5BS7 C;  5B40 A;  1P3L D;  4LD9 A;  3A6N B;  4G92 C;  1M19 C;  1P3B D;  4YM6 D;  2NZD D;  3AV1 A;  4WU8 D;  5AY8 A;  1U35 A;  2JSS A;  3X1V C;  3AZE A;  4XZQ A;  2NQB C;  3WTP C;  3AYW C;  2RVQ C;  3UTA B;  3O62 A;  5BNX B;  4Z2M H;  5GSU D;  5AV8 D;  2HIO B;  3KUY B;  1F66 A;  4E44 A;  4KUD D;  4WU9 A;  5CPI B;  5B0Y D;  1P3A D;  4Z5T B;  1KX3 A;  1P3F C;  3KSY A;  5B1L B;  1TAF A;  5GXQ C;  5DNN C;  4EO5 C;  1P3O A;  3VH5 T;  5AVB D;  1EQZ C;  4QLC B;  3UTB B;  1P3M A;  3W99 D;  3LZ0 A;  3MGR D;  3AZM D;  3AZJ A;  4LD9 C;  1ZLA B;  5AV9 B;  5JRG D;  4H9O B;  3AZF A;  4XUJ A;  3UT9 A;  3AV1 C;  4H9S C;  3AZK B;  5AVC B;  5AY8 C;  1U35 C;  3X1U A;  1KX4 D;  3REI D;  5FUG A;  3AZE C;  3MNN D;  5B2I D;  3AFA D;  1F66 C;  3W98 B;  5B2J D;  1P3I A;  5AV6 D;  3WAA D;  3REL C;  1KX3 C;  4YS3 D;  5KDM B;  1Q9C A;  4H9N B;  3R45 B;  3MGQ A;  5CPK A;  4HGA C;  5B1M C;  5B31 A;  3VH6 W;  1F1E A;  2PYO A;  5B0Y B;  5CP6 A;  3LZ0 C;  2CV5 A;  4H9Q B;  3X1T C;  3X1S B;  2HUE C;  3B6F D;  3VH6 T;  3W96 A;  1M19 D;  3AZL B;  4XUJ C;  3UT9 C;  1P3L C;  4YM6 C;  2FJ7 A;  3X1U C;  1HQ3 C;  2NZD C;  4Z66 B;  4KGC B;  3REH C;  4X23 A;  4UUZ A;  4CAY B;  5JRG B;  4WU8 C;  2YFW B;  3X1V D;  4J8U B;  3B6G A;  2NQB D;  3WTP D;  2RVQ D;  5AV5 A;  3B0C W;  4WNN A;  1P3P B;  3REI B;  3LZ1 A;  3LJA A;  5B24 A;  5AV8 C;  4J8W A;  1P3F D;  3AFA B;  3MGQ C;  5GT0 B;  3W97 D;  3B0C T;  5GXQ D;  5DNN D;  5B2J B;  3C1B A;  4JJN D;  1P3G A;  3V9R A;  2F8N A;  1EQZ D;  5B40 D;  4LD9 D;  2L5A A;  3MGR C;  1P3K B;  2ARO A;  4AWL C;  3AV1 D;  3NQU A;  5BO0 A;  5AY8 D;  1U35 D;  1BH8 A;  1N1J B;  4X23 C;  1M18 B;  5DNM A;  1ID3 A;  4ZUX A;  3C1C A;  5CPJ A;  3AZE D;  3B6G C;  5BT1 C;  5GT3 A;  3O62 D;  5AV5 C;  1F66 D;  4NE3 A;  1P34 C;  4WU9 D;  3LZ1 C;  3MGS A;  3REL D;  4J8X A;  1KX3 D;  4J8W C;  4H9R B;  3WAA C;  2NQB B;  3WTP B;  3AYW B;  1P3O D;  1TZY A;  3KXB B;  1P3G C;  3LZ0 D;  3AZJ D;  3REJ A;  3AN2 B;  4E45 A;  5GXQ B;  5DNN B;  3WA9 A;  3MVD B;  4EO5 B;  1KX5 A;  3VH6 A;  4XUJ D;  2ARO C;  3UT9 D;  3B6F C;  3WKJ C;  3X1U D;  1HQ3 D;  3REK A;  1S32 B;  5DNM C;  1ID3 C;  4ZUX C;  1B67 A;  5F99 A;  3C1C C;  1BH9 A;  3REH D;  5CPJ C;  5GT3 C;  4J8V B;  3AV1 B;  1AOI B;  1A7W A;  3MGP A;  1M1A B;  3AV2 A;  3MGS C;  3AZN C;  3TU4 C;  3B0D C;  5E5A A;  3AZI A;  3MGQ D;  3A6N A;  3LEL C;  1F66 B;  2PYO D;  5B31 G;  5CP6 D;  3REL B;  3W97 C;  4JJN C;  2IO5 C;  