3A6NC

The nucleosome containing a testis-specific histone variant, human h3t
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1t
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3a6nC00
1P3AB 3NQUA 5B32D 1P3AD 4WU8C 5B40A 2HIOD 4KGCC 2IO5C 4M6BA 3VH5T 3R45A 4Z5TB 1HQ3D 3AZHB 3UTAC 1BH9A 4Z5TD 3AZHD 4LD9C 5CP6A 5B0YA 1ZLAB 2AROC 3WA9B 3LZ1D 5AVCC 3AZFA 5BT1D 3WA9D 3W96C 2NQBA 3UTBC 5B1LC 5CPJD 2BYKA 4UUZB 3LJAB 5AY8D 3O62D 4ZBJC 3LJAD 3REHC 3AZIC 5B2JA 3AZEC 5BO0B 5DNNB 4WU8D 1BH8B 4HGAB 3AFAC 5AVBA 3AZNB 1F66A 3AZND 3B0CW 2FJ7C 1U35A 4H9OA 3REKC 3UTAD 3AZKA 2CV5C 4R8PB 4Z66B 4R8PD 5AVCD 3C1CC 1JFIA 4H9RA 3W96D 3UTBD 1P34B 5B1LD 3VH6A 1EQZB 1H3OB 1P3AA 3WTPC 2F8NH 4J8VB 5B24A 2HIOA 4KHAA 5B0ZC 4J8VD 3A6NA 3C1BC 4J8WB 1HQ3A 3AFAD 4J8WD 4YS3C 3AZHA 2FJ7D 5AV8C 5F99C 3LZ1A 1P3BB 3WAAB 4YM6C 5B31C 2HUEB 1P3BD 1KX5A 5CPJA 1P3GA 1M19D 5AY8A 4WV4B 3O62A 3LELC 4WZSB 4ZUXB 3RELB 2PYOB 3KUYD 1P3PC 1S32B 3RELD 1TZYB 4WU8A 5BO0A 1M1AB 1P3FC 2PYOD 4KGCA 1BH8A 3LZ0B 3C1BD 1M1AD 5GT3C 3LZ0D 3UTAA 4NFTA 5B0YC 2NZDC 1P3LB 3B0DB 2AROA 4R8PA 5AVCA 5DNMC 3MGPB 4Z2MH 3W96A 3MGPD 5CPIC 3UTBA 1ID3B 5B1LA 1AOIB 3AV2B 1H3OA 3AV2D 3VH5W 3X1UB 3AN2B 4EO5B 3X1UD 3AZEA 5FUGA 3AN2D 3B0BA 3AFAA 5AV5C 3KXBB 4NE5A 2FJ7A 3KXBD 3V9RA 1KX4B 4J8XB 1KX4D 5DNMD 5CPKC 3KWQC 4E45A 2RVQD 1M19A 1P3OB 5B32C 1P3AC 5GSUD 2BYMB 1P3OD 3TU4D 5GXQB 3WTPA 2HIOC 3KUYA 5GXQD 4H9PA 2PYOA 3AZLB 3C1BA 3REIB 4Z5TC 3AZHC 5AV5D 3X1VB 4YS3A 3MNNB 5BT1C 1ZLAC 3WA9C 1ULYA 1P3MB 4YM6A 1N1JA 5B31A 3B6GB 3KWQD 3B6GD 4G91B 3LJAC 4H9NA 3LELA 1TAFA 5JA4A 5AV9B 5JRGB 1F1EA 1P3PA 4WNNB 5DNNC 5AV6B 4HGAC 3AZNC 1P3FA 5AV6D 3VH5A 5GT3A 1M18B 5BNXB 1M18D 2NZDA 4R8PC 3MGRB 1ZLAD 4Z66C 5DNMA 3W97B 5CPIA 5BNVA 5GSUA 1P3OA 4CAYB 3X1SB 4XUJB 3X1TB 3TU4A 3X1SD 4XUJD 4QLCB 3X1TD 3W98B 4J8VC 5GXQA 3W98D 5DNND 4J8WC 5BS7C 5AV5A 3REJB 5G49B 3MGSB 2YFWB 3MGSD 1P3BC 3WKJB 3AYWB 4Z66D 2HUEC 3NQJB 5CPKA 3KWQA 1M19C 4WU9B 5B32A 1P34D 1EQZD 5C3IB 3KUYC 3W99B 4ZUXC 3RELC 4KUDB 2PYOC 1KX3B 3W99D 1S32C 1TZYC 2IO5B 1M1AC 1KX3D 2F8NG 4WNNA 5AV6A 1R4VA 3LZ0C 4Z5TA 4LD9B 3B0DC 3WA9A 4XZQB 1ZLAA 2F8NB 4XZQD 3MGPC 1P3IB 3WAAD 1P3ID 4X23B 1ID3C 4X23D 2LY8A 1AOIC 3AV2C 4UUZA 3LJAA 3X1UC 4J8UB 4CSRB 3AN2C 4ZUXD 4J8UD 1S32D 1TZYD 5DNNA 1P3KB 5B2IB 4AWLB 3AZNA 3AV1B 3KXBC 5B2ID 3AV1D 5B33B 5GT0B 2CV5B 5B33D 5GT0D 2YFWA 3B6FB 4DRBA 1P3LD 3MGQB 1KX4C 4J8XC 4Z66A 3MGQD 3UT9B 3UT9D 2RVQC 5GSUC 1P3OC 1ID3D 4G92B 1P34A 3MVDB 3TU4C 1AOID 1EQZA 5GXQC 5KDMB 3W99A 4J8VA 3AZLC 1KX3A 3REIC 4J8WA 5BS7A 3X1VC 5AV8B 3MNNC 5F99B 4XZQA 1P3MC 5E5AB 1P3BA 3WAAA 4J8XD 1A7WA 3B6GC 3NQUB 4G91C 1B6WA 1BFMA 3AZGB 5AV9C 5JRGC 5B40B 4ZUXA 3RELA 3AZGD 4CSRA 1S32A 1TZYA 5AV6C 1M1AA 3R45B 3AZLD 1BH9B 2YFVB 3LZ0A 3REID 1M18C 5CP6B 3X1VD 3AZFB 5GT0A 5CP6D 3MNND 1P3LA 2NQBB 4H9SC 3MGPA 1P3MD 3W97C 1ID3A 1AOIA 3X1SC 3AV2A 4XUJC 3X1TC 1Q9CA 5B2JB 3W98C 4QLCC 3X1UA 5AV9D 3AN2A 5JRGD 3AZJB 5AVBB 1F66B 3AZJD 5AVBD 1F66D 2CWEA 1U35B 4H9OB 3REJC 3KXBA 3AZKB 4H9QB 1U35D 3MGSC 1KU5A 4H9RB 1KX4A 3MGRD 3AYWC 3WKJC 4J8XA 4JJNB 4JJND 3W97D 4WU9C 1P34C 1EQZC 2BYMA 5C3IC 5B24B 2HIOB 4KHAB 3W99C 4KUDC 3AZGA 4QLCD 5B24D 3A6NB 1KX3C 3A6ND 3AZLA 5B1MB 1HQ3B 5B1MD 3REIA 2YFVA 3X1VA 3LZ1B 3REJD 3MNNA 4XZQC 3AZMB 3WAAC 1P3IC 3AZMD 1P3MA 4NE6A 3AYWD 1KX5B 3WKJD 4X23C 1KX5D 5CPJB 1P3GB 3B6GA 5AY8B 3O62B 1P3GD 4WU9D 4J8UC 5AV9A 4WU8B 5JRGA 4KUDD 4KGCB 3AZJA 1P3KC 4KGCD 5B2IC 4AWLC 3AV1C 3UTAB 5B33C 5GT0C 1M18A 5BNXA 4H9QA 1P3LC 2AROB 4LD9D 5AVCB 3B6FC 2AROD 3MGQC 3MGRA 3W96B 3UT9C 1WWIA 2F8ND 4H9SA 3UTBB 4JJNA 3W97A 2JSSA 3VH6T 5B1LB 4G92C 4ZBJB 3MVDC 3WTPE 4CAYA 3X1SA 3REHB 4XUJA 3X1TA 3AZIB 3AZEB 3REHD 3W98A 5FUGB 4QLCA 4EO5C 3AZID 3AZED 3AFAB 5B1MA 1P3KD 2FJ7B 3REJA 3REKB 3V9RB 5G49A 3MGSA 3REKD 2CV5D 3C1CB 3B6FD 5E5AC 3AZMA 3C1CD 3AYWA 3WKJA 4DRAA 1M19B 3NQJA 4Z2MG 4WU9A 3MVDD 3WTPB 3KUYB 3AZGC 3WTPD 4H9PB 5B40C 4KUDA 5B0ZB 3C1BB 1WWSA 5B0ZD 5B31G 4YS3B 5CP6C 4YS3D 4LD9A 3AZFC 5AV8D 5F99D 3B0CT 2NQBC 2F8NA 4YM6B 1N1JB 5B31B 4YM6D 5B31D 5E5AD 1P3IA 4X23A 4H9NB 3LELB 1TAFB 5JA4B 3LELD 2L5AA 5B2JC 3REHA 1B67A 3AZIA 4J8UA 1P3PB 5B40D 3AZJC 1P3FB 5AVBC 1P3PD 1F66C 1P3FD 1P3KA 5GT3B 5B2IA 3AV1A 1U35C 5GT3D 3AZKC 5B0YB 2NZDB 5B33A 3REKA 2CV5A 5B0YD 2NZDD 3MGRC 3AZFD 2F8NK 5DNMB 3B6FA 3MGQA 3C1CA 2NQBD 3UT9A 4JJNC 5CPIB 5CPID 5BNVB 2BYKB 5GSUB 1HTAA 1P3GC 4NE3A 3TU4B 3MVDA 4E44A 5B24C 5B2JD 3A6NC 5KDMA 5B0ZA 5B1MC 1HQ3C 5AV5B 3LZ1C 3AZKD 5AV8A 5B32G 5F99A 1JFIB 3VH6W 3AZMC 5E5AA 5CPKB 3KSYA 3KWQB 1KX5C 5CHLB 5CPKD 5CPJC 5AY8C 3O62C 5B32B
