3KXBC

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription/dna
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kxbC00
4XZQA 1ZLAB 3LZ0A 5CP6D 3KWQB 3RELB 3LELB 3C1BD 1BH8B 5BS7C 3MNND 4CAYB 5GT3B 1P3LB 3AZLA 5B24B 5AV9D 5B0YB 5GT0C 2F8NA 3X1UC 3X1VC 5B2IA 4XZQC 3LZ0C 3AZKD 4G92B 4E45A 3AZLB 3AZED 5B2JD 1AOID 2AROB 4QLCA 2F8NB 4Z2MH 5B2IB 3AZJC 2LY8A 1HQ3A 4WU9D 4Z66D 3R45B 3AV2B 1N1JB 4WU8A 5G49B 5CPJC 2PYOA 4KGCA 4H9QA 5E5AA 4JJNC 1HQ3B 3MNNB 4X23B 5AV6C 2FJ7A 3REHD 3AZND 2PYOB 3WAAD 3WTPA 3NQJA 5B31D 4J8XA 2NZDD 4H9PA 4WU8C 4KUDA 4KGCC 2FJ7B 5E5AC 5AV5A 3UT9D 1AOIB 3WA9D 3WTPB 3NQJB 5B1LD 3REKA 5AY8D 3B0DC 3AV1A 1M19A 1M18B 4J8XC 1ID3D 1H3OA 3A6ND 4KUDC 1P3MD 5BO0B 4H9OA 5AV5C 1P3KB 5B0ZB 3MGPD 1M19B 3REKC 1KX3A 4WNNA 3AZGD 3NQUA 3LZ1A 1ULYA 4H9OB 5AVBD 3AV1C 4ZUXD 2NQBA 2HIOA 5B1MD 4J8UB 4WNNB 5FUGA 3NQUB 3LZ1B 3LJAD 1F66B 3REIC 1KX3C 3UTBA 3WKJB 3MGRC 4R8PD 4XUJB 2NQBC 2HIOC 2YFVA 5AY8B 2BYMA 1P3FA 1TAFB 4CSRB 3W98A 1WWSA 3KXBD 3MVDB 3AZHD 3UTBB 4J8WA 3B6FB 1TZYD 2YFVB 1M1AB 5DNNA 2BYMB 5GSUB 4EO5C 4WV4B 1P3FC 3W98C 3O62B 5F99D 4J8WC 5AV8D 4ZBJC 5DNNC 3WTPE 1P34A 5B33A 5B40D 2F8NG 4Z5TD 5CPKB 1Q9CA 4YM6A 4R8PB 1KX4A 2HUEC 3AZFD 3X1SA 1P34B 5B33B 5B32D 3VH5T 1P3GD 5AVCB 3X1TD 4DRBA 1P3PA 4YM6C 1KX4C 5JRGA 5DNMD 3W99D 1P3AA 1U35B 5GXQB 3AZIB 4LD9D 2RVQC 3AFAD 1KX5C 1P3PB 1P3BD 4J8VA 3AN2A 1P3AB 1P3IA 3VH6A 3REJC 1BH9B 3W96A 5JRGC 4AWLB 3AYWC 3AZMB 3KWQA 3RELA 3LELA 3AN2B 1F1EA 1EQZB 2F8NK 2CV5A 5KDMB 3KUYC 5GT0D 3X1UD 5B24A 4J8VC 3UTAA 3X1VD 4XZQD 4YS3B 5B0YA 3LZ0D 1P3IC 5CPIB 3W96C 4H9SA 1S32A 1P3OB 1ZLAC 3B6GB 2CV5B 3KWQC 3RELC 3LELC 1R4VA 3UTAB 2AROA 3V9RA 1HTAA 5GT3C 1P3LC 3AZJD 1S32B 5B24C 4LD9B 4G91B 5B0YC 1P3BB 4H9SC 3V9RB 3MGSA 5CPJD 3R45A 3AZLC 3AV2A 1N1JA 4JJND 5G49A 2AROC 5CP6A 5JA4B 5AV6D 5B2IC 3MNNA 3C1CB 3MGSB 4X23A 5GT0B 4QLCC 4WU8D 1B6WA 5CP6B 4KGCD 3C1BB 5E5AD 3AV2D 3AZEA 1HQ3C 3MNNC 5AV9B 1AOIA 4X23C 3B0BA 2PYOC 4J8XD 3AZKB 4KUDD 1M18A 3AZEB 5B2JB 5AV5D 2YFWB 4WU9A 5BO0A 2FJ7C 3REKD 1P3KA 5B0ZA 1AOIC 3WTPC 2L5AA 3AV1D 4WU9B 4Z66B 1M18C 5BT1C 4J8UA 3REID 1P3KC 5B0ZC 1KX3D 1F66A 3MGRD 1M19C 3REHB 3AZNB 3UT9A 3WKJA 2NQBD 2HIOD 3WAAB 5B1LA 4XUJA 5B31B 2NZDB 5AY8A 1TAFA 4CSRA 4J8UC 3MVDA 3UT9B 3WA9B 3LZ1C 3B6FA 5B1LB 1F66C 1M1AA 3WKJC 5GSUA 1P3FD 4XUJC 1ID3B 3KSYA 3W98D 3A6NB 1P3MB 4J8WD 3O62A 3MVDC 4ZUXA 3UTBC 3B6FC 3MGPB 5DNND 3MGQD 1KU5A 3AZGB 1M1AC 3LJAA 5GSUC 5AVBB 4H9NB 4ZUXB 5B1MB 5CPKA 4R8PA 3O62C 4HGAB 3LJAB 1BFMA 3AZHA 3KXBA 3W97D 1TZYA 5BNXB 5AVCA 4YM6D 1KX4D 5BNVB 4H9RB 5CPKC 4R8PC 3KXBB 3AZHB 1U35A 5GXQA 1TZYB 2RVQD 1P34C 5B33C 3AZIA 1KX5D 5F99A 3TU4D 1A7WA 3MGQB 5AV8A 5AVCC 3REJD 5JRGD 3X1SC 1BH9A 3AYWD 5B40A 5F99B 4WZSB 4Z5TA 3AZMA 1U35C 5GXQC 3AZIC 5AV8B 3KUYD 1EQZA 4J8VD 5KDMA 1P3PC 5B40B 3VH6T 3W97B 3W96D 4YS3A 5B32A 4Z5TB 1P3AC 1ZLAD 5CPIA 3AZFB 3KWQD 4AWLC 3RELD 3X1TA 3LELD 1P3OA 3B6GA 3AZMC 2IO5B 3VH5W 5GT3D 1P3LD 3AN2C 1EQZC 5B32B 5B24D 4UUZB 1P3GB 5B0YD 4KHAB 3X1TB 4LD9A 4YS3C 3AFAA 3TU4B 5CPIC 1P3BA 5DNMB 3AZLD 1P3OC 3W99B 2CWEA 3B6GC 4Z2MG 5C3IB 2AROD 2CV5C 1B67A 2F8ND 3UTAC 5B31G 5B2ID 3AFAB 5JA4A 3B0CW 3C1CA 1S32C 4G91C 4QLCD 4G92C 5GT0A 1P3BC 3C1BA 1HQ3D 4X23D 3X1UB 3C1CC 5AV9A 3X1VB 4XZQB 4NE5A 3MGSC 2PYOD 3LZ0B 3AV2C 3AZJA 3AZKA 5CP6C 5B2JA 3C1BC 2FJ7D 2YFWA 5CPJA 3WTPD 3AZJB 4JJNA 5AV9C 5AV6A 1M18D 4Z66A 3AZKC 5CPJB 5BT1D 4QLCB 3AZEC 1JFIA 5B2JC 4JJNB 1P3KD 5B0ZD 5AV6B 1M19D 2JSSA 1JFIB 3REHA 3AZNA 4M6BA 4WU9C 4Z66C 4WU8B 3WAAA 5B31A 4J8UD 4KGCB 4H9QB 5E5AB 2NZDA 3LZ1D 1F66D 3WA9A 3WKJD 3B0DB 4XUJD 3REHC 3AZNC 4J8XB 4NE3A 4H9PB 3WAAC 4KUDB 5B31C 1ID3A 2NZDC 3MVDD 3A6NA 5AV5B 5CHLB 1P3MA 3UTBD 3B6FD 3REKB 3UT9C 3WA9C 3MGPA 1M1AD 5B1LC 5GSUD 3AZGA 3AV1B 5AY8C 3REIA 1H3OB 5AVBA 3MGRA 4H9NA 4E44A 5B32G 1ID3C 5B1MA 3O62D 3A6NC 1P3MC 3REIB 1KX3B 3MGPC 3MGRB 3AZGC 2NQBB 2HIOB 1WWIA 5AVBC 5BNXA 4ZUXC 5CPKD 5B1MC 5BNVA 5FUGB 4H9RA 1P34D 4NFTA 4HGAC 5B33D 3LJAC 2BYKA 4EO5B 5AVCD 3X1SD 3MGQA 1P3FB 3W98B 2BYKB 4J8WB 3AZHC 3KXBC 1U35D 5GXQD 3AZID 4ZBJB 5DNNB 1TZYC 1P3PD 1P3AD 3MGQC 2HUEB 3W97A 3AZMD 3AZFA 5F99C 3AN2D 4NE6A 1EQZD 1P3ID 5AV8C 3VH5A 4UUZA 4YS3D 1P3GA 1KX5A 2F8NH 4YM6B 4KHAA 5B40C 1KX4B 5CPID 3W97C 3TU4A 4Z5TC 1P3OD 3X1SB 3B6GD 2CV5D 5DNMA 3AZFC 3REJA 3W99A 3UTAD 2IO5C 3AYWA 1KX5B 5B32C 1S32D 1P3GC 3KUYA 3REJB 3X1TC 5JRGB 3TU4C 3AYWB 5DNMC 3B0CT 3W99C 5BS7A 1ZLAA 5C3IC 3KUYB 4LD9C 3VH6W 3C1CD 1BH8A 3AFAC 4DRAA 4J8VB 4CAYA 3MGSD 5GT3A 1P3LA 1P3IB 3X1UA 3X1VA 3W96B
