3MVDC

Crystal structure of the chromatin factor rcc1 in complex with the nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/structural protein/dna
molecule keywords Histone H3.2
publication title Structure of RCC1 chromatin factor bound to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mvdC00
5CPJB 5FUGB 3WAAA 3NQJB 4WU8C 3MNNB 3RELC 1KX5C 4WNNB 5AVBA 1P3AA 5AY8A 4G91B 4YS3C 2F8NB 5B0YC 2HIOB 5GT0B 1H3OB 3TU4C 3AV1D 2NZDA 5DNNC 3X1UD 3AZHA 5G49A 5KDMA 3W99B 5B1LB 3MGQD 3AZEC 3LZ0C 2AROB 4WU9C 2HUEB 5AV8D 4WV4B 1P3BB 1KX5D 5BS7C 3AV2A 5BNXB 5JA4A 4XUJA 4YS3D 3MNND 5B0YD 2CV5A 3LJAB 3KXBA 2F8ND 3AZIC 1ULYA 5GT0D 5DNMC 3REHA 3X1SA 3AZJA 5F99B 1KX3A 5B1LD 1B67A 4H9RB 2AROD 5B33A 3V9RA 5AVCB 5B2IA 5JRGA 3AZMB 3B0CW 1P3BD 3KUYC 3B0DB 5GT3D 3UTAC 4J8XC 3LJAD 5DNMD 5CPIA 4KGCA 1P3IB 1P3FD 1P34C 5F99D 3AZNB 1BH8A 5AVCD 5B32B 3AZMD 5C3IB 5AV6C 3AV1A 4UUZA 3LELA 3W98C 1A7WA 1KX5A 2CWEA 3AZND 3NQJA 3UTBC 4YS3A 3VH6A 5B0YA 5AV6D 5DNNA 5GT0A 3LZ0A 2F8NH 3WTPB 5B1LA 4J8WC 5BS7A 1HQ3B 3UTBD 5GT3A 4J8VC 3AFAB 3AZIA 1B6WA 4CSRA 5B31D 1P3OC 1R4VA 5DNMA 4R8PC 1M18B 4NE3A 3B6GB 1P3FA 3WTPD 1TAFB 3KUYA 1HQ3D 1P3MB 1P3PB 3W96B 3UT9C 4XZQD 1P3OD 4CAYB 3AFAD 5B40B 2BYMB 4YM6C 1F66D 3AZLB 1P3LB 3AYWB 3R45B 3VH6T 1P34A 3B6GD 5B32G 3AV2C 5BT1C 4EO5B 4QLCD 1P3MD 3KXBC 1ZLAB 4NFTA 5AV6A 3W96D 4YM6D 3REHC 1P3KB 3REJB 5B40D 4Z5TB 1P3LD 3AYWD 3W98A 5B33C 1P3GC 5JRGC 3REID 5B2JB 1KX4B 1WWIA 3UTBA 4Z66C 5GXQB 1ZLAD 4ZBJB 5B31A 4KGCC 3A6ND 5E5AC 4X23D 3AZKB 4LD9B 2IO5C 3X1VB 5B1MB 3C1CB 3WTPA 1Q9CA 1KX4D 4Z66D 3AZFB 1M1AB 1EQZB 3AV1C 2NQBC 4XZQA 1P3OA 3X1UC 1AOIB 2PYOC 1F66A 3MGQC 4G92C 5AV8C 5B24B 4KHAB 4Z2MG 3AZKD 3B0BA 4LD9D 5BNVB 3X1VD 5B1MD 3C1CD 4KUDB 3MNNC 3WA9B 1TAFA 4QLCA 4G91C 3UT9A 3NQUB 3AZFD 2NQBD 2PYOD 5GT0C 1M1AD 3B6FB 1BH9B 4YM6A 1EQZD 5AV9B 5B0ZB 4Z2MH 1ID3D 1AOID 3MGPB 3W99C 5B1LC 4H9PB 4J8UB 5CPJD 3AN2B 2AROC 5B24D 2LY8A 3REIA 5CP6B 1P3BC 1BFMA 5GT3C 4WU8B 2HIOD 3RELB 3LJAC 3A6NA 2JSSA 5AV9D 3W99D 5B0ZD 4X23A 3X1TB 1P3FC 5F99C 1P3GA 5AVCC 3AZMC 4WU9B 3VH6W 4Z66A 5CPKB 5GSUB 3VH5T 5E5AA 1S32B 3WKJB 3MGSB 4H9NB 3X1TD 3C1BB 1JFIA 3AZNC 3MVDB 4WZSB 1M19B 3AZGB 2NQBA 3X1UA 2PYOA 5C3IC 1N1JB 4ZUXB 5CPKD 5GSUD 2FJ7B 3MGQA 1ID3A 1P3ID 1AOIA 2YFWB 5AV8A 1S32D 3WKJD 5CPJA 5FUGA 3C1BD 3MNNA 4WNNA 5B32D 4JJNB 2F8NA 5B31C 2HIOA 1U35B 1H3OA 1TZYB 3AZGD 3MGRB 2BYKB 4ZUXD 5AV5B 2FJ7D 3W99A 5B0ZA 2AROA 3WTPC 1P3BA 1HQ3C 4HGAB 5BNXA 3KSYA 3LZ1B 2YFVB 4JJND 4M6BA 4XZQC 3KWQB 3LJAA 3AFAC 3O62B 1F66C 1U35D 1TZYD 3MGRD 1M18C 3B6GC 5F99A 4H9RA 5AVCA 3AZMA 3REKB 4QLCC 4J8WB 1P3MC 5BO0B 1P3PC 3LZ1D 3W96C 3KWQD 3O62D 5B40C 5CPKA 1M18D 4J8VB 4H9QB 3AZLC 1P3LC 3AYWC 1P3IA 3REIC 4R8PB 3AZNA 3C1BA 3WAAB 4EO5C 5B32A 1P3PD 5AVBB 1P3AB 1ZLAC 5AY8B 3A6NC 3AZGA 3AZLD 3REJC 2NZDB 4Z5TC 4X23C 3AZHB 5G49B 5KDMB 2RVQC 3B0CT 2YFWA 1HTAA 5B2JC 1KX4C 3AV2B 4JJNA 5JA4B 4XUJB 5AVBD 1P3AD 2CV5B 5AY8D 1P3KD 4ZBJC 3KXBB 3REJD 1TZYA 4Z5TD 5CHLB 2RVQD 3AZKC 3AZHD 4LD9C 3X1SB 3X1VC 5B1MC 5B2JD 3C1CC 1HQ3A 3AZJB 1KX3B 5B2IB 3V9RB 5JRGB 3AZFC 5GXQD 3LZ1A 3AFAA 1M1AC 4DRAA 1EQZC 4XUJD 1AOIC 2CV5D 1ID3C 1M18A 3B6GA 5CPIB 5CPJC 5B24C 3VH5A 3X1SD 3AZJD 1P3MA 4KUDC 1BH8B 2IO5B 4NE6A 3WA9C 1P3PA 2HIOC 3W96A 4CAYA 4AWLB 5B40A 2BYMA 5AV9C 3AZLA 1P3LA 5B0ZC 3AYWA 2F8NK 3R45A 4H9OB 4UUZB 2HUEC 3W97B 4J8UC 5CPID 3AN2C 3LELB 4H9SC 4KUDD 3WA9D 1KX5B 1ZLAA 4YS3B 3B6FD 5B0YB 1P3KA 3TU4B 3REJA 4Z5TA 5DNNB 3MGPD 4J8UD 3AN2D 3X1TC 3AZEB 3LZ0B 4E45A 1KU5A 3W97D 5CP6D 5B2JA 3B0DC 1KX4A 3LELD 4NE5A 4WU8D 3RELD 5GXQA 5GT3B 5CPKC 5GSUC 3AZIB 4CSRB 1P3IC 3TU4D 5DNMB 1S32C 5DNND 3AZKA 3WKJC 4LD9A 3MGSC 3X1VA 5B1MA 3C1CA 3C1BC 3AZED 3LZ0D 5B32C 4WU9D 1P3FB 3AZFA 3KUYB 3MVDC 1M1AA 3UTAB 3AZGC 1EQZA 4J8XB 4ZUXC 2FJ7C 3AZID 3MGSD 5B24A 4KHAA 5BNVA 1P34B 4KUDA 3WA9A 3MVDD 4JJNC 1M19D 3NQUA 3KUYD 1U35C 3B6FA 3UTAD 1BH9A 1TZYC 5AV9A 5AV6B 3MGRC 4J8XD 5AV5C 3MGPA 4H9PA 4J8UA 4H9OA 3AN2A 4H9SA 3W97A 3W98B 5CP6A 4HGAC 1P34D 3LZ1C 4WU8A 3UTBB 3RELA 3KWQC 2F8NG 3O62C 5AV5D 5B31B 3TU4A 4DRBA 3X1TA 3AZEA 2L5AA 3W98D 4E44A 3REKC 4WU9A 1M19C 5GSUA 1WWSA 4XZQB 1P3OB 1S32A 1F66B 3WKJA 3MGSA 4H9NA 3REKD 3WAAC 4J8WD 3MVDA 1M19A 5AVBC 1P3AC 4QLCB 5AY8C 1P3KC 4ZUXA 1N1JA 3UT9B 3UTAA 4J8VD 2FJ7A 4J8XA 4YM6B 2NZDC 3AZHC 3VH5W 4R8PD 3WAAD 3REIB 5GXQC 1U35A 4XUJC 2CV5C 3MGRA 2BYKA 5AV5A 3UT9D 2NZDD 3REHB 3A6NB 4X23B 3X1SC 3AZJC 5B33B 1P3GB 1KX3C 3AV2D 1F1EA 5BT1D 2YFVA 5B2IC 3KWQA 4Z66B 5B31G 3O62A 3KXBD 4KGCB 5E5AB 3REHD 5CPIC 1KX3D 3REKA 1JFIB 5B33D 5B2ID 5JRGD 4J8WA 1P3GD 5BO0A 3B6FC 4AWLC 3AV1B 2NQBB 3MGPC 3X1UB 4H9QA 4J8VA 2PYOB 4KGCD 5E5AD 3MGQB 3WTPE 1ID3B 3W97C 4G92B 4R8PA 5CP6C 5AV8B 3LELC
