3MVDC

Crystal structure of the chromatin factor rcc1 in complex with the nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
107
structure length
107
Chain Sequence
b'AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structure of RCC1 chromatin factor bound to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 31
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mvdC00
5GT0D 4H9QA 5BT1C 1EQZB 3B6FB 1KX4C 4KUDA 1U35D 3LELC 4XUJC 4JJNA 3B6GC 3C1BB 2RVQC 3W97A 5F99D 5B0ZA 3AZFA 1P3MB 5B24C 3AZHB 1P3LD 4CAYA 5CPIB 5AV5A 5JA4A 3X1SA 3RELC 1KX3B 5GT3D 3W98A 3REJA 2AROD 4YS3D 3W99B 3AV1B 4J8XB 4X23C 5FUGB 3UT9D 3MVDA 2CV5C 5B2JD 3REKB 3AZMB 3UTAC 1KU5A 3MNNB 5CP6B 5KDMA 3MGPC 5JRGA 5GXQB 2NQBA 3AFAC 3WA9B 4E44A 5B40A 3AZGA 2FJ7A 4H9QB 3REHC 1P3LC 5B32A 4J8VB 5E5AD 4JJNB 3AYWD 1ZLAC 3W97B 5B33A 3AZFB 3KUYC 4YS3C 5AVCC 1M18B 3X1VC 5G49A 4CAYB 2IO5B 4XZQD 5BNXA 5AV5B 5JA4B 1KX5C 4Z66A 3REKD 3AZEA 5AV8B 5B2JC 1EQZC 3B6FC 1P3OD 1P3FB 1M19D 5B1MA 3C1BC 3WA9D 1N1JA 3MVDB 3KSYA 3LJAA 1P3MC 2YFWA 3AZHC 1B67A 5AY8A 3C1CA 2YFVA 5KDMB 4G92B 3KXBD 2NQBB 1HQ3D 3W99C 3AV1C 1BFMA 5B40B 3AZKB 3AV2A 3AZGB 5GSUA 1TZYB 4XZQC 3O62D 3LZ0B 1M1AD 5B32B 5DNMD 3REKC 3AZMC 3TU4A 4WU9A 5B33B 3AZNA 4UUZA 5GXQC 2HUEB 3NQUB 3VH5A 3V9RB 1AOIA 3MGSA 3WA9C 4CSRA 4ZUXA 4KGCD 3AZEB 1P3AD 5GT0A 1P3PA 4J8VC 2NZDA 3KXBC 5AVBD 3WAAD 3LJAB 3AZFC 5F99A 5AY8B 1M18C 5AV6D 3C1CB 1BH8B 3X1TB 2YFVB 4NFTA 3LZ1D 1ID3D 5B31A 5AV8C 3WKJD 5DNMC 4LD9B 3WTPA 3W96B 1B6WA 1P3FC 2AROA 3AV2B 5CPJA 1P34A 5GSUB 2RVQD 3B0DB 3AN2D 4QLCA 1P3KA 3UT9A 5B24D 1P3AC 1R4VA 3KWQB 3RELD 4WU9B 4G92C 3AZNB 4UUZB 4H9SC 1AOIB 3X1UA 3WAAC 3MGSB 1P3IA 3VH6A 3AZKC 4H9PA 3X1TD 3MGRB 3AZGC 1TZYC 5AV6C 4G91C 2CV5D 2F8ND 3LZ0C 1P3PB 3LZ1C 3UTAD 4WU8B 1ID3C 2NZDB 2HIOA 1F66B 5DNND 4WNNA 5B33C 3MGPD 3AFAD 4HGAB 3AN2C 1TAFA 5B31B 5AV9D 3REHD 1P3GA 3WTPB 4J8WD 4R8PB 1WWSA 1Q9CA 5CPJB 4YM6B 1P34B 1ZLAD 1M19A 1H3OA 4QLCB 3AZLB 1P3KB 3MGQA 3KUYD 5AVCD 5B1LA 3X1VD 3A6ND 3X1TC 4KHAA 1S32B 4J8UA 1KX5D 5B0YB 2BYKA 1EQZD 3B6FD 1P3BB 5C3IB 4LD9C 3W96C 3AZIA 3X1UB 5DNNC 1P3IB 4EO5B 4Z5TA 3NQJA 3UTBA 4H9OB 3C1BD 3REIA 3B0DC 1P3MD 3AZHD 1BH9A 5CPKA 2HIOB 5AV9C 4R8PD 5CPID 3KWQC 4J8WC 4WV4B 4KUDB 1KX3D 1AOIC 3AZJA 3W99D 3AV1D 4J8XD 5B0ZB 4WZSB 3MGRC 1F1EA 4KGCA 3A6NC 1P3GB 3X1SB 3AZMD 4WU8C 1F66C 3MNND 4ZBJB 5CP6D 3W98B 3REJB 3MGQB 3R45A 5B1LB 5GXQD 4KHAB 4J8UB 4HGAC 1WWIA 5B32G 5B31C 5B2IA 3WTPC 5CPIC 4R8PC 3WKJA 4J8VD 1KX4A 1KX3C 4JJND 4Z5TB 3NQJB 5JRGB 4YM6C 3UTBB 3LELA 4XUJA 3REIB 3B6GA 3W97D 3AZLC 3AZFD 4DRAA 1ULYA 4J8XC 4DRBA 1M18D 5CPKB 1S32C 2FJ7B 5AV5D 5B0YC 3RELA 5AV8D 1P3BC 3REJD 3MNNC 3AZJB 5CP6C 4Z2MH 4EO5C 1P3FD 1JFIA 4X23A 2PYOA 5G49B 3MVDD 5BNXB 4Z66B 2CV5A 2F8NA 3UTAA 4H9RA 4KUDC 3MGPA 4JJNC 2NQBD 1U35A 5B1MB 4E45A 3W97C 1N1JB 5B0ZC 3AFAA 5B40D 3AZKD 3AZGD 2YFWB 5CHLB 2FJ7D 1TZYD 3B0CT 2IO5C 1P3LA 3LZ0D 5AV5C 5B32D 3X1SC 1KX4B 3LELB 2CWEA 5GT3A 3W98C 5B33D 3B0CW 3REJC 2L5AA 3VH5W 3KUYA 4YS3A 5AVCA 3X1VA 3MVDC 1KX5A 3AZED 5B2JA 3TU4B 1EQZA 3B6FA 2JSSA 5JRGC 3UTBC 4X23B 2PYOB 5B1MD 3REIC 2NQBC 3B0BA 3LJAD 4CSRB 5B31G 4ZUXB 1A7WA 5AY8D 5B40C 3C1CD 2LY8A 1P3MA 2FJ7C 5GT0B 4H9RB 5B32C 4LD9D 3W96D 5BO0A 1U35B 5E5AA 3AYWA 3AV2D 3W99A 5F99B 3AV1A 5GSUD 2HUEC 1P3LB 4Z66C 4XZQA 3AZEC 3REKA 3AZMA 3KWQD 2F8NH 4WU9D 5GT3B 3AZND 1P3OA 2AROB 4AWLB 4YS3B 1AOID 5GXQA 5B1MC 3MGSD 4ZUXD 3LJAC 3UT9B 3MGRD 3WA9A 5AY8C 3C1CC 5B2JB 1P3PD 4WU8D 2NZDD 4J8VA 1F66D 3KXBA 1HQ3A 3AV2C 4H9PB 5GSUC 1M18A 5B31D 3O62A 1M1AA 5AV8A 3WTPD 5DNMA 5BO0B 3TU4C 5E5AB 4WU9C 4WNNB 3AZNC 3AYWB 5CPJD 4YM6D 1P34D 1P3FA 2PYOC 4QLCD 3AZLD 1P3KD 3MGSC 4ZUXC 5BNVA 1TAFB 4XZQB 1S32D 3WTPE 4Z2MG 1P3AA 5B0YD 5GT0C 1P3PC 1P3OB 1P3BD 2NZDC 3X1UD 1U35C 1M19B 4H9SA 1P3ID 1H3OB 5AVBA 3WAAA 5F99C 3AZKA 1TZYA 5AV6A 3LZ0A 5BS7A 2HIOD 2BYKB 3LZ1A 1ID3A 2BYMA 3KXBB 5GT3C 3AZIB 4KUDD 1HQ3B 2AROC 4AWLC 5CPJC 1P34C 3NQUA 3V9RA 4QLCC 5B0ZD 1P3KC 3UT9C 3AN2A 1BH9B 3O62B 5B24A 1P3GD 1M1AB 5DNMB 3X1SD 5C3IC 3W98D 3X1UC 3MGQD 1P3IC 5B1LD 4NE6A 5BNVB 4J8UD 4KGCB 3X1TA 1BH8A 1P3AB 2HIOC 3AZID 4LD9A 5E5AC 3W96A 5DNNA 3AYWC 5AVBB 4Z5TD 5JRGD 3UTBD 3R45B 3WAAB 3REID 5AV6B 4G91B 5B2IB 5CPKD 3LZ1B 1ID3B 2BYMB 1P3GC 5AV9A 3WKJB 3REHA 3KWQA 3VH5T 4J8WA 1P3OC 4NE5A 4NE3A 4XUJB 4ZBJC 3AZJD 4H9NA 1M19C 3B6GB 1ZLAA 3MGQC 3AN2B 2F8NG 5B1LC 3MGRA 5B24B 4J8UC 3A6NA 4Z66D 3RELB 4WU8A 3AZIC 1F66A 1HQ3C 1JFIB 4Z5TC 3C1BA 5B2ID 2CV5B 2F8NB 3O62C 1M1AC 3AZHA 5CPKC 5BT1D 3UTAB 5CPIA 4R8PA 1KX4D 5DNNB 3LELD 4XUJD 3MGPB 1KX3A 3B6GD 4YM6A 3AZJC 3AZLA 3AFAB 4J8XA 4KGCC 5FUGA 1S32A 5AV9B 3REHB 4J8WB 5B0YA 3VH6T 1HTAA 3TU4D 1P3BA 4H9NB 1ZLAB 3MNNA 5CP6A 5AVBC 4X23D 2PYOD 3KUYB 5AVCB 3VH6W 4H9OA 3X1VB 3A6NB 2F8NK 4M6BA 1KX5B 5BS7C 5B2IC 3WKJC