chains in the Genus database with same CATH superfamily
1P3AB 3NQUA 5B32D 1P3AD 3EPJA 3A1IA 4WU8C 5B40A 2HIOD 4KGCC 2IO5C 4M6BA 3VH5T 3R45A 4Z5TB 1HQ3D 3AZHB 3UTAC 1BH9A 4Z5TD 3AZHD 4LD9C 5CP6A 5B0YA 1ZLAB 2AROC 3WA9B 3LZ1D 5AVCC 3AZFA 5BT1D 3WA9D 4WJ3C 3W96C 2NQBA 3UTBC 5B1LC 2Y2HA 2BYKA 4UUZB 5CPJD 5AY8D 3O62D 4ZBJC 3LJAB 3LJAD 3REHC 2ZY5A 3AZIC 5B2JA 3AZEC 5BO0B 5DNNB 4WU8D 1BH8B 4HGAB 3AFAC 5AVBA 3AZNB 1F66A 3AZND 3B0CW 2FJ7C 1U35A 4H9OA 3REKC 3UTAD 3AZKA 2CV5C 4R8PB 4Z66B 4R8PD 5AVCD 3C1CC 1JFIA 4H9RA 2JE5A 2ZY4A 3W96D 3UTBD 1P34B 5B1LD 3VH6A 1EQZB 1H3OB 1P3AA 3WTPC 2F8NH 4J8VB 5B24A 2HIOA 4KHAA 5B0ZC 4J8VD 3A6NA 3C1BC 4J8WB 1HQ3A 3AFAD 4J8WD 4YS3C 3AZHA 2JCHA 2FJ7D 5AV8C 5F99C 3LZ1A 1P3BB 3WAAB 4YM6C 5B31C 2HUEB 1P3BD 1KX5A 5CPJA 1P3GA 1M19D 5AY8A 4WV4B 3O62A 3LELC 4WZSB 4ZUXB 3RELB 2PYOB 3KUYD 1P3PC 1S32B 3RELD 1TZYB 4WU8A 5BO0A 1M1AB 1P3FC 2PYOD 4KGCA 1BH8A 3LZ0B 3C1BD 1M1AD 5GT3C 3LZ0D 3UTAA 4NFTA 5B0YC 2NZDC 1P3LB 3B0DB 2AROA 2Y2QA 5AVCA 4R8PA 5DNMC 3MGPB 2XD1A 4Z2MH 3W96A 3MGPD 2Y2OA 5CPIC 3UTBA 1ID3B 2Y2IA 5B1LA 1AOIB 3AV2B 1H3OA 3AV2D 3VH5W 3X1UB 3AN2B 4EO5B 3X1UD 3AZEA 5FUGA 3AN2D 3B0BA 3AFAA 5AV5C 3H0RC 3KXBB 4NE5A 2FJ7A 3KXBD 3V9RA 1KX4B 2UWXA 4J8XB 1KX4D 2W8SA 5DNMD 5CPKC 3KWQC 4E45A 3H0MC 2RVQD 1M19A 1P3OB 5B32C 1P3AC 5GSUD 2BYMB 2VQRA 2Y2PA 1P3OD 3TU4D 5GXQB 3WTPA 2HIOC 3KUYA 5GXQD 4H9PA 2PYOA 3AZLB 3C1BA 3REIB 4Z5TC 3AZHC 5AV5D 3X1VB 4YS3A 3MNNB 5BT1C 1ZLAC 3WA9C 1ULYA 1P3MB 2ZY2A 4YM6A 1N1JA 5B31A 3B6GB 3KWQD 3B6GD 4G91B 3LJAC 4H9NA 3LELA 1TAFA 5JA4A 5AV9B 5JRGB 1F1EA 1P3PA 4WNNB 5DNNC 5AV6B 4HGAC 3AZNC 1P3FA 5AV6D 3VH5A 5GT3A 1M18B 5BNXB 1M18D 2NZDA 4R8PC 3MGRB 1ZLAD 2ZM5A 4Z66C 5DNMA 3W97B 5CPIA 5BNVA 5GSUA 3EG5B 1P3OA 4CAYB 3X1SB 4XUJB 3X1TB 3TU4A 3X1SD 4XUJD 4QLCB 3X1TD 3W98B 4J8VC 5GXQA 3W98D 3F6TA 5DNND 4J8WC 5BS7C 5AV5A 2G5HC 3REJB 5G49B 1PZRA 3MGSB 2YFWB 3MGSD 1P3BC 3WKJB 3AYWB 4Z66D 2HUEC 2DQNC 3IP4C 3NQJB 3P5JB 3KWQA 5CPKA 1M19C 4WU9B 5B32A 1P34D 1EQZD 5C3IB 3KUYC 3W99B 4ZUXC 3RELC 4KUDB 2PYOC 1KX3B 3W99D 1S32C 1TZYC 2XD5A 2IO5B 1M1AC 1KX3D 2F8NG 4WNNA 5AV6A 1R4VA 3LZ0C 4Z5TA 4LD9B 3B0DC 3WA9A 4XZQB 1ZLAA 2F8NB 4XZQD 3MGPC 1Z2CB 1P3IB 3WAAD 1P3ID 4X23B 1T3UA 1ID3C 4X23D 2LY8A 1AOIC 3AV2C 4UUZA 3LJAA 3X1UC 4J8UB 4CSRB 3AN2C 4ZUXD 4J8UD 2ZY3A 1S32D 1TZYD 5DNNA 1P3KB 5B2IB 4AWLB 3AZNA 3AV1B 3KXBC 5B2ID 3AV1D 5B33B 5GT0B 2CV5B 5B33D 5GT0D 2YFWA 3B6FB 4DRBA 1P3LD 3MGQB 1KX4C 4J8XC 4Z66A 3MGQD 3UT9B 3UT9D 2RVQC 5GSUC 1P3OC 1ID3D 4G92B 1P34A 3MVDB 3TU4C 1AOID 1EQZA 5GXQC 5KDMB 3W99A 4J8VA 3AZLC 1KX3A 3REIC 4J8WA 5BS7A 3X1VC 5AV8B 3MNNC 5F99B 2Y2NA 4XZQA 1P3MC 5E5AB 1P3BA 3WAAA 4J8XD 1A7WA 3EPLA 3B6GC 4UPKA 3NQUB 4G91C 1B6WA 1BFMA 3AZGB 5AV9C 5JRGC 5B40B 4ZUXA 3RELA 3AZGD 4CSRA 1S32A 1TZYA 5AV6C 1M1AA 3R45B 3AZLD 1BH9B 2YFVB 3LZ0A 3REID 3EPKA 1M18C 5CP6B 3X1VD 3AZFB 5GT0A 5CP6D 3MNND 1P3LA 2Y2GA 2NQBB 4H9SC 3MGPA 1P3MD 2G5IC 3W97C 1ID3A 3FDDA 2FFFB 2BG1A 1AOIA 3X1SC 3AV2A 4XUJC 3X1TC 1Q9CA 5B2JB 3W98C 4QLCC 3X1UA 5AV9D 3AN2A 5JRGD 3AZJB 5AVBB 1F66B 3AZJD 5AVBD 1F66D 2CWEA 1U35B 4H9OB 3REJC 3KXBA 3AZKB 4H9QB 1U35D 3MGSC 1KU5A 4H9RB 1KX4A 3MGRD 3AYWC 3WKJC 4J8XA 4JJNB 4JJND 3W97D 4WU9C 1P34C 3H0LC 1EQZC 2BYMA 5C3IC 5B24B 2HIOB 2Y2LA 4KHAB 3W99C 3AZGA 4KUDC 4QLCD 5B24D 3A6NB 1KX3C 3A6ND 3AZLA 5B1MB 1HQ3B 5B1MD 3AL0C 3REIA 2YFVA 3X1VA 3LZ1B 3REJD 3MNNA 4XZQC 3AZMB 3WAAC 1P3IC 3AZMD 1P3MA 4NE6A 3AYWD 1KX5B 3WKJD 4X23C 1KX5D 5CPJB 1P3GB 3B6GA 5AY8B 3O62B 1P3GD 4WU9D 4J8UC 5AV9A 4WU8B 5JRGA 4KUDD 4KGCB 3AZJA 1P3KC 4KGCD 5B2IC 4AWLC 3AV1C 3UTAB 5B33C 5GT0C 1M18A 5BNXA 4H9QA 1P3LC 2AROB 4LD9D 5AVCB 3B6FC 2AROD 3MGQC 3MGRA 3W96B 3UT9C 1WWIA 2F8ND 4H9SA 3UTBB 4JJNA 2F2AC 3W97A 2JSSA 3VH6T 5B1LB 4G92C 4ZBJB 3MVDC 3WTPE 4CAYA 3X1SA 3REHB 4XUJA 3X1TA 3AZIB 3AZEB 3REHD 3W98A 5FUGB 4QLCA 4EO5C 3AZID 3AZED 3AFAB 5B1MA 1P3KD 2FJ7B 1W2EA 3REJA 3REKB 3V9RB 5G49A 3MGSA 3REKD 2CV5D 3C1CB 3B6FD 5E5AC 3AZMA 3C1CD 3AYWA 3WKJA 4DRAA 1M19B 3NQJA 2DF4C 4Z2MG 4WU9A 3MVDD 3WTPB 3KUYB 3AZGC 3WTPD 4H9PB 5B40C 4KUDA 5B0ZB 3C1BB 1WWSA 5B0ZD 5B31G 4YS3B 5CP6C 4YS3D 4LD9A 3AZFC 5AV8D 5F99D 3B0CT 2NQBC 2F8NA 4YM6B 1N1JB 5B31B 4YM6D 5B31D 5E5AD 1P3IA 2J8PA 4X23A 2Y2KA 4H9NB 3LELB 1TAFB 5JA4B 3LELD 4DQYB 2L5AA 5B2JC 3REHA 1B67A 3AZIA 4J8UA 1P3PB 5B40D 3AZJC 1P3FB 5AVBC 1P3PD 1F66C 1P3FD 1P3KA 3A1KA 5GT3B 5B2IA 3AV1A 1U35C 5GT3D 3AZKC 5B0YB 2NZDB 5B33A 3REKA 2CV5A 5B0YD 2NZDD 3MGRC 3AZFD 2F8NK 5DNMB 3B6FA 3MGQA 3C1CA 2NQBD 3UT9A 4JJNC 5CPIB 3KFUG 2RIQA 5CPID 5BNVB 2BYKB 5GSUB 1HTAA 1P3GC 4NE3A 3TU4B 3EPHA 3MVDA 4E44A 5B24C 5B2JD 3A6NC 5KDMA 5B0ZA 5B1MC 1HQ3C 5AV5B 2Y2JA 3LZ1C 3AZKD 5AV8A 5B32G 5F99A 1JFIB 3VH6W 2Y2MA 3AZMC 5E5AA 5CPKB 3KSYA 3KWQB 1KX5C 5CHLB 5CPKD 5CPJC 5AY8C 3O62C 5B32B