chains in the Genus database with same CATH superfamily
4XZQA 1ZLAB 3LZ0A 5CP6D 3KWQB 3RELB 3LELB 3C1BD 1BH8B 5BS7C 3MNND 4CAYB 5GT3B 1P3LB 3AZLA 5B24B 5AV9D 5B0YB 5GT0C 3EPKA 2F8NA 3F6TA 3X1UC 3X1VC 5B2IA 4XZQC 3LZ0C 3AZKD 4G92B 4E45A 3AZLB 3AZED 5B2JD 1AOID 2AROB 4QLCA 2F8NB 2XD1A 4Z2MH 5B2IB 3AZJC 2LY8A 1HQ3A 4WU9D 4Z66D 3R45B 3AV2B 1N1JB 4WU8A 2ZY2A 5G49B 5CPJC 2PYOA 4KGCA 4H9QA 5E5AA 4JJNC 1HQ3B 3MNNB 4X23B 5AV6C 2FJ7A 2VQRA 3REHD 3AZND 2PYOB 3WAAD 3WTPA 3NQJA 5B31D 4J8XA 2NZDD 4H9PA 4WU8C 4KUDA 4KGCC 2FJ7B 5E5AC 5AV5A 3UT9D 1AOIB 3WA9D 3WTPB 3NQJB 5B1LD 3REKA 5AY8D 3B0DC 3AV1A 1M19A 1M18B 4J8XC 1ID3D 1H3OA 3A6ND 4KUDC 1P3MD 5BO0B 4H9OA 2FFFB 5AV5C 1P3KB 5B0ZB 3MGPD 1Z2CB 1M19B 3REKC 1KX3A 4WNNA 3AZGD 3NQUA 3LZ1A 1ULYA 4H9OB 5AVBD 3AV1C 4ZUXD 2NQBA 2HIOA 2Y2QA 5B1MD 4J8UB 4WNNB 5FUGA 3NQUB 3LZ1B 3LJAD 3EG5B 1F66B 3REIC 1KX3C 3UTBA 3WKJB 3MGRC 4R8PD 4XUJB 2NQBC 2HIOC 2YFVA 5AY8B 2BYMA 1P3FA 1TAFB 4CSRB 3W98A 1WWSA 3KXBD 3MVDB 3AZHD 3UTBB 2Y2NA 4J8WA 3B6FB 1TZYD 2YFVB 1M1AB 5DNNA 2BYMB 5GSUB 4EO5C 4WV4B 2Y2OA 1P3FC 3W98C 3O62B 5F99D 4J8WC 5AV8D 4ZBJC 5DNNC 3KFUG 3WTPE 1P34A 5B33A 5B40D 2F8NG 4Z5TD 3A1IA 5CPKB 1Q9CA 4YM6A 4R8PB 1KX4A 2HUEC 3AZFD 2ZY4A 3X1SA 1P34B 5B33B 5B32D 2DF4C 3VH5T 1P3GD 4UPKA 5AVCB 3X1TD 4DRBA 1P3PA 4YM6C 1KX4C 5JRGA 5DNMD 3W99D 1P3AA 2JE5A 1U35B 5GXQB 3AZIB 4LD9D 2RVQC 3AFAD 1KX5C 1P3PB 1P3BD 4J8VA 3AN2A 1P3AB 1P3IA 3VH6A 3REJC 1BH9B 3W96A 5JRGC 4AWLB 3AYWC 2Y2HA 3AZMB 3KWQA 3RELA 3LELA 3AN2B 1F1EA 1EQZB 2F8NK 2CV5A 5KDMB 3KUYC 5GT0D 3X1UD 5B24A 2ZY3A 4J8VC 3UTAA 4XZQD 3X1VD 5B0YA 4YS3B 3LZ0D 1P3IC 5CPIB 3W96C 4H9SA 1S32A 1P3OB 1ZLAC 3B6GB 2CV5B 3AL0C 3KWQC 3RELC 3LELC 1R4VA 3UTAB 2AROA 3V9RA 1HTAA 5GT3C 1P3LC 3AZJD 1S32B 5B24C 4LD9B 4G91B 5B0YC 1P3BB 4H9SC 3V9RB 3MGSA 5CPJD 3R45A 3AZLC 3AV2A 1N1JA 4JJND 5G49A 4DQYB 2AROC 5CP6A 5JA4B 2XD5A 5AV6D 5B2IC 3MNNA 3C1CB 3MGSB 4X23A 5GT0B 4QLCC 4WU8D 1B6WA 5CP6B 4KGCD 3C1BB 5E5AD 3AV2D 3AZEA 1HQ3C 3MNNC 5AV9B 1AOIA 4X23C 3B0BA 2BG1A 2PYOC 4J8XD 3AZKB 4KUDD 1M18A 3AZEB 5B2JB 5AV5D 2YFWB 4WU9A 5BO0A 2FJ7C 3REKD 1P3KA 5B0ZA 1AOIC 3WTPC 2L5AA 3AV1D 4WU9B 4Z66B 1M18C 5BT1C 4J8UA 3REID 1P3KC 5B0ZC 1KX3D 3EPLA 1F66A 3MGRD 1M19C 3A1KA 3REHB 3AZNB 3UT9A 3WKJA 2NQBD 2HIOD 3WAAB 5B1LA 4XUJA 5B31B 2NZDB 5AY8A 1TAFA 4CSRA 4J8UC 3MVDA 3UT9B 3WA9B 3LZ1C 3B6FA 5B1LB 1F66C 1M1AA 3WKJC 5GSUA 1P3FD 4XUJC 3H0LC 1ID3B 3KSYA 3W98D 3A6NB 3H0MC 1P3MB 4J8WD 3O62A 3MVDC 4ZUXA 3UTBC 3B6FC 3MGPB 5DNND 3MGQD 1KU5A 1PZRA 3AZGB 1M1AC 3LJAA 5GSUC 5AVBB 4H9NB 4ZUXB 5B1MB 5CPKA 4R8PA 3O62C 4HGAB 3LJAB 1BFMA 3AZHA 3KXBA 2RIQA 3W97D 1TZYA 5BNXB 5AVCA 4YM6D 1KX4D 5BNVB 4H9RB 5CPKC 4R8PC 3KXBB 3AZHB 1U35A 5GXQA 1TZYB 2RVQD 1P34C 5B33C 3AZIA 1KX5D 1T3UA 5F99A 3TU4D 1A7WA 3MGQB 5AV8A 5AVCC 3REJD 5JRGD 3X1SC 1BH9A 3AYWD 5B40A 5F99B 4WZSB 4Z5TA 3AZMA 1U35C 5GXQC 3AZIC 5AV8B 3KUYD 1EQZA 4J8VD 5KDMA 1P3PC 5B40B 3VH6T 3W97B 2Y2IA 4YS3A 5B32A 4Z5TB 1P3AC 1ZLAD 2DQNC 3W96D 5CPIA 3AZFB 3KWQD 4AWLC 3RELD 3X1TA 3LELD 1P3OA 3B6GA 3EPHA 4WJ3C 3AZMC 2IO5B 3VH5W 5GT3D 1P3LD 3AN2C 1EQZC 5B32B 5B24D 4UUZB 1P3GB 5B0YD 4KHAB 3X1TB 4LD9A 4YS3C 3AFAA 2ZM5A 3TU4B 5CPIC 1P3BA 5DNMB 3AZLD 1P3OC 3W99B 2CWEA 3B6GC 4Z2MG 5C3IB 2AROD 2CV5C 1B67A 2F8ND 3UTAC 5B31G 5B2ID 2Y2PA 3AFAB 3IP4C 2G5HC 5JA4A 3B0CW 3C1CA 1S32C 2F2AC 4G91C 4QLCD 4G92C 1W2EA 5GT0A 1P3BC 3C1BA 1HQ3D 4X23D 3X1UB 3C1CC 5AV9A 3X1VB 4XZQB 4NE5A 3MGSC 2PYOD 3LZ0B 3AV2C 3AZJA 3AZKA 5CP6C 5B2JA 3C1BC 2FJ7D 2YFWA 5CPJA 3WTPD 3AZJB 4JJNA 5AV9C 2W8SA 5AV6A 1M18D 4Z66A 3AZKC 5CPJB 5BT1D 4QLCB 3AZEC 1JFIA 5B2JC 4JJNB 1P3KD 5B0ZD 5AV6B 1M19D 2JSSA 1JFIB 3REHA 3AZNA 4M6BA 4WU9C 4Z66C 4WU8B 2Y2MA 3WAAA 5B31A 4J8UD 4KGCB 4H9QB 5E5AB 2NZDA 3LZ1D 1F66D 3WA9A 3WKJD 3B0DB 4XUJD 3REHC 3AZNC 4J8XB 4NE3A 4H9PB 3WAAC 4KUDB 5B31C 1ID3A 2NZDC 3MVDD 3A6NA 5AV5B 5CHLB 1P3MA 3UTBD 3B6FD 3REKB 3UT9C 3WA9C 3MGPA 1M1AD 5B1LC 5GSUD 3AZGA 3AV1B 5AY8C 