chains in the Genus database with same CATH superfamily
5GT0D 4H9QA 5BT1C 1EQZB 3B6FB 1KX4C 4KUDA 2Y2LA 1U35D 3LELC 4XUJC 4JJNA 3B6GC 3C1BB 2RVQC 3W97A 5F99D 5B0ZA 3AZFA 1P3MB 5B24C 3AZHB 1P3LD 4CAYA 5CPIB 5AV5A 5JA4A 3X1SA 3RELC 3F6TA 1KX3B 5GT3D 3W98A 3REJA 2AROD 4YS3D 3W99B 3AV1B 4J8XB 4X23C 2F2AC 5FUGB 3UT9D 3MVDA 2FFFB 2CV5C 5B2JD 3REKB 3AZMB 3UTAC 1KU5A 3MNNB 5CP6B 5KDMA 3MGPC 5JRGA 5GXQB 2NQBA 3AFAC 3WA9B 4E44A 5B40A 3AZGA 2FJ7A 4H9QB 3REHC 1P3LC 5B32A 4J8VB 5E5AD 4JJNB 3AYWD 1ZLAC 3W97B 5B33A 3AZFB 3KUYC 4YS3C 5AVCC 2Y2QA 1M18B 3X1VC 5G49A 4CAYB 2IO5B 4XZQD 5BNXA 5AV5B 5JA4B 1KX5C 4Z66A 3REKD 3AZEA 5AV8B 5B2JC 1EQZC 3B6FC 3AL0C 1P3OD 1P3FB 1M19D 5B1MA 3C1BC 3WA9D 1N1JA 3MVDB 3KSYA 3LJAA 1P3MC 2YFWA 3AZHC 1B67A 5AY8A 3C1CA 2YFVA 5KDMB 3EG5B 4G92B 3KXBD 2NQBB 1HQ3D 3W99C 3AV1C 1BFMA 5B40B 3AZKB 3AV2A 3AZGB 5GSUA 1TZYB 4XZQC 3O62D 3LZ0B 1M1AD 5B32B 5DNMD 3REKC 3AZMC 3TU4A 4WU9A 5B33B 3AZNA 4UUZA 5GXQC 2UWXA 2HUEB 3NQUB 3VH5A 2Y2KA 3V9RB 1AOIA 3MGSA 3WA9C 4CSRA 4ZUXA 1T3UA 4KGCD 3AZEB 1P3AD 3EPJA 5GT0A 1P3PA 4J8VC 2NZDA 3KXBC 5AVBD 3WAAD 3LJAB 3AZFC 5F99A 5AY8B 1M18C 5AV6D 3C1CB 1BH8B 3X1TB 2YFVB 4NFTA 3LZ1D 1ID3D 5B31A 5AV8C 3WKJD 5DNMC 4LD9B 3WTPA 3W96B 1B6WA 1P3FC 2AROA 3AV2B 5CPJA 1P34A 5GSUB 2RVQD 3B0DB 3AN2D 4QLCA 1P3KA 3UT9A 5B24D 1P3AC 1R4VA 2DF4C 3KWQB 2Y2OA 3RELD 4WU9B 4G92C 3AZNB 4UUZB 4H9SC 1AOIB 3X1UA 3WAAC 3MGSB 1P3IA 3VH6A 3AZKC 4H9PA 3X1TD 2G5HC 3MGRB 3AZGC 1TZYC 5AV6C 4G91C 2CV5D 2F8ND 3LZ0C 1P3PB 3LZ1C 3UTAD 4WU8B 1ID3C 2NZDB 2HIOA 1F66B 5DNND 4WNNA 5B33C 3MGPD 3FDDA 3AFAD 4HGAB 3AN2C 1TAFA 5B31B 5AV9D 3REHD 1P3GA 3WTPB 4J8WD 4R8PB 1WWSA 1Q9CA 5CPJB 4YM6B 1P34B 1ZLAD 1M19A 1H3OA 4QLCB 3AZLB 1P3KB 3MGQA 3KUYD 5AVCD 3EPHA 5B1LA 3X1VD 3A6ND 3X1TC 4KHAA 1S32B 4J8UA 1KX5D 5B0YB 2BYKA 1EQZD 3B6FD 1P3BB 5C3IB 4LD9C 3W96C 3AZIA 3X1UB 5DNNC 2G5IC 1P3IB 4EO5B 4Z5TA 3NQJA 1PZRA 3UTBA 4H9OB 3C1BD 3REIA 3B0DC 3KFUG 1P3MD 3AZHD 1BH9A 5CPKA 2HIOB 5AV9C 4R8PD 5CPID 3KWQC 4J8WC 4WV4B 4KUDB 1KX3D 1AOIC 3AZJA 3W99D 3AV1D 4J8XD 5B0ZB 4WZSB 3MGRC 2BG1A 1F1EA 4KGCA 3A1IA 3A6NC 1P3GB 2XD5A 3X1SB 3AZMD 4WU8C 1F66C 3MNND 4ZBJB 5CP6D 3W98B 3REJB 3MGQB 3R45A 5B1LB 5GXQD 4KHAB 4J8UB 4HGAC 4UPKA 1WWIA 5B32G 5B31C 5B2IA 5CPIC 3WTPC 4R8PC 3WKJA 4J8VD 1KX4A 1KX3C 4JJND 4Z5TB 3NQJB 5JRGB 4YM6C 3UTBB 3LELA 4XUJA 3REIB 3B6GA 3W97D 3AZLC 3AZFD 3H0RC 4DRAA 1ULYA 4J8XC 4DRBA 1M18D 2Y2MA 5CPKB 1S32C 2FJ7B 5AV5D 5B0YC 3RELA 5AV8D 1P3BC 3REJD 3MNNC 3AZJB 5CP6C 4Z2MH 4EO5C 1P3FD 1JFIA 4X23A 2PYOA 5G49B 3MVDD 2Y2IA 5BNXB 4Z66B 2CV5A 2F8NA 3UTAA 3H0LC 4H9RA 4KUDC 3MGPA 4JJNC 2NQBD 2JE5A 1U35A 5B1MB 4E45A 3W97C 1N1JB 5B0ZC 3AFAA 5B40D 3AZKD 3AZGD 2YFWB 5CHLB 2FJ7D 1TZYD 3B0CT 2IO5C 1P3LA 3LZ0D 5AV5C 5B32D 3X1SC 1KX4B 2Y2HA 2ZY3A 3LELB 2CWEA 5GT3A 3W98C 5B33D 3B0CW 3REJC 2L5AA 3VH5W 3KUYA 4YS3A 5AVCA 3X1VA 3MVDC 1KX5A 3AZED 5B2JA 3TU4B 1EQZA 3B6FA 2JSSA 5JRGC 3UTBC 4X23B 2PYOB 5B1MD 3REIC 2NQBC 3B0BA 3LJAD 4CSRB 5B31G 4ZUXB 1A7WA 5AY8D 5B40C 3C1CD 2LY8A 1P3MA 2FJ7C 5GT0B 4H9RB 5B32C 4LD9D 3W96D 5BO0A 1U35B 5E5AA 3AYWA 3AV2D 3W99A 5F99B 3AV1A 5GSUD 3H0MC 2HUEC 1P3LB 3EPKA 4Z66C 4XZQA 3AZEC 2RIQA 3REKA 3AZMA 3KWQD 2F8NH 4WU9D 5GT3B 3AZND 1P3OA 2JCHA 2AROB 4AWLB 4YS3B 1AOID 5GXQA 5B1MC 3MGSD 4ZUXD 3LJAC 3UT9B 3MGRD 3WA9A 5AY8C 3C1CC 2DQNC 5B2JB 1P3PD 4WU8D 2NZDD 4J8VA 1F66D 2Y2JA 3KXBA 1W2EA 1HQ3A 2J8PA 3AV2C 4H9PB 5GSUC 2ZY4A 1M18A 5B31D 3O62A 1M1AA 5AV8A 3WTPD 5DNMA 5BO0B 3TU4C 5E5AB 4WU9C 4WNNB 3AZNC 3AYWB 5CPJD 4YM6D 2ZY2A 1P34D 1P3FA 2PYOC 4QLCD 3AZLD 1P3KD 3MGSC 4ZUXC 5BNVA 1TAFB 4XZQB 1S32D 3WTPE 4Z2MG 1P3AA 5B0YD 5GT0C 1P3PC 1P3OB 1P3BD 2NZDC 3X1UD 1U35C 1M19B 4H9SA 1P3ID 1H3OB 5AVBA 3WAAA 5F99C 3AZKA 1TZYA 5AV6A 3LZ0A 3P5JB 2HIOD 5BS7A 2BYKB 3LZ1A 1ID3A 2BYMA 3KXBB 5GT3C 3AZIB 4KUDD 1Z2CB 1HQ3B 2AROC 4AWLC 5CPJC 1P34C 3NQUA 3V9RA 4QLCC 5B0ZD 1P3KC 3UT9C 3AN2A 1BH9B 3O62B 5B24A 1P3GD 1M1AB 5DNMB 3X1SD 2XD1A 2ZM5A 5C3IC 3W98D 3X1UC 3MGQD 1P3IC 5B1LD 4NE6A 5BNVB 4J8UD 4KGCB 3X1TA 1BH8A 1P3AB 2HIOC 3AZID 