chains in the Genus database with same CATH topology
1P3AB 3NQUA 5B32D 1P3AD 3EPJA 3A1IA 4WU8C 5B40A 2HIOD 4KGCC 2IO5C 4M6BA 3VH5T 3R45A 4Z5TB 1HQ3D 3AZHB 3UTAC 1BH9A 4Z5TD 3AZHD 4LD9C 5CP6A 5B0YA 1ZLAB 2AROC 3WA9B 3LZ1D 5AVCC 3AZFA 5BT1D 3WA9D 4WJ3C 3W96C 2NQBA 3UTBC 5B1LC 2Y2HA 2BYKA 4UUZB 5CPJD 5AY8D 3O62D 4ZBJC 3LJAB 3LJAD 3REHC 2ZY5A 3AZIC 5B2JA 3AZEC 5BO0B 5DNNB 4WU8D 1BH8B 4HGAB 3AFAC 5AVBA 3AZNB 1F66A 3AZND 3B0CW 2FJ7C 1U35A 4H9OA 3REKC 3UTAD 3AZKA 2CV5C 4R8PB 4Z66B 4R8PD 5AVCD 3C1CC 1JFIA 4H9RA 2JE5A 2ZY4A 3W96D 3UTBD 1P34B 5B1LD 3VH6A 1EQZB 1H3OB 1P3AA 3WTPC 2F8NH 4J8VB 5B24A 2HIOA 4KHAA 5B0ZC 4J8VD 3A6NA 3C1BC 4J8WB 1HQ3A 3AFAD 4J8WD 4YS3C 3AZHA 2JCHA 2FJ7D 5AV8C 5F99C 3LZ1A 1P3BB 3WAAB 4YM6C 5B31C 2HUEB 1P3BD 1KX5A 5CPJA 1P3GA 1M19D 5AY8A 4WV4B 3O62A 3LELC 4WZSB 4ZUXB 3RELB 2PYOB 3KUYD 1P3PC 1S32B 3RELD 1TZYB 4WU8A 5BO0A 1M1AB 1P3FC 2PYOD 4KGCA 1BH8A 3LZ0B 3C1BD 1M1AD 5GT3C 3LZ0D 3UTAA 4NFTA 5B0YC 2NZDC 1P3LB 3B0DB 2AROA 2Y2QA 5AVCA 4R8PA 5DNMC 3MGPB 2XD1A 4Z2MH 3W96A 3MGPD 2Y2OA 5CPIC 3UTBA 1ID3B 2Y2IA 5B1LA 1AOIB 3AV2B 1H3OA 3AV2D 3VH5W 3X1UB 3AN2B 4EO5B 3X1UD 3AZEA 5FUGA 3AN2D 3B0BA 3AFAA 5AV5C 3H0RC 3KXBB 4NE5A 2FJ7A 3KXBD 3V9RA 1KX4B 2UWXA 4J8XB 1KX4D 2W8SA 5DNMD 5CPKC 3KWQC 4E45A 3H0MC 2RVQD 1M19A 1P3OB 5B32C 1P3AC 5GSUD 2BYMB 2VQRA 2Y2PA 1P3OD 3TU4D 5GXQB 3WTPA 2HIOC 3KUYA 5GXQD 4H9PA 2PYOA 3AZLB 3C1BA 3REIB 4Z5TC 3AZHC 5AV5D 3X1VB 4YS3A 3MNNB 5BT1C 1ZLAC 3WA9C 1ULYA 1P3MB 2ZY2A 4YM6A 1N1JA 5B31A 3B6GB 3KWQD 3B6GD 4G91B 3LJAC 4H9NA 3LELA 1TAFA 5JA4A 5AV9B 5JRGB 1F1EA 1P3PA 4WNNB 5DNNC 5AV6B 4HGAC 3AZNC 1P3FA 5AV6D 3VH5A 5GT3A 1M18B 5BNXB 1M18D 2NZDA 4R8PC 3MGRB 1ZLAD 2ZM5A 4Z66C 5DNMA 3W97B 5CPIA 5BNVA 5GSUA 3EG5B 1P3OA 4CAYB 3X1SB 4XUJB 3X1TB 3TU4A 3X1SD 4XUJD 4QLCB 3X1TD 3W98B 4J8VC 5GXQA 3W98D 3F6TA 5DNND 4J8WC 5BS7C 5AV5A 2G5HC 3REJB 5G49B 1PZRA 3MGSB 2YFWB 3MGSD 1P3BC 3WKJB 3AYWB 4Z66D 2HUEC 2DQNC 3IP4C 3NQJB 3P5JB 3KWQA 5CPKA 1M19C 4WU9B 5B32A 1P34D 1EQZD 5C3IB 3KUYC 3W99B 4ZUXC 3RELC 4KUDB 2PYOC 1KX3B 3W99D 1S32C 1TZYC 2XD5A 2IO5B 1M1AC 1KX3D 2F8NG 4WNNA 5AV6A 1R4VA 3LZ0C 4Z5TA 4LD9B 3B0DC 3WA9A 4XZQB 1ZLAA 2F8NB 4XZQD 3MGPC 1Z2CB 1P3IB 3WAAD 1P3ID 4X23B 1T3UA 1ID3C 4X23D 2LY8A 1AOIC 3AV2C 4UUZA 3LJAA 3X1UC 4J8UB 4CSRB 3AN2C 4ZUXD 4J8UD 2ZY3A 1S32D 1TZYD 5DNNA 1P3KB 5B2IB 4AWLB 3AZNA 3AV1B 3KXBC 5B2ID 3AV1D 5B33B 5GT0B 2CV5B 5B33D 5GT0D 2YFWA 3B6FB 4DRBA 1P3LD 3MGQB 1KX4C 4J8XC 4Z66A 3MGQD 3UT9B 3UT9D 2RVQC 5GSUC 1P3OC 1ID3D 4G92B 1P34A 3MVDB 3TU4C 1AOID 1EQZA 5GXQC 5KDMB 3W99A 4J8VA 3AZLC 1KX3A 3REIC 4J8WA 5BS7A 3X1VC 5AV8B 3MNNC 5F99B 2Y2NA 4XZQA 1P3MC 5E5AB 1P3BA 3WAAA 4J8XD 1A7WA 3EPLA 3B6GC 4UPKA 3NQUB 4G91C 1B6WA 1BFMA 3AZGB 5AV9C 5JRGC 5B40B 4ZUXA 3RELA 3AZGD 4CSRA 1S32A 1TZYA 5AV6C 1M1AA 3R45B 3AZLD 1BH9B 2YFVB 3LZ0A 3REID 3EPKA 1M18C 5CP6B 3X1VD 3AZFB 5GT0A 5CP6D 3MNND 1P3LA 2Y2GA 2NQBB 4H9SC 3MGPA 1P3MD 2G5IC 3W97C 1ID3A 3FDDA 2FFFB 2BG1A 1AOIA 3X1SC 3AV2A 4XUJC 3X1TC 1Q9CA 5B2JB 3W98C 4QLCC 3X1UA 5AV9D 3AN2A 5JRGD 3AZJB 5AVBB 1F66B 3AZJD 5AVBD 1F66D 2CWEA 1U35B 4H9OB 3REJC 3KXBA 3AZKB 4H9QB 1U35D 3MGSC 1KU5A 4H9RB 1KX4A 3MGRD 3AYWC 3WKJC 4J8XA 4JJNB 4JJND 3W97D 4WU9C 1P34C 3H0LC 1EQZC 2BYMA 5C3IC 5B24B 2HIOB 2Y2LA 4KHAB 3W99C 3AZGA 4KUDC 4QLCD 5B24D 3A6NB 1KX3C 3A6ND 3AZLA 5B1MB 1HQ3B 5B1MD 3AL0C 3REIA 2YFVA 3X1VA 3LZ1B 3REJD 3MNNA 4XZQC 3AZMB 3WAAC 1P3IC 3AZMD 1P3MA 4NE6A 3AYWD 1KX5B 3WKJD 4X23C 1KX5D 5CPJB 1P3GB 3B6GA 5AY8B 3O62B 1P3GD 4WU9D 4J8UC 5AV9A 4WU8B 5JRGA 4KUDD 4KGCB 3AZJA 1P3KC 4KGCD 5B2IC 4AWLC 3AV1C 3UTAB 5B33C 5GT0C 1M18A 5BNXA 4H9QA 1P3LC 2AROB 4LD9D 5AVCB 3B6FC 2AROD 3MGQC 3MGRA 3W96B 3UT9C 1WWIA 2F8ND 4H9SA 3UTBB 4JJNA 2F2AC 3W97A 2JSSA 3VH6T 5B1LB 4G92C 4ZBJB 3MVDC 3WTPE 4CAYA 3X1SA 3REHB 4XUJA 