2Y2KA 3REIA 1H3OB 5AVBA 3MGRA 2J8PA 4H9NA 4E44A 5B32G 1ID3C 5B1MA 3O62D 3A6NC 1P3MC 2Y2JA 3REIB 1KX3B 3MGPC 3MGRB 3AZGC 2NQBB 2HIOB 1WWIA 5AVBC 5BNXA 4ZUXC 5CPKD 5B1MC 5BNVA 5FUGB 4H9RA 1P34D 4NFTA 4HGAC 3H0RC 5B33D 3LJAC 2BYKA 4EO5B 5AVCD 3X1SD 3MGQA 1P3FB 3W98B 3P5JB 2BYKB 4J8WB 2Y2GA 3AZHC 3FDDA 3KXBC 5GXQD 1U35D 2ZY5A 3AZID 4ZBJB 5DNNB 1TZYC 1P3PD 1P3AD 3MGQC 2HUEB 3W97A 2Y2LA 3AZMD 3AZFA 2JCHA 5F99C 3AN2D 4NE6A 1EQZD 1P3ID 5AV8C 3EPJA 3VH5A 4UUZA 4YS3D 1P3GA 2UWXA 1KX5A 2F8NH 4YM6B 4KHAA 5B40C 2G5IC 5CPID 1KX4B 3W97C 3TU4A 4Z5TC 1P3OD 3X1SB 3B6GD 2CV5D 5DNMA 3AZFC 3REJA 3W99A 3UTAD 2IO5C 3AYWA 1KX5B 5B32C 1S32D 1P3GC 3KUYA 3REJB 3X1TC 5JRGB 3TU4C 3AYWB 5DNMC 3B0CT 3W99C 5BS7A 1ZLAA 5C3IC 3KUYB 4LD9C 3VH6W 3C1CD 1BH8A 3AFAC 4DRAA 4J8VB 4CAYA 3MGSD 5GT3A 1P3LA 1P3IB 3X1UA 3X1VA 3W96B
chains in the Genus database with same CATH topology
4XZQA 1ZLAB 3LZ0A 5CP6D 3KWQB 3RELB 3LELB 3C1BD 1BH8B 5BS7C 3MNND 4CAYB 5GT3B 1P3LB 3AZLA 5B24B 5AV9D 5B0YB 5GT0C 3EPKA 2F8NA 3F6TA 3X1UC 3X1VC 5B2IA 4XZQC 3LZ0C 3AZKD 4G92B 4E45A 3AZLB 3AZED 5B2JD 1AOID 2AROB 4QLCA 2F8NB 2XD1A 4Z2MH 5B2IB 3AZJC 2LY8A 1HQ3A 4WU9D 4Z66D 3R45B 3AV2B 1N1JB 4WU8A 2ZY2A 5G49B 5CPJC 2PYOA 4KGCA 4H9QA 5E5AA 4JJNC 1HQ3B 3MNNB 4X23B 5AV6C 2FJ7A 2VQRA 3REHD 3AZND 2PYOB 3WAAD 3WTPA 3NQJA 5B31D 4J8XA 2NZDD 4H9PA 4WU8C 4KUDA 4KGCC 2FJ7B 5E5AC 5AV5A 3UT9D 1AOIB 3WA9D 3WTPB 3NQJB 5B1LD 3REKA 5AY8D 3B0DC 3AV1A 1M19A 1M18B 4J8XC 1ID3D 1H3OA 3A6ND 4KUDC 1P3MD 5BO0B 4H9OA 2FFFB 5AV5C 1P3KB 5B0ZB 3MGPD 1Z2CB 1M19B 3REKC 1KX3A 4WNNA 3AZGD 3NQUA 3LZ1A 1ULYA 4H9OB 5AVBD 3AV1C 4ZUXD 2NQBA 2HIOA 2Y2QA 5B1MD 4J8UB 4WNNB 5FUGA 3NQUB 3LZ1B 3LJAD 3EG5B 1F66B 3REIC 1KX3C 3UTBA 3WKJB 3MGRC 4R8PD 4XUJB 2NQBC 2HIOC 2YFVA 5AY8B 2BYMA 1P3FA 1TAFB 4CSRB 3W98A 1WWSA 3KXBD 3MVDB 3AZHD 3UTBB 2Y2NA 4J8WA 3B6FB 1TZYD 2YFVB 1M1AB 5DNNA 2BYMB 5GSUB 4EO5C 4WV4B 2Y2OA 1P3FC 3W98C 3O62B 5F99D 4J8WC 5AV8D 4ZBJC 5DNNC 3KFUG 3WTPE 1P34A 5B33A 5B40D 2F8NG 4Z5TD 3A1IA 5CPKB 1Q9CA 4YM6A 4R8PB 1KX4A 2HUEC 3AZFD 2ZY4A 3X1SA 1P34B 5B33B 5B32D 2DF4C 3VH5T 1P3GD 4UPKA 5AVCB 3X1TD 4DRBA 1P3PA 4YM6C 1KX4C 5JRGA 5DNMD 3W99D 1P3AA 2JE5A 1U35B 5GXQB 3AZIB 4LD9D 2RVQC 3AFAD 1KX5C 1P3PB 1P3BD 4J8VA 3AN2A 1P3AB 1P3IA 3VH6A 3REJC 1BH9B 3W96A 5JRGC 4AWLB 3AYWC 2Y2HA 3AZMB 3KWQA 3RELA 3LELA 3AN2B 1F1EA 1EQZB 2F8NK 2CV5A 5KDMB 3KUYC 5GT0D 3X1UD 5B24A 2ZY3A 4J8VC 3UTAA 4XZQD 3X1VD 5B0YA 4YS3B 3LZ0D 1P3IC 5CPIB 3W96C 4H9SA 1S32A 1P3OB 1ZLAC 3B6GB 2CV5B 3AL0C 3KWQC 3RELC 3LELC 1R4VA 3UTAB 2AROA 3V9RA 1HTAA 5GT3C 1P3LC 3AZJD 1S32B 5B24C 4LD9B 4G91B 5B0YC 1P3BB 4H9SC 3V9RB 3MGSA 5CPJD 3R45A 3AZLC 3AV2A 1N1JA 4JJND 5G49A 4DQYB 2AROC 5CP6A 5JA4B 2XD5A 5AV6D 5B2IC 3MNNA 3C1CB 3MGSB 4X23A 5GT0B 4QLCC 4WU8D 1B6WA 5CP6B 4KGCD 3C1BB 5E5AD 3AV2D 3AZEA 1HQ3C 3MNNC 5AV9B 1AOIA 4X23C 3B0BA 2BG1A 2PYOC 4J8XD 3AZKB 4KUDD 1M18A 3AZEB 5B2JB 5AV5D 2YFWB 4WU9A 5BO0A 2FJ7C 3REKD 1P3KA 5B0ZA 1AOIC 3WTPC 2L5AA 3AV1D 4WU9B 4Z66B 1M18C 5BT1C 4J8UA 3REID 1P3KC 5B0ZC 1KX3D 3EPLA 1F66A 3MGRD 1M19C 3A1KA 3REHB 3AZNB 3UT9A 3WKJA 2NQBD 2HIOD 3WAAB 5B1LA 4XUJA 5B31B 2NZDB 5AY8A 1TAFA 4CSRA 4J8UC 3MVDA 3UT9B 3WA9B 3LZ1C 3B6FA 5B1LB 1F66C 1M1AA 3WKJC 5GSUA 1P3FD 4XUJC 3H0LC 1ID3B 3KSYA 3W98D 3A6NB 3H0MC 1P3MB 4J8WD 3O62A 3MVDC 4ZUXA 3UTBC 3B6FC 3MGPB 5DNND 3MGQD 1KU5A 1PZRA 3AZGB 1M1AC 3LJAA 5GSUC 5AVBB 4H9NB 4ZUXB 5B1MB 5CPKA 4R8PA 3O62C 4HGAB 3LJAB 1BFMA 3AZHA 3KXBA 2RIQA 3W97D 1TZYA 5BNXB 5AVCA 4YM6D 1KX4D 5BNVB 4H9RB 5CPKC 4R8PC 3KXBB 3AZHB 1U35A 5GXQA 1TZYB 2RVQD 1P34C 5B33C 3AZIA 1KX5D 1T3UA 5F99A 3TU4D 1A7WA 3MGQB 5AV8A 5AVCC 3REJD 5JRGD 3X1SC 1BH9A 3AYWD 5B40A 5F99B 4WZSB 4Z5TA 3AZMA 1U35C 5GXQC 3AZIC 5AV8B 3KUYD 1EQZA 4J8VD 5KDMA 1P3PC 5B40B 3VH6T 3W97B 2Y2IA 4YS3A 5B32A 4Z5TB 1P3AC 1ZLAD 2DQNC 3W96D 5CPIA 3AZFB 3KWQD 4AWLC 3RELD 3X1TA 3LELD 1P3OA 3B6GA 3EPHA 4WJ3C 3AZMC 2IO5B 3VH5W 5GT3D 1P3LD 3AN2C 1EQZC 5B32B 5B24D 4UUZB 1P3GB 5B0YD 4KHAB 3X1TB 4LD9A 4YS3C 3AFAA 2ZM5A 3TU4B 5CPIC 1P3BA 5DNMB 3AZLD 1P3OC 3W99B 2CWEA 3B6GC 4Z2MG 5C3IB 2AROD 2CV5C 1B67A 2F8ND 3UTAC 5B31G 5B2ID 2Y2PA 3AFAB 3IP4C 2G5HC 5JA4A 3B0CW 3C1CA 1S32C 2F2AC 4G91C 4QLCD 4G92C 1W2EA 5GT0A 1P3BC 3C1BA 1HQ3D 4X23D 