4LD9A 5E5AC 3W96A 5DNNA 3AYWC 5AVBB 4Z5TD 5JRGD 3UTBD 3R45B 3WAAB 3REID 5AV6B 4G91B 2Y2NA 3A1KA 5B2IB 5CPKD 3LZ1B 1ID3B 2BYMB 1P3GC 5AV9A 3WKJB 3REHA 3KWQA 3VH5T 4J8WA 1P3OC 4NE5A 4NE3A 4XUJB 4ZBJC 3AZJD 4H9NA 1M19C 3B6GB 1ZLAA 3MGQC 3AN2B 2F8NG 5B1LC 3EPLA 3MGRA 5B24B 2ZY5A 4J8UC 3A6NA 4Z66D 3RELB 4WU8A 2VQRA 3AZIC 1F66A 1HQ3C 1JFIB 4Z5TC 3C1BA 5B2ID 2CV5B 2F8NB 3O62C 1M1AC 3AZHA 5CPKC 2Y2PA 5BT1D 3UTAB 5CPIA 4R8PA 1KX4D 4WJ3C 5DNNB 3LELD 4XUJD 3MGPB 1KX3A 3B6GD 4YM6A 3AZJC 3AZLA 3AFAB 4J8XA 4KGCC 5FUGA 1S32A 2W8SA 5AV9B 3REHB 4DQYB 4J8WB 5B0YA 3VH6T 1HTAA 3TU4D 1P3BA 4H9NB 3IP4C 2Y2GA 3MNNA 1ZLAB 5CP6A 5AVBC 4X23D 2PYOD 3KUYB 5AVCB 3VH6W 4H9OA 3X1VB 3A6NB 2F8NK 4M6BA 1KX5B 5BS7C 5B2IC 3WKJC
chains in the Genus database with same CATH topology
5GT0D 4H9QA 5BT1C 1EQZB 3B6FB 1KX4C 4KUDA 2Y2LA 1U35D 3LELC 4XUJC 4JJNA 3B6GC 3C1BB 2RVQC 3W97A 5F99D 5B0ZA 3AZFA 1P3MB 5B24C 3AZHB 1P3LD 4CAYA 5CPIB 5AV5A 5JA4A 3X1SA 3RELC 3F6TA 1KX3B 5GT3D 3W98A 3REJA 2AROD 4YS3D 3W99B 3AV1B 4J8XB 4X23C 2F2AC 5FUGB 3UT9D 3MVDA 2FFFB 2CV5C 5B2JD 3REKB 3AZMB 3UTAC 1KU5A 3MNNB 5CP6B 5KDMA 3MGPC 5JRGA 5GXQB 2NQBA 3AFAC 3WA9B 4E44A 5B40A 3AZGA 2FJ7A 4H9QB 3REHC 1P3LC 5B32A 4J8VB 5E5AD 4JJNB 3AYWD 1ZLAC 3W97B 5B33A 3AZFB 3KUYC 4YS3C 5AVCC 2Y2QA 1M18B 3X1VC 5G49A 4CAYB 2IO5B 4XZQD 5BNXA 5AV5B 5JA4B 1KX5C 4Z66A 3REKD 3AZEA 5AV8B 5B2JC 1EQZC 3B6FC 3AL0C 1P3OD 1P3FB 1M19D 5B1MA 3C1BC 3WA9D 1N1JA 3MVDB 3KSYA 3LJAA 1P3MC 2YFWA 3AZHC 1B67A 5AY8A 3C1CA 2YFVA 5KDMB 3EG5B 4G92B 3KXBD 2NQBB 1HQ3D 3W99C 3AV1C 1BFMA 5B40B 3AZKB 3AV2A 3AZGB 5GSUA 1TZYB 4XZQC 3O62D 3LZ0B 1M1AD 5B32B 5DNMD 3REKC 3AZMC 3TU4A 4WU9A 5B33B 3AZNA 4UUZA 5GXQC 2UWXA 2HUEB 3NQUB 3VH5A 2Y2KA 3V9RB 1AOIA 3MGSA 3WA9C 4CSRA 4ZUXA 1T3UA 4KGCD 3AZEB 1P3AD 3EPJA 5GT0A 1P3PA 4J8VC 2NZDA 3KXBC 5AVBD 3WAAD 3LJAB 3AZFC 5F99A 5AY8B 1M18C 5AV6D 3C1CB 1BH8B 3X1TB 2YFVB 4NFTA 3LZ1D 1ID3D 5B31A 5AV8C 3WKJD 5DNMC 4LD9B 3WTPA 3W96B 1B6WA 1P3FC 2AROA 3AV2B 5CPJA 1P34A 5GSUB 2RVQD 3B0DB 3AN2D 4QLCA 1P3KA 3UT9A 5B24D 1P3AC 1R4VA 2DF4C 3KWQB 2Y2OA 3RELD 4WU9B 4G92C 3AZNB 4UUZB 4H9SC 1AOIB 3X1UA 3WAAC 3MGSB 1P3IA 3VH6A 3AZKC 4H9PA 3X1TD 2G5HC 3MGRB 3AZGC 1TZYC 5AV6C 4G91C 2CV5D 2F8ND 3LZ0C 1P3PB 3LZ1C 3UTAD 4WU8B 1ID3C 2NZDB 2HIOA 1F66B 5DNND 4WNNA 5B33C 3MGPD 3FDDA 3AFAD 4HGAB 3AN2C 1TAFA 5B31B 5AV9D 3REHD 1P3GA 3WTPB 4J8WD 4R8PB 1WWSA 1Q9CA 5CPJB 4YM6B 1P34B 1ZLAD 1M19A 1H3OA 4QLCB 3AZLB 1P3KB 3MGQA 3KUYD 5AVCD 3EPHA 5B1LA 3X1VD 3A6ND 3X1TC 4KHAA 1S32B 4J8UA 1KX5D 5B0YB 2BYKA 1EQZD 3B6FD 1P3BB 5C3IB 4LD9C 3W96C 3AZIA 3X1UB 5DNNC 2G5IC 1P3IB 4EO5B 4Z5TA 3NQJA 1PZRA 3UTBA 4H9OB 3C1BD 3REIA 3B0DC 3KFUG 1P3MD 3AZHD 1BH9A 5CPKA 2HIOB 5AV9C 4R8PD 5CPID 3KWQC 4J8WC 4WV4B 4KUDB 1KX3D 1AOIC 3AZJA 3W99D 3AV1D 4J8XD 5B0ZB 4WZSB 3MGRC 2BG1A 1F1EA 4KGCA 3A1IA 3A6NC 1P3GB 2XD5A 3X1SB 3AZMD 4WU8C 1F66C 3MNND 4ZBJB 5CP6D 3W98B 3REJB 3MGQB 3R45A 5B1LB 5GXQD 4KHAB 4J8UB 4HGAC 4UPKA 1WWIA 5B32G 5B31C 5B2IA 5CPIC 3WTPC 4R8PC 3WKJA 4J8VD 1KX4A 1KX3C 4JJND 4Z5TB 3NQJB 5JRGB 4YM6C 3UTBB 3LELA 4XUJA 3REIB 3B6GA 3W97D 3AZLC 3AZFD 3H0RC 4DRAA 1ULYA 4J8XC 4DRBA 1M18D 2Y2MA 5CPKB 1S32C 2FJ7B 5AV5D 5B0YC 3RELA 5AV8D 1P3BC 3REJD 3MNNC 3AZJB 5CP6C 4Z2MH 4EO5C 1P3FD 1JFIA 4X23A 2PYOA 5G49B 3MVDD 2Y2IA 5BNXB 4Z66B 2CV5A 2F8NA 3UTAA 3H0LC 4H9RA 4KUDC 3MGPA 4JJNC 2NQBD 2JE5A 1U35A 5B1MB 4E45A 3W97C 1N1JB 5B0ZC 3AFAA 5B40D 3AZKD 3AZGD 2YFWB 5CHLB 2FJ7D 1TZYD 3B0CT 2IO5C 1P3LA 3LZ0D 5AV5C 5B32D 3X1SC 1KX4B 2Y2HA 2ZY3A 3LELB 2CWEA 5GT3A 3W98C 5B33D 3B0CW 3REJC 2L5AA 3VH5W 3KUYA 4YS3A 5AVCA 3X1VA 3MVDC 1KX5A 3AZED 5B2JA 3TU4B 1EQZA 3B6FA 2JSSA 5JRGC 3UTBC 4X23B 2PYOB 5B1MD 3REIC 2NQBC 3B0BA 3LJAD 4CSRB 5B31G 4ZUXB 1A7WA 5AY8D 5B40C 3C1CD 2LY8A 1P3MA 2FJ7C 5GT0B 4H9RB 5B32C 4LD9D 3W96D 5BO0A 1U35B 5E5AA 3AYWA 3AV2D 3W99A 5F99B 3AV1A 5GSUD 3H0MC 2HUEC 1P3LB 3EPKA 4Z66C 4XZQA 3AZEC 2RIQA 3REKA 3AZMA 3KWQD 2F8NH 4WU9D 5GT3B 3AZND 1P3OA 2JCHA 2AROB 4AWLB 4YS3B 1AOID 5GXQA 5B1MC 3MGSD 4ZUXD 3LJAC 3UT9B 3MGRD 3WA9A 5AY8C 3C1CC 2DQNC 5B2JB 1P3PD 4WU8D 2NZDD 4J8VA 1F66D 2Y2JA 3KXBA 1W2EA 1HQ3A 2J8PA 3AV2C 4H9PB 5GSUC 2ZY4A 1M18A 5B31D 3O62A 1M1AA 5AV8A 3WTPD 5DNMA 5BO0B 3TU4C 5E5AB 4WU9C 4WNNB 3AZNC 3AYWB 5CPJD 4YM6D 2ZY2A 1P34D 1P3FA 2PYOC 4QLCD 3AZLD 1P3KD 3MGSC 4ZUXC 5BNVA 1TAFB 4XZQB 1S32D 3WTPE 4Z2MG 1P3AA 5B0YD 5GT0C 1P3PC 1P3OB 1P3BD 2NZDC 3X1UD 1U35C 1M19B 