chains in the Genus database with same CATH superfamily
5CPJB 5FUGB 3WAAA 3NQJB 4WU8C 3MNNB 3RELC 1KX5C 4WNNB 5AVBA 1P3AA 5AY8A 4G91B 4YS3C 2F8NB 5B0YC 2HIOB 5GT0B 1H3OB 3TU4C 3AV1D 2NZDA 5DNNC 3X1UD 3AZHA 5G49A 5KDMA 3W99B 5B1LB 3MGQD 3AZEC 3LZ0C 2AROB 4WU9C 2HUEB 5AV8D 3EG5B 4WV4B 1P3BB 1KX5D 5BS7C 3AV2A 5BNXB 5JA4A 4XUJA 4YS3D 3MNND 5B0YD 2CV5A 3LJAB 3KXBA 2F8ND 3AZIC 1ULYA 5GT0D 5DNMC 3REHA 2Y2IA 3X1SA 3AZJA 5F99B 1KX3A 5B1LD 1B67A 4H9RB 2AROD 5B33A 3V9RA 5AVCB 5B2IA 5JRGA 3AZMB 3B0CW 1P3BD 3KUYC 3B0DB 5GT3D 3UTAC 4J8XC 3LJAD 5DNMD 5CPIA 4KGCA 1P3IB 1P3FD 1P34C 5F99D 3AZNB 1BH8A 5AVCD 5B32B 3AZMD 5C3IB 5AV6C 3AV1A 4UUZA 3LELA 3W98C 1A7WA 1KX5A 2CWEA 3AZND 3NQJA 2G5HC 3UTBC 4YS3A 3VH6A 5B0YA 5AV6D 5DNNA 5GT0A 3LZ0A 2F8NH 3WTPB 5B1LA 4J8WC 5BS7A 1HQ3B 3IP4C 3UTBD 5GT3A 2Y2JA 4J8VC 3AFAB 3AZIA 2G5IC 1B6WA 4CSRA 5B31D 1P3OC 1R4VA 5DNMA 2JE5A 4R8PC 1M18B 4NE3A 2Y2HA 3B6GB 3FDDA 1P3FA 3WTPD 1TAFB 3KUYA 1HQ3D 1P3MB 1P3PB 3W96B 3UT9C 4XZQD 1P3OD 4CAYB 3AFAD 5B40B 2BYMB 4YM6C 1F66D 3AZLB 1P3LB 3AYWB 3R45B 3VH6T 1P34A 3B6GD 5B32G 3AV2C 5BT1C 4EO5B 2Y2LA 4QLCD 3EPHA 1P3MD 3KXBC 1ZLAB 2UWXA 4NFTA 5AV6A 3W96D 4YM6D 3REHC 1P3KB 3REJB 5B40D 4Z5TB 1P3LD 3AYWD 3W98A 5B33C 3A1IA 5JRGC 1P3GC 3REID 5B2JB 1KX4B 3F6TA 1WWIA 3UTBA 4Z66C 5GXQB 1ZLAD 4ZBJB 5B31A 4KGCC 3A6ND 5E5AC 2J8PA 4X23D 3AZKB 4LD9B 2IO5C 3X1VB 5B1MB 3C1CB 3WTPA 1Q9CA 1KX4D 4Z66D 3AZFB 2Y2NA 1M1AB 1EQZB 3AV1C 2NQBC 4UPKA 4XZQA 1P3OA 3X1UC 1AOIB 2PYOC 1F66A 3MGQC 4G92C 5AV8C 5B24B 4KHAB 4Z2MG 3AZKD 3B0BA 4LD9D 5BNVB 3X1VD 5B1MD 3C1CD 4KUDB 3MNNC 3WA9B 1TAFA 4QLCA 4G91C 3UT9A 3NQUB 3AZFD 2NQBD 2PYOD 5GT0C 1M1AD 3B6FB 1BH9B 4YM6A 1EQZD 5AV9B 5B0ZB 4Z2MH 1ID3D 1AOID 3MGPB 3W99C 5B1LC 4H9PB 4J8UB 5CPJD 3AN2B 2AROC 5B24D 2LY8A 3REIA 5CP6B 1P3BC 1BFMA 5GT3C 4WU8B 2HIOD 3RELB 3LJAC 3A6NA 2JSSA 5AV9D 3W99D 5B0ZD 4X23A 3X1TB 1P3FC 5F99C 1P3GA 5AVCC 3AZMC 4WU9B 3VH6W 4Z66A 2F2AC 5CPKB 5GSUB 3VH5T 5E5AA 1S32B 3WKJB 3KFUG 3MGSB 4H9NB 3X1TD 3C1BB 1JFIA 3AZNC 3EPJA 3MVDB 4WZSB 1M19B 3AZGB 2NQBA 3X1UA 2PYOA 5C3IC 1N1JB 4ZUXB 5CPKD 3EPLA 5GSUD 2FJ7B 3MGQA 1ID3A 1P3ID 1AOIA 2ZY5A 2YFWB 5AV8A 1S32D 3WKJD 5CPJA 5FUGA 4DQYB 3C1BD 3MNNA 4WNNA 5B32D 4JJNB 2Y2QA 2F8NA 5B31C 2HIOA 1U35B 1H3OA 1TZYB 3AZGD 3MGRB 2BYKB 4ZUXD 5AV5B 2FJ7D 3W99A 5B0ZA 2AROA 3WTPC 1P3BA 1HQ3C 4HGAB 5BNXA 3KSYA 3LZ1B 2YFVB 4JJND 4M6BA 4XZQC 3KWQB 3LJAA 2ZY2A 3O62B 3AFAC 1F66C 1U35D 1TZYD 3MGRD 1M18C 3B6GC 5F99A 4H9RA 5AVCA 3AZMA 3REKB 4QLCC 4J8WB 1P3MC 5BO0B 1P3PC 3LZ1D 3W96C 3KWQD 3O62D 5B40C 5CPKA 1M18D 4J8VB 4H9QB 3AZLC 1P3LC 3AYWC 1P3IA 3REIC 4R8PB 3AZNA 3P5JB 3C1BA 3WAAB 4EO5C 5B32A 1P3PD 5AVBB 1P3AB 1ZLAC 5AY8B 3A6NC 3AZGA 3AZLD 3REJC 2NZDB 4Z5TC 4X23C 3AZHB 5G49B 5KDMB 2RVQC 3B0CT 2YFWA 1HTAA 5B2JC 1KX4C 3H0MC 3AV2B 4JJNA 3A1KA 5JA4B 4XUJB 5AVBD 1P3AD 2CV5B 5AY8D 1P3KD 4ZBJC 3KXBB 3REJD 3AL0C 1TZYA 4Z5TD 5CHLB 2RVQD 2RIQA 3AZKC 3AZHD 4LD9C 3X1SB 3X1VC 5B1MC 5B2JD 3C1CC 1HQ3A 3AZJB 1KX3B 1T3UA 5B2IB 3V9RB 5JRGB 3AZFC 5GXQD 3LZ1A 3AFAA 1M1AC 4DRAA 1EQZC 4XUJD 1AOIC 2CV5D 1ID3C 2XD1A 1M18A 3B6GA 5CPIB 5CPJC 5B24C 3VH5A 2XD5A 3X1SD 2Y2MA 3AZJD 1P3MA 4KUDC 1BH8B 2IO5B 4NE6A 3WA9C 1P3PA 2DQNC 2HIOC 3W96A 4CAYA 4AWLB 5B40A 2BYMA 5AV9C 3AZLA 1P3LA 5B0ZC 3AYWA 2F8NK 3R45A 4H9OB 4UUZB 1PZRA 2HUEC 3W97B 4J8UC 5CPID 3AN2C 2W8SA 3LELB 4H9SC 4KUDD 3WA9D 1KX5B 1ZLAA 4YS3B 3B6FD 5B0YB 1P3KA 3TU4B 3REJA 4Z5TA 5DNNB 3MGPD 4J8UD 3AN2D 3X1TC 3AZEB 3LZ0B 4E45A 1KU5A 3W97D 5CP6D 5B2JA 3B0DC 1KX4A 3LELD 4NE5A 4WU8D 3RELD 5GXQA 5GT3B 5CPKC 5GSUC 3AZIB 4CSRB 1P3IC 3TU4D 3EPKA 5DNMB 1S32C 5DNND 3AZKA 2Y2PA 3WKJC 4LD9A 3MGSC 3X1VA 5B1MA 3C1CA 3C1BC 3AZED 3LZ0D 5B32C 4WU9D 1P3FB 3AZFA 3KUYB 3MVDC 1M1AA 3UTAB 3AZGC 1EQZA 4J8XB 4ZUXC 2FJ7C 3AZID 2ZY4A 2BG1A 3MGSD 5B24A 4KHAA 5BNVA 1P34B 4KUDA 2ZY3A 3WA9A 3MVDD 4JJNC 1M19D 3NQUA 3KUYD 1U35C 3B6FA 3UTAD 1BH9A 1TZYC 2Y2KA 5AV9A 5AV6B 3MGRC 4J8XD 5AV5C 3MGPA 4H9PA 4J8UA 4H9OA 2VQRA 2Y2OA 3AN2A 4H9SA 3W97A 3W98B 5CP6A 4HGAC 1P34D 3LZ1C 4WU8A 3UTBB 3RELA 3KWQC 2F8NG 3O62C 5AV5D 5B31B 3TU4A 4DRBA 3X1TA 1Z2CB 2JCHA 3AZEA 