3X1UB 3C1CC 5AV9A 3X1VB 4XZQB 4NE5A 3MGSC 2PYOD 3LZ0B 3AV2C 3AZJA 3AZKA 5CP6C 5B2JA 3C1BC 2FJ7D 2YFWA 5CPJA 3WTPD 3AZJB 4JJNA 5AV9C 2W8SA 5AV6A 1M18D 4Z66A 3AZKC 5CPJB 5BT1D 4QLCB 3AZEC 1JFIA 5B2JC 4JJNB 1P3KD 5B0ZD 5AV6B 1M19D 2JSSA 1JFIB 3REHA 3AZNA 4M6BA 4WU9C 4Z66C 4WU8B 2Y2MA 3WAAA 5B31A 4J8UD 4KGCB 4H9QB 5E5AB 2NZDA 3LZ1D 1F66D 3WA9A 3WKJD 3B0DB 4XUJD 3REHC 3AZNC 4J8XB 4NE3A 4H9PB 3WAAC 4KUDB 5B31C 1ID3A 2NZDC 3MVDD 3A6NA 5AV5B 5CHLB 1P3MA 3UTBD 3B6FD 3REKB 3UT9C 3WA9C 3MGPA 1M1AD 5B1LC 5GSUD 3AZGA 3AV1B 5AY8C 2Y2KA 3REIA 1H3OB 5AVBA 3MGRA 2J8PA 4H9NA 4E44A 5B32G 1ID3C 5B1MA 3O62D 3A6NC 1P3MC 2Y2JA 3REIB 1KX3B 3MGPC 3MGRB 3AZGC 2NQBB 2HIOB 1WWIA 5AVBC 5BNXA 4ZUXC 5CPKD 5B1MC 5BNVA 5FUGB 4H9RA 1P34D 4NFTA 4HGAC 3H0RC 5B33D 3LJAC 2BYKA 4EO5B 5AVCD 3X1SD 3MGQA 1P3FB 3W98B 3P5JB 2BYKB 4J8WB 2Y2GA 3AZHC 3FDDA 3KXBC 5GXQD 1U35D 2ZY5A 3AZID 4ZBJB 5DNNB 1TZYC 1P3PD 1P3AD 3MGQC 2HUEB 3W97A 2Y2LA 3AZMD 3AZFA 2JCHA 5F99C 3AN2D 4NE6A 1EQZD 1P3ID 5AV8C 3EPJA 3VH5A 4UUZA 4YS3D 1P3GA 2UWXA 1KX5A 2F8NH 4YM6B 4KHAA 5B40C 2G5IC 5CPID 1KX4B 3W97C 3TU4A 4Z5TC 1P3OD 3X1SB 3B6GD 2CV5D 5DNMA 3AZFC 3REJA 3W99A 3UTAD 2IO5C 3AYWA 1KX5B 5B32C 1S32D 1P3GC 3KUYA 3REJB 3X1TC 5JRGB 3TU4C 3AYWB 5DNMC 3B0CT 3W99C 5BS7A 1ZLAA 5C3IC 3KUYB 4LD9C 3VH6W 3C1CD 1BH8A 3AFAC 4DRAA 4J8VB 4CAYA 3MGSD 5GT3A 1P3LA 1P3IB 3X1UA 3X1VA 3W96B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZQ A;  1ZLA B;  3LZ0 A;  5CP6 D;  3KWQ B;  3REL B;  3LEL B;  3C1B D;  1BH8 B;  5BS7 C;  3MNN D;  4CAY B;  5GT3 B;  1P3L B;  3AZL A;  5B24 B;  5AV9 D;  5B0Y B;  5GT0 C;  2F8N A;  3X1U C;  3X1V C;  5B2I A;  4XZQ C;  3LZ0 C;  3AZK D;  4G92 B;  4E45 A;  3AZL B;  3AZE D;  5B2J D;  1AOI D;  2ARO B;  4QLC A;  2F8N B;  4Z2M H;  5B2I B;  3AZJ C;  2LY8 A;  1HQ3 A;  4WU9 D;  4Z66 D;  3R45 B;  3AV2 B;  1N1J B;  4WU8 A;  5G49 B;  5CPJ C;  2PYO A;  4KGC A;  4H9Q A;  5E5A A;  4JJN C;  1HQ3 B;  3MNN B;  4X23 B;  5AV6 C;  2FJ7 A;  3REH D;  3AZN D;  2PYO B;  3WAA D;  3WTP A;  3NQJ A;  5B31 D;  4J8X A;  2NZD D;  4H9P A;  4WU8 C;  4KUD A;  4KGC C;  2FJ7 B;  5E5A C;  5AV5 A;  3UT9 D;  1AOI B;  3WA9 D;  3WTP B;  3NQJ B;  5B1L D;  3REK A;  5AY8 D;  3B0D C;  3AV1 A;  1M19 A;  1M18 B;  4J8X C;  1ID3 D;  1H3O A;  3A6N D;  4KUD C;  1P3M D;  5BO0 B;  4H9O A;  5AV5 C;  1P3K B;  5B0Z B;  3MGP D;  1M19 B;  3REK C;  1KX3 A;  4WNN A;  3AZG D;  3NQU A;  3LZ1 A;  1ULY A;  4H9O B;  5AVB D;  3AV1 C;  4ZUX D;  2NQB A;  2HIO A;  5B1M D;  4J8U B;  4WNN B;  5FUG A;  3NQU B;  3LZ1 B;  3LJA D;  1F66 B;  3REI C;  1KX3 C;  3UTB A;  3WKJ B;  3MGR C;  4R8P D;  4XUJ B;  2NQB C;  2HIO C;  2YFV A;  5AY8 B;  2BYM A;  1P3F A;  1TAF B;  4CSR B;  3W98 A;  1WWS A;  3KXB D;  3MVD B;  3AZH D;  3UTB B;  4J8W A;  3B6F B;  1TZY D;  2YFV B;  1M1A B;  5DNN A;  2BYM B;  5GSU B;  4EO5 C;  4WV4 B;  1P3F C;  3W98 C;  3O62 B;  5F99 D;  4J8W C;  5AV8 D;  4ZBJ C;  5DNN C;  3WTP E;  1P34 A;  5B33 A;  5B40 D;  2F8N G;  4Z5T D;  5CPK B;  1Q9C A;  4YM6 A;  4R8P B;  1KX4 A;  2HUE C;  3AZF D;  3X1S A;  1P34 B;  5B33 B;  5B32 D;  3VH5 T;  1P3G D;  5AVC B;  3X1T D;  4DRB A;  1P3P A;  4YM6 C;  1KX4 C;  5JRG A;  5DNM D;  3W99 D;  1P3A A;  1U35 B;  5GXQ B;  3AZI B;  4LD9 D;  2RVQ C;  3AFA D;  1KX5 C;  1P3P B;  1P3B D;  4J8V A;  3AN2 A;  1P3A B;  1P3I A;  3VH6 A;  3REJ C;  1BH9 B;  3W96 A;  5JRG C;  4AWL B;  3AYW C;  3AZM B;  3KWQ A;  3REL A;  3LEL A;  3AN2 B;  1F1E A;  1EQZ B;  2F8N K;  2CV5 A;  5KDM B;  3KUY C;  5GT0 D;  3X1U D;  5B24 A;  4J8V C;  3UTA A;  3X1V D;  4XZQ D;  4YS3 B;  5B0Y A;  3LZ0 D;  1P3I C;  5CPI B;  3W96 C;  4H9S A;  1S32 A;  1P3O B;  1ZLA C;  3B6G B;  2CV5 B;  3KWQ C;  3REL C;  3LEL C;  1R4V A;  3UTA B;  2ARO A;  3V9R A;  1HTA A;  5GT3 C;  1P3L C;  3AZJ D;  1S32 B;  5B24 C;  4LD9 B;  4G91 B;  5B0Y C;  1P3B B;  4H9S C;  3V9R B;  3MGS A;  5CPJ D;  3R45 A;  3AZL C;  3AV2 A;  1N1J A;  4JJN D;  5G49 A;  2ARO C;  5CP6 A;  5JA4 B;  5AV6 D;  5B2I C;  3MNN A;  3C1C B;  3MGS B;  4X23 A;  5GT0 B;  4QLC C;  4WU8 D;  1B6W A;  5CP6 B;  4KGC D;  3C1B B;  5E5A D;  3AV2 D;  3AZE A;  1HQ3 C;  3MNN C;  5AV9 B;  1AOI A;  4X23 C;  3B0B A;  2PYO C;  4J8X D;  3AZK B;  4KUD D;  1M18 A;  3AZE