3X1TA 3AZIB 3AZEB 3REHD 3W98A 5FUGB 4QLCA 4EO5C 3AZID 3AZED 3AFAB 5B1MA 1P3KD 2FJ7B 1W2EA 3REJA 3REKB 3V9RB 5G49A 3MGSA 3REKD 2CV5D 3C1CB 3B6FD 5E5AC 3AZMA 3C1CD 3AYWA 3WKJA 4DRAA 1M19B 3NQJA 2DF4C 4Z2MG 4WU9A 3MVDD 3WTPB 3KUYB 3AZGC 3WTPD 4H9PB 5B40C 4KUDA 5B0ZB 3C1BB 1WWSA 5B0ZD 5B31G 4YS3B 5CP6C 4YS3D 4LD9A 3AZFC 5AV8D 5F99D 3B0CT 2NQBC 2F8NA 4YM6B 1N1JB 5B31B 4YM6D 5B31D 5E5AD 1P3IA 2J8PA 4X23A 2Y2KA 4H9NB 3LELB 1TAFB 5JA4B 3LELD 4DQYB 2L5AA 5B2JC 3REHA 1B67A 3AZIA 4J8UA 1P3PB 5B40D 3AZJC 1P3FB 5AVBC 1P3PD 1F66C 1P3FD 1P3KA 3A1KA 5GT3B 5B2IA 3AV1A 1U35C 5GT3D 3AZKC 5B0YB 2NZDB 5B33A 3REKA 2CV5A 5B0YD 2NZDD 3MGRC 3AZFD 2F8NK 5DNMB 3B6FA 3MGQA 3C1CA 2NQBD 3UT9A 4JJNC 5CPIB 3KFUG 2RIQA 5CPID 5BNVB 2BYKB 5GSUB 1HTAA 1P3GC 4NE3A 3TU4B 3EPHA 3MVDA 4E44A 5B24C 5B2JD 3A6NC 5KDMA 5B0ZA 5B1MC 1HQ3C 5AV5B 2Y2JA 3LZ1C 3AZKD 5AV8A 5B32G 5F99A 1JFIB 3VH6W 2Y2MA 3AZMC 5E5AA 5CPKB 3KSYA 3KWQB 1KX5C 5CHLB 5CPKD 5CPJC 5AY8C 3O62C 5B32B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3A B;  3NQU A;  5B32 D;  1P3A D;  4WU8 C;  5B40 A;  2HIO D;  4KGC C;  2IO5 C;  4M6B A;  3VH5 T;  3R45 A;  4Z5T B;  1HQ3 D;  3AZH B;  3UTA C;  1BH9 A;  4Z5T D;  3AZH D;  4LD9 C;  5CP6 A;  5B0Y A;  1ZLA B;  2ARO C;  3WA9 B;  3LZ1 D;  5AVC C;  3AZF A;  5BT1 D;  3WA9 D;  3W96 C;  2NQB A;  3UTB C;  5B1L C;  5CPJ D;  2BYK A;  4UUZ B;  3LJA B;  5AY8 D;  3O62 D;  4ZBJ C;  3LJA D;  3REH C;  3AZI C;  5B2J A;  3AZE C;  5BO0 B;  5DNN B;  4WU8 D;  1BH8 B;  4HGA B;  3AFA C;  5AVB A;  3AZN B;  1F66 A;  3AZN D;  3B0C W;  2FJ7 C;  1U35 A;  4H9O A;  3REK C;  3UTA D;  3AZK A;  2CV5 C;  4R8P B;  4Z66 B;  4R8P D;  5AVC D;  3C1C C;  1JFI A;  4H9R A;  3W96 D;  3UTB D;  1P34 B;  5B1L D;  3VH6 A;  1EQZ B;  1H3O B;  1P3A A;  3WTP C;  2F8N H;  4J8V B;  5B24 A;  2HIO A;  4KHA A;  5B0Z C;  4J8V D;  3A6N A;  3C1B C;  4J8W B;  1HQ3 A;  3AFA D;  4J8W D;  4YS3 C;  3AZH A;  2FJ7 D;  5AV8 C;  5F99 C;  3LZ1 A;  1P3B B;  3WAA B;  4YM6 C;  5B31 C;  2HUE B;  1P3B D;  1KX5 A;  5CPJ A;  1P3G A;  1M19 D;  5AY8 A;  4WV4 B;  3O62 A;  3LEL C;  4WZS B;  4ZUX B;  3REL B;  2PYO B;  3KUY D;  1P3P C;  1S32 B;  3REL D;  1TZY B;  4WU8 A;  5BO0 A;  1M1A B;  1P3F C;  2PYO D;  4KGC A;  1BH8 A;  3LZ0 B;  3C1B D;  1M1A D;  5GT3 C;  3LZ0 D;  3UTA A;  4NFT A;  5B0Y C;  2NZD C;  1P3L B;  3B0D B;  2ARO A;  4R8P A;  5AVC A;  5DNM C;  3MGP B;  4Z2M H;  3W96 A;  3MGP D;  5CPI C;  3UTB A;  1ID3 B;  5B1L A;  1AOI B;  3AV2 B;  1H3O A;  3AV2 D;  3VH5 W;  3X1U B;  3AN2 B;  4EO5 B;  3X1U D;  3AZE A;  5FUG A;  3AN2 D;  3B0B A;  3AFA A;  5AV5 C;  3KXB B;  4NE5 A;  2FJ7 A;  3KXB D;  3V9R A;  1KX4 B;  4J8X B;  1KX4 D;  5DNM D;  5CPK C;  3KWQ C;  4E45 A;  2RVQ D;  1M19 A;  1P3O B;  5B32 C;  1P3A C;  5GSU D;  2BYM B;  1P3O D;  3TU4 D;  5GXQ B;  3WTP A;  2HIO C;  3KUY A;  5GXQ D;  4H9P A;  2PYO A;  3AZL B;  3C1B A;  3REI B;  4Z5T C;  3AZH C;  5AV5 D;  3X1V B;  4YS3 A;  3MNN B;  5BT1 C;  1ZLA C;  3WA9 C;  1ULY A;  1P3M B;  4YM6 A;  1N1J A;  5B31 A;  3B6G B;  3KWQ D;  3B6G D;  4G91 B;  3LJA C;  4H9N A;  3LEL A;  1TAF A;  5JA4 A;  5AV9 B;  5JRG B;  1F1E A;  1P3P A;  4WNN B;  5DNN C;  5AV6 B;  4HGA C;  3AZN C;  1P3F A;  5AV6 D;  3VH5 A;  5GT3 A;  1M18 B;  5BNX B;  1M18 D;  2NZD A;  4R8P C;  3MGR B;  1ZLA D;  4Z66 C;  5DNM A;  3W97 B;  5CPI A;  5BNV A;  5GSU A;  1P3O A;  4CAY B;  3X1S B;  4XUJ B;  3X1T B;  3TU4 A;  3X1S D;  4XUJ D;  4QLC B;  3X1T D;  3W98 B;  4J8V C;  5GXQ A;  3W98 D;  5DNN D;  4J8W C;  5BS7 C;  5AV5 A;  3REJ B;  5G49 B;  3MGS B;  2YFW B;  3MGS D;  1P3B C;  3WKJ B;  3AYW B;  4Z66 D;  2HUE C;  3NQJ B;  5CPK A;  3KWQ A;  1M19 C;  4WU9 B;  5B32 A;  1P34 D;  1EQZ D;  5C3I B;  3KUY C;  3W99 B;  4ZUX C;  3REL C;  4KUD B;  2PYO C;  1KX3 B;  3W99 D;  1S32 C;  1TZY C;  2IO5 B;  1M1A C;  1KX3 D;  2F8N G;  4WNN A;  5AV6 A;  1R4V A;  3LZ0 C;  4Z5T A;  4LD9 B;  3B0D C;  3WA9 A;  4XZQ B;  1ZLA A;  2F8N B;  4XZQ D;  3MGP C;  1P3I B;  3WAA D;  1P3I D;  4X23 B;  1ID3 C;  4X23 D;  2LY8 A;  1AOI C;  3AV2 C;  4UUZ A;  3LJA A;  3X1U C;  4J8U B;  4CSR B;  3AN2 C;  4ZUX D;  4J8U D;  1S32 D;  1TZY D;  5DNN A;  1P3K B;  5B2I B;  4AWL B;  3AZN A;  3AV1 B;  3KXB C;  5B2I D;  3AV1 D;  5B33 B;  5GT0 B;  2CV5 B;  5B33 D;  5GT0 D;  2YFW A;  3B6F B;  4DRB A;  1P3L D;  3MGQ B;  1KX4 C;  4J8X C;  4Z66 A;  3MGQ D;  3UT9 B;  3UT9 D;  