5B32 B;  3W96 D;  5C3I B;  5B1M B;  5B40 C;  3UTA A;  5BNX A;  2FJ7 D;  3REK C;  2HIO A;  3X1T B;  5CPI A;  4Z5T A;  2HUE B;  5F99 C;  4X23 D;  5B1L A;  4XUJ B;  3UT9 B;  1P3L B;  3B6G D;  5BT1 D;  1P3B B;  4YM6 B;  5AV5 D;  1HQ3 B;  4XZQ C;  3X1U B;  2NZD B;  1H3O B;  1P34 D;  4WV4 B;  3O62 C;  3LZ1 D;  5B24 D;  4QLC A;  3REH B;  3UTB A;  4WU8 B;  4J8W D;  1WWI A;  3AZI C;  4WU9 C;  3A6N C;  1ZLA A;  2BYM B;  3C1B D;  5AV9 A;  4H9O A;  1P3G D;  2F8N D;  5GSU B;  1P3O C;  2F8N G;  5AV8 B;  3AZK A;  5AVC A;  4KUD B;  1P3A B;  3MGQ B;  1JFI A;  1P3M C;  5B0Z A;  4NFT A;  3AZJ C;  2LY8 A;  2ARO D;  3AZF C;  3WKJ D;  2HIO C;  3W98 A;  5AVB B;  4Z5T C;  5DNM D;  4WZS B;  1ID3 D;  3AZM B;  4NE5 A;  5B1L C;  5KDM A;  4ZUX D;  5CPJ D;  3MGR B;  3C1C D;  4H9N A;  5GT3 D;  5JA4 A;  5B0Y A;  4QLC C;  3MGS D;  4X23 B;  3AZN D;  3TU4 D;  1P3I C;  5BNV B;  4H9Q A;  1KX4 B;  3X1S A;  1ZLA C;  3NQJ B;  4ZBJ B;  5AV9 C;  3LEL D;  4M6B A;  3AZL A;  3MNN B;  5B2I B;  1P34 B;  3AZH A;  5CPK C;  3AZK C;  2BYK B;  5B31 C;  5AV6 B;  2PYO C;  4G91 B;  3REJ D;  5G49 B;  5CP6 C;  3WAA B;  4Z66 A;  3WA9 D;  2CV5 C;  4KGC A;  5B0Z C;  4YS3 B;  1KX5 D;  2CWE A;  2YFW A;  3V9R B;  4J8U A;  3W96 C;  3W98 C;  3REK D;  1P3P A;  3REI A;  2FJ7 C;  5F99 D;  4KHA B;  5GT0 A;  3B6F B;  2YFV A;  4G92 B;  1M19 B;  3MGP D;  3WKJ B;  5B2J A;  4XZQ D;  1ID3 B;  4ZUX B;  3C1C B;  5CPJ B;  3X1S C;  3AZI D;  5GT3 B;  4CSR B;  3LJA C;  5B24 C;  3KWQ A;  3A6N D;  3X1V B;  3AZH C;  3MGS B;  5B33 A;  1P3K A;  3AZN B;  3TU4 B;  3C1B C;  3B0D B;  5BS7 A;  4Z66 C;  4KGC C;  1N1J A;  3LJA B;  3LEL B;  1P3M D;  1M18 A;  3W99 B;  1P3F B;  4H9P B;  4J8U C;  3UTA D;  3W97 B;  1ULY A;  4JJN B;  3AZF D;  2HIO D;  4Z5T D;  1EQZ B;  5B40 B;  5B1L D;  2F8N H;  4H9R A;  1BFM A;  4LD9 B;  2NQB A;  3WTP A;  3AYW A;  3REK B;  3KXB A;  4QLC D;  5F99 B;  3UTB D;  1P3I D;  5AY8 B;  1U35 B;  3KWQ C;  4J8X C;  1ZLA D;  3AN2 A;  4R8P A;  5DNN A;  1KU5 A;  3MVD A;  3AZG A;  5AV9 D;  4XZQ B;  5B33 C;  3AZE B;  1R4V A;  3O62 B;  5CPK D;  1TZY C;  3AZK D;  5B31 D;  5AVC D;  3AZI B;  4WU9 B;  1S32 A;  1M18 C;  1KX3 B;  2CV5 D;  5B0Z D;  3REJ C;  1TAF B;  3WA9 C;  4J8V A;  4HGA B;  1P3O B;  1M1A A;  4H9S A;  1KX5 C;  1AOI A;  3W98 D;  1P3M B;  3LZ0 B;  3AZJ B;  3KUY A;  3AZF B;  3KXB C;  3VH5 W;  3REL A;  3MGP C;  3AV2 C;  3X1S D;  3AN2 C;  4R8P C;  3LJA D;  5FUG B;  3MVD C;  5B32 A;  3AZG C;  5E5A C;  