B;  5B2J B;  5AV5 D;  2YFW B;  4WU9 A;  5BO0 A;  2FJ7 C;  3REK D;  1P3K A;  5B0Z A;  1AOI C;  3WTP C;  2L5A A;  3AV1 D;  4WU9 B;  4Z66 B;  1M18 C;  5BT1 C;  4J8U A;  3REI D;  1P3K C;  5B0Z C;  1KX3 D;  1F66 A;  3MGR D;  1M19 C;  3REH B;  3AZN B;  3UT9 A;  3WKJ A;  2NQB D;  2HIO D;  3WAA B;  5B1L A;  4XUJ A;  5B31 B;  2NZD B;  5AY8 A;  1TAF A;  4CSR A;  4J8U C;  3MVD A;  3UT9 B;  3WA9 B;  3LZ1 C;  3B6F A;  5B1L B;  1F66 C;  1M1A A;  3WKJ C;  5GSU A;  1P3F D;  4XUJ C;  1ID3 B;  3KSY A;  3W98 D;  3A6N B;  1P3M B;  4J8W D;  3O62 A;  3MVD C;  4ZUX A;  3UTB C;  3B6F C;  3MGP B;  5DNN D;  3MGQ D;  1KU5 A;  3AZG B;  1M1A C;  3LJA A;  5GSU C;  5AVB B;  4H9N B;  4ZUX B;  5B1M B;  5CPK A;  4R8P A;  3O62 C;  4HGA B;  3LJA B;  1BFM A;  3AZH A;  3KXB A;  3W97 D;  1TZY A;  5BNX B;  5AVC A;  4YM6 D;  1KX4 D;  5BNV B;  4H9R B;  5CPK C;  4R8P C;  3KXB B;  3AZH B;  1U35 A;  5GXQ A;  1TZY B;  2RVQ D;  1P34 C;  5B33 C;  3AZI A;  1KX5 D;  5F99 A;  3TU4 D;  1A7W A;  3MGQ B;  5AV8 A;  5AVC C;  3REJ D;  5JRG D;  3X1S C;  1BH9 A;  3AYW D;  5B40 A;  5F99 B;  4WZS B;  4Z5T A;  3AZM A;  1U35 C;  5GXQ C;  3AZI C;  5AV8 B;  3KUY D;  1EQZ A;  4J8V D;  5KDM A;  1P3P C;  5B40 B;  3VH6 T;  3W97 B;  3W96 D;  4YS3 A;  5B32 A;  4Z5T B;  1P3A C;  1ZLA D;  5CPI A;  3AZF B;  3KWQ D;  4AWL C;  3REL D;  3X1T A;  3LEL D;  1P3O A;  3B6G A;  3AZM C;  2IO5 B;  3VH5 W;  5GT3 D;  1P3L D;  3AN2 C;  1EQZ C;  5B32 B;  5B24 D;  4UUZ B;  1P3G B;  5B0Y D;  4KHA B;  3X1T B;  4LD9 A;  4YS3 C;  3AFA A;  3TU4 B;  5CPI C;  1P3B A;  5DNM B;  3AZL D;  1P3O C;  3W99 B;  2CWE A;  3B6G C;  4Z2M G;  5C3I B;  2ARO D;  2CV5 C;  1B67 A;  2F8N D;  3UTA C;  5B31 G;  5B2I D;  3AFA B;  5JA4 A;  3B0C W;  3C1C A;  1S32 C;  4G91 C;  4QLC D;  4G92 C;  5GT0 A;  1P3B C;  3C1B A;  1HQ3 D;  4X23 D;  3X1U B;  3C1C C;  5AV9 A;  3X1V B;  4XZQ B;  4NE5 A;  3MGS C;  2PYO D;  3LZ0 B;  3AV2 C;  3AZJ A;  3AZK A;  5CP6 C;  5B2J A;  3C1B C;  2FJ7 D;  2YFW A;  5CPJ A;  3WTP D;  3AZJ B;  4JJN A;  5AV9 C;  5AV6 A;  1M18 D;  4Z66 A;  3AZK C;  5CPJ B;  5BT1 D;  4QLC B;  3AZE C;  1JFI A;  5B2J C;  4JJN B;  1P3K D;  5B0Z D;  5AV6 B;  1M19 D;  2JSS A;  1JFI B;  3REH A;  3AZN A;  4M6B A;  4WU9 C;  4Z66 C;  4WU8 B;  3WAA A;  5B31 A;  4J8U D;  4KGC B;  4H9Q B;  5E5A B;  2NZD A;  3LZ1 D;  1F66 D;  3WA9 A;  3WKJ D;  3B0D B;  4XUJ D;  3REH C;  3AZN C;  4J8X B;  4NE3 A;  4H9P B;  3WAA C;  4KUD B;  5B31 C;  1ID3 A;  2NZD C;  3MVD D;  3A6N A;  5AV5 B;  5CHL B;  1P3M A;  3UTB D;  3B6F D;  3REK B;  3UT9 C;  3WA9 C;  3MGP A;  1M1A D;  5B1L C;  5GSU D;  3AZG A;  3AV1 B;  5AY8 C;  3REI A;  1H3O B;  5AVB A;  3MGR A;  4H9N A;  4E44 A;  5B32 G;  1ID3 C;  5B1M A;  3O62 D;  3A6N C;  1P3M C;  3REI B;  1KX3 B;  3MGP C;  3MGR B;  3AZG C;  2NQB B;  2HIO B;  1WWI A;  5AVB C;  5BNX A;  4ZUX C;  5CPK D;  5B1M C;  5BNV A;  5FUG B;  4H9R A;  1P34 D;  4NFT A;  4HGA C;  5B33 D;  3LJA C;  2BYK A;  4EO5 B;  5AVC D;  3X1S D;  3MGQ A;  1P3F B;  3W98 B;  2BYK B;  4J8W B;  3AZH C;  3KXB C;  1U35 D;  5GXQ D;  3AZI D;  4ZBJ B;  5DNN B;  1TZY C;  1P3P D;  1P3A D;  3MGQ C;  2HUE B;  3W97 A;  3AZM D;  3AZF A;  5F99 C;  3AN2 D;  4NE6 A;  1EQZ D;  1P3I D;  5AV8 C;  3VH5 A;  4UUZ A;  4YS3 D;  1P3G A;  1KX5 A;  2F8N H;  4YM6 B;  4KHA A;  5B40 C;  1KX4 B;  5CPI D;  3W97 C;  3TU4 A;  4Z5T C;  1P3O D;  3X1S B;  3B6G D;  2CV5 D;  5DNM A;  3AZF C;  3REJ A;  3W99 A;  3UTA D;  2IO5 C;  3AYW A;  1KX5 B;  5B32 C;  1S32 D;  1P3G C;  3KUY A;  3REJ B;  3X1T C;  5JRG B;  3TU4 C;  3AYW B;  5DNM C;  3B0C T;  3W99 C;  5BS7 A;  1ZLA A;  5C3I C;  3KUY B;  4LD9 C;  3VH6 W;  3C1C D;  1BH8 A;  3AFA C;  4DRA A;  4J8V B;  4CAY A;  3MGS D;  5GT3 A;  1P3L A;  1P3I B;  3X1U A;  3X1V A;  3W96 B; 
#chains in the Genus database with same CATH topology