2RVQ C;  5GSU C;  1P3O C;  1ID3 D;  4G92 B;  1P34 A;  3MVD B;  3TU4 C;  1AOI D;  1EQZ A;  5GXQ C;  5KDM B;  3W99 A;  4J8V A;  3AZL C;  1KX3 A;  3REI C;  4J8W A;  5BS7 A;  3X1V C;  5AV8 B;  3MNN C;  5F99 B;  4XZQ A;  1P3M C;  5E5A B;  1P3B A;  3WAA A;  4J8X D;  1A7W A;  3B6G C;  3NQU B;  4G91 C;  1B6W A;  1BFM A;  3AZG B;  5AV9 C;  5JRG C;  5B40 B;  4ZUX A;  3REL A;  3AZG D;  4CSR A;  1S32 A;  1TZY A;  5AV6 C;  1M1A A;  3R45 B;  3AZL D;  1BH9 B;  2YFV B;  3LZ0 A;  3REI D;  1M18 C;  5CP6 B;  3X1V D;  3AZF B;  5GT0 A;  5CP6 D;  3MNN D;  1P3L A;  2NQB B;  4H9S C;  3MGP A;  1P3M D;  3W97 C;  1ID3 A;  1AOI A;  3X1S C;  3AV2 A;  4XUJ C;  3X1T C;  1Q9C A;  5B2J B;  3W98 C;  4QLC C;  3X1U A;  5AV9 D;  3AN2 A;  5JRG D;  3AZJ B;  5AVB B;  1F66 B;  3AZJ D;  5AVB D;  1F66 D;  2CWE A;  1U35 B;  4H9O B;  3REJ C;  3KXB A;  3AZK B;  4H9Q B;  1U35 D;  3MGS C;  1KU5 A;  4H9R B;  1KX4 A;  3MGR D;  3AYW C;  3WKJ C;  4J8X A;  4JJN B;  4JJN D;  3W97 D;  4WU9 C;  1P34 C;  1EQZ C;  2BYM A;  5C3I C;  5B24 B;  2HIO B;  4KHA B;  3W99 C;  4KUD C;  3AZG A;  4QLC D;  5B24 D;  3A6N B;  1KX3 C;  3A6N D;  3AZL A;  5B1M B;  1HQ3 B;  5B1M D;  3REI A;  2YFV A;  3X1V A;  3LZ1 B;  3REJ D;  3MNN A;  4XZQ C;  3AZM B;  3WAA C;  1P3I C;  3AZM D;  1P3M A;  4NE6 A;  3AYW D;  1KX5 B;  3WKJ D;  4X23 C;  1KX5 D;  5CPJ B;  1P3G B;  3B6G A;  5AY8 B;  3O62 B;  1P3G D;  4WU9 D;  4J8U C;  5AV9 A;  4WU8 B;  5JRG A;  4KUD D;  4KGC B;  3AZJ A;  1P3K C;  4KGC D;  5B2I C;  4AWL C;  3AV1 C;  3UTA B;  5B33 C;  5GT0 C;  1M18 A;  5BNX A;  4H9Q A;  1P3L C;  2ARO B;  4LD9 D;  5AVC B;  3B6F C;  2ARO D;  3MGQ C;  3MGR A;  3W96 B;  3UT9 C;  1WWI A;  2F8N D;  4H9S A;  3UTB B;  4JJN A;  3W97 A;  2JSS A;  3VH6 T;  5B1L B;  4G92 C;  4ZBJ B;  3MVD C;  3WTP E;  4CAY A;  3X1S A;  3REH B;  4XUJ A;  3X1T A;  3AZI B;  3AZE B;  3REH D;  3W98 A;  5FUG B;  4QLC A;  4EO5 C;  3AZI D;  3AZE D;  3AFA B;  5B1M A;  1P3K D;  2FJ7 B;  3REJ A;  3REK B;  3V9R B;  5G49 A;  3MGS A;  3REK D;  2CV5 D;  3C1C B;  3B6F D;  5E5A C;  3AZM A;  3C1C D;  3AYW A;  3WKJ A;  4DRA A;  1M19 B;  3NQJ A;  4Z2M G;  4WU9 A;  3MVD D;  3WTP B;  3KUY B;  3AZG C;  3WTP D;  4H9P B;  5B40 C;  4KUD A;  5B0Z B;  3C1B B;  1WWS A;  5B0Z D;  5B31 G;  4YS3 B;  5CP6 C;  4YS3 D;  4LD9 A;  3AZF C;  5AV8 D;  5F99 D;  3B0C T;  2NQB C;  2F8N A;  4YM6 B;  1N1J B;  5B31 B;  4YM6 D;  5B31 D;  5E5A D;  1P3I A;  4X23 A;  4H9N B;  3LEL B;  1TAF B;  5JA4 B;  3LEL D;  2L5A A;  5B2J C;  3REH A;  1B67 A;  3AZI A;  4J8U A;  1P3P B;  5B40 D;  3AZJ C;  1P3F B;  5AVB C;  1P3P D;  1F66 C;  1P3F D;  1P3K A;  5GT3 B;  5B2I A;  3AV1 A;  1U35 C;  5GT3 D;  3AZK C;  5B0Y B;  2NZD B;  5B33 A;  3REK A;  2CV5 A;  5B0Y D;  2NZD D;  3MGR C;  3AZF D;  2F8N K;  5DNM B;  3B6F A;  3MGQ A;  3C1C A;  2NQB D;  3UT9 A;  4JJN C;  5CPI B;  5CPI D;  5BNV B;  2BYK B;  5GSU B;  1HTA A;  1P3G C;  4NE3 A;  3TU4 B;  3MVD A;  4E44 A;  5B24 C;  5B2J D;  3A6N C;  5KDM A;  5B0Z A;  5B1M C;  1HQ3 C;  5AV5 B;  3LZ1 C;  3AZK D;  5AV8 A;  5B32 G;  5F99 A;  1JFI B;  3VH6 W;  3AZM C;  5E5A A;  5CPK B;  3KSY A;  3KWQ B;  1KX5 C;  5CHL B;  5CPK D;  5CPJ C;  5AY8 C;  3O62 C;  5B32 B; 
#chains in the Genus database with same CATH topology
 1P3A B;  3NQU A;  5B32 D;  1P3A D;  3EPJ A;  3A1I A;  4WU8 C;  5B40 A;  2HIO D;  4KGC C;  2IO5 C;  4M6B A;  3VH5 T;  3R45 A;  4Z5T B;  1HQ3 D;  3AZH B;  3UTA C;  1BH9 A;  4Z5T D;  3AZH D;  4LD9 C;  5CP6 A;  5B0Y A;  1ZLA B;  2ARO C;  3WA9 B;  3LZ1 D;  5AVC C;  3AZF A;  5BT1 D;  3WA9 D;  4WJ3 C;  3W96 C;  2NQB A;  3UTB C;  5B1L C;  2Y2H A;  2BYK A;  4UUZ B;  5CPJ D;  5AY8 D;  3O62 D;  4ZBJ C;  3LJA B;  3LJA D;  3REH C;  2ZY5 A;  3AZI C;  5B2J A;  3AZE C;  5BO0 B;  5DNN B;  4WU8 D;  1BH8 B;  4HGA B;  3AFA C;  5AVB A;  3AZN B;  1F66 A;  3AZN D;  3B0C W;  2FJ7 C;  1U35 A;  4H9O A;  3REK C;  3UTA D;  3AZK A;  2CV5 C;  4R8P B;  4Z66 B;  4R8P D;  5AVC D;  3C1C C;  1JFI A;  4H9R A;  2JE5 A;  2ZY4 A;  3W96 D;  3UTB D;  1P34 B;  5B1L D;  3VH6 A;  1EQZ B;  1H3O B;  1P3A A;  3WTP C;  2F8N H;  4J8V B;  5B24 A;  2HIO A;  4KHA A;  5B0Z C;  4J8V D;  3A6N A;  3C1B C;  4J8W B;  1HQ3 A;  3AFA D;  4J8W D;  4YS3 C;  3AZH A;  2JCH A;  2FJ7 D;  5AV8 C;  5F99 C;  3LZ1 A;  1P3B B;  3WAA B;  4YM6 C;  5B31 C;  2HUE B;  1P3B D;  1KX5 A;  5CPJ A;  1P3G A;  1M19 D;  5AY8 A;  4WV4 