2L5AA 3W98D 4E44A 3REKC 4WU9A 1M19C 2FFFB 5GSUA 1WWSA 4XZQB 1P3OB 1S32A 1F66B 3WKJA 2DF4C 3MGSA 1W2EA 4H9NA 3REKD 3WAAC 4J8WD 3MVDA 1M19A 5AVBC 1P3AC 4QLCB 5AY8C 1P3KC 4ZUXA 1N1JA 3UT9B 3UTAA 4J8VD 2FJ7A 4J8XA 4YM6B 2ZM5A 2NZDC 3AZHC 3VH5W 4R8PD 3WAAD 3REIB 5GXQC 4WJ3C 1U35A 4XUJC 2CV5C 3MGRA 2BYKA 5AV5A 3UT9D 2NZDD 3REHB 3A6NB 4X23B 3X1SC 3AZJC 5B33B 1P3GB 1KX3C 3AV2D 1F1EA 5BT1D 2YFVA 5B2IC 3KWQA 4Z66B 5B31G 3O62A 3KXBD 4KGCB 5E5AB 3H0LC 3REHD 3H0RC 5CPIC 1KX3D 3REKA 1JFIB 5B33D 5B2ID 5JRGD 4J8WA 2Y2GA 5BO0A 1P3GD 3B6FC 4AWLC 3AV1B 2NQBB 3MGPC 3X1UB 4H9QA 4J8VA 2PYOB 4KGCD 5E5AD 3MGQB 3WTPE 1ID3B 3W97C 4G92B 4R8PA 5CP6C 5AV8B 3LELC
chains in the Genus database with same CATH topology
5CPJB 5FUGB 3WAAA 3NQJB 4WU8C 3MNNB 3RELC 1KX5C 4WNNB 5AVBA 1P3AA 5AY8A 4G91B 4YS3C 2F8NB 5B0YC 2HIOB 5GT0B 1H3OB 3TU4C 3AV1D 2NZDA 5DNNC 3X1UD 3AZHA 5G49A 5KDMA 3W99B 5B1LB 3MGQD 3AZEC 3LZ0C 2AROB 4WU9C 2HUEB 5AV8D 3EG5B 4WV4B 1P3BB 1KX5D 5BS7C 3AV2A 5BNXB 5JA4A 4XUJA 4YS3D 3MNND 5B0YD 2CV5A 3LJAB 3KXBA 2F8ND 3AZIC 1ULYA 5GT0D 5DNMC 3REHA 2Y2IA 3X1SA 3AZJA 5F99B 1KX3A 5B1LD 1B67A 4H9RB 2AROD 5B33A 3V9RA 5AVCB 5B2IA 5JRGA 3AZMB 3B0CW 1P3BD 3KUYC 3B0DB 5GT3D 3UTAC 4J8XC 3LJAD 5DNMD 5CPIA 4KGCA 1P3IB 1P3FD 1P34C 5F99D 3AZNB 1BH8A 5AVCD 5B32B 3AZMD 5C3IB 5AV6C 3AV1A 4UUZA 3LELA 3W98C 1A7WA 1KX5A 2CWEA 3AZND 3NQJA 2G5HC 3UTBC 4YS3A 3VH6A 5B0YA 5AV6D 5DNNA 5GT0A 3LZ0A 2F8NH 3WTPB 5B1LA 4J8WC 5BS7A 1HQ3B 3IP4C 3UTBD 5GT3A 2Y2JA 4J8VC 3AFAB 3AZIA 2G5IC 1B6WA 4CSRA 5B31D 1P3OC 1R4VA 5DNMA 2JE5A 4R8PC 1M18B 4NE3A 2Y2HA 3B6GB 3FDDA 1P3FA 3WTPD 1TAFB 3KUYA 1HQ3D 1P3MB 1P3PB 3W96B 3UT9C 4XZQD 1P3OD 4CAYB 3AFAD 5B40B 2BYMB 4YM6C 1F66D 3AZLB 1P3LB 3AYWB 3R45B 3VH6T 1P34A 3B6GD 5B32G 3AV2C 5BT1C 4EO5B 2Y2LA 4QLCD 3EPHA 1P3MD 3KXBC 1ZLAB 2UWXA 4NFTA 5AV6A 3W96D 4YM6D 3REHC 1P3KB 3REJB 5B40D 4Z5TB 1P3LD 3AYWD 3W98A 5B33C 3A1IA 5JRGC 1P3GC 3REID 5B2JB 1KX4B 3F6TA 1WWIA 3UTBA 4Z66C 5GXQB 1ZLAD 4ZBJB 5B31A 4KGCC 3A6ND 5E5AC 2J8PA 4X23D 3AZKB 4LD9B 2IO5C 3X1VB 5B1MB 3C1CB 3WTPA 1Q9CA 1KX4D 4Z66D 3AZFB 2Y2NA 1M1AB 1EQZB 3AV1C 2NQBC 4UPKA 4XZQA 1P3OA 3X1UC 1AOIB 2PYOC 1F66A 3MGQC 4G92C 5AV8C 5B24B 4KHAB 4Z2MG 3AZKD 3B0BA 4LD9D 5BNVB 3X1VD 5B1MD 3C1CD 4KUDB 3MNNC 3WA9B 1TAFA 4QLCA 4G91C 3UT9A 3NQUB 3AZFD 2NQBD 2PYOD 5GT0C 1M1AD 3B6FB 1BH9B 4YM6A 1EQZD 5AV9B 5B0ZB 4Z2MH 1ID3D 1AOID 3MGPB 3W99C 5B1LC 4H9PB 4J8UB 5CPJD 3AN2B 2AROC 5B24D 2LY8A 3REIA 5CP6B 1P3BC 1BFMA 5GT3C 4WU8B 2HIOD 3RELB 3LJAC 3A6NA 2JSSA 5AV9D 3W99D 5B0ZD 4X23A 3X1TB 1P3FC 5F99C 1P3GA 5AVCC 3AZMC 4WU9B 3VH6W 4Z66A 2F2AC 5CPKB 5GSUB 3VH5T 5E5AA 1S32B 3WKJB 3KFUG 3MGSB 4H9NB 3X1TD 3C1BB 1JFIA 3AZNC 3EPJA 3MVDB 4WZSB 1M19B 3AZGB 2NQBA 3X1UA 2PYOA 5C3IC 1N1JB 4ZUXB 5CPKD 3EPLA 5GSUD 2FJ7B 3MGQA 1ID3A 1P3ID 1AOIA 2ZY5A 2YFWB 5AV8A 1S32D 3WKJD 5CPJA 5FUGA 4DQYB 3C1BD 3MNNA 4WNNA 5B32D 4JJNB 2Y2QA 2F8NA 5B31C 2HIOA 1U35B 1H3OA 1TZYB 3AZGD 3MGRB 2BYKB 4ZUXD 5AV5B 2FJ7D 3W99A 5B0ZA 2AROA 3WTPC 1P3BA 1HQ3C 4HGAB 5BNXA 3KSYA 3LZ1B 2YFVB 4JJND 4M6BA 4XZQC 3KWQB 3LJAA 2ZY2A 3O62B 3AFAC 1F66C 1U35D 1TZYD 3MGRD 1M18C 3B6GC 5F99A 4H9RA 5AVCA 3AZMA 3REKB 4QLCC 4J8WB 1P3MC 5BO0B 1P3PC 3LZ1D 3W96C 3KWQD 3O62D 5B40C 5CPKA 1M18D 4J8VB 4H9QB 3AZLC 1P3LC 3AYWC 1P3IA 3REIC 4R8PB 3AZNA 3P5JB 3C1BA 3WAAB 4EO5C 5B32A 1P3PD 5AVBB 1P3AB 1ZLAC 5AY8B 3A6NC 3AZGA 3AZLD 3REJC 2NZDB 4Z5TC 4X23C 3AZHB 5G49B 5KDMB 2RVQC 3B0CT 2YFWA 1HTAA 5B2JC 1KX4C 3H0MC 3AV2B 4JJNA 3A1KA 5JA4B 4XUJB 5AVBD 1P3AD 2CV5B 5AY8D 1P3KD 4ZBJC 3KXBB 3REJD 3AL0C 1TZYA 4Z5TD 5CHLB 2RVQD 2RIQA 3AZKC 3AZHD 4LD9C 3X1SB 3X1VC 5B1MC 5B2JD 3C1CC 1HQ3A 3AZJB 1KX3B 1T3UA 5B2IB 3V9RB 5JRGB 3AZFC 5GXQD 3LZ1A 3AFAA 1M1AC 4DRAA 1EQZC 4XUJD 1AOIC 2CV5D 1ID3C 2XD1A 1M18A 3B6GA 5CPIB 5CPJC 5B24C 3VH5A 2XD5A 3X1SD 2Y2MA 3AZJD 1P3MA 4KUDC 1BH8B 2IO5B 4NE6A 3WA9C 1P3PA 2DQNC 2HIOC 3W96A 4CAYA 4AWLB 5B40A 2BYMA 5AV9C 3AZLA 1P3LA 5B0ZC 3AYWA 2F8NK 3R45A 4H9OB 4UUZB 1PZRA 2HUEC 3W97B 4J8UC 5CPID 3AN2C 2W8SA 3LELB 4H9SC 4KUDD 3WA9D 1KX5B 1ZLAA 4YS3B 3B6FD 5B0YB 1P3KA 3TU4B 3REJA 4Z5TA 5DNNB 3MGPD 4J8UD 3AN2D 3X1TC 3AZEB 3LZ0B 4E45A 1KU5A 3W97D 5CP6D 5B2JA 3B0DC 1KX4A 3LELD 4NE5A 4WU8D 3RELD 5GXQA 5GT3B 5CPKC 5GSUC 3AZIB 4CSRB 1P3IC 3TU4D 3EPKA 5DNMB 1S32C 5DNND 3AZKA 2Y2PA 3WKJC 4LD9A 3MGSC 3X1VA 5B1MA 3C1CA 3C1BC 3AZED 3LZ0D 5B32C 4WU9D 1P3FB 3AZFA 3KUYB 3MVDC 1M1AA 3UTAB 