4H9SA 1P3ID 1H3OB 5AVBA 3WAAA 5F99C 3AZKA 1TZYA 5AV6A 3LZ0A 3P5JB 2HIOD 5BS7A 2BYKB 3LZ1A 1ID3A 2BYMA 3KXBB 5GT3C 3AZIB 4KUDD 1Z2CB 1HQ3B 2AROC 4AWLC 5CPJC 1P34C 3NQUA 3V9RA 4QLCC 5B0ZD 1P3KC 3UT9C 3AN2A 1BH9B 3O62B 5B24A 1P3GD 1M1AB 5DNMB 3X1SD 2XD1A 2ZM5A 5C3IC 3W98D 3X1UC 3MGQD 1P3IC 5B1LD 4NE6A 5BNVB 4J8UD 4KGCB 3X1TA 1BH8A 1P3AB 2HIOC 3AZID 4LD9A 5E5AC 3W96A 5DNNA 3AYWC 5AVBB 4Z5TD 5JRGD 3UTBD 3R45B 3WAAB 3REID 5AV6B 4G91B 2Y2NA 3A1KA 5B2IB 5CPKD 3LZ1B 1ID3B 2BYMB 1P3GC 5AV9A 3WKJB 3REHA 3KWQA 3VH5T 4J8WA 1P3OC 4NE5A 4NE3A 4XUJB 4ZBJC 3AZJD 4H9NA 1M19C 3B6GB 1ZLAA 3MGQC 3AN2B 2F8NG 5B1LC 3EPLA 3MGRA 5B24B 2ZY5A 4J8UC 3A6NA 4Z66D 3RELB 4WU8A 2VQRA 3AZIC 1F66A 1HQ3C 1JFIB 4Z5TC 3C1BA 5B2ID 2CV5B 2F8NB 3O62C 1M1AC 3AZHA 5CPKC 2Y2PA 5BT1D 3UTAB 5CPIA 4R8PA 1KX4D 4WJ3C 5DNNB 3LELD 4XUJD 3MGPB 1KX3A 3B6GD 4YM6A 3AZJC 3AZLA 3AFAB 4J8XA 4KGCC 5FUGA 1S32A 2W8SA 5AV9B 3REHB 4DQYB 4J8WB 5B0YA 3VH6T 1HTAA 3TU4D 1P3BA 4H9NB 3IP4C 2Y2GA 3MNNA 1ZLAB 5CP6A 5AVBC 4X23D 2PYOD 3KUYB 5AVCB 3VH6W 4H9OA 3X1VB 3A6NB 2F8NK 4M6BA 1KX5B 5BS7C 5B2IC 3WKJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GT0 D;  4H9Q A;  5BT1 C;  1EQZ B;  3B6F B;  1KX4 C;  4KUD A;  1U35 D;  3LEL C;  4XUJ C;  4JJN A;  3B6G C;  3C1B B;  2RVQ C;  3W97 A;  5F99 D;  5B0Z A;  3AZF A;  1P3M B;  5B24 C;  3AZH B;  1P3L D;  4CAY A;  5CPI B;  5AV5 A;  5JA4 A;  3X1S A;  3REL C;  1KX3 B;  5GT3 D;  3W98 A;  3REJ A;  2ARO D;  4YS3 D;  3W99 B;  3AV1 B;  4J8X B;  4X23 C;  5FUG B;  3UT9 D;  3MVD A;  2CV5 C;  5B2J D;  3REK B;  3AZM B;  3UTA C;  1KU5 A;  3MNN B;  5CP6 B;  5KDM A;  3MGP C;  5JRG A;  5GXQ B;  2NQB A;  3AFA C;  3WA9 B;  4E44 A;  5B40 A;  3AZG A;  2FJ7 A;  4H9Q B;  3REH C;  1P3L C;  5B32 A;  4J8V B;  5E5A D;  4JJN B;  3AYW D;  1ZLA C;  3W97 B;  5B33 A;  3AZF B;  3KUY C;  4YS3 C;  5AVC C;  1M18 B;  3X1V C;  5G49 A;  4CAY B;  2IO5 B;  4XZQ D;  5BNX A;  5AV5 B;  5JA4 B;  1KX5 C;  4Z66 A;  3REK D;  3AZE A;  5AV8 B;  5B2J C;  1EQZ C;  3B6F C;  1P3O D;  1P3F B;  1M19 D;  5B1M A;  3C1B C;  3WA9 D;  1N1J A;  3MVD B;  3KSY A;  3LJA A;  1P3M C;  2YFW A;  3AZH C;  1B67 A;  5AY8 A;  3C1C A;  2YFV A;  5KDM B;  4G92 B;  3KXB D;  2NQB B;  1HQ3 D;  3W99 C;  3AV1 C;  1BFM A;  5B40 B;  3AZK B;  3AV2 A;  3AZG B;  5GSU A;  1TZY B;  4XZQ C;  3O62 D;  3LZ0 B;  1M1A D;  5B32 B;  5DNM D;  3REK C;  3AZM C;  3TU4 A;  4WU9 A;  5B33 B;  3AZN A;  4UUZ A;  5GXQ C;  2HUE B;  3NQU B;  3VH5 A;  3V9R B;  1AOI A;  3MGS A;  3WA9 C;  4CSR A;  4ZUX A;  4KGC D;  3AZE B;  1P3A D;  5GT0 A;  1P3P A;  4J8V C;  2NZD A;  3KXB C;  5AVB D;  3WAA D;  3LJA B;  3AZF C;  5F99 A;  5AY8 B;  1M18 C;  5AV6 D;  3C1C B;  1BH8 B;  3X1T B;  2YFV B;  4NFT A;  3LZ1 D;  1ID3 D;  5B31 A;  5AV8 C;  3WKJ D;  5DNM C;  4LD9 B;  3WTP A;  3W96 B;  1B6W A;  1P3F C;  2ARO A;  3AV2 B;  5CPJ A;  1P34 A;  5GSU B;  2RVQ D;  3B0D B;  3AN2 D;  4QLC A;  1P3K A;  3UT9 A;  5B24 D;  1P3A C;  1R4V A;  3KWQ B;  3REL D;  4WU9 B;  4G92 C;  3AZN B;  4UUZ B;  4H9S C;  1AOI B;  3X1U A;  3WAA C;  3MGS B;  1P3I A;  3VH6 A;  3AZK C;  4H9P A;  3X1T D;  3MGR B;  3AZG C;  1TZY C;  5AV6 C;  4G91 C;  2CV5 D;  2F8N D;  3LZ0 C;  1P3P B;  3LZ1 C;  3UTA D;  4WU8 B;  1ID3 C;  2NZD B;  2HIO A;  1F66 B;  5DNN D;  4WNN A;  5B33 C;  3MGP D;  3AFA D;  4HGA B;  3AN2 C;  1TAF A;  5B31 B;  5AV9 D;  3REH D;  1P3G A;  3WTP B;  4J8W D;  4R8P B;  1WWS A;  1Q9C A;  5CPJ B;  4YM6 B;  1P34 B;  1ZLA D;  1M19 A;  1H3O A;  4QLC B;  3AZL B;  1P3K B;  3MGQ A;  3KUY D;  5AVC D;  5B1L A;  3X1V D;  3A6N D;  3X1T C;  4KHA A;  1S32 B;  4J8U A;  1KX5 D;  5B0Y B;  2BYK A;  1EQZ D;  3B6F D;  1P3B B;  5C3I B;  4LD9 C;  3W96 C;  3AZI A;  3X1U B;  5DNN C;  1P3I B;  4EO5 B;  4Z5T A;  3NQJ A;  3UTB A;  4H9O B;  3C1B D;  3REI A;  3B0D C;  1P3M D;  3AZH D;  1BH9 A;  5CPK A;  2HIO B;  5AV9 C;  4R8P D;  5CPI D;  3KWQ C;  4J8W C;  4WV4 B;  4KUD B;  1KX3 D;  1AOI C;  3AZJ A;  3W99 D;  3AV1 D;  4J8X D;  5B0Z B;  4WZS B;  3MGR C;  1F1E A;  4KGC A;  3A6N C;  1P3G B;  3X1S B;  3AZM D;  4WU8 C;  1F66 C;  3MNN D;  4ZBJ B;  5CP6 D;  3W98 B;  3REJ B;  3MGQ B;  3R45 A;  5B1L B;  5GXQ D;  4KHA B;  4J8U B;  4HGA C;  1WWI A;  5B32 G;  5B31 C;  5B2I A;  3WTP C;  5CPI C;  4R8P C;  3WKJ A;  4J8V D;  1KX4 A;  1KX3 C;  4JJN D;  4Z5T B;  3NQJ B;  5JRG B;  4YM6 C;  3UTB B;  3LEL A;  4XUJ A;  3REI B;  3B6G A;  3W97 D;  3AZL