B;  3O62 A;  3LEL C;  4WZS B;  4ZUX B;  3REL B;  2PYO B;  3KUY D;  1P3P C;  1S32 B;  3REL D;  1TZY B;  4WU8 A;  5BO0 A;  1M1A B;  1P3F C;  2PYO D;  4KGC A;  1BH8 A;  3LZ0 B;  3C1B D;  1M1A D;  5GT3 C;  3LZ0 D;  3UTA A;  4NFT A;  5B0Y C;  2NZD C;  1P3L B;  3B0D B;  2ARO A;  2Y2Q A;  5AVC A;  4R8P A;  5DNM C;  3MGP B;  2XD1 A;  4Z2M H;  3W96 A;  3MGP D;  2Y2O A;  5CPI C;  3UTB A;  1ID3 B;  2Y2I A;  5B1L A;  1AOI B;  3AV2 B;  1H3O A;  3AV2 D;  3VH5 W;  3X1U B;  3AN2 B;  4EO5 B;  3X1U D;  3AZE A;  5FUG A;  3AN2 D;  3B0B A;  3AFA A;  5AV5 C;  3H0R C;  3KXB B;  4NE5 A;  2FJ7 A;  3KXB D;  3V9R A;  1KX4 B;  2UWX A;  4J8X B;  1KX4 D;  2W8S A;  5DNM D;  5CPK C;  3KWQ C;  4E45 A;  3H0M C;  2RVQ D;  1M19 A;  1P3O B;  5B32 C;  1P3A C;  5GSU D;  2BYM B;  2VQR A;  2Y2P A;  1P3O D;  3TU4 D;  5GXQ B;  3WTP A;  2HIO C;  3KUY A;  5GXQ D;  4H9P A;  2PYO A;  3AZL B;  3C1B A;  3REI B;  4Z5T C;  3AZH C;  5AV5 D;  3X1V B;  4YS3 A;  3MNN B;  5BT1 C;  1ZLA C;  3WA9 C;  1ULY A;  1P3M B;  2ZY2 A;  4YM6 A;  1N1J A;  5B31 A;  3B6G B;  3KWQ D;  3B6G D;  4G91 B;  3LJA C;  4H9N A;  3LEL A;  1TAF A;  5JA4 A;  5AV9 B;  5JRG B;  1F1E A;  1P3P A;  4WNN B;  5DNN C;  5AV6 B;  4HGA C;  3AZN C;  1P3F A;  5AV6 D;  3VH5 A;  5GT3 A;  1M18 B;  5BNX B;  1M18 D;  2NZD A;  4R8P C;  3MGR B;  1ZLA D;  2ZM5 A;  4Z66 C;  5DNM A;  3W97 B;  5CPI A;  5BNV A;  5GSU A;  3EG5 B;  1P3O A;  4CAY B;  3X1S B;  4XUJ B;  3X1T B;  3TU4 A;  3X1S D;  4XUJ D;  4QLC B;  3X1T D;  3W98 B;  4J8V C;  5GXQ A;  3W98 D;  3F6T A;  5DNN D;  4J8W C;  5BS7 C;  5AV5 A;  2G5H C;  3REJ B;  5G49 B;  1PZR A;  3MGS B;  2YFW B;  3MGS D;  1P3B C;  3WKJ B;  3AYW B;  4Z66 D;  2HUE C;  2DQN C;  3IP4 C;  3NQJ B;  3P5J B;  3KWQ A;  5CPK A;  1M19 C;  4WU9 B;  5B32 A;  1P34 D;  1EQZ D;  5C3I B;  3KUY C;  3W99 B;  4ZUX C;  3REL C;  4KUD B;  2PYO C;  1KX3 B;  3W99 D;  1S32 C;  1TZY C;  2XD5 A;  2IO5 B;  1M1A C;  1KX3 D;  2F8N G;  4WNN A;  5AV6 A;  1R4V A;  3LZ0 C;  4Z5T A;  4LD9 B;  3B0D C;  3WA9 A;  4XZQ B;  1ZLA A;  2F8N B;  4XZQ D;  3MGP C;  1Z2C B;  1P3I B;  3WAA D;  1P3I D;  4X23 B;  1T3U A;  1ID3 C;  4X23 D;  2LY8 A;  1AOI C;  3AV2 C;  4UUZ A;  3LJA A;  3X1U C;  4J8U B;  4CSR B;  3AN2 C;  4ZUX D;  4J8U D;  2ZY3 A;  1S32 D;  1TZY D;  5DNN A;  1P3K B;  5B2I B;  4AWL B;  3AZN A;  3AV1 B;  3KXB C;  5B2I D;  3AV1 D;  5B33 B;  5GT0 B;  2CV5 B;  5B33 D;  5GT0 D;  2YFW A;  3B6F B;  4DRB A;  1P3L D;  3MGQ B;  1KX4 C;  4J8X C;  4Z66 A;  3MGQ D;  3UT9 B;  3UT9 D;  2RVQ C;  5GSU C;  1P3O C;  1ID3 D;  4G92 B;  1P34 A;  3MVD B;  3TU4 C;  1AOI D;  1EQZ A;  5GXQ C;  5KDM B;  3W99 A;  4J8V A;  3AZL C;  1KX3 A;  3REI C;  4J8W A;  5BS7 A;  3X1V C;  5AV8 B;  3MNN C;  5F99 B;  2Y2N A;  4XZQ A;  1P3M C;  5E5A B;  1P3B A;  3WAA A;  4J8X D;  1A7W A;  3EPL A;  3B6G C;  4UPK A;  3NQU B;  4G91 C;  1B6W A;  1BFM A;  3AZG B;  5AV9 C;  5JRG C;  5B40 B;  4ZUX A;  3REL A;  3AZG D;  4CSR A;  1S32 A;  1TZY A;  5AV6 C;  1M1A A;  3R45 B;  3AZL D;  1BH9 B;  2YFV B;  3LZ0 A;  3REI D;  3EPK A;  1M18 C;  5CP6 B;  3X1V D;  3AZF B;  5GT0 A;  5CP6 D;  3MNN D;  1P3L A;  2Y2G A;  2NQB B;  4H9S C;  3MGP A;  1P3M D;  2G5I C;  3W97 C;  1ID3 A;  3FDD A;  2FFF B;  2BG1 A;  1AOI A;  3X1S C;  3AV2 A;  4XUJ C;  3X1T C;  1Q9C A;  5B2J B;  3W98 C;  4QLC C;  3X1U A;  5AV9 D;  3AN2 A;  5JRG D;  3AZJ B;  5AVB B;  1F66 B;  3AZJ D;  5AVB D;  1F66 D;  2CWE A;  1U35 B;  4H9O B;  3REJ C;  3KXB A;  3AZK B;  4H9Q B;  1U35 D;  3MGS C;  1KU5 A;  4H9R B;  1KX4 A;  3MGR D;  3AYW C;  3WKJ C;  4J8X A;  4JJN B;  4JJN D;  3W97 D;  4WU9 C;  1P34 C;  3H0L C;  1EQZ C;  2BYM A;  5C3I C;  5B24 B;  2HIO B;  2Y2L A;  4KHA B;  3W99 C;  3AZG A;  4KUD C;  4QLC D;  5B24 D;  3A6N B;  1KX3 C;  3A6N D;  3AZL A;  5B1M B;  1HQ3 B;  5B1M D;  3AL0 C;  3REI A;  2YFV A;  3X1V A;  3LZ1 B;  3REJ D;  3MNN A;  4XZQ C;  3AZM B;  3WAA C;  1P3I C;  3AZM D;  1P3M A;  4NE6 A;  3AYW D;  1KX5 B;  3WKJ D;  4X23 C;  1KX5 D;  5CPJ B;  1P3G B;  3B6G A;  5AY8 B;  3O62 B;  1P3G D;  4WU9 D;  4J8U C;  5AV9 A;  4WU8 B;  5JRG A;  4KUD D;  4KGC B;  3AZJ A;  1P3K C;  4KGC D;  5B2I C;  4AWL C;  3AV1 C;  3UTA B;  5B33 C;  5GT0 C;  1M18 A;  5BNX A;  4H9Q A;  1P3L C;  2ARO B;  4LD9 D;  5AVC B;  3B6F C;  2ARO D;  3MGQ C;  3MGR A;  3W96 B;  3UT9 C;  1WWI A;  2F8N D;  4H9S A;  3UTB B;  4JJN A;  2F2A C;  3W97 A;  