3AZL D;  5B1M A;  2F8N K;  4DRA A;  3AZH D;  1P3I B;  1S32 C;  3X1T A;  4Z66 D;  4KGC D;  4J8V C;  4J8U D;  5CPK B;  1P3L A;  1AOI C;  1M1A C;  5B31 B;  1P3B A;  4YM6 A;  2PYO B;  1HQ3 A;  5CP6 B;  1JFI B;  3UTA C;  1P3P D;  1H3O A;  2NZD A;  2CV5 B;  5B0Z B;  3REH A;  3KUY C;  4WU8 A;  1WWS A;  3WTP E;  5CPI C;  5GT0 D;  3W96 B;  2BYM A;  3R45 A;  2FJ7 B;  5GSU A;  4AWL B;  5AV8 A;  4KUD A;  1P3A A;  5JA4 B;  5B32 C;  3KWQ D;  4UUZ B;  5C3I C;  4J8X D;  3UTB C;  5B33 D;  3B6G B;  1P3K D;  5AV5 B;  1TZY D;  4WNN B;  5AVB A;  3LZ1 B; 
#chains in the Genus database with same CATH topology
 5B24 B;  1M18 D;  5AVC C;  3W99 A;  4J8W B;  3MGR A;  3AZM A;  3AZH B;  4Z2M G;  1P3B C;  3C1B B;  4CAY A;  5JRG A;  1B6W A;  1P3G B;  2F8N B;  5BNV A;  1KX4 A;  3AYW D;  3NQJ A;  3P5J B;  3MNN A;  3KXB D;  5B2I A;  3AFA A;  1P34 A;  2ARO B;  2XD1 A;  5GSU C;  3NQU B;  5BO0 B;  2BYK A;  2BG1 A;  4KUD C;  5AV6 A;  3AV2 D;  1P3A C;  1BH8 B;  5B0Y C;  5G49 A;  2YFV B;  3WAA A;  5DNM B;  3AN2 D;  4R8P D;  4YS3 A;  3MVD D;  3AZG D;  5E5A D;  3VH5 A;  3AZL C;  5AVB C;  2XD5 A;  1S32 D;  3KWQ B;  4J8X B;  3W99 C;  3AZM C;  3EG5 B;  5B33 B;  2Y2M A;  4KHA A;  2ZY5 A;  4J8V D;  3B6F A;  1AOI D;  1TZY B;  5JRG C;  1M19 A;  1M1A D;  3WKJ A;  3B0B A;  3REJ B;  3KUY D;  1KX4 C;  2IO5 B;  3REI C;  1P3P C;  5CPI D;  3WA9 B;  4CSR A;  4ZBJ C;  1KX5 B;  4NE6 A;  3MNN C;  5B2I C;  3AFA C;  3X1V A;  2Y2J A;  5GT0 C;  3AZN A;  3TU4 A;  5B2J C;  5AV6 C;  4G91 C;  2FFF B;  4YS3 C;  5B32 D;  1BH9 B;  3LEL A;  5B1M D;  5B32 G;  2Y2H A;  1P3F A;  4H9P A;  5CHL B;  4DRB A;  3W97 A;  3MGP B;  5GXQ A;  3AV2 B;  4JJN A;  1P3K C;  3X1T D;  1HTA A;  4R8P B;  1EQZ A;  3AZG B;  5E5A B;  5BS7 C;  5B40 A;  1P3L D;  4LD9 A;  3A6N B;  4G92 C;  1M19 C;  1P3B D;  4YM6 D;  2RIQ A;  2NZD D;  3AV1 A;  3FDD A;  4WU8 D;  5AY8 A;  1U35 A;  2JSS A;  3X1V C;  3AZE A;  4XZQ A;  2NQB C;  3WTP C;  2G5H C;  2RVQ C;  3UTA B;  3AYW C;  3O62 A;  5BNX B;  4Z2M H;  5GSU D;  5AV8 D;  2HIO B;  3KUY B;  1F66 A;  4E44 A;  4KUD D;  4WU9 A;  5CPI B;  5B0Y D;  1P3A D;  4Z5T B;  1KX3 A;  1P3F C;  3KSY A;  5B1L B;  1TAF A;  5GXQ C;  5DNN C;  4EO5 C;  1P3O A;  3VH5 T;  5AVB D;  1EQZ C;  4QLC B;  3UTB B;  1P3M A;  3W99 D;  3LZ0 A;  3MGR D;  3AZM D;  3AZJ A;  4LD9 C;  1ZLA B;  2VQR A;  2ZM5 A;  5AV9 B;  5JRG D;  4H9O B;  3AZF A;  2Y2Q A;  4XUJ A;  3UT9 A;  3AV1 C;  4H9S C;  3AZK B;  2Y2N A;  5AY8 C;  5AVC B;  