C;  3AZF D;  4DRA A;  1ULY A;  4J8X C;  4DRB A;  1M18 D;  5CPK B;  1S32 C;  2FJ7 B;  5AV5 D;  5B0Y C;  3REL A;  5AV8 D;  1P3B C;  3REJ D;  3MNN C;  3AZJ B;  5CP6 C;  4Z2M H;  4EO5 C;  1P3F D;  1JFI A;  4X23 A;  2PYO A;  5G49 B;  3MVD D;  5BNX B;  4Z66 B;  2CV5 A;  2F8N A;  3UTA A;  4H9R A;  4KUD C;  3MGP A;  4JJN C;  2NQB D;  1U35 A;  5B1M B;  4E45 A;  3W97 C;  1N1J B;  5B0Z C;  3AFA A;  5B40 D;  3AZK D;  3AZG D;  2YFW B;  5CHL B;  2FJ7 D;  1TZY D;  3B0C T;  2IO5 C;  1P3L A;  3LZ0 D;  5AV5 C;  5B32 D;  3X1S C;  1KX4 B;  3LEL B;  2CWE A;  5GT3 A;  3W98 C;  5B33 D;  3B0C W;  3REJ C;  2L5A A;  3VH5 W;  3KUY A;  4YS3 A;  5AVC A;  3X1V A;  3MVD C;  1KX5 A;  3AZE D;  5B2J A;  3TU4 B;  1EQZ A;  3B6F A;  2JSS A;  5JRG C;  3UTB C;  4X23 B;  2PYO B;  5B1M D;  3REI C;  2NQB C;  3B0B A;  3LJA D;  4CSR B;  5B31 G;  4ZUX B;  1A7W A;  5AY8 D;  5B40 C;  3C1C D;  2LY8 A;  1P3M A;  2FJ7 C;  5GT0 B;  4H9R B;  5B32 C;  4LD9 D;  3W96 D;  5BO0 A;  1U35 B;  5E5A A;  3AYW A;  3AV2 D;  3W99 A;  5F99 B;  3AV1 A;  5GSU D;  2HUE C;  1P3L B;  4Z66 C;  4XZQ A;  3AZE C;  3REK A;  3AZM A;  3KWQ D;  2F8N H;  4WU9 D;  5GT3 B;  3AZN D;  1P3O A;  2ARO B;  4AWL B;  4YS3 B;  1AOI D;  5GXQ A;  5B1M C;  3MGS D;  4ZUX D;  3LJA C;  3UT9 B;  3MGR D;  3WA9 A;  5AY8 C;  3C1C C;  5B2J B;  1P3P D;  4WU8 D;  2NZD D;  4J8V A;  1F66 D;  3KXB A;  1HQ3 A;  3AV2 C;  4H9P B;  5GSU C;  1M18 A;  5B31 D;  3O62 A;  1M1A A;  5AV8 A;  3WTP D;  5DNM A;  5BO0 B;  3TU4 C;  5E5A B;  4WU9 C;  4WNN B;  3AZN C;  3AYW B;  5CPJ D;  4YM6 D;  1P34 D;  1P3F A;  2PYO C;  4QLC D;  3AZL D;  1P3K D;  3MGS C;  4ZUX C;  5BNV A;  1TAF B;  4XZQ B;  1S32 D;  3WTP E;  4Z2M G;  1P3A A;  5B0Y D;  5GT0 C;  1P3P C;  1P3O B;  1P3B D;  2NZD C;  3X1U D;  1U35 C;  1M19 B;  4H9S A;  1P3I D;  1H3O B;  5AVB A;  3WAA A;  5F99 C;  3AZK A;  1TZY A;  5AV6 A;  3LZ0 A;  5BS7 A;  2HIO D;  2BYK B;  3LZ1 A;  1ID3 A;  2BYM A;  3KXB B;  5GT3 C;  3AZI B;  4KUD D;  1HQ3 B;  2ARO C;  4AWL C;  5CPJ C;  1P34 C;  3NQU A;  3V9R A;  4QLC C;  5B0Z D;  1P3K C;  3UT9 C;  3AN2 A;  1BH9 B;  3O62 B;  5B24 A;  1P3G D;  1M1A B;  5DNM B;  3X1S D;  5C3I C;  3W98 D;  3X1U C;  3MGQ D;  1P3I C;  5B1L D;  4NE6 A;  5BNV B;  4J8U D;  4KGC B;  3X1T A;  1BH8 A;  1P3A B;  2HIO C;  3AZI D;  4LD9 A;  5E5A C;  3W96 A;  5DNN A;  3AYW C;  5AVB B;  4Z5T D;  5JRG D;  3UTB D;  3R45 B;  3WAA B;  3REI D;  5AV6 B;  4G91 B;  5B2I B;  5CPK D;  3LZ1 B;  1ID3 B;  2BYM B;  1P3G C;  5AV9 A;  3WKJ B;  3REH A;  3KWQ A;  3VH5 T;  4J8W A;  1P3O C;  4NE5 A;  4NE3 A;  4XUJ B;  4ZBJ C;  3AZJ D;  4H9N A;  1M19 C;  3B6G B;  1ZLA A;  3MGQ C;  3AN2 B;  2F8N G;  5B1L C;  3MGR A;  5B24 B;  4J8U C;  3A6N A;  4Z66 D;  3REL B;  4WU8 A;  3AZI C;  1F66 A;  1HQ3 C;  1JFI B;  4Z5T C;  3C1B A;  5B2I D;  2CV5 B;  2F8N B;  3O62 C;  1M1A C;  3AZH A;  5CPK C;  5BT1 D;  3UTA B;  5CPI A;  4R8P A;  1KX4 D;  5DNN B;  3LEL D;  4XUJ D;  3MGP B;  1KX3 A;  3B6G D;  4YM6 A;  3AZJ C;  3AZL A;  3AFA B;  4J8X A;  4KGC C;  5FUG A;  1S32 A;  5AV9 B;  3REH B;  4J8W B;  5B0Y A;  3VH6 T;  1HTA A;  3TU4 D;  1P3B A;  4H9N B;  1ZLA B;  3MNN A;  5CP6 A;  5AVB C;  4X23 D;  2PYO D;  3KUY B;  5AVC B;  3VH6 W;  4H9O A;  3X1V B;  3A6N B;  2F8N K;  4M6B A;  1KX5 B;  5BS7 C;  5B2I C;  3WKJ C; 
#chains in the Genus database with same CATH topology
 5GT0 D;  4H9Q A;  5BT1 C;  1EQZ B;  3B6F B;  1KX4 C;  4KUD A;  2Y2L A;  1U35 D;  3LEL C;  4XUJ C;  4JJN A;  3B6G C;  3C1B B;  2RVQ C;  3W97 A;  5F99 D;  5B0Z A;  3AZF A;  1P3M B;  5B24 C;  3AZH B;  1P3L D;  4CAY A;  5CPI B;  5AV5 A;  5JA4 A;  3X1S A;  3REL C;  3F6T A;  1KX3 B;  5GT3 D;  3W98 A;  3REJ A;  2ARO D;  4YS3 D;  3W99 B;  3AV1 B;  4J8X B;  4X23 C;  2F2A C;  5FUG B;  3UT9 D;  3MVD A;  2FFF B;  2CV5 C;  5B2J D;  3REK B;  3AZM B;  3UTA C;  1KU5 A;  3MNN B;  5CP6 B;  5KDM A;  3MGP C;  5JRG A;  5GXQ B;  2NQB A;  3AFA C;  3WA9 B;  4E44 A;  5B40 A;  3AZG A;  2FJ7 A;  4H9Q B;  3REH C;  1P3L C;  5B32 A;  4J8V B;  5E5A D;  4JJN B;  3AYW D;  1ZLA C;  3W97 B;  5B33 A;  3AZF B;  3KUY C;  4YS3 C;  5AVC C;  2Y2Q A;  1M18 B;  3X1V C;  5G49 A;  4CAY B;  2IO5 B;  4XZQ D;  5BNX A;  5AV5 B;  5JA4 B;  1KX5 C;  4Z66 A;  3REK D;  3AZE A;  5AV8 B;  5B2J C;  1EQZ C;  3B6F C;  3AL0 C;  1P3O D;  1P3F B;  1M19 D;  5B1M A;  3C1B C;  3WA9 D;  1N1J A;  3MVD B;  3KSY A;  3LJA A;  1P3M C;  2YFW A;  3AZH