 4XZQ A;  1ZLA B;  3LZ0 A;  5CP6 D;  3KWQ B;  3REL B;  3LEL B;  3C1B D;  1BH8 B;  5BS7 C;  3MNN D;  4CAY B;  5GT3 B;  1P3L B;  3AZL A;  5B24 B;  5AV9 D;  5B0Y B;  5GT0 C;  3EPK A;  2F8N A;  3F6T A;  3X1U C;  3X1V C;  5B2I A;  4XZQ C;  3LZ0 C;  3AZK D;  4G92 B;  4E45 A;  3AZL B;  3AZE D;  5B2J D;  1AOI D;  2ARO B;  4QLC A;  2F8N B;  2XD1 A;  4Z2M H;  5B2I B;  3AZJ C;  2LY8 A;  1HQ3 A;  4WU9 D;  4Z66 D;  3R45 B;  3AV2 B;  1N1J B;  4WU8 A;  2ZY2 A;  5G49 B;  5CPJ C;  2PYO A;  4KGC A;  4H9Q A;  5E5A A;  4JJN C;  1HQ3 B;  3MNN B;  4X23 B;  5AV6 C;  2FJ7 A;  2VQR A;  3REH D;  3AZN D;  2PYO B;  3WAA D;  3WTP A;  3NQJ A;  5B31 D;  4J8X A;  2NZD D;  4H9P A;  4WU8 C;  4KUD A;  4KGC C;  2FJ7 B;  5E5A C;  5AV5 A;  3UT9 D;  1AOI B;  3WA9 D;  3WTP B;  3NQJ B;  5B1L D;  3REK A;  5AY8 D;  3B0D C;  3AV1 A;  1M19 A;  1M18 B;  4J8X C;  1ID3 D;  1H3O A;  3A6N D;  4KUD C;  1P3M D;  5BO0 B;  4H9O A;  2FFF B;  5AV5 C;  1P3K B;  5B0Z B;  3MGP D;  1Z2C B;  1M19 B;  3REK C;  1KX3 A;  4WNN A;  3AZG D;  3NQU A;  3LZ1 A;  1ULY A;  4H9O B;  5AVB D;  3AV1 C;  4ZUX D;  2NQB A;  2HIO A;  2Y2Q A;  5B1M D;  4J8U B;  4WNN B;  5FUG A;  3NQU B;  3LZ1 B;  3LJA D;  3EG5 B;  1F66 B;  3REI C;  1KX3 C;  3UTB A;  3WKJ B;  3MGR C;  4R8P D;  4XUJ B;  2NQB C;  2HIO C;  2YFV A;  5AY8 B;  2BYM A;  1P3F A;  1TAF B;  4CSR B;  3W98 A;  1WWS A;  3KXB D;  3MVD B;  3AZH D;  3UTB B;  2Y2N A;  4J8W A;  3B6F B;  1TZY D;  2YFV B;  1M1A B;  5DNN A;  2BYM B;  5GSU B;  4EO5 C;  4WV4 B;  2Y2O A;  1P3F C;  3W98 C;  3O62 B;  5F99 D;  4J8W C;  5AV8 D;  4ZBJ C;  5DNN C;  3KFU G;  3WTP E;  1P34 A;  5B33 A;  5B40 D;  2F8N G;  4Z5T D;  3A1I A;  5CPK B;  1Q9C A;  4YM6 A;  4R8P B;  1KX4 A;  2HUE C;  3AZF D;  2ZY4 A;  3X1S A;  1P34 B;  5B33 B;  5B32 D;  2DF4 C;  3VH5 T;  1P3G D;  4UPK A;  5AVC B;  3X1T D;  4DRB A;  1P3P A;  4YM6 C;  1KX4 C;  5JRG A;  5DNM D;  3W99 D;  1P3A A;  2JE5 A;  1U35 B;  5GXQ B;  3AZI B;  4LD9 D;  2RVQ C;  3AFA D;  1KX5 C;  1P3P B;  1P3B D;  4J8V A;  3AN2 A;  1P3A B;  1P3I A;  3VH6 A;  3REJ C;  1BH9 B;  3W96 A;  5JRG C;  4AWL B;  3AYW C;  2Y2H A;  3AZM B;  3KWQ A;  3REL A;  3LEL A;  3AN2 B;  1F1E A;  1EQZ B;  2F8N K;  2CV5 A;  5KDM B;  3KUY C;  5GT0 D;  3X1U D;  5B24 A;  2ZY3 A;  4J8V C;  3UTA A;  4XZQ D;  3X1V D;  5B0Y A;  4YS3 B;  3LZ0 D;  1P3I C;  5CPI B;  3W96 C;  4H9S A;  1S32 A;  1P3O B;  1ZLA C;  3B6G B;  2CV5 B;  3AL0 C;  3KWQ C;  3REL C;  3LEL C;  1R4V A;  3UTA B;  2ARO A;  3V9R A;  1HTA A;  5GT3 C;  1P3L C;  3AZJ D;  1S32 B;  5B24 C;  4LD9 B;  4G91 B;  5B0Y C;  1P3B B;  4H9S C;  3V9R B;  3MGS A;  5CPJ D;  3R45 A;  3AZL C;  3AV2 A;  1N1J A;  4JJN D;  5G49 A;  4DQY B;  2ARO C;  5CP6 A;  5JA4 B;  2XD5 A;  5AV6 D;  5B2I C;  3MNN A;  3C1C B;  3MGS B;  4X23 A;  5GT0 B;  4QLC C;  4WU8 D;  1B6W A;  5CP6 B;  4KGC D;  3C1B B;  5E5A D;  3AV2 D;  3AZE A;  1HQ3 C;  3MNN C;  5AV9 B;  1AOI A;  4X23 C;  3B0B A;  2BG1 A;  2PYO C;  4J8X D;  3AZK B;  4KUD D;  1M18 A;  3AZE B;  5B2J B;  5AV5 D;  2YFW B;  4WU9 A;  5BO0 A;  2FJ7 C;  3REK D;  1P3K A;  5B0Z A;  1AOI C;  3WTP C;  2L5A A;  3AV1 D;  4WU9 B;  4Z66 B;  1M18 C;  5BT1 C;  4J8U A;  3REI D;  1P3K C;  5B0Z C;  1KX3 D;  3EPL A;  1F66 A;  3MGR D;  1M19 C;  3A1K A;  3REH B;  3AZN B;  3UT9 A;  3WKJ A;  2NQB D;  2HIO D;  3WAA B;  5B1L A;  4XUJ A;  5B31 B;  2NZD B;  5AY8 A;  1TAF A;  4CSR A;  4J8U C;  3MVD A;  3UT9 B;  3WA9 B;  3LZ1 C;  3B6F A;  5B1L B;  1F66 C;  1M1A A;  3WKJ C;  5GSU A;  1P3F D;  4XUJ C;  3H0L C;  1ID3 B;  3KSY A;  3W98 D;  3A6N B;  3H0M C;  1P3M B;  4J8W D;  3O62 A;  3MVD C;  4ZUX A;  3UTB C;  3B6F C;  3MGP B;  5DNN D;  3MGQ D;  1KU5 A;  1PZR A;  3AZG B;  1M1A C;  3LJA A;  5GSU C;  5AVB B;  4H9N B;  4ZUX B;  5B1M B;  5CPK A;  4R8P A;  3O62 C;  4HGA B;  3LJA B;  1BFM A;  3AZH A;  3KXB A;  2RIQ A;  3W97 D;  1TZY A;  5BNX B;  5AVC A;  4YM6 D;  1KX4 D;  5BNV B;  4H9R B;  5CPK C;  4R8P C;  3KXB B;  3AZH B;  1U35 A;  5GXQ A;  1TZY B;  2RVQ D;  1P34 C;  5B33 C;  3AZI A;  1KX5 D;  1T3U A;  5F99 A;  3TU4 D;  1A7W A;  3MGQ B;  5AV8 A;  5AVC C;  3REJ D;  5JRG D;  3X1S C;  1BH9 A;  3AYW D;  5B40 A;  5F99 B;  4WZS B;  4Z5T A;  3AZM A;  1U35 C;  5GXQ C;  3AZI C;  5AV8 B;  3KUY D;  1EQZ A;  4J8V D;  5KDM A;  1P3P C;  5B40 B;  3VH6 T;  3W97 B;  2Y2I A;  4YS3 A;  5B32 A;  4Z5T B;  1P3A C;  1ZLA D;  2DQN C;  3W96 D;  5CPI A;  3AZF B;  3KWQ D;  4AWL C;  3REL D;  3X1T A;  3LEL D;  1P3O A;  3B6G A;  3EPH A;  4WJ3 C;  3AZM C;  2IO5 B;  3VH5 W;  5GT3 D;  1P3L D;  3AN2 C;  1EQZ C;  5B32 B;  5B24 D;  4UUZ B;  1P3G B;  5B0Y D;  4KHA B;  3X1T