2JSS A;  3VH6 T;  5B1L B;  4G92 C;  4ZBJ B;  3MVD C;  3WTP E;  4CAY A;  3X1S A;  3REH B;  4XUJ A;  3X1T A;  3AZI B;  3AZE B;  3REH D;  3W98 A;  5FUG B;  4QLC A;  4EO5 C;  3AZI D;  3AZE D;  3AFA B;  5B1M A;  1P3K D;  2FJ7 B;  1W2E A;  3REJ A;  3REK B;  3V9R B;  5G49 A;  3MGS A;  3REK D;  2CV5 D;  3C1C B;  3B6F D;  5E5A C;  3AZM A;  3C1C D;  3AYW A;  3WKJ A;  4DRA A;  1M19 B;  3NQJ A;  2DF4 C;  4Z2M G;  4WU9 A;  3MVD D;  3WTP B;  3KUY B;  3AZG C;  3WTP D;  4H9P B;  5B40 C;  4KUD A;  5B0Z B;  3C1B B;  1WWS A;  5B0Z D;  5B31 G;  4YS3 B;  5CP6 C;  4YS3 D;  4LD9 A;  3AZF C;  5AV8 D;  5F99 D;  3B0C T;  2NQB C;  2F8N A;  4YM6 B;  1N1J B;  5B31 B;  4YM6 D;  5B31 D;  5E5A D;  1P3I A;  2J8P A;  4X23 A;  2Y2K A;  4H9N B;  3LEL B;  1TAF B;  5JA4 B;  3LEL D;  4DQY B;  2L5A A;  5B2J C;  3REH A;  1B67 A;  3AZI A;  4J8U A;  1P3P B;  5B40 D;  3AZJ C;  1P3F B;  5AVB C;  1P3P D;  1F66 C;  1P3F D;  1P3K A;  3A1K A;  5GT3 B;  5B2I A;  3AV1 A;  1U35 C;  5GT3 D;  3AZK C;  5B0Y B;  2NZD B;  5B33 A;  3REK A;  2CV5 A;  5B0Y D;  2NZD D;  3MGR C;  3AZF D;  2F8N K;  5DNM B;  3B6F A;  3MGQ A;  3C1C A;  2NQB D;  3UT9 A;  4JJN C;  5CPI B;  3KFU G;  2RIQ A;  5CPI D;  5BNV B;  2BYK B;  5GSU B;  1HTA A;  1P3G C;  4NE3 A;  3TU4 B;  3EPH A;  3MVD A;  4E44 A;  5B24 C;  5B2J D;  3A6N C;  5KDM A;  5B0Z A;  5B1M C;  1HQ3 C;  5AV5 B;  2Y2J A;  3LZ1 C;  3AZK D;  5AV8 A;  5B32 G;  5F99 A;  1JFI B;  3VH6 W;  2Y2M A;  3AZM C;  5E5A A;  5CPK B;  3KSY A;  3KWQ B;  1KX5 C;  5CHL B;  5CPK D;  5CPJ C;  5AY8 C;  3O62 C;  5B32 B; 
#chains in the Genus database with same CATH homology
 1P3A B;  3NQU A;  5B32 D;  1P3A D;  3EPJ A;  3A1I A;  4WU8 C;  5B40 A;  2HIO D;  4KGC C;  2IO5 C;  4M6B A;  3VH5 T;  3R45 A;  4Z5T B;  1HQ3 D;  3AZH B;  3UTA C;  1BH9 A;  4Z5T D;  3AZH D;  4LD9 C;  5CP6 A;  5B0Y A;  1ZLA B;  2ARO C;  3WA9 B;  3LZ1 D;  5AVC C;  3AZF A;  5BT1 D;  3WA9 D;  4WJ3 C;  3W96 C;  2NQB A;  3UTB C;  5B1L C;  2Y2H A;  2BYK A;  4UUZ B;  5CPJ D;  5AY8 D;  3O62 D;  4ZBJ C;  3LJA B;  3LJA D;  3REH C;  2ZY5 A;  3AZI C;  5B2J A;  3AZE C;  5BO0 B;  5DNN B;  4WU8 D;  1BH8 B;  4HGA B;  3AFA C;  5AVB A;  3AZN B;  1F66 A;  3AZN D;  3B0C W;  2FJ7 C;  1U35 A;  4H9O A;  3REK C;  3UTA D;  3AZK A;  2CV5 C;  4R8P B;  4Z66 B;  4R8P D;  5AVC D;  3C1C C;  1JFI A;  4H9R A;  2JE5 A;  2ZY4 A;  3W96 D;  3UTB D;  1P34 B;  5B1L D;  3VH6 A;  1EQZ B;  1H3O B;  1P3A A;  3WTP C;  2F8N H;  4J8V B;  5B24 A;  2HIO A;  4KHA A;  5B0Z C;  4J8V D;  3A6N A;  3C1B C;  4J8W B;  1HQ3 A;  3AFA D;  4J8W D;  4YS3 C;  3AZH A;  2JCH A;  2FJ7 D;  5AV8 C;  5F99 C;  3LZ1 A;  1P3B B;  3WAA B;  4YM6 C;  5B31 C;  2HUE B;  1P3B D;  1KX5 A;  5CPJ A;  1P3G A;  1M19 D;  5AY8 A;  4WV4 B;  3O62 A;  3LEL C;  4WZS B;  4ZUX B;  3REL B;  2PYO B;  3KUY D;  1P3P C;  1S32 B;  3REL D;  1TZY B;  4WU8 A;  5BO0 A;  1M1A B;  1P3F C;  2PYO D;  4KGC A;  1BH8 A;  3LZ0 B;  3C1B D;  1M1A D;  5GT3 C;  3LZ0 D;  3UTA A;  4NFT A;  5B0Y C;  2NZD C;  1P3L B;  3B0D B;  2ARO A;  2Y2Q A;  5AVC A;  4R8P A;  5DNM C;  3MGP B;  2XD1 A;  4Z2M H;  3W96 A;  3MGP D;  2Y2O A;  5CPI C;  3UTB A;  1ID3 B;  2Y2I A;  5B1L A;  1AOI B;  3AV2 B;  1H3O A;  3AV2 D;  3VH5 W;  3X1U B;  3AN2 B;  4EO5 B;  3X1U D;  3AZE A;  5FUG A;  3AN2 D;  3B0B A;  3AFA A;  5AV5 C;  3H0R C;  3KXB B;  4NE5 A;  2FJ7 A;  3KXB D;  3V9R A;  1KX4 B;  2UWX A;  4J8X B;  1KX4 D;  2W8S A;  5DNM D;  5CPK C;  3KWQ C;  4E45 A;  3H0M C;  2RVQ D;  1M19 A;  1P3O B;  5B32 C;  1P3A C;  5GSU D;  2BYM B;  2VQR A;  2Y2P A;  1P3O D;  3TU4 D;  5GXQ B;  3WTP A;  2HIO C;  3KUY A;  5GXQ D;  4H9P A;  2PYO A;  3AZL B;  3C1B A;  3REI B;  4Z5T C;  3AZH C;  5AV5 D;  3X1V B;  4YS3 A;  3MNN B;  5BT1 C;  1ZLA C;  3WA9 C;  1ULY A;  1P3M B;  2ZY2 A;  4YM6 A;  1N1J A;  5B31 A;  3B6G B;  3KWQ D;  3B6G D;  4G91 B;  3LJA C;  4H9N A;  3LEL A;  1TAF A;  5JA4 A;  5AV9 B;  5JRG B;  1F1E A;  1P3P A;  4WNN B;  5DNN C;  5AV6 B;  4HGA C;  3AZN C;  1P3F A;  5AV6 D;  3VH5 A;  5GT3 A;  1M18 B;  5BNX B;  1M18 D;  2NZD A;  4R8P C;  3MGR B;  1ZLA D;  2ZM5 A;  4Z66 C;  5DNM A;  3W97 B;  5CPI A;  5BNV A;  5GSU A;  3EG5 B;  1P3O A;  4CAY B;  3X1S B;  4XUJ B;  3X1T B;  3TU4 A;  3X1S D;  4XUJ D;  4QLC B;  3X1T D;  3W98 B;  4J8V C;  5GXQ A;  3W98 D;  3F6T A;  5DNN D;  4J8W C;  5BS7 C;  5AV5 A;  2G5H C;  3REJ B;  5G49 B;  1PZR A;  3MGS