3AZGC 1EQZA 4J8XB 4ZUXC 2FJ7C 3AZID 2ZY4A 2BG1A 3MGSD 5B24A 4KHAA 5BNVA 1P34B 4KUDA 2ZY3A 3WA9A 3MVDD 4JJNC 1M19D 3NQUA 3KUYD 1U35C 3B6FA 3UTAD 1BH9A 1TZYC 2Y2KA 5AV9A 5AV6B 3MGRC 4J8XD 5AV5C 3MGPA 4H9PA 4J8UA 4H9OA 2VQRA 2Y2OA 3AN2A 4H9SA 3W97A 3W98B 5CP6A 4HGAC 1P34D 3LZ1C 4WU8A 3UTBB 3RELA 3KWQC 2F8NG 3O62C 5AV5D 5B31B 3TU4A 4DRBA 3X1TA 1Z2CB 2JCHA 3AZEA 2L5AA 3W98D 4E44A 3REKC 4WU9A 1M19C 2FFFB 5GSUA 1WWSA 4XZQB 1P3OB 1S32A 1F66B 3WKJA 2DF4C 3MGSA 1W2EA 4H9NA 3REKD 3WAAC 4J8WD 3MVDA 1M19A 5AVBC 1P3AC 4QLCB 5AY8C 1P3KC 4ZUXA 1N1JA 3UT9B 3UTAA 4J8VD 2FJ7A 4J8XA 4YM6B 2ZM5A 2NZDC 3AZHC 3VH5W 4R8PD 3WAAD 3REIB 5GXQC 4WJ3C 1U35A 4XUJC 2CV5C 3MGRA 2BYKA 5AV5A 3UT9D 2NZDD 3REHB 3A6NB 4X23B 3X1SC 3AZJC 5B33B 1P3GB 1KX3C 3AV2D 1F1EA 5BT1D 2YFVA 5B2IC 3KWQA 4Z66B 5B31G 3O62A 3KXBD 4KGCB 5E5AB 3H0LC 3REHD 3H0RC 5CPIC 1KX3D 3REKA 1JFIB 5B33D 5B2ID 5JRGD 4J8WA 2Y2GA 5BO0A 1P3GD 3B6FC 4AWLC 3AV1B 2NQBB 3MGPC 3X1UB 4H9QA 4J8VA 2PYOB 4KGCD 5E5AD 3MGQB 3WTPE 1ID3B 3W97C 4G92B 4R8PA 5CP6C 5AV8B 3LELC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ B;  5FUG B;  3WAA A;  3NQJ B;  4WU8 C;  3MNN B;  3REL C;  1KX5 C;  4WNN B;  5AVB A;  1P3A A;  5AY8 A;  4G91 B;  4YS3 C;  2F8N B;  5B0Y C;  2HIO B;  5GT0 B;  1H3O B;  3TU4 C;  3AV1 D;  2NZD A;  5DNN C;  3X1U D;  3AZH A;  5G49 A;  5KDM A;  3W99 B;  5B1L B;  3MGQ D;  3AZE C;  3LZ0 C;  2ARO B;  4WU9 C;  2HUE B;  5AV8 D;  4WV4 B;  1P3B B;  1KX5 D;  5BS7 C;  3AV2 A;  5BNX B;  5JA4 A;  4XUJ A;  4YS3 D;  3MNN D;  5B0Y D;  2CV5 A;  3LJA B;  3KXB A;  2F8N D;  3AZI C;  1ULY A;  5GT0 D;  5DNM C;  3REH A;  3X1S A;  3AZJ A;  5F99 B;  1KX3 A;  5B1L D;  1B67 A;  4H9R B;  2ARO D;  5B33 A;  3V9R A;  5AVC B;  5B2I A;  5JRG A;  3AZM B;  3B0C W;  1P3B D;  3KUY C;  3B0D B;  5GT3 D;  3UTA C;  4J8X C;  3LJA D;  5DNM D;  5CPI A;  4KGC A;  1P3I B;  1P3F D;  1P34 C;  5F99 D;  3AZN B;  1BH8 A;  5AVC D;  5B32 B;  3AZM D;  5C3I B;  5AV6 C;  3AV1 A;  4UUZ A;  3LEL A;  3W98 C;  1A7W A;  1KX5 A;  2CWE A;  3AZN D;  3NQJ A;  3UTB C;  4YS3 A;  3VH6 A;  5B0Y A;  5AV6 D;  5DNN A;  5GT0 A;  3LZ0 A;  2F8N H;  3WTP B;  5B1L A;  4J8W C;  5BS7 A;  1HQ3 B;  3UTB D;  5GT3 A;  4J8V C;  3AFA B;  3AZI A;  1B6W A;  4CSR A;  5B31 D;  1P3O C;  1R4V A;  5DNM A;  4R8P C;  1M18 B;  4NE3 A;  3B6G B;  1P3F A;  3WTP D;  1TAF B;  3KUY A;  1HQ3 D;  1P3M B;  1P3P B;  3W96 B;  3UT9 C;  4XZQ D;  1P3O D;  4CAY B;  3AFA D;  5B40 B;  2BYM B;  4YM6 C;  1F66 D;  3AZL B;  1P3L B;  3AYW B;  3R45 B;  3VH6 T;  1P34 A;  3B6G D;  5B32 G;  3AV2 C;  5BT1 C;  4EO5 B;  4QLC D;  1P3M D;  3KXB C;  1ZLA B;  4NFT A;  5AV6 A;  3W96 D;  4YM6 D;  3REH C;  1P3K B;  3REJ B;  5B40 D;  4Z5T B;  1P3L D;  3AYW D;  3W98 A;  5B33 C;  1P3G C;  5JRG C;  3REI D;  5B2J B;  1KX4 B;  1WWI A;  3UTB A;  4Z66 C;  5GXQ B;  1ZLA D;  4ZBJ B;  5B31 A;  4KGC C;  3A6N D;  5E5A C;  4X23 D;  3AZK B;  4LD9 B;  2IO5 C;  3X1V B;  5B1M B;  3C1C B;  3WTP A;  1Q9C A;  1KX4 D;  4Z66 D;  3AZF B;  1M1A B;  1EQZ B;  3AV1 C;  2NQB C;  4XZQ A;  1P3O A;  3X1U C;  1AOI B;  2PYO C;  1F66 A;  3MGQ C;  4G92 C;  5AV8 C;  5B24 B;  4KHA B;  4Z2M G;  3AZK D;  3B0B A;  4LD9 D;  5BNV B;  3X1V D;  5B1M D;  3C1C D;  4KUD B;  3MNN C;  3WA9 B;  1TAF A;  4QLC A;  4G91 C;  3UT9 A;  3NQU B;  3AZF D;  2NQB D;  2PYO D;  5GT0 C;  1M1A D;  3B6F B;  1BH9 B;  4YM6 A;  1EQZ D;  5AV9 B;  5B0Z B;  4Z2M H;  1ID3 D;  1AOI D;  3MGP B;  3W99 C;  5B1L C;  4H9P B;  4J8U B;  5CPJ D;  3AN2 B;  2ARO C;  5B24 D;  2LY8 A;  3REI A;  5CP6 B;  1P3B C;  1BFM A;  5GT3 C;  4WU8 B;  2HIO D;  3REL B;  3LJA C;  3A6N A;  2JSS A;  5AV9 D;  3W99 D;  5B0Z D;  4X23 A;  3X1T B;  1P3F C;  5F99 C;  1P3G A;  5AVC C;  3AZM C;  4WU9 B;  3VH6 W;  4Z66 A;  5CPK B;  5GSU B;  3VH5 T;  5E5A A;  1S32 B;  3WKJ B;  3MGS B;  4H9N B;  3X1T D;  3C1B B;  1JFI A;  3AZN C;  3MVD B;  4WZS B;  1M19 B;  3AZG B;  2NQB A;  3X1U A;  2PYO A;  5C3I C;  1N1J B;  4ZUX B;  5CPK D;  5GSU D;  2FJ7 B;  3MGQ A;  1ID3 A;  1P3I D;  1AOI A;  2YFW B;  5AV8 A;  1S32 D;  3WKJ D;  5CPJ A;  5FUG A;  3C1B D;  3MNN A;  4WNN A;  5B32 D;  4JJN B;  2F8N A;  5B31 C;  2HIO A;  1U35 B;  1H3O A;  1TZY B;  3AZG D;  3MGR B;  2BYK B;  4ZUX D;  5AV5 B;  2FJ7 D;  3W99 A;  5B0Z A;  2ARO A;  3WTP C;  1P3B A;  1HQ3 C;  4HGA B;  5BNX A;  3KSY A;  3LZ1 B;  2YFV B;  4JJN D;  4M6B A;  4XZQ C;  3KWQ B;  3LJA A;  