1U35 C;  3AL0 C;  3X1U A;  1KX4 D;  3REI D;  5FUG A;  3AZE C;  3MNN D;  5B2I D;  3AFA D;  1F66 C;  3W98 B;  5B2J D;  1P3I A;  5AV6 D;  2Y2G A;  3WAA D;  3REL C;  1KX3 C;  4YS3 D;  5KDM B;  1Q9C A;  4H9N B;  3R45 B;  1T3U A;  3MGQ A;  5CPK A;  4HGA C;  5B1M C;  5B31 A;  3VH6 W;  1F1E A;  2PYO A;  5B0Y B;  5CP6 A;  3LZ0 C;  2CV5 A;  4H9Q B;  3X1T C;  3X1S B;  2DF4 C;  2HUE C;  3VH6 T;  3W96 A;  3B6F D;  1M19 D;  3AZL B;  4XUJ C;  3UT9 C;  1P3L C;  2ZY4 A;  4YM6 C;  2FJ7 A;  3X1U C;  1HQ3 C;  2NZD C;  4Z66 B;  2JE5 A;  4KGC B;  3REH C;  4X23 A;  4UUZ A;  4CAY B;  5JRG B;  4WU8 C;  2YFW B;  3X1V D;  4J8U B;  2J8P A;  3B6G A;  2NQB D;  3WTP D;  3KFU G;  2RVQ D;  3A1K A;  5AV5 A;  3B0C W;  4WNN A;  1P3P B;  3REI B;  3LZ1 A;  3LJA A;  5B24 A;  5AV8 C;  4J8W A;  1P3F D;  3AFA B;  3MGQ C;  5GT0 B;  3W97 D;  3B0C T;  5GXQ D;  5DNN D;  5B2J B;  3C1B A;  4JJN D;  1P3G A;  3V9R A;  2F8N A;  1EQZ D;  5B40 D;  4LD9 D;  2UWX A;  2L5A A;  3MGR C;  2Y2K A;  1P3K B;  2ARO A;  4AWL C;  3AV1 D;  3NQU A;  5BO0 A;  5AY8 D;  1U35 D;  1BH8 A;  1N1J B;  4X23 C;  1M18 B;  5DNM A;  1ID3 A;  4ZUX A;  3C1C A;  5CPJ A;  3AZE D;  3B6G C;  5BT1 C;  5GT3 A;  3O62 D;  5AV5 C;  1F66 D;  4NE3 A;  1P34 C;  4WU9 D;  3LZ1 C;  3MGS A;  3REL D;  4J8X A;  1KX3 D;  2ZY2 A;  4J8W C;  4H9R B;  3WAA C;  2NQB B;  3WTP B;  3AYW B;  1P3O D;  1TZY A;  3KXB B;  1P3G C;  1PZR A;  3H0L C;  3LZ0 D;  3AZJ D;  3REJ A;  3AN2 B;  4E45 A;  5GXQ B;  5DNN B;  3WA9 A;  3MVD B;  4EO5 B;  1KX5 A;  3VH6 A;  4XUJ D;  2ARO C;  3UT9 D;  3B6F C;  2ZY3 A;  3WKJ C;  3X1U D;  1HQ3 D;  3REK A;  1S32 B;  3EPJ A;  5DNM C;  1ID3 C;  4ZUX C;  1B67 A;  5F99 A;  3C1C C;  1BH9 A;  3REH D;  5CPJ C;  5GT3 C;  4J8V B;  3AV1 B;  1AOI B;  1A7W A;  3MGP A;  1M1A B;  3AV2 A;  3MGS C;  3AZN C;  3TU4 C;  2Y2L A;  3B0D C;  5E5A A;  3AZI A;  3MGQ D;  3A6N A;  3LEL C;  1F66 B;  2PYO D;  5B31 G;  5CP6 D;  3REL B;  3W97 C;  4JJN C;  2IO5 C;  5B32 B;  3W96 D;  5C3I B;  5B1M B;  5B40 C;  4WJ3 C;  3UTA A;  5BNX A;  2FJ7 D;  3REK C;  2HIO A;  3X1T B;  5CPI A;  4Z5T A;  2HUE B;  5F99 C;  4X23 D;  1W2E A;  5B1L A;  4XUJ B;  3UT9 B;  1P3L B;  3B6G D;  5BT1 D;  1P3B B;  4YM6 B;  5AV5 D;  1HQ3 B;  4XZQ C;  3X1U B;  2NZD B;  1H3O B;  1P34 D;  4WV4 B;  3O62 C;  3LZ1 D;  5B24 D;  4QLC A;  3REH B;  3UTB A;  4WU8 B;  4J8W D;  1WWI A;  3AZI C;  4WU9 C;  2G5I C;  3A6N C;  1ZLA A;  2BYM B;  3C1B D;  5AV9 A;  4H9O A;  1P3G D;  2Y2P A;  