C;  1B67 A;  5AY8 A;  3C1C A;  2YFV A;  5KDM B;  3EG5 B;  4G92 B;  3KXB D;  2NQB B;  1HQ3 D;  3W99 C;  3AV1 C;  1BFM A;  5B40 B;  3AZK B;  3AV2 A;  3AZG B;  5GSU A;  1TZY B;  4XZQ C;  3O62 D;  3LZ0 B;  1M1A D;  5B32 B;  5DNM D;  3REK C;  3AZM C;  3TU4 A;  4WU9 A;  5B33 B;  3AZN A;  4UUZ A;  5GXQ C;  2UWX A;  2HUE B;  3NQU B;  3VH5 A;  2Y2K A;  3V9R B;  1AOI A;  3MGS A;  3WA9 C;  4CSR A;  4ZUX A;  1T3U A;  4KGC D;  3AZE B;  1P3A D;  3EPJ A;  5GT0 A;  1P3P A;  4J8V C;  2NZD A;  3KXB C;  5AVB D;  3WAA D;  3LJA B;  3AZF C;  5F99 A;  5AY8 B;  1M18 C;  5AV6 D;  3C1C B;  1BH8 B;  3X1T B;  2YFV B;  4NFT A;  3LZ1 D;  1ID3 D;  5B31 A;  5AV8 C;  3WKJ D;  5DNM C;  4LD9 B;  3WTP A;  3W96 B;  1B6W A;  1P3F C;  2ARO A;  3AV2 B;  5CPJ A;  1P34 A;  5GSU B;  2RVQ D;  3B0D B;  3AN2 D;  4QLC A;  1P3K A;  3UT9 A;  5B24 D;  1P3A C;  1R4V A;  2DF4 C;  3KWQ B;  2Y2O A;  3REL D;  4WU9 B;  4G92 C;  3AZN B;  4UUZ B;  4H9S C;  1AOI B;  3X1U A;  3WAA C;  3MGS B;  1P3I A;  3VH6 A;  3AZK C;  4H9P A;  3X1T D;  2G5H C;  3MGR B;  3AZG C;  1TZY C;  5AV6 C;  4G91 C;  2CV5 D;  2F8N D;  3LZ0 C;  1P3P B;  3LZ1 C;  3UTA D;  4WU8 B;  1ID3 C;  2NZD B;  2HIO A;  1F66 B;  5DNN D;  4WNN A;  5B33 C;  3MGP D;  3FDD A;  3AFA D;  4HGA B;  3AN2 C;  1TAF A;  5B31 B;  5AV9 D;  3REH D;  1P3G A;  3WTP B;  4J8W D;  4R8P B;  1WWS A;  1Q9C A;  5CPJ B;  4YM6 B;  1P34 B;  1ZLA D;  1M19 A;  1H3O A;  4QLC B;  3AZL B;  1P3K B;  3MGQ A;  3KUY D;  5AVC D;  3EPH A;  5B1L A;  3X1V D;  3A6N D;  3X1T C;  4KHA A;  1S32 B;  4J8U A;  1KX5 D;  5B0Y B;  2BYK A;  1EQZ D;  3B6F D;  1P3B B;  5C3I B;  4LD9 C;  3W96 C;  3AZI A;  3X1U B;  5DNN C;  2G5I C;  1P3I B;  4EO5 B;  4Z5T A;  3NQJ A;  1PZR A;  3UTB A;  4H9O B;  3C1B D;  3REI A;  3B0D C;  3KFU G;  1P3M D;  3AZH D;  1BH9 A;  5CPK A;  2HIO B;  5AV9 C;  4R8P D;  5CPI D;  3KWQ C;  4J8W C;  4WV4 B;  4KUD B;  1KX3 D;  1AOI C;  3AZJ A;  3W99 D;  3AV1 D;  4J8X D;  5B0Z B;  4WZS B;  3MGR C;  2BG1 A;  1F1E A;  4KGC A;  3A1I A;  3A6N C;  1P3G B;  2XD5 A;  3X1S B;  3AZM D;  4WU8 C;  1F66 C;  3MNN D;  4ZBJ B;  5CP6 D;  3W98 B;  3REJ B;  3MGQ B;  3R45 A;  5B1L B;  5GXQ D;  4KHA B;  4J8U B;  4HGA C;  4UPK A;  1WWI A;  5B32 G;  5B31 C;  5B2I A;  5CPI C;  3WTP C;  4R8P C;  3WKJ A;  4J8V D;  1KX4 A;  1KX3 C;  4JJN D;  4Z5T B;  3NQJ B;  5JRG B;  4YM6 C;  3UTB B;  3LEL A;  4XUJ A;  3REI B;  3B6G A;  3W97 D;  3AZL C;  3AZF D;  3H0R C;  4DRA A;  1ULY A;  4J8X C;  4DRB A;  1M18 D;  2Y2M A;  5CPK B;  1S32 C;  2FJ7 B;  5AV5 D;  5B0Y C;  3REL A;  5AV8 D;  1P3B C;  3REJ D;  3MNN C;  3AZJ B;  5CP6 C;  4Z2M H;  4EO5 C;  1P3F D;  1JFI A;  4X23 A;  2PYO A;  5G49 B;  3MVD D;  2Y2I A;  5BNX B;  4Z66 B;  2CV5 A;  2F8N A;  3UTA A;  3H0L C;  4H9R A;  4KUD C;  3MGP A;  4JJN C;  2NQB D;  2JE5 A;  1U35 A;  5B1M B;  4E45 A;  3W97 C;  1N1J B;  5B0Z C;  3AFA A;  5B40 D;  3AZK D;  3AZG D;  2YFW B;  5CHL B;  2FJ7 D;  1TZY D;  3B0C T;  2IO5 C;  1P3L A;  3LZ0 D;  5AV5 C;  5B32 D;  3X1S C;  1KX4 B;  2Y2H A;  2ZY3 A;  3LEL B;  2CWE A;  5GT3 A;  3W98 C;  5B33 D;  3B0C W;  3REJ C;  2L5A A;  3VH5 W;  3KUY A;  4YS3 A;  5AVC A;  3X1V A;  3MVD C;  1KX5 A;  3AZE D;  5B2J A;  3TU4 B;  1EQZ A;  3B6F A;  2JSS A;  5JRG C;  3UTB C;  4X23 B;  2PYO B;  5B1M D;  3REI C;  2NQB C;  3B0B A;  3LJA D;  4CSR B;  5B31 G;  4ZUX B;  1A7W A;  5AY8 D;  5B40 C;  3C1C D;  2LY8 A;  1P3M A;  2FJ7 C;  5GT0 B;  4H9R B;  5B32 C;  4LD9 D;  3W96 D;  5BO0 A;  1U35 B;  5E5A A;  3AYW A;  3AV2 D;  3W99 A;  5F99 B;  3AV1 A;  5GSU D;  3H0M C;  2HUE C;  1P3L B;  3EPK A;  4Z66 C;  4XZQ A;  3AZE C;  2RIQ A;  3REK A;  3AZM A;  3KWQ D;  2F8N H;  4WU9 D;  5GT3 B;  3AZN D;  1P3O A;  2JCH A;  2ARO B;  4AWL B;  4YS3 B;  1AOI D;  5GXQ A;  5B1M C;  3MGS D;  4ZUX D;  3LJA C;  3UT9 B;  3MGR D;  3WA9 A;  5AY8 C;  3C1C C;  2DQN C;  5B2J B;  1P3P D;  4WU8 D;  2NZD D;  4J8V A;  1F66 D;  2Y2J A;  3KXB A;  1W2E A;  1HQ3 A;  2J8P A;  3AV2 C;  4H9P B;  5GSU C;  2ZY4 A;  1M18 A;  5B31 D;  3O62 A;  1M1A A;  5AV8 A;  3WTP D;  5DNM A;  5BO0 B;  3TU4 C;  5E5A B;  4WU9 C;  4WNN B;  3AZN C;  3AYW B;  5CPJ D;  4YM6 D;  2ZY2 A;  1P34 D;  1P3F A;  2PYO C;  4QLC D;  3AZL D;  1P3K D;  3MGS C;  4ZUX C;  5BNV A;  1TAF B;  4XZQ B;  1S32 D;  3WTP E;  4Z2M G;  1P3A A;  5B0Y D;  5GT0 C;  1P3P C;  1P3O B;  1P3B D;  2NZD C;  3X1U D;  1U35 C;  1M19 B;  4H9S A;  1P3I D;  1H3O