3AFA C;  3O62 B;  1F66 C;  1U35 D;  1TZY D;  3MGR D;  1M18 C;  3B6G C;  5F99 A;  4H9R A;  5AVC A;  3AZM A;  3REK B;  4QLC C;  4J8W B;  1P3M C;  5BO0 B;  1P3P C;  3LZ1 D;  3W96 C;  3KWQ D;  3O62 D;  5B40 C;  5CPK A;  1M18 D;  4J8V B;  4H9Q B;  3AZL C;  1P3L C;  3AYW C;  1P3I A;  3REI C;  4R8P B;  3AZN A;  3C1B A;  3WAA B;  4EO5 C;  5B32 A;  1P3P D;  5AVB B;  1P3A B;  1ZLA C;  5AY8 B;  3A6N C;  3AZG A;  3AZL D;  3REJ C;  2NZD B;  4Z5T C;  4X23 C;  3AZH B;  5G49 B;  5KDM B;  2RVQ C;  3B0C T;  2YFW A;  1HTA A;  5B2J C;  1KX4 C;  3AV2 B;  4JJN A;  5JA4 B;  4XUJ B;  5AVB D;  1P3A D;  2CV5 B;  5AY8 D;  1P3K D;  4ZBJ C;  3KXB B;  3REJ D;  1TZY A;  4Z5T D;  5CHL B;  2RVQ D;  3AZK C;  3AZH D;  4LD9 C;  3X1S B;  3X1V C;  5B1M C;  5B2J D;  3C1C C;  1HQ3 A;  3AZJ B;  1KX3 B;  5B2I B;  3V9R B;  5JRG B;  3AZF C;  5GXQ D;  3LZ1 A;  3AFA A;  1M1A C;  4DRA A;  1EQZ C;  4XUJ D;  1AOI C;  2CV5 D;  1ID3 C;  1M18 A;  3B6G A;  5CPI B;  5CPJ C;  5B24 C;  3VH5 A;  3X1S D;  3AZJ D;  1P3M A;  4KUD C;  1BH8 B;  2IO5 B;  4NE6 A;  3WA9 C;  1P3P A;  2HIO C;  3W96 A;  4CAY A;  4AWL B;  5B40 A;  2BYM A;  5AV9 C;  3AZL A;  1P3L A;  5B0Z C;  3AYW A;  2F8N K;  3R45 A;  4H9O B;  4UUZ B;  2HUE C;  3W97 B;  4J8U C;  5CPI D;  3AN2 C;  3LEL B;  4H9S C;  4KUD D;  3WA9 D;  1KX5 B;  1ZLA A;  4YS3 B;  3B6F D;  5B0Y B;  1P3K A;  3TU4 B;  3REJ A;  4Z5T A;  5DNN B;  3MGP D;  4J8U D;  3AN2 D;  3X1T C;  3AZE B;  3LZ0 B;  4E45 A;  1KU5 A;  3W97 D;  5CP6 D;  5B2J A;  3B0D C;  1KX4 A;  3LEL D;  4NE5 A;  4WU8 D;  3REL D;  5GXQ A;  5GT3 B;  5CPK C;  5GSU C;  3AZI B;  4CSR B;  1P3I C;  3TU4 D;  5DNM B;  1S32 C;  5DNN D;  3AZK A;  3WKJ C;  4LD9 A;  3MGS C;  3X1V A;  5B1M A;  3C1C A;  3C1B C;  3AZE D;  3LZ0 D;  5B32 C;  4WU9 D;  1P3F B;  3AZF A;  3KUY B;  3MVD C;  1M1A A;  3UTA B;  3AZG C;  1EQZ A;  4J8X B;  4ZUX C;  2FJ7 C;  3AZI D;  3MGS D;  5B24 A;  4KHA A;  5BNV A;  1P34 B;  4KUD A;  3WA9 A;  3MVD D;  4JJN C;  1M19 D;  3NQU A;  3KUY D;  1U35 C;  3B6F A;  3UTA D;  1BH9 A;  1TZY C;  5AV9 A;  5AV6 B;  3MGR C;  4J8X D;  5AV5 C;  3MGP A;  4H9P A;  4J8U A;  4H9O A;  3AN2 A;  4H9S A;  3W97 A;  3W98 B;  5CP6 A;  4HGA C;  1P34 D;  3LZ1 C;  4WU8 A;  3UTB B;  3REL A;  3KWQ C;  2F8N G;  3O62 C;  5AV5 D;  5B31 B;  3TU4 A;  4DRB A;  3X1T A;  3AZE A;  2L5A A;  3W98 D;  4E44 A;  3REK C;  4WU9 A;  1M19 C;  5GSU A;  1WWS A;  4XZQ B;  1P3O B;  1S32 A;  1F66 B;  3WKJ A;  3MGS A;  4H9N A;  3REK D;  3WAA C;  4J8W D;  3MVD A;  1M19 A;  5AVB C;  1P3A C;  4QLC B;  5AY8 C;  1P3K C;  4ZUX A;  1N1J A;  3UT9 B;  3UTA A;  4J8V D;  2FJ7 A;  4J8X A;  4YM6 B;  2NZD C;  3AZH C;  3VH5 W;  4R8P D;  3WAA D;  3REI B;  5GXQ C;  1U35 A;  4XUJ C;  2CV5 C;  3MGR A;  2BYK A;  5AV5 A;  3UT9 D;  2NZD D;  3REH B;  3A6N B;  4X23 B;  3X1S C;  3AZJ C;  5B33 B;  1P3G B;  1KX3 C;  3AV2 D;  1F1E A;  5BT1 D;  2YFV A;  5B2I C;  3KWQ A;  4Z66 B;  5B31 G;  3O62 A;  3KXB D;  4KGC B;  5E5A B;  3REH D;  5CPI C;  1KX3 D;  3REK A;  1JFI B;  5B33 D;  5B2I D;  5JRG D;  4J8W A;  1P3G D;  5BO0 A;  3B6F C;  4AWL C;  3AV1 B;  2NQB B;  3MGP C;  3X1U B;  4H9Q A;  4J8V A;  2PYO B;  4KGC D;  5E5A D;  3MGQ B;  3WTP E;  1ID3 B;  3W97 C;  4G92 B;  4R8P A;  5CP6 C;  5AV8 B;  3LEL C; 
#chains in the Genus database with same CATH topology
 5CPJ B;  5FUG B;  3WAA A;  3NQJ B;  4WU8 C;  3MNN B;  3REL C;  1KX5 C;  4WNN B;  5AVB A;  1P3A A;  5AY8 A;  4G91 B;  4YS3 C;  2F8N B;  5B0Y C;  2HIO B;  5GT0 B;  1H3O B;  3TU4 C;  3AV1 D;  2NZD A;  5DNN C;  3X1U D;  3AZH A;  5G49 A;  5KDM A;  3W99 B;  5B1L B;  3MGQ D;  3AZE C;  3LZ0 C;  2ARO B;  4WU9 C;  2HUE B;  5AV8 D;  3EG5 B;  4WV4 B;  1P3B B;  1KX5 D;  5BS7 C;  3AV2 A;  5BNX B;  5JA4 A;  4XUJ A;  4YS3 D;  3MNN D;  5B0Y D;  2CV5 A;  3LJA B;  3KXB A;  2F8N D;  3AZI C;  1ULY A;  5GT0 D;  5DNM C;  3REH A;  2Y2I A;  3X1S A;  3AZJ A;  5F99 B;  1KX3 A;  5B1L D;  1B67 A;  4H9R B;  2ARO D;  5B33 A;  3V9R A;  5AVC B;  5B2I A;  5JRG A;  3AZM B;  3B0C W;  1P3B D;  3KUY C;  3B0D B;  5GT3 D;  3UTA C;  4J8X C;  3LJA D;  5DNM D;  5CPI A;  4KGC A;  1P3I B;  1P3F D;  1P34 C;  5F99 D;  3AZN B;  1BH8 A;  5AVC D;  5B32 B;  3AZM D;  5C3I B;  5AV6 C;  3AV1 A;  4UUZ A;  3LEL A;  3W98 C;  1A7W A;  1KX5 A;  2CWE A;  3AZN D;  3NQJ A;  2G5H C;  3UTB C;  4YS3 A;  3VH6 A;  5B0Y A;  5AV6 D;  5DNN A;  5GT0 A;  3LZ0 A;  2F8N H;  3WTP B;  