2F8N D;  5GSU B;  1P3O C;  2F8N G;  5AV8 B;  3AZK A;  5AVC A;  4KUD B;  1P3A B;  3MGQ B;  1Z2C B;  1JFI A;  1P3M C;  2Y2I A;  4UPK A;  5B0Z A;  4NFT A;  3AZJ C;  2LY8 A;  2ARO D;  3AZF C;  3WKJ D;  2HIO C;  3W98 A;  5AVB B;  4Z5T C;  5DNM D;  4WZS B;  1ID3 D;  3AZM B;  4NE5 A;  5B1L C;  5KDM A;  4ZUX D;  5CPJ D;  3MGR B;  3C1C D;  4H9N A;  5GT3 D;  5JA4 A;  2Y2O A;  5B0Y A;  4QLC C;  3MGS D;  4X23 B;  3AZN D;  3TU4 D;  1P3I C;  5BNV B;  4H9Q A;  1KX4 B;  3X1S A;  1ZLA C;  2DQN C;  3NQJ B;  4ZBJ B;  5AV9 C;  3LEL D;  4M6B A;  3AZL A;  3MNN B;  5B2I B;  1P34 B;  3AZH A;  5CPK C;  3AZK C;  2BYK B;  5B31 C;  5AV6 B;  2PYO C;  4G91 B;  3REJ D;  5G49 B;  2W8S A;  5CP6 C;  3WAA B;  4Z66 A;  3WA9 D;  2CV5 C;  4KGC A;  5B0Z C;  4YS3 B;  1KX5 D;  2CWE A;  2YFW A;  3V9R B;  4J8U A;  3W96 C;  3W98 C;  3REK D;  1P3P A;  3REI A;  2FJ7 C;  5F99 D;  3IP4 C;  4KHA B;  5GT0 A;  3B6F B;  2YFV A;  4G92 B;  1M19 B;  3MGP D;  3WKJ B;  5B2J A;  3H0M C;  4XZQ D;  1ID3 B;  4ZUX B;  3C1C B;  5CPJ B;  3X1S C;  3AZI D;  5GT3 B;  4CSR B;  3LJA C;  5B24 C;  3KWQ A;  3A6N D;  3X1V B;  3AZH C;  3MGS B;  5B33 A;  1P3K A;  3AZN B;  3TU4 B;  3C1B C;  3B0D B;  5BS7 A;  4Z66 C;  4KGC C;  1N1J A;  3LJA B;  3LEL B;  1P3M D;  1M18 A;  3W99 B;  1P3F B;  4H9P B;  2F2A C;  4J8U C;  3UTA D;  3W97 B;  1ULY A;  4JJN B;  3AZF D;  2HIO D;  4DQY B;  4Z5T D;  1EQZ B;  5B40 B;  5B1L D;  2F8N H;  4H9R A;  1BFM A;  4LD9 B;  2NQB A;  3WTP A;  3AYW A;  3REK B;  3KXB A;  4QLC D;  5F99 B;  3UTB D;  3F6T A;  1P3I D;  5AY8 B;  1U35 B;  3KWQ C;  2JCH A;  4J8X C;  1ZLA D;  3AN2 A;  4R8P A;  5DNN A;  1KU5 A;  3MVD A;  3AZG A;  5AV9 D;  4XZQ B;  5B33 C;  3AZE B;  1R4V A;  3O62 B;  5CPK D;  1TZY C;  3AZK D;  5B31 D;  5AVC D;  3AZI B;  4WU9 B;  1S32 A;  1M18 C;  1KX3 B;  2CV5 D;  5B0Z D;  3REJ C;  1TAF B;  3WA9 C;  4J8V A;  4HGA B;  1P3O B;  1M1A A;  4H9S A;  1KX5 C;  1AOI A;  3W98 D;  1P3M B;  3LZ0 B;  3AZJ B;  3KUY A;  3AZF B;  3KXB C;  3VH5 W;  3REL A;  3MGP C;  3AV2 C;  3X1S D;  3AN2 C;  4R8P C;  3LJA D;  5FUG B;  3MVD C;  5B32 A;  3AZG C;  3EPH A;  5E5A C;  3AZL D;  5B1M A;  2F8N K;  4DRA A;  3AZH D;  1P3I B;  1S32 C;  3X1T A;  4Z66 D;  4KGC D;  3A1I A;  4J8V C;  4J8U D;  3H0R C;  5CPK B;  1P3L A;  1AOI C;  1M1A C;  5B31 B;  1P3B A;  4YM6 A;  2PYO B;  1HQ3 A;  5CP6 B;  1JFI B;  3UTA C;  1P3P D;  1H3O A;  2NZD A;  2CV5 B;  5B0Z B;  3REH A;  3KUY C;  4WU8 A;  1WWS A;  3WTP E;  5CPI C;  5GT0 D;  3W96 B;  2BYM A;  3R45 A;  2FJ7 B;  3EPL A;  5GSU A;  4AWL B;  5AV8 A;  4KUD A;  1P3A A;  5JA4 B;  5B32 C;  3KWQ D;  4UUZ B;  5C3I C;  4J8X D;  3EPK A;  3UTB C;  5B33 D;  3B6G B;  1P3K D;  5AV5 B;  1TZY D;  4WNN B;  5AVB A;  3LZ1 B; 