B;  5AVB A;  3WAA A;  5F99 C;  3AZK A;  1TZY A;  5AV6 A;  3LZ0 A;  3P5J B;  2HIO D;  5BS7 A;  2BYK B;  3LZ1 A;  1ID3 A;  2BYM A;  3KXB B;  5GT3 C;  3AZI B;  4KUD D;  1Z2C B;  1HQ3 B;  2ARO C;  4AWL C;  5CPJ C;  1P34 C;  3NQU A;  3V9R A;  4QLC C;  5B0Z D;  1P3K C;  3UT9 C;  3AN2 A;  1BH9 B;  3O62 B;  5B24 A;  1P3G D;  1M1A B;  5DNM B;  3X1S D;  2XD1 A;  2ZM5 A;  5C3I C;  3W98 D;  3X1U C;  3MGQ D;  1P3I C;  5B1L D;  4NE6 A;  5BNV B;  4J8U D;  4KGC B;  3X1T A;  1BH8 A;  1P3A B;  2HIO C;  3AZI D;  4LD9 A;  5E5A C;  3W96 A;  5DNN A;  3AYW C;  5AVB B;  4Z5T D;  5JRG D;  3UTB D;  3R45 B;  3WAA B;  3REI D;  5AV6 B;  4G91 B;  2Y2N A;  3A1K A;  5B2I B;  5CPK D;  3LZ1 B;  1ID3 B;  2BYM B;  1P3G C;  5AV9 A;  3WKJ B;  3REH A;  3KWQ A;  3VH5 T;  4J8W A;  1P3O C;  4NE5 A;  4NE3 A;  4XUJ B;  4ZBJ C;  3AZJ D;  4H9N A;  1M19 C;  3B6G B;  1ZLA A;  3MGQ C;  3AN2 B;  2F8N G;  5B1L C;  3EPL A;  3MGR A;  5B24 B;  2ZY5 A;  4J8U C;  3A6N A;  4Z66 D;  3REL B;  4WU8 A;  2VQR A;  3AZI C;  1F66 A;  1HQ3 C;  1JFI B;  4Z5T C;  3C1B A;  5B2I D;  2CV5 B;  2F8N B;  3O62 C;  1M1A C;  3AZH A;  5CPK C;  2Y2P A;  5BT1 D;  3UTA B;  5CPI A;  4R8P A;  1KX4 D;  4WJ3 C;  5DNN B;  3LEL D;  4XUJ D;  3MGP B;  1KX3 A;  3B6G D;  4YM6 A;  3AZJ C;  3AZL A;  3AFA B;  4J8X A;  4KGC C;  5FUG A;  1S32 A;  2W8S A;  5AV9 B;  3REH B;  4DQY B;  4J8W B;  5B0Y A;  3VH6 T;  1HTA A;  3TU4 D;  1P3B A;  4H9N B;  3IP4 C;  2Y2G A;  3MNN A;  1ZLA B;  5CP6 A;  5AVB C;  4X23 D;  2PYO D;  3KUY B;  5AVC B;  3VH6 W;  4H9O A;  3X1V B;  3A6N B;  2F8N K;  4M6B A;  1KX5 B;  5BS7 C;  5B2I C;  3WKJ C; 
#chains in the Genus database with same CATH homology
 5GT0 D;  4H9Q A;  5BT1 C;  1EQZ B;  3B6F B;  1KX4 C;  4KUD A;  2Y2L A;  1U35 D;  3LEL C;  4XUJ C;  4JJN A;  3B6G C;  3C1B B;  2RVQ C;  3W97 A;  5F99 D;  5B0Z A;  3AZF A;  1P3M B;  5B24 C;  3AZH B;  1P3L D;  4CAY A;  5CPI B;  5AV5 A;  5JA4 A;  3X1S A;  3REL C;  3F6T A;  1KX3 B;  5GT3 D;  3W98 A;  3REJ A;  2ARO D;  4YS3 D;  3W99 B;  3AV1 B;  4J8X B;  4X23 C;  2F2A C;  5FUG B;  3UT9 D;  3MVD A;  2FFF B;  2CV5 C;  5B2J D;  3REK B;  3AZM B;  3UTA C;  1KU5 A;  3MNN B;  5CP6 B;  5KDM A;  3MGP C;  5JRG A;  5GXQ B;  2NQB A;  3AFA C;  3WA9 B;  4E44 A;  5B40 A;  3AZG A;  2FJ7 A;  4H9Q B;  3REH C;  1P3L C;  5B32 A;  4J8V B;  5E5A D;  4JJN B;  3AYW D;  1ZLA C;  3W97 B;  5B33 A;  3AZF B;  3KUY C;  4YS3 C;  5AVC C;  2Y2Q A;  1M18 B;  3X1V C;  5G49 A;  4CAY B;  2IO5 B;  4XZQ D;  5BNX A;  5AV5 B;  5JA4 B;  1KX5 C;  4Z66 A;  3REK D;  3AZE A;  5AV8 B;  5B2J C;  1EQZ C;  3B6F C;  3AL0 C;  1P3O D;  1P3F B;  1M19 D;  5B1M A;  3C1B C;  3WA9 D;  1N1J A;  3MVD B;  3KSY A;  3LJA A;  1P3M C;  2YFW A;  3AZH C;  1B67 A;  5AY8 A;  3C1C A;  2YFV A;  5KDM B;  3EG5 B;  4G92 B;  3KXB D;  2NQB B;  1HQ3 D;  3W99 C;  3AV1 C;  1BFM A;  5B40 B;  3AZK B;  3AV2 A;  3AZG B;  5GSU A;  1TZY B;  4XZQ C;  3O62 D;  3LZ0 B;  1M1A D;  5B32 B;  5DNM D;  3REK C;  3AZM C;  3TU4 A;  4WU9 A;  5B33 B;  3AZN A;  4UUZ A;  5GXQ C;  2UWX A;  2HUE B;  3NQU B;  3VH5 A;  2Y2K A;  3V9R B;  1AOI A;  3MGS A;  3WA9 C;  4CSR A;  4ZUX A;  1T3U A;  4KGC D;  3AZE B;  1P3A D;  3EPJ A;  5GT0 A;  1P3P A;  4J8V C;  2NZD A;  3KXB C;  5AVB D;  3WAA D;  3LJA B;  3AZF C;  5F99 A;  5AY8 B;  1M18 C;  5AV6 D;  3C1C B;  1BH8 B;  3X1T B;  2YFV B;  4NFT A;  3LZ1 D;  1ID3 D;  5B31 A;  5AV8 C;  3WKJ D;  5DNM C;  4LD9 B;  3WTP A;  3W96 B;  1B6W A;  1P3F C;  2ARO A;  3AV2 B;  5CPJ A;  1P34 A;  5GSU B;  2RVQ D;  3B0D B;  3AN2 D;  4QLC A;  1P3K A;  3UT9 A;  5B24 D;  1P3A C;  1R4V A;  2DF4 C;  3KWQ B;  2Y2O A;  3REL D;  4WU9 B;  4G92 C;  3AZN B;  4UUZ B;  4H9S C;  1AOI B;  3X1U A;  3WAA C;  3MGS B;  1P3I A;  3VH6 A;  3AZK C;  4H9P A;  3X1T D;  2G5H C;  3MGR B;  3AZG C;  1TZY C;  5AV6 C;  4G91 C;  2CV5 D;  2F8N D;  3LZ0 C;  1P3P B;  3LZ1 C;  3UTA D;  4WU8 B;  1ID3 C;  2NZD B;  2HIO A;  1F66 B;  5DNN D;  4WNN A;  5B33 C;  3MGP D;  3FDD A;  3AFA D;  4HGA B;  3AN2 C;  1TAF A;  5B31 B;  5AV9 D;  3REH D;  1P3G A;  3WTP B;  4J8W D;  4R8P B;  1WWS A;  1Q9C A;  5CPJ B;  4YM6 B;  1P34 B;  1ZLA D;  1M19 A;  1H3O A;  4QLC B;  3AZL B;  1P3K B;  3MGQ A;  3KUY D;  5AVC D;  3EPH A;  5B1L A;  3X1V D;  3A6N D;  3X1T C;  4KHA A;  1S32 B;  4J8U A;  1KX5 D;  5B0Y B;  2BYK A;  1EQZ D;  3B6F D;  1P3B B;  5C3I B;  4LD9 C;  3W96 C;  3AZI A;  3X1U B;  5DNN C;  2G5I