5B1L A;  4J8W C;  5BS7 A;  1HQ3 B;  3IP4 C;  3UTB D;  5GT3 A;  2Y2J A;  4J8V C;  3AFA B;  3AZI A;  2G5I C;  1B6W A;  4CSR A;  5B31 D;  1P3O C;  1R4V A;  5DNM A;  2JE5 A;  4R8P C;  1M18 B;  4NE3 A;  2Y2H A;  3B6G B;  3FDD A;  1P3F A;  3WTP D;  1TAF B;  3KUY A;  1HQ3 D;  1P3M B;  1P3P B;  3W96 B;  3UT9 C;  4XZQ D;  1P3O D;  4CAY B;  3AFA D;  5B40 B;  2BYM B;  4YM6 C;  1F66 D;  3AZL B;  1P3L B;  3AYW B;  3R45 B;  3VH6 T;  1P34 A;  3B6G D;  5B32 G;  3AV2 C;  5BT1 C;  4EO5 B;  2Y2L A;  4QLC D;  3EPH A;  1P3M D;  3KXB C;  1ZLA B;  2UWX A;  4NFT A;  5AV6 A;  3W96 D;  4YM6 D;  3REH C;  1P3K B;  3REJ B;  5B40 D;  4Z5T B;  1P3L D;  3AYW D;  3W98 A;  5B33 C;  3A1I A;  5JRG C;  1P3G C;  3REI D;  5B2J B;  1KX4 B;  3F6T A;  1WWI A;  3UTB A;  4Z66 C;  5GXQ B;  1ZLA D;  4ZBJ B;  5B31 A;  4KGC C;  3A6N D;  5E5A C;  2J8P A;  4X23 D;  3AZK B;  4LD9 B;  2IO5 C;  3X1V B;  5B1M B;  3C1C B;  3WTP A;  1Q9C A;  1KX4 D;  4Z66 D;  3AZF B;  2Y2N A;  1M1A B;  1EQZ B;  3AV1 C;  2NQB C;  4UPK A;  4XZQ A;  1P3O A;  3X1U C;  1AOI B;  2PYO C;  1F66 A;  3MGQ C;  4G92 C;  5AV8 C;  5B24 B;  4KHA B;  4Z2M G;  3AZK D;  3B0B A;  4LD9 D;  5BNV B;  3X1V D;  5B1M D;  3C1C D;  4KUD B;  3MNN C;  3WA9 B;  1TAF A;  4QLC A;  4G91 C;  3UT9 A;  3NQU B;  3AZF D;  2NQB D;  2PYO D;  5GT0 C;  1M1A D;  3B6F B;  1BH9 B;  4YM6 A;  1EQZ D;  5AV9 B;  5B0Z B;  4Z2M H;  1ID3 D;  1AOI D;  3MGP B;  3W99 C;  5B1L C;  4H9P B;  4J8U B;  5CPJ D;  3AN2 B;  2ARO C;  5B24 D;  2LY8 A;  3REI A;  5CP6 B;  1P3B C;  1BFM A;  5GT3 C;  4WU8 B;  2HIO D;  3REL B;  3LJA C;  3A6N A;  2JSS A;  5AV9 D;  3W99 D;  5B0Z D;  4X23 A;  3X1T B;  1P3F C;  5F99 C;  1P3G A;  5AVC C;  3AZM C;  4WU9 B;  3VH6 W;  4Z66 A;  2F2A C;  5CPK B;  5GSU B;  3VH5 T;  5E5A A;  1S32 B;  3WKJ B;  3KFU G;  3MGS B;  4H9N B;  3X1T D;  3C1B B;  1JFI A;  3AZN C;  3EPJ A;  3MVD B;  4WZS B;  1M19 B;  3AZG B;  2NQB A;  3X1U A;  2PYO A;  5C3I C;  1N1J B;  4ZUX B;  5CPK D;  3EPL A;  5GSU D;  2FJ7 B;  3MGQ A;  1ID3 A;  1P3I D;  1AOI A;  2ZY5 A;  2YFW B;  5AV8 A;  1S32 D;  3WKJ D;  5CPJ A;  5FUG A;  4DQY B;  3C1B D;  3MNN A;  4WNN A;  5B32 D;  4JJN B;  2Y2Q A;  2F8N A;  5B31 C;  2HIO A;  1U35 B;  1H3O A;  1TZY B;  3AZG D;  3MGR B;  2BYK B;  4ZUX D;  5AV5 B;  2FJ7 D;  3W99 A;  5B0Z A;  2ARO A;  3WTP C;  1P3B A;  1HQ3 C;  4HGA B;  5BNX A;  3KSY A;  3LZ1 B;  2YFV B;  4JJN D;  4M6B A;  4XZQ C;  3KWQ B;  3LJA A;  2ZY2 A;  3O62 B;  3AFA C;  1F66 C;  1U35 D;  1TZY D;  3MGR D;  1M18 C;  3B6G C;  5F99 A;  4H9R A;  5AVC A;  3AZM A;  3REK B;  4QLC C;  4J8W B;  1P3M C;  5BO0 B;  1P3P C;  3LZ1 D;  3W96 C;  3KWQ D;  3O62 D;  5B40 C;  5CPK A;  1M18 D;  4J8V B;  4H9Q B;  3AZL C;  1P3L C;  3AYW C;  1P3I A;  3REI C;  4R8P B;  3AZN A;  3P5J B;  3C1B A;  3WAA B;  4EO5 C;  5B32 A;  1P3P D;  5AVB B;  1P3A B;  1ZLA C;  5AY8 B;  3A6N C;  3AZG A;  3AZL D;  3REJ C;  2NZD B;  4Z5T C;  4X23 C;  3AZH B;  5G49 B;  5KDM B;  2RVQ C;  3B0C T;  2YFW A;  1HTA A;  5B2J C;  1KX4 C;  3H0M C;  3AV2 B;  4JJN A;  3A1K A;  5JA4 B;  4XUJ B;  5AVB D;  1P3A D;  2CV5 B;  5AY8 D;  1P3K D;  4ZBJ C;  3KXB B;  3REJ D;  3AL0 C;  1TZY A;  4Z5T D;  5CHL B;  2RVQ D;  2RIQ A;  3AZK C;  3AZH D;  4LD9 C;  3X1S B;  3X1V C;  5B1M C;  5B2J D;  3C1C C;  1HQ3 A;  3AZJ B;  1KX3 B;  1T3U A;  5B2I B;  3V9R B;  5JRG B;  3AZF C;  5GXQ D;  3LZ1 A;  3AFA A;  1M1A C;  4DRA A;  1EQZ C;  4XUJ D;  1AOI C;  2CV5 D;  1ID3 C;  2XD1 A;  1M18 A;  3B6G A;  5CPI B;  5CPJ C;  5B24 C;  3VH5 A;  2XD5 A;  3X1S D;  2Y2M A;  3AZJ D;  1P3M A;  4KUD C;  1BH8 B;  2IO5 B;  4NE6 A;  3WA9 C;  1P3P A;  2DQN C;  2HIO C;  3W96 A;  4CAY A;  4AWL B;  5B40 A;  2BYM A;  5AV9 C;  3AZL A;  1P3L A;  5B0Z C;  3AYW A;  2F8N K;  3R45 A;  4H9O B;  4UUZ B;  1PZR A;  2HUE C;  3W97 B;  4J8U C;  5CPI D;  3AN2 C;  2W8S A;  3LEL B;  4H9S C;  4KUD D;  3WA9 D;  1KX5 B;  1ZLA A;  4YS3 B;  3B6F D;  5B0Y B;  1P3K A;  3TU4 B;  3REJ A;  4Z5T A;  5DNN B;  3MGP D;  4J8U D;  3AN2 D;  3X1T C;  3AZE B;  3LZ0 B;  4E45 A;  1KU5 A;  3W97 D;  5CP6 D;  5B2J A;  3B0D C;  1KX4 A;  3LEL D;  4NE5 A;  4WU8 D;  3REL D;  5GXQ A;  5GT3 B;  5CPK C;  5GSU C;  3AZI B;  4CSR B;  1P3I C;  3TU4 D;  3EPK A;  5DNM B;  1S32 C;  5DNN D;  3AZK A;  2Y2P A;  3WKJ C;  4LD9 A;  3MGS C;  3X1V A;  5B1M A;  3C1C A;  3C1B C;  3AZE D;  3LZ0 D;  5B32 C;  4WU9 D;  1P3F B;  3AZF A;  3KUY B;  