B;  4LD9 A;  4YS3 C;  3AFA A;  2ZM5 A;  3TU4 B;  5CPI C;  1P3B A;  5DNM B;  3AZL D;  1P3O C;  3W99 B;  2CWE A;  3B6G C;  4Z2M G;  5C3I B;  2ARO D;  2CV5 C;  1B67 A;  2F8N D;  3UTA C;  5B31 G;  5B2I D;  2Y2P A;  3AFA B;  3IP4 C;  2G5H C;  5JA4 A;  3B0C W;  3C1C A;  1S32 C;  2F2A C;  4G91 C;  4QLC D;  4G92 C;  1W2E A;  5GT0 A;  1P3B C;  3C1B A;  1HQ3 D;  4X23 D;  3X1U B;  3C1C C;  5AV9 A;  3X1V B;  4XZQ B;  4NE5 A;  3MGS C;  2PYO D;  3LZ0 B;  3AV2 C;  3AZJ A;  3AZK A;  5CP6 C;  5B2J A;  3C1B C;  2FJ7 D;  2YFW A;  5CPJ A;  3WTP D;  3AZJ B;  4JJN A;  5AV9 C;  2W8S A;  5AV6 A;  1M18 D;  4Z66 A;  3AZK C;  5CPJ B;  5BT1 D;  4QLC B;  3AZE C;  1JFI A;  5B2J C;  4JJN B;  1P3K D;  5B0Z D;  5AV6 B;  1M19 D;  2JSS A;  1JFI B;  3REH A;  3AZN A;  4M6B A;  4WU9 C;  4Z66 C;  4WU8 B;  2Y2M A;  3WAA A;  5B31 A;  4J8U D;  4KGC B;  4H9Q B;  5E5A B;  2NZD A;  3LZ1 D;  1F66 D;  3WA9 A;  3WKJ D;  3B0D B;  4XUJ D;  3REH C;  3AZN C;  4J8X B;  4NE3 A;  4H9P B;  3WAA C;  4KUD B;  5B31 C;  1ID3 A;  2NZD C;  3MVD D;  3A6N A;  5AV5 B;  5CHL B;  1P3M A;  3UTB D;  3B6F D;  3REK B;  3UT9 C;  3WA9 C;  3MGP A;  1M1A D;  5B1L C;  5GSU D;  3AZG A;  3AV1 B;  5AY8 C;  2Y2K A;  3REI A;  1H3O B;  5AVB A;  3MGR A;  2J8P A;  4H9N A;  4E44 A;  5B32 G;  1ID3 C;  5B1M A;  3O62 D;  3A6N C;  1P3M C;  2Y2J A;  3REI B;  1KX3 B;  3MGP C;  3MGR B;  3AZG C;  2NQB B;  2HIO B;  1WWI A;  5AVB C;  5BNX A;  4ZUX C;  5CPK D;  5B1M C;  5BNV A;  5FUG B;  4H9R A;  1P34 D;  4NFT A;  4HGA C;  3H0R C;  5B33 D;  3LJA C;  2BYK A;  4EO5 B;  5AVC D;  3X1S D;  3MGQ A;  1P3F B;  3W98 B;  3P5J B;  2BYK B;  4J8W B;  2Y2G A;  3AZH C;  3FDD A;  3KXB C;  5GXQ D;  1U35 D;  2ZY5 A;  3AZI D;  4ZBJ B;  5DNN B;  1TZY C;  1P3P D;  1P3A D;  3MGQ C;  2HUE B;  3W97 A;  2Y2L A;  3AZM D;  3AZF A;  2JCH A;  5F99 C;  3AN2 D;  4NE6 A;  1EQZ D;  1P3I D;  5AV8 C;  3EPJ A;  3VH5 A;  4UUZ A;  4YS3 D;  1P3G A;  2UWX A;  1KX5 A;  2F8N H;  4YM6 B;  4KHA A;  5B40 C;  2G5I C;  5CPI D;  1KX4 B;  3W97 C;  3TU4 A;  4Z5T C;  1P3O D;  3X1S B;  3B6G D;  2CV5 D;  5DNM A;  3AZF C;  3REJ A;  3W99 A;  3UTA D;  2IO5 C;  3AYW A;  1KX5 B;  5B32 C;  1S32 D;  1P3G C;  3KUY A;  3REJ B;  3X1T C;  5JRG B;  3TU4 C;  3AYW B;  5DNM C;  3B0C T;  3W99 C;  5BS7 A;  1ZLA A;  5C3I C;  3KUY B;  4LD9 C;  3VH6 W;  3C1C D;  1BH8 A;  3AFA C;  4DRA A;  4J8V B;  4CAY A;  3MGS D;  5GT3 A;  1P3L A;  1P3I B;  3X1U A;  3X1V A;  3W96 B; 
#chains in the Genus database with same CATH homology
 4XZQ A;  1ZLA B;  3LZ0 A;  5CP6 D;  3KWQ B;  3REL B;  3LEL B;  3C1B D;  1BH8 B;  5BS7 C;  3MNN D;  4CAY B;  5GT3 B;  1P3L B;  3AZL A;  5B24 B;  5AV9 D;  5B0Y B;  5GT0 C;  3EPK A;  2F8N A;  3F6T A;  3X1U C;  3X1V C;  5B2I A;  4XZQ C;  3LZ0 C;  3AZK D;  4G92 B;  4E45 A;  3AZL B;  3AZE D;  5B2J D;  1AOI D;  2ARO B;  4QLC A;  2F8N B;  2XD1 A;  4Z2M H;  5B2I B;  3AZJ C;  2LY8 A;  1HQ3 A;  4WU9 D;  4Z66 D;  3R45 B;  3AV2 B;  1N1J B;  4WU8 A;  2ZY2 A;  5G49 B;  5CPJ C;  2PYO A;  4KGC A;  4H9Q A;  5E5A A;  4JJN C;  1HQ3 B;  3MNN B;  4X23 B;  5AV6 C;  2FJ7 A;  2VQR A;  3REH D;  3AZN D;  2PYO B;  3WAA D;  3WTP A;  3NQJ A;  5B31 D;  4J8X A;  2NZD D;  4H9P A;  4WU8 C;  4KUD A;  4KGC C;  2FJ7 B;  5E5A C;  5AV5 A;  3UT9 D;  1AOI B;  3WA9 D;  3WTP B;  3NQJ B;  5B1L D;  3REK A;  5AY8 D;  3B0D C;  3AV1 A;  1M19 A;  1M18 B;  4J8X C;  1ID3 D;  1H3O A;  3A6N D;  4KUD C;  1P3M D;  5BO0 B;  4H9O A;  2FFF B;  5AV5 C;  1P3K B;  5B0Z B;  3MGP D;  1Z2C B;  1M19 B;  3REK C;  1KX3 A;  4WNN A;  3AZG D;  3NQU A;  3LZ1 A;  1ULY A;  4H9O B;  5AVB D;  3AV1 C;  4ZUX D;  2NQB A;  2HIO A;  2Y2Q A;  5B1M D;  4J8U B;  4WNN B;  5FUG A;  3NQU B;  3LZ1 B;  3LJA D;  3EG5 B;  1F66 B;  3REI C;  1KX3 C;  3UTB A;  3WKJ B;  3MGR C;  4R8P D;  4XUJ B;  2NQB C;  2HIO C;  2YFV A;  5AY8 B;  2BYM A;  1P3F A;  1TAF B;  4CSR B;  3W98 A;  1WWS A;  3KXB D;  3MVD B;  3AZH D;  3UTB B;  2Y2N A;  4J8W A;  3B6F B;  1TZY D;  2YFV B;  1M1A B;  5DNN A;  2BYM B;  5GSU B;  4EO5 C;  4WV4 B;  2Y2O A;  1P3F C;  3W98 C;  3O62 B;  5F99 D;  4J8W C;  5AV8 D;  4ZBJ C;  5DNN C;  3KFU G;  3WTP E;  1P34 A;  5B33 A;  5B40 D;  2F8N G;  4Z5T D;  3A1I A;  5CPK B;  1Q9C A;  4YM6 A;  4R8P