#chains in the Genus database with same CATH homology
 5B24 B;  1M18 D;  5AVC C;  3W99 A;  4J8W B;  3MGR A;  3AZM A;  3AZH B;  4Z2M G;  1P3B C;  3C1B B;  4CAY A;  5JRG A;  1B6W A;  1P3G B;  2F8N B;  5BNV A;  1KX4 A;  3AYW D;  3NQJ A;  3P5J B;  3MNN A;  3KXB D;  5B2I A;  3AFA A;  1P34 A;  2ARO B;  2XD1 A;  5GSU C;  3NQU B;  5BO0 B;  2BYK A;  2BG1 A;  4KUD C;  5AV6 A;  3AV2 D;  1P3A C;  1BH8 B;  5B0Y C;  5G49 A;  2YFV B;  3WAA A;  5DNM B;  3AN2 D;  4R8P D;  4YS3 A;  3MVD D;  3AZG D;  5E5A D;  3VH5 A;  3AZL C;  5AVB C;  2XD5 A;  1S32 D;  3KWQ B;  4J8X B;  3W99 C;  3AZM C;  3EG5 B;  5B33 B;  2Y2M A;  4KHA A;  2ZY5 A;  4J8V D;  3B6F A;  1AOI D;  1TZY B;  5JRG C;  1M19 A;  1M1A D;  3WKJ A;  3B0B A;  3REJ B;  3KUY D;  1KX4 C;  2IO5 B;  3REI C;  1P3P C;  5CPI D;  3WA9 B;  4CSR A;  4ZBJ C;  1KX5 B;  4NE6 A;  3MNN C;  5B2I C;  3AFA C;  3X1V A;  2Y2J A;  5GT0 C;  3AZN A;  3TU4 A;  5B2J C;  5AV6 C;  4G91 C;  2FFF B;  4YS3 C;  5B32 D;  1BH9 B;  3LEL A;  5B1M D;  5B32 G;  2Y2H A;  1P3F A;  4H9P A;  5CHL B;  4DRB A;  3W97 A;  3MGP B;  5GXQ A;  3AV2 B;  4JJN A;  1P3K C;  3X1T D;  1HTA A;  4R8P B;  1EQZ A;  3AZG B;  5E5A B;  5BS7 C;  5B40 A;  1P3L D;  4LD9 A;  3A6N B;  4G92 C;  1M19 C;  1P3B D;  4YM6 D;  2RIQ A;  2NZD D;  3AV1 A;  3FDD A;  4WU8 D;  5AY8 A;  1U35 A;  2JSS A;  3X1V C;  3AZE A;  4XZQ A;  2NQB C;  3WTP C;  2G5H C;  2RVQ C;  3UTA B;  3AYW C;  3O62 A;  5BNX B;  4Z2M H;  5GSU D;  5AV8 D;  2HIO B;  3KUY B;  1F66 A;  4E44 A;  4KUD D;  4WU9 A;  5CPI B;  5B0Y D;  1P3A D;  4Z5T B;  1KX3 A;  1P3F C;  3KSY A;  5B1L B;  1TAF A;  5GXQ C;  5DNN C;  4EO5 C;  1P3O A;  3VH5 T;  5AVB D;  1EQZ C;  4QLC B;  3UTB B;  1P3M A;  3W99 D;  3LZ0 A;  3MGR D;  3AZM D;  3AZJ A;  4LD9 C;  1ZLA B;  2VQR A;  2ZM5 A;  5AV9 B;  5JRG D;  4H9O B;  3AZF A;  2Y2Q A;  4XUJ A;  3UT9 A;  3AV1 C;  4H9S C;  3AZK B;  2Y2N A;  5AY8 C;  5AVC B;  1U35 C;  3AL0 C;  3X1U A;  1KX4 D;  3REI D;  5FUG A;  3AZE C;  3MNN D;  5B2I D;  3AFA D;  1F66 C;  3W98 B;  5B2J D;  1P3I A;  5AV6 D;  2Y2G A;  3WAA D;  3REL C;  1KX3 C;  4YS3 D;  5KDM B;  1Q9C A;  4H9N B;  3R45 B;  1T3U A;  3MGQ A;  5CPK A;  4HGA C;  5B1M C;  5B31 A;  3VH6 W;  1F1E A;  2PYO