3MVD C;  1M1A A;  3UTA B;  3AZG C;  1EQZ A;  4J8X B;  4ZUX C;  2FJ7 C;  3AZI D;  2ZY4 A;  2BG1 A;  3MGS D;  5B24 A;  4KHA A;  5BNV A;  1P34 B;  4KUD A;  2ZY3 A;  3WA9 A;  3MVD D;  4JJN C;  1M19 D;  3NQU A;  3KUY D;  1U35 C;  3B6F A;  3UTA D;  1BH9 A;  1TZY C;  2Y2K A;  5AV9 A;  5AV6 B;  3MGR C;  4J8X D;  5AV5 C;  3MGP A;  4H9P A;  4J8U A;  4H9O A;  2VQR A;  2Y2O A;  3AN2 A;  4H9S A;  3W97 A;  3W98 B;  5CP6 A;  4HGA C;  1P34 D;  3LZ1 C;  4WU8 A;  3UTB B;  3REL A;  3KWQ C;  2F8N G;  3O62 C;  5AV5 D;  5B31 B;  3TU4 A;  4DRB A;  3X1T A;  1Z2C B;  2JCH A;  3AZE A;  2L5A A;  3W98 D;  4E44 A;  3REK C;  4WU9 A;  1M19 C;  2FFF B;  5GSU A;  1WWS A;  4XZQ B;  1P3O B;  1S32 A;  1F66 B;  3WKJ A;  2DF4 C;  3MGS A;  1W2E A;  4H9N A;  3REK D;  3WAA C;  4J8W D;  3MVD A;  1M19 A;  5AVB C;  1P3A C;  4QLC B;  5AY8 C;  1P3K C;  4ZUX A;  1N1J A;  3UT9 B;  3UTA A;  4J8V D;  2FJ7 A;  4J8X A;  4YM6 B;  2ZM5 A;  2NZD C;  3AZH C;  3VH5 W;  4R8P D;  3WAA D;  3REI B;  5GXQ C;  4WJ3 C;  1U35 A;  4XUJ C;  2CV5 C;  3MGR A;  2BYK A;  5AV5 A;  3UT9 D;  2NZD D;  3REH B;  3A6N B;  4X23 B;  3X1S C;  3AZJ C;  5B33 B;  1P3G B;  1KX3 C;  3AV2 D;  1F1E A;  5BT1 D;  2YFV A;  5B2I C;  3KWQ A;  4Z66 B;  5B31 G;  3O62 A;  3KXB D;  4KGC B;  5E5A B;  3H0L C;  3REH D;  3H0R C;  5CPI C;  1KX3 D;  3REK A;  1JFI B;  5B33 D;  5B2I D;  5JRG D;  4J8W A;  2Y2G A;  5BO0 A;  1P3G D;  3B6F C;  4AWL C;  3AV1 B;  2NQB B;  3MGP C;  3X1U B;  4H9Q A;  4J8V A;  2PYO B;  4KGC D;  5E5A D;  3MGQ B;  3WTP E;  1ID3 B;  3W97 C;  4G92 B;  4R8P A;  5CP6 C;  5AV8 B;  3LEL C; 
#chains in the Genus database with same CATH homology
 5CPJ B;  5FUG B;  3WAA A;  3NQJ B;  4WU8 C;  3MNN B;  3REL C;  1KX5 C;  4WNN B;  5AVB A;  1P3A A;  5AY8 A;  4G91 B;  4YS3 C;  2F8N B;  5B0Y C;  2HIO B;  5GT0 B;  1H3O B;  3TU4 C;  3AV1 D;  2NZD A;  5DNN C;  3X1U D;  3AZH A;  5G49 A;  5KDM A;  3W99 B;  5B1L B;  3MGQ D;  3AZE C;  3LZ0 C;  2ARO B;  4WU9 C;  2HUE B;  5AV8 D;  3EG5 B;  4WV4 B;  1P3B B;  1KX5 D;  5BS7 C;  3AV2 A;  5BNX B;  5JA4 A;  4XUJ A;  4YS3 D;  3MNN D;  5B0Y D;  2CV5 A;  3LJA B;  3KXB A;  2F8N D;  3AZI C;  1ULY A;  5GT0 D;  5DNM C;  3REH A;  2Y2I A;  3X1S A;  3AZJ A;  5F99 B;  1KX3 A;  5B1L D;  1B67 A;  4H9R B;  2ARO D;  5B33 A;  3V9R A;  5AVC B;  5B2I A;  5JRG A;  3AZM B;  3B0C W;  1P3B D;  3KUY C;  3B0D B;  5GT3 D;  3UTA C;  4J8X C;  3LJA D;  5DNM D;  5CPI A;  4KGC A;  1P3I B;  1P3F D;  1P34 C;  5F99 D;  3AZN B;  1BH8 A;  5AVC D;  5B32 B;  3AZM D;  5C3I B;  5AV6 C;  3AV1 A;  4UUZ A;  3LEL A;  3W98 C;  1A7W A;  1KX5 A;  2CWE A;  3AZN D;  3NQJ A;  2G5H C;  3UTB C;  4YS3 A;  3VH6 A;  5B0Y A;  5AV6 D;  5DNN A;  5GT0 A;  3LZ0 A;  2F8N H;  3WTP B;  5B1L A;  4J8W C;  5BS7 A;  1HQ3 B;  3IP4 C;  3UTB D;  5GT3 A;  2Y2J A;  4J8V C;  3AFA B;  3AZI A;  2G5I C;  1B6W A;  4CSR A;  5B31 D;  1P3O C;  1R4V A;  5DNM A;  2JE5 A;  4R8P C;  1M18 B;  4NE3 A;  2Y2H A;  3B6G B;  3FDD A;  1P3F A;  3WTP D;  1TAF B;  3KUY A;  1HQ3 D;  1P3M B;  1P3P B;  3W96 B;  3UT9 C;  4XZQ D;  1P3O D;  4CAY B;  3AFA D;  5B40 B;  2BYM B;  4YM6 C;  1F66 D;  3AZL B;  1P3L B;  3AYW B;  3R45 B;  3VH6 T;  1P34 A;  3B6G D;  5B32 G;  3AV2 C;  5BT1 C;  4EO5 B;  2Y2L A;  4QLC D;  3EPH A;  1P3M D;  3KXB C;  1ZLA B;  2UWX A;  4NFT A;  5AV6 A;  3W96 D;  4YM6 D;  3REH C;  1P3K B;  3REJ B;  5B40 D;  4Z5T B;  1P3L D;  3AYW D;  3W98 A;  5B33 C;  3A1I A;  5JRG C;  1P3G C;  3REI D;  5B2J B;  1KX4 B;  3F6T A;  1WWI A;  3UTB A;  4Z66 C;  5GXQ B;  1ZLA D;  4ZBJ B;  5B31 A;  4KGC C;  3A6N D;  5E5A C;  2J8P A;  4X23 D;  3AZK B;  4LD9 B;  2IO5 C;  3X1V B;  5B1M B;  3C1C B;  3WTP A;  1Q9C A;  1KX4 D;  4Z66 D;  3AZF B;  2Y2N A;  1M1A B;  1EQZ B;  3AV1 C;  2NQB C;  4UPK A;  4XZQ A;  1P3O A;  3X1U C;  1AOI B;  2PYO C;  1F66 A;  3MGQ C;  4G92 C;  5AV8 C;  5B24 B;  4KHA B;  4Z2M G;  3AZK D;  3B0B A;  4LD9 D;  5BNV B;  3X1V D;  5B1M D;  3C1C D;  4KUD B;  3MNN C;  3WA9 B;  1TAF A;  4QLC A;  4G91 C;  3UT9 A;  3NQU B;  3AZF D;  2NQB D;  2PYO D;  5GT0 C;  1M1A D;  3B6F B;  1BH9 B;  4YM6 A;  1EQZ D;  5AV9 B;  5B0Z B;  4Z2M H;  1ID3 D;  1AOI D;  3MGP B;  3W99 C;  5B1L C;  4H9P B;  4J8U B;  5CPJ D;  3AN2 B;  2ARO C;  5B24 D;  2LY8 A;  3REI A;  5CP6 B;  1P3B C;  1BFM A;  5GT3 C;  4WU8 B;  2HIO D;  3REL B;  3LJA C;  3A6N A;  2JSS A;  5AV9 D;  3W99 D;  5B0Z D;  4X23 A;  3X1T