B;  2YFW B;  3MGS D;  1P3B C;  3WKJ B;  3AYW B;  4Z66 D;  2HUE C;  2DQN C;  3IP4 C;  3NQJ B;  3P5J B;  3KWQ A;  5CPK A;  1M19 C;  4WU9 B;  5B32 A;  1P34 D;  1EQZ D;  5C3I B;  3KUY C;  3W99 B;  4ZUX C;  3REL C;  4KUD B;  2PYO C;  1KX3 B;  3W99 D;  1S32 C;  1TZY C;  2XD5 A;  2IO5 B;  1M1A C;  1KX3 D;  2F8N G;  4WNN A;  5AV6 A;  1R4V A;  3LZ0 C;  4Z5T A;  4LD9 B;  3B0D C;  3WA9 A;  4XZQ B;  1ZLA A;  2F8N B;  4XZQ D;  3MGP C;  1Z2C B;  1P3I B;  3WAA D;  1P3I D;  4X23 B;  1T3U A;  1ID3 C;  4X23 D;  2LY8 A;  1AOI C;  3AV2 C;  4UUZ A;  3LJA A;  3X1U C;  4J8U B;  4CSR B;  3AN2 C;  4ZUX D;  4J8U D;  2ZY3 A;  1S32 D;  1TZY D;  5DNN A;  1P3K B;  5B2I B;  4AWL B;  3AZN A;  3AV1 B;  3KXB C;  5B2I D;  3AV1 D;  5B33 B;  5GT0 B;  2CV5 B;  5B33 D;  5GT0 D;  2YFW A;  3B6F B;  4DRB A;  1P3L D;  3MGQ B;  1KX4 C;  4J8X C;  4Z66 A;  3MGQ D;  3UT9 B;  3UT9 D;  2RVQ C;  5GSU C;  1P3O C;  1ID3 D;  4G92 B;  1P34 A;  3MVD B;  3TU4 C;  1AOI D;  1EQZ A;  5GXQ C;  5KDM B;  3W99 A;  4J8V A;  3AZL C;  1KX3 A;  3REI C;  4J8W A;  5BS7 A;  3X1V C;  5AV8 B;  3MNN C;  5F99 B;  2Y2N A;  4XZQ A;  1P3M C;  5E5A B;  1P3B A;  3WAA A;  4J8X D;  1A7W A;  3EPL A;  3B6G C;  4UPK A;  3NQU B;  4G91 C;  1B6W A;  1BFM A;  3AZG B;  5AV9 C;  5JRG C;  5B40 B;  4ZUX A;  3REL A;  3AZG D;  4CSR A;  1S32 A;  1TZY A;  5AV6 C;  1M1A A;  3R45 B;  3AZL D;  1BH9 B;  2YFV B;  3LZ0 A;  3REI D;  3EPK A;  1M18 C;  5CP6 B;  3X1V D;  3AZF B;  5GT0 A;  5CP6 D;  3MNN D;  1P3L A;  2Y2G A;  2NQB B;  4H9S C;  3MGP A;  1P3M D;  2G5I C;  3W97 C;  1ID3 A;  3FDD A;  2FFF B;  2BG1 A;  1AOI A;  3X1S C;  3AV2 A;  4XUJ C;  3X1T C;  1Q9C A;  5B2J B;  3W98 C;  4QLC C;  3X1U A;  5AV9 D;  3AN2 A;  5JRG D;  3AZJ B;  5AVB B;  1F66 B;  3AZJ D;  5AVB D;  1F66 D;  2CWE A;  1U35 B;  4H9O B;  3REJ C;  3KXB A;  3AZK B;  4H9Q B;  1U35 D;  3MGS C;  1KU5 A;  4H9R B;  1KX4 A;  3MGR D;  3AYW C;  3WKJ C;  4J8X A;  4JJN B;  4JJN D;  3W97 D;  4WU9 C;  1P34 C;  3H0L C;  1EQZ C;  2BYM A;  5C3I C;  5B24 B;  2HIO B;  2Y2L A;  4KHA B;  3W99 C;  3AZG A;  4KUD C;  4QLC D;  5B24 D;  3A6N B;  1KX3 C;  3A6N D;  3AZL A;  5B1M B;  1HQ3 B;  5B1M D;  3AL0 C;  3REI A;  2YFV A;  3X1V A;  3LZ1 B;  3REJ D;  3MNN A;  4XZQ C;  3AZM B;  3WAA C;  1P3I C;  3AZM D;  1P3M A;  4NE6 A;  3AYW D;  1KX5 B;  3WKJ D;  4X23 C;  1KX5 D;  5CPJ B;  1P3G B;  3B6G A;  5AY8 B;  3O62 B;  1P3G D;  4WU9 D;  4J8U C;  5AV9 A;  4WU8 B;  5JRG A;  4KUD D;  4KGC B;  3AZJ A;  1P3K C;  4KGC D;  5B2I C;  4AWL C;  3AV1 C;  3UTA B;  5B33 C;  5GT0 C;  1M18 A;  5BNX A;  4H9Q A;  1P3L C;  2ARO B;  4LD9 D;  5AVC B;  3B6F C;  2ARO D;  3MGQ C;  3MGR A;  3W96 B;  3UT9 C;  1WWI A;  2F8N D;  4H9S A;  3UTB B;  4JJN A;  2F2A C;  3W97 A;  2JSS A;  3VH6 T;  5B1L B;  4G92 C;  4ZBJ B;  3MVD C;  3WTP E;  4CAY A;  3X1S A;  3REH B;  4XUJ A;  3X1T A;  3AZI B;  3AZE B;  3REH D;  3W98 A;  5FUG B;  4QLC A;  4EO5 C;  3AZI D;  3AZE D;  3AFA B;  5B1M A;  1P3K D;  2FJ7 B;  1W2E A;  3REJ A;  3REK B;  3V9R B;  5G49 A;  3MGS A;  3REK D;  2CV5 D;  3C1C B;  3B6F D;  5E5A C;  3AZM A;  3C1C D;  3AYW A;  3WKJ A;  4DRA A;  1M19 B;  3NQJ A;  2DF4 C;  4Z2M G;  4WU9 A;  3MVD D;  3WTP B;  3KUY B;  3AZG C;  3WTP D;  4H9P B;  5B40 C;  4KUD A;  5B0Z B;  3C1B B;  1WWS A;  5B0Z D;  5B31 G;  4YS3 B;  5CP6 C;  4YS3 D;  4LD9 A;  3AZF C;  5AV8 D;  5F99 D;  3B0C T;  2NQB C;  2F8N A;  4YM6 B;  1N1J B;  5B31 B;  4YM6 D;  5B31 D;  5E5A D;  1P3I A;  2J8P A;  4X23 A;  2Y2K A;  4H9N B;  3LEL B;  1TAF B;  5JA4 B;  3LEL D;  4DQY B;  2L5A A;  5B2J C;  3REH A;  1B67 A;  3AZI A;  4J8U A;  1P3P B;  5B40 D;  3AZJ C;  1P3F B;  5AVB C;  1P3P D;  1F66 C;  1P3F D;  1P3K A;  3A1K A;  5GT3 B;  5B2I A;  3AV1 A;  1U35 C;  5GT3 D;  3AZK C;  5B0Y B;  2NZD B;  5B33 A;  3REK A;  2CV5 A;  5B0Y D;  2NZD D;  3MGR C;  3AZF D;  2F8N K;  5DNM B;  3B6F A;  3MGQ A;  3C1C A;  2NQB D;  3UT9 A;  4JJN C;  5CPI B;  3KFU G;  2RIQ A;  5CPI D;  5BNV B;  2BYK B;  5GSU B;  1HTA A;  1P3G C;  4NE3 A;  3TU4 B;  3EPH A;  3MVD A;  4E44 A;  5B24 C;  5B2J D;  3A6N C;  5KDM A;  5B0Z A;  5B1M C;  1HQ3 C;  5AV5 B;  2Y2J A;  3LZ1 C;  3AZK D;  5AV8 A;  5B32 G;  5F99 A;  1JFI B;  3VH6 W;  2Y2M A;  3AZM C;  5E5A A;  5CPK B;  3KSY A;  3KWQ B;  1KX5 C;  5CHL B;  5CPK D;  5CPJ C;  5AY8 C;  3O62 C;  5B32 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...