A;  5B0Y B;  5CP6 A;  3LZ0 C;  2CV5 A;  4H9Q B;  3X1T C;  3X1S B;  2DF4 C;  2HUE C;  3VH6 T;  3W96 A;  3B6F D;  1M19 D;  3AZL B;  4XUJ C;  3UT9 C;  1P3L C;  2ZY4 A;  4YM6 C;  2FJ7 A;  3X1U C;  1HQ3 C;  2NZD C;  4Z66 B;  2JE5 A;  4KGC B;  3REH C;  4X23 A;  4UUZ A;  4CAY B;  5JRG B;  4WU8 C;  2YFW B;  3X1V D;  4J8U B;  2J8P A;  3B6G A;  2NQB D;  3WTP D;  3KFU G;  2RVQ D;  3A1K A;  5AV5 A;  3B0C W;  4WNN A;  1P3P B;  3REI B;  3LZ1 A;  3LJA A;  5B24 A;  5AV8 C;  4J8W A;  1P3F D;  3AFA B;  3MGQ C;  5GT0 B;  3W97 D;  3B0C T;  5GXQ D;  5DNN D;  5B2J B;  3C1B A;  4JJN D;  1P3G A;  3V9R A;  2F8N A;  1EQZ D;  5B40 D;  4LD9 D;  2UWX A;  2L5A A;  3MGR C;  2Y2K A;  1P3K B;  2ARO A;  4AWL C;  3AV1 D;  3NQU A;  5BO0 A;  5AY8 D;  1U35 D;  1BH8 A;  1N1J B;  4X23 C;  1M18 B;  5DNM A;  1ID3 A;  4ZUX A;  3C1C A;  5CPJ A;  3AZE D;  3B6G C;  5BT1 C;  5GT3 A;  3O62 D;  5AV5 C;  1F66 D;  4NE3 A;  1P34 C;  4WU9 D;  3LZ1 C;  3MGS A;  3REL D;  4J8X A;  1KX3 D;  2ZY2 A;  4J8W C;  4H9R B;  3WAA C;  2NQB B;  3WTP B;  3AYW B;  1P3O D;  1TZY A;  3KXB B;  1P3G C;  1PZR A;  3H0L C;  3LZ0 D;  3AZJ D;  3REJ A;  3AN2 B;  4E45 A;  5GXQ B;  5DNN B;  3WA9 A;  3MVD B;  4EO5 B;  1KX5 A;  3VH6 A;  4XUJ D;  2ARO C;  3UT9 D;  3B6F C;  2ZY3 A;  3WKJ C;  3X1U D;  1HQ3 D;  3REK A;  1S32 B;  3EPJ A;  5DNM C;  1ID3 C;  4ZUX C;  1B67 A;  5F99 A;  3C1C C;  1BH9 A;  3REH D;  5CPJ C;  5GT3 C;  4J8V B;  3AV1 B;  1AOI B;  1A7W A;  3MGP A;  1M1A B;  3AV2 A;  3MGS C;  3AZN C;  3TU4 C;  2Y2L A;  3B0D C;  5E5A A;  3AZI A;  3MGQ D;  3A6N A;  3LEL C;  1F66 B;  2PYO D;  5B31 G;  5CP6 D;  3REL B;  3W97 C;  4JJN C;  2IO5 C;  5B32 B;  3W96 D;  5C3I B;  5B1M B;  5B40 C;  4WJ3 C;  3UTA A;  5BNX A;  2FJ7 D;  3REK C;  2HIO A;  3X1T B;  5CPI A;  4Z5T A;  2HUE B;  5F99 C;  4X23 D;  1W2E A;  5B1L A;  4XUJ B;  3UT9 B;  1P3L B;  3B6G D;  5BT1 D;  1P3B B;  4YM6 B;  5AV5 D;  1HQ3 B;  4XZQ C;  3X1U B;  2NZD B;  1H3O B;  1P34 D;  4WV4 B;  3O62 C;  3LZ1 D;  5B24 D;  4QLC A;  3REH B;  3UTB A;  4WU8 B;  4J8W D;  1WWI A;  3AZI C;  4WU9 C;  2G5I C;  3A6N C;  1ZLA A;  2BYM B;  3C1B D;  5AV9 A;  4H9O A;  1P3G D;  2Y2P A;  2F8N D;  5GSU B;  1P3O C;  2F8N G;  5AV8 B;  3AZK A;  5AVC A;  4KUD B;  1P3A B;  3MGQ B;  1Z2C B;  1JFI A;  1P3M C;  2Y2I A;  4UPK A;  5B0Z A;  4NFT A;  3AZJ C;  2LY8 A;  2ARO D;  3AZF C;  3WKJ D;  2HIO C;  3W98 A;  5AVB B;  4Z5T C;  5DNM D;  4WZS B;  1ID3 D;  3AZM B;  4NE5 A;  5B1L C;  5KDM