B;  1P3F C;  5F99 C;  1P3G A;  5AVC C;  3AZM C;  4WU9 B;  3VH6 W;  4Z66 A;  2F2A C;  5CPK B;  5GSU B;  3VH5 T;  5E5A A;  1S32 B;  3WKJ B;  3KFU G;  3MGS B;  4H9N B;  3X1T D;  3C1B B;  1JFI A;  3AZN C;  3EPJ A;  3MVD B;  4WZS B;  1M19 B;  3AZG B;  2NQB A;  3X1U A;  2PYO A;  5C3I C;  1N1J B;  4ZUX B;  5CPK D;  3EPL A;  5GSU D;  2FJ7 B;  3MGQ A;  1ID3 A;  1P3I D;  1AOI A;  2ZY5 A;  2YFW B;  5AV8 A;  1S32 D;  3WKJ D;  5CPJ A;  5FUG A;  4DQY B;  3C1B D;  3MNN A;  4WNN A;  5B32 D;  4JJN B;  2Y2Q A;  2F8N A;  5B31 C;  2HIO A;  1U35 B;  1H3O A;  1TZY B;  3AZG D;  3MGR B;  2BYK B;  4ZUX D;  5AV5 B;  2FJ7 D;  3W99 A;  5B0Z A;  2ARO A;  3WTP C;  1P3B A;  1HQ3 C;  4HGA B;  5BNX A;  3KSY A;  3LZ1 B;  2YFV B;  4JJN D;  4M6B A;  4XZQ C;  3KWQ B;  3LJA A;  2ZY2 A;  3O62 B;  3AFA C;  1F66 C;  1U35 D;  1TZY D;  3MGR D;  1M18 C;  3B6G C;  5F99 A;  4H9R A;  5AVC A;  3AZM A;  3REK B;  4QLC C;  4J8W B;  1P3M C;  5BO0 B;  1P3P C;  3LZ1 D;  3W96 C;  3KWQ D;  3O62 D;  5B40 C;  5CPK A;  1M18 D;  4J8V B;  4H9Q B;  3AZL C;  1P3L C;  3AYW C;  1P3I A;  3REI C;  4R8P B;  3AZN A;  3P5J B;  3C1B A;  3WAA B;  4EO5 C;  5B32 A;  1P3P D;  5AVB B;  1P3A B;  1ZLA C;  5AY8 B;  3A6N C;  3AZG A;  3AZL D;  3REJ C;  2NZD B;  4Z5T C;  4X23 C;  3AZH B;  5G49 B;  5KDM B;  2RVQ C;  3B0C T;  2YFW A;  1HTA A;  5B2J C;  1KX4 C;  3H0M C;  3AV2 B;  4JJN A;  3A1K A;  5JA4 B;  4XUJ B;  5AVB D;  1P3A D;  2CV5 B;  5AY8 D;  1P3K D;  4ZBJ C;  3KXB B;  3REJ D;  3AL0 C;  1TZY A;  4Z5T D;  5CHL B;  2RVQ D;  2RIQ A;  3AZK C;  3AZH D;  4LD9 C;  3X1S B;  3X1V C;  5B1M C;  5B2J D;  3C1C C;  1HQ3 A;  3AZJ B;  1KX3 B;  1T3U A;  5B2I B;  3V9R B;  5JRG B;  3AZF C;  5GXQ D;  3LZ1 A;  3AFA A;  1M1A C;  4DRA A;  1EQZ C;  4XUJ D;  1AOI C;  2CV5 D;  1ID3 C;  2XD1 A;  1M18 A;  3B6G A;  5CPI B;  5CPJ C;  5B24 C;  3VH5 A;  2XD5 A;  3X1S D;  2Y2M A;  3AZJ D;  1P3M A;  4KUD C;  1BH8 B;  2IO5 B;  4NE6 A;  3WA9 C;  1P3P A;  2DQN C;  2HIO C;  3W96 A;  4CAY A;  4AWL B;  5B40 A;  2BYM A;  5AV9 C;  3AZL A;  1P3L A;  5B0Z C;  3AYW A;  2F8N K;  3R45 A;  4H9O B;  4UUZ B;  1PZR A;  2HUE C;  3W97 B;  4J8U C;  5CPI D;  3AN2 C;  2W8S A;  3LEL B;  4H9S C;  4KUD D;  3WA9 D;  1KX5 B;  1ZLA A;  4YS3 B;  3B6F D;  5B0Y B;  1P3K A;  3TU4 B;  3REJ A;  4Z5T A;  5DNN B;  3MGP D;  4J8U D;  3AN2 D;  3X1T C;  3AZE B;  3LZ0 B;  4E45 A;  1KU5 A;  3W97 D;  5CP6 D;  5B2J A;  3B0D C;  1KX4 A;  3LEL D;  4NE5 A;  4WU8 D;  3REL D;  5GXQ A;  5GT3 B;  5CPK C;  5GSU C;  3AZI B;  4CSR B;  1P3I C;  3TU4 D;  3EPK A;  5DNM B;  1S32 C;  5DNN D;  3AZK A;  2Y2P A;  3WKJ C;  4LD9 A;  3MGS C;  3X1V A;  5B1M A;  3C1C A;  3C1B C;  3AZE D;  3LZ0 D;  5B32 C;  4WU9 D;  1P3F B;  3AZF A;  3KUY B;  3MVD C;  1M1A A;  3UTA B;  3AZG C;  1EQZ A;  4J8X B;  4ZUX C;  2FJ7 C;  3AZI D;  2ZY4 A;  2BG1 A;  3MGS D;  5B24 A;  4KHA A;  5BNV A;  1P34 B;  4KUD A;  2ZY3 A;  3WA9 A;  3MVD D;  4JJN C;  1M19 D;  3NQU A;  3KUY D;  1U35 C;  3B6F A;  3UTA D;  1BH9 A;  1TZY C;  2Y2K A;  5AV9 A;  5AV6 B;  3MGR C;  4J8X D;  5AV5 C;  3MGP A;  4H9P A;  4J8U A;  4H9O A;  2VQR A;  2Y2O A;  3AN2 A;  4H9S A;  3W97 A;  3W98 B;  5CP6 A;  4HGA C;  1P34 D;  3LZ1 C;  4WU8 A;  3UTB B;  3REL A;  3KWQ C;  2F8N G;  3O62 C;  5AV5 D;  5B31 B;  3TU4 A;  4DRB A;  3X1T A;  1Z2C B;  2JCH A;  3AZE A;  2L5A A;  3W98 D;  4E44 A;  3REK C;  4WU9 A;  1M19 C;  2FFF B;  5GSU A;  1WWS A;  4XZQ B;  1P3O B;  1S32 A;  1F66 B;  3WKJ A;  2DF4 C;  3MGS A;  1W2E A;  4H9N A;  3REK D;  3WAA C;  4J8W D;  3MVD A;  1M19 A;  5AVB C;  1P3A C;  4QLC B;  5AY8 C;  1P3K C;  4ZUX A;  1N1J A;  3UT9 B;  3UTA A;  4J8V D;  2FJ7 A;  4J8X A;  4YM6 B;  2ZM5 A;  2NZD C;  3AZH C;  3VH5 W;  4R8P D;  3WAA D;  3REI B;  5GXQ C;  4WJ3 C;  1U35 A;  4XUJ C;  2CV5 C;  3MGR A;  2BYK A;  5AV5 A;  3UT9 D;  2NZD D;  3REH B;  3A6N B;  4X23 B;  3X1S C;  3AZJ C;  5B33 B;  1P3G B;  1KX3 C;  3AV2 D;  1F1E A;  5BT1 D;  2YFV A;  5B2I C;  3KWQ A;  4Z66 B;  5B31 G;  3O62 A;  3KXB D;  4KGC B;  5E5A B;  3H0L C;  3REH D;  3H0R C;  5CPI C;  1KX3 D;  3REK A;  1JFI B;  5B33 D;  5B2I D;  5JRG D;  4J8W A;  2Y2G A;  5BO0 A;  1P3G D;  3B6F C;  4AWL C;  3AV1 B;  2NQB B;  3MGP C;  3X1U B;  4H9Q A;  4J8V A;  2PYO B;  4KGC D;  5E5A D;  3MGQ B;  3WTP E;  1ID3 B;  3W97 C;  4G92 B;  4R8P A;  5CP6 C;  5AV8 B;  3LEL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...