C;  1P3I B;  4EO5 B;  4Z5T A;  3NQJ A;  1PZR A;  3UTB A;  4H9O B;  3C1B D;  3REI A;  3B0D C;  3KFU G;  1P3M D;  3AZH D;  1BH9 A;  5CPK A;  2HIO B;  5AV9 C;  4R8P D;  5CPI D;  3KWQ C;  4J8W C;  4WV4 B;  4KUD B;  1KX3 D;  1AOI C;  3AZJ A;  3W99 D;  3AV1 D;  4J8X D;  5B0Z B;  4WZS B;  3MGR C;  2BG1 A;  1F1E A;  4KGC A;  3A1I A;  3A6N C;  1P3G B;  2XD5 A;  3X1S B;  3AZM D;  4WU8 C;  1F66 C;  3MNN D;  4ZBJ B;  5CP6 D;  3W98 B;  3REJ B;  3MGQ B;  3R45 A;  5B1L B;  5GXQ D;  4KHA B;  4J8U B;  4HGA C;  4UPK A;  1WWI A;  5B32 G;  5B31 C;  5B2I A;  5CPI C;  3WTP C;  4R8P C;  3WKJ A;  4J8V D;  1KX4 A;  1KX3 C;  4JJN D;  4Z5T B;  3NQJ B;  5JRG B;  4YM6 C;  3UTB B;  3LEL A;  4XUJ A;  3REI B;  3B6G A;  3W97 D;  3AZL C;  3AZF D;  3H0R C;  4DRA A;  1ULY A;  4J8X C;  4DRB A;  1M18 D;  2Y2M A;  5CPK B;  1S32 C;  2FJ7 B;  5AV5 D;  5B0Y C;  3REL A;  5AV8 D;  1P3B C;  3REJ D;  3MNN C;  3AZJ B;  5CP6 C;  4Z2M H;  4EO5 C;  1P3F D;  1JFI A;  4X23 A;  2PYO A;  5G49 B;  3MVD D;  2Y2I A;  5BNX B;  4Z66 B;  2CV5 A;  2F8N A;  3UTA A;  3H0L C;  4H9R A;  4KUD C;  3MGP A;  4JJN C;  2NQB D;  2JE5 A;  1U35 A;  5B1M B;  4E45 A;  3W97 C;  1N1J B;  5B0Z C;  3AFA A;  5B40 D;  3AZK D;  3AZG D;  2YFW B;  5CHL B;  2FJ7 D;  1TZY D;  3B0C T;  2IO5 C;  1P3L A;  3LZ0 D;  5AV5 C;  5B32 D;  3X1S C;  1KX4 B;  2Y2H A;  2ZY3 A;  3LEL B;  2CWE A;  5GT3 A;  3W98 C;  5B33 D;  3B0C W;  3REJ C;  2L5A A;  3VH5 W;  3KUY A;  4YS3 A;  5AVC A;  3X1V A;  3MVD C;  1KX5 A;  3AZE D;  5B2J A;  3TU4 B;  1EQZ A;  3B6F A;  2JSS A;  5JRG C;  3UTB C;  4X23 B;  2PYO B;  5B1M D;  3REI C;  2NQB C;  3B0B A;  3LJA D;  4CSR B;  5B31 G;  4ZUX B;  1A7W A;  5AY8 D;  5B40 C;  3C1C D;  2LY8 A;  1P3M A;  2FJ7 C;  5GT0 B;  4H9R B;  5B32 C;  4LD9 D;  3W96 D;  5BO0 A;  1U35 B;  5E5A A;  3AYW A;  3AV2 D;  3W99 A;  5F99 B;  3AV1 A;  5GSU D;  3H0M C;  2HUE C;  1P3L B;  3EPK A;  4Z66 C;  4XZQ A;  3AZE C;  2RIQ A;  3REK A;  3AZM A;  3KWQ D;  2F8N H;  4WU9 D;  5GT3 B;  3AZN D;  1P3O A;  2JCH A;  2ARO B;  4AWL B;  4YS3 B;  1AOI D;  5GXQ A;  5B1M C;  3MGS D;  4ZUX D;  3LJA C;  3UT9 B;  3MGR D;  3WA9 A;  5AY8 C;  3C1C C;  2DQN C;  5B2J B;  1P3P D;  4WU8 D;  2NZD D;  4J8V A;  1F66 D;  2Y2J A;  3KXB A;  1W2E A;  1HQ3 A;  2J8P A;  3AV2 C;  4H9P B;  5GSU C;  2ZY4 A;  1M18 A;  5B31 D;  3O62 A;  1M1A A;  5AV8 A;  3WTP D;  5DNM A;  5BO0 B;  3TU4 C;  5E5A B;  4WU9 C;  4WNN B;  3AZN C;  3AYW B;  5CPJ D;  4YM6 D;  2ZY2 A;  1P34 D;  1P3F A;  2PYO C;  4QLC D;  3AZL D;  1P3K D;  3MGS C;  4ZUX C;  5BNV A;  1TAF B;  4XZQ B;  1S32 D;  3WTP E;  4Z2M G;  1P3A A;  5B0Y D;  5GT0 C;  1P3P C;  1P3O B;  1P3B D;  2NZD C;  3X1U D;  1U35 C;  1M19 B;  4H9S A;  1P3I D;  1H3O B;  5AVB A;  3WAA A;  5F99 C;  3AZK A;  1TZY A;  5AV6 A;  3LZ0 A;  3P5J B;  2HIO D;  5BS7 A;  2BYK B;  3LZ1 A;  1ID3 A;  2BYM A;  3KXB B;  5GT3 C;  3AZI B;  4KUD D;  1Z2C B;  1HQ3 B;  2ARO C;  4AWL C;  5CPJ C;  1P34 C;  3NQU A;  3V9R A;  4QLC C;  5B0Z D;  1P3K C;  3UT9 C;  3AN2 A;  1BH9 B;  3O62 B;  5B24 A;  1P3G D;  1M1A B;  5DNM B;  3X1S D;  2XD1 A;  2ZM5 A;  5C3I C;  3W98 D;  3X1U C;  3MGQ D;  1P3I C;  5B1L D;  4NE6 A;  5BNV B;  4J8U D;  4KGC B;  3X1T A;  1BH8 A;  1P3A B;  2HIO C;  3AZI D;  4LD9 A;  5E5A C;  3W96 A;  5DNN A;  3AYW C;  5AVB B;  4Z5T D;  5JRG D;  3UTB D;  3R45 B;  3WAA B;  3REI D;  5AV6 B;  4G91 B;  2Y2N A;  3A1K A;  5B2I B;  5CPK D;  3LZ1 B;  1ID3 B;  2BYM B;  1P3G C;  5AV9 A;  3WKJ B;  3REH A;  3KWQ A;  3VH5 T;  4J8W A;  1P3O C;  4NE5 A;  4NE3 A;  4XUJ B;  4ZBJ C;  3AZJ D;  4H9N A;  1M19 C;  3B6G B;  1ZLA A;  3MGQ C;  3AN2 B;  2F8N G;  5B1L C;  3EPL A;  3MGR A;  5B24 B;  2ZY5 A;  4J8U C;  3A6N A;  4Z66 D;  3REL B;  4WU8 A;  2VQR A;  3AZI C;  1F66 A;  1HQ3 C;  1JFI B;  4Z5T C;  3C1B A;  5B2I D;  2CV5 B;  2F8N B;  3O62 C;  1M1A C;  3AZH A;  5CPK C;  2Y2P A;  5BT1 D;  3UTA B;  5CPI A;  4R8P A;  1KX4 D;  4WJ3 C;  5DNN B;  3LEL D;  4XUJ D;  3MGP B;  1KX3 A;  3B6G D;  4YM6 A;  3AZJ C;  3AZL A;  3AFA B;  4J8X A;  4KGC C;  5FUG A;  1S32 A;  2W8S A;  5AV9 B;  3REH B;  4DQY B;  4J8W B;  5B0Y A;  3VH6 T;  1HTA A;  3TU4 D;  1P3B A;  4H9N B;  3IP4 C;  2Y2G A;  3MNN A;  1ZLA B;  5CP6 A;  5AVB C;  4X23 D;  2PYO D;  3KUY B;  5AVC B;  3VH6 W;  4H9O A;  3X1V B;  3A6N B;  2F8N K;  4M6B A;  1KX5 B;  5BS7 C;  5B2I C;  3WKJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...