A;  4ZUX D;  5CPJ D;  3MGR B;  3C1C D;  4H9N A;  5GT3 D;  5JA4 A;  2Y2O A;  5B0Y A;  4QLC C;  3MGS D;  4X23 B;  3AZN D;  3TU4 D;  1P3I C;  5BNV B;  4H9Q A;  1KX4 B;  3X1S A;  1ZLA C;  2DQN C;  3NQJ B;  4ZBJ B;  5AV9 C;  3LEL D;  4M6B A;  3AZL A;  3MNN B;  5B2I B;  1P34 B;  3AZH A;  5CPK C;  3AZK C;  2BYK B;  5B31 C;  5AV6 B;  2PYO C;  4G91 B;  3REJ D;  5G49 B;  2W8S A;  5CP6 C;  3WAA B;  4Z66 A;  3WA9 D;  2CV5 C;  4KGC A;  5B0Z C;  4YS3 B;  1KX5 D;  2CWE A;  2YFW A;  3V9R B;  4J8U A;  3W96 C;  3W98 C;  3REK D;  1P3P A;  3REI A;  2FJ7 C;  5F99 D;  3IP4 C;  4KHA B;  5GT0 A;  3B6F B;  2YFV A;  4G92 B;  1M19 B;  3MGP D;  3WKJ B;  5B2J A;  3H0M C;  4XZQ D;  1ID3 B;  4ZUX B;  3C1C B;  5CPJ B;  3X1S C;  3AZI D;  5GT3 B;  4CSR B;  3LJA C;  5B24 C;  3KWQ A;  3A6N D;  3X1V B;  3AZH C;  3MGS B;  5B33 A;  1P3K A;  3AZN B;  3TU4 B;  3C1B C;  3B0D B;  5BS7 A;  4Z66 C;  4KGC C;  1N1J A;  3LJA B;  3LEL B;  1P3M D;  1M18 A;  3W99 B;  1P3F B;  4H9P B;  2F2A C;  4J8U C;  3UTA D;  3W97 B;  1ULY A;  4JJN B;  3AZF D;  2HIO D;  4DQY B;  4Z5T D;  1EQZ B;  5B40 B;  5B1L D;  2F8N H;  4H9R A;  1BFM A;  4LD9 B;  2NQB A;  3WTP A;  3AYW A;  3REK B;  3KXB A;  4QLC D;  5F99 B;  3UTB D;  3F6T A;  1P3I D;  5AY8 B;  1U35 B;  3KWQ C;  2JCH A;  4J8X C;  1ZLA D;  3AN2 A;  4R8P A;  5DNN A;  1KU5 A;  3MVD A;  3AZG A;  5AV9 D;  4XZQ B;  5B33 C;  3AZE B;  1R4V A;  3O62 B;  5CPK D;  1TZY C;  3AZK D;  5B31 D;  5AVC D;  3AZI B;  4WU9 B;  1S32 A;  1M18 C;  1KX3 B;  2CV5 D;  5B0Z D;  3REJ C;  1TAF B;  3WA9 C;  4J8V A;  4HGA B;  1P3O B;  1M1A A;  4H9S A;  1KX5 C;  1AOI A;  3W98 D;  1P3M B;  3LZ0 B;  3AZJ B;  3KUY A;  3AZF B;  3KXB C;  3VH5 W;  3REL A;  3MGP C;  3AV2 C;  3X1S D;  3AN2 C;  4R8P C;  3LJA D;  5FUG B;  3MVD C;  5B32 A;  3AZG C;  3EPH A;  5E5A C;  3AZL D;  5B1M A;  2F8N K;  4DRA A;  3AZH D;  1P3I B;  1S32 C;  3X1T A;  4Z66 D;  4KGC D;  3A1I A;  4J8V C;  4J8U D;  3H0R C;  5CPK B;  1P3L A;  1AOI C;  1M1A C;  5B31 B;  1P3B A;  4YM6 A;  2PYO B;  1HQ3 A;  5CP6 B;  1JFI B;  3UTA C;  1P3P D;  1H3O A;  2NZD A;  2CV5 B;  5B0Z B;  3REH A;  3KUY C;  4WU8 A;  1WWS A;  3WTP E;  5CPI C;  5GT0 D;  3W96 B;  2BYM A;  3R45 A;  2FJ7 B;  3EPL A;  5GSU A;  4AWL B;  5AV8 A;  4KUD A;  1P3A A;  5JA4 B;  5B32 C;  3KWQ D;  4UUZ B;  5C3I C;  4J8X D;  3EPK A;  3UTB C;  5B33 D;  3B6G B;  1P3K D;  5AV5 B;  1TZY D;  4WNN B;  5AVB A;  3LZ1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...