B;  1KX4 A;  2HUE C;  3AZF D;  2ZY4 A;  3X1S A;  1P34 B;  5B33 B;  5B32 D;  2DF4 C;  3VH5 T;  1P3G D;  4UPK A;  5AVC B;  3X1T D;  4DRB A;  1P3P A;  4YM6 C;  1KX4 C;  5JRG A;  5DNM D;  3W99 D;  1P3A A;  2JE5 A;  1U35 B;  5GXQ B;  3AZI B;  4LD9 D;  2RVQ C;  3AFA D;  1KX5 C;  1P3P B;  1P3B D;  4J8V A;  3AN2 A;  1P3A B;  1P3I A;  3VH6 A;  3REJ C;  1BH9 B;  3W96 A;  5JRG C;  4AWL B;  3AYW C;  2Y2H A;  3AZM B;  3KWQ A;  3REL A;  3LEL A;  3AN2 B;  1F1E A;  1EQZ B;  2F8N K;  2CV5 A;  5KDM B;  3KUY C;  5GT0 D;  3X1U D;  5B24 A;  2ZY3 A;  4J8V C;  3UTA A;  4XZQ D;  3X1V D;  5B0Y A;  4YS3 B;  3LZ0 D;  1P3I C;  5CPI B;  3W96 C;  4H9S A;  1S32 A;  1P3O B;  1ZLA C;  3B6G B;  2CV5 B;  3AL0 C;  3KWQ C;  3REL C;  3LEL C;  1R4V A;  3UTA B;  2ARO A;  3V9R A;  1HTA A;  5GT3 C;  1P3L C;  3AZJ D;  1S32 B;  5B24 C;  4LD9 B;  4G91 B;  5B0Y C;  1P3B B;  4H9S C;  3V9R B;  3MGS A;  5CPJ D;  3R45 A;  3AZL C;  3AV2 A;  1N1J A;  4JJN D;  5G49 A;  4DQY B;  2ARO C;  5CP6 A;  5JA4 B;  2XD5 A;  5AV6 D;  5B2I C;  3MNN A;  3C1C B;  3MGS B;  4X23 A;  5GT0 B;  4QLC C;  4WU8 D;  1B6W A;  5CP6 B;  4KGC D;  3C1B B;  5E5A D;  3AV2 D;  3AZE A;  1HQ3 C;  3MNN C;  5AV9 B;  1AOI A;  4X23 C;  3B0B A;  2BG1 A;  2PYO C;  4J8X D;  3AZK B;  4KUD D;  1M18 A;  3AZE B;  5B2J B;  5AV5 D;  2YFW B;  4WU9 A;  5BO0 A;  2FJ7 C;  3REK D;  1P3K A;  5B0Z A;  1AOI C;  3WTP C;  2L5A A;  3AV1 D;  4WU9 B;  4Z66 B;  1M18 C;  5BT1 C;  4J8U A;  3REI D;  1P3K C;  5B0Z C;  1KX3 D;  3EPL A;  1F66 A;  3MGR D;  1M19 C;  3A1K A;  3REH B;  3AZN B;  3UT9 A;  3WKJ A;  2NQB D;  2HIO D;  3WAA B;  5B1L A;  4XUJ A;  5B31 B;  2NZD B;  5AY8 A;  1TAF A;  4CSR A;  4J8U C;  3MVD A;  3UT9 B;  3WA9 B;  3LZ1 C;  3B6F A;  5B1L B;  1F66 C;  1M1A A;  3WKJ C;  5GSU A;  1P3F D;  4XUJ C;  3H0L C;  1ID3 B;  3KSY A;  3W98 D;  3A6N B;  3H0M C;  1P3M B;  4J8W D;  3O62 A;  3MVD C;  4ZUX A;  3UTB C;  3B6F C;  3MGP B;  5DNN D;  3MGQ D;  1KU5 A;  1PZR A;  3AZG B;  1M1A C;  3LJA A;  5GSU C;  5AVB B;  4H9N B;  4ZUX B;  5B1M B;  5CPK A;  4R8P A;  3O62 C;  4HGA B;  3LJA B;  1BFM A;  3AZH A;  3KXB A;  2RIQ A;  3W97 D;  1TZY A;  5BNX B;  5AVC A;  4YM6 D;  1KX4 D;  5BNV B;  4H9R B;  5CPK C;  4R8P C;  3KXB B;  3AZH B;  1U35 A;  5GXQ A;  1TZY B;  2RVQ D;  1P34 C;  5B33 C;  3AZI A;  1KX5 D;  1T3U A;  5F99 A;  3TU4 D;  1A7W A;  3MGQ B;  5AV8 A;  5AVC C;  3REJ D;  5JRG D;  3X1S C;  1BH9 A;  3AYW D;  5B40 A;  5F99 B;  4WZS B;  4Z5T A;  3AZM A;  1U35 C;  5GXQ C;  3AZI C;  5AV8 B;  3KUY D;  1EQZ A;  4J8V D;  5KDM A;  1P3P C;  5B40 B;  3VH6 T;  3W97 B;  2Y2I A;  4YS3 A;  5B32 A;  4Z5T B;  1P3A C;  1ZLA D;  2DQN C;  3W96 D;  5CPI A;  3AZF B;  3KWQ D;  4AWL C;  3REL D;  3X1T A;  3LEL D;  1P3O A;  3B6G A;  3EPH A;  4WJ3 C;  3AZM C;  2IO5 B;  3VH5 W;  5GT3 D;  1P3L D;  3AN2 C;  1EQZ C;  5B32 B;  5B24 D;  4UUZ B;  1P3G B;  5B0Y D;  4KHA B;  3X1T B;  4LD9 A;  4YS3 C;  3AFA A;  2ZM5 A;  3TU4 B;  5CPI C;  1P3B A;  5DNM B;  3AZL D;  1P3O C;  3W99 B;  2CWE A;  3B6G C;  4Z2M G;  5C3I B;  2ARO D;  2CV5 C;  1B67 A;  2F8N D;  3UTA C;  5B31 G;  5B2I D;  2Y2P A;  3AFA B;  3IP4 C;  2G5H C;  5JA4 A;  3B0C W;  3C1C A;  1S32 C;  2F2A C;  4G91 C;  4QLC D;  4G92 C;  1W2E A;  5GT0 A;  1P3B C;  3C1B A;  1HQ3 D;  4X23 D;  3X1U B;  3C1C C;  5AV9 A;  3X1V B;  4XZQ B;  4NE5 A;  3MGS C;  2PYO D;  3LZ0 B;  3AV2 C;  3AZJ A;  3AZK A;  5CP6 C;  5B2J A;  3C1B C;  2FJ7 D;  2YFW A;  5CPJ A;  3WTP D;  3AZJ B;  4JJN A;  5AV9 C;  2W8S A;  5AV6 A;  1M18 D;  4Z66 A;  3AZK C;  5CPJ B;  5BT1 D;  4QLC B;  3AZE C;  1JFI A;  5B2J C;  4JJN B;  1P3K D;  5B0Z D;  5AV6 B;  1M19 D;  2JSS A;  1JFI B;  3REH A;  3AZN A;  4M6B A;  4WU9 C;  4Z66 C;  4WU8 B;  2Y2M A;  3WAA A;  5B31 A;  4J8U D;  4KGC B;  4H9Q B;  5E5A B;  2NZD A;  3LZ1 D;  1F66 D;  3WA9 A;  3WKJ D;  3B0D B;  4XUJ D;  3REH C;  3AZN C;  4J8X B;  4NE3 A;  4H9P B;  3WAA C;  4KUD B;  5B31 C;  1ID3 A;  2NZD C;  3MVD D;  3A6N A;  5AV5 B;  5CHL B;  1P3M A;  3UTB D;  3B6F D;  3REK B;  3UT9 C;  3WA9 C;  3MGP A;  1M1A D;  5B1L C;  5GSU D;  3AZG A;  3AV1 B;  5AY8 C;  2Y2K A;  3REI A;  1H3O B;  5AVB A;  3MGR A;  2J8P A;  4H9N A;  4E44 A;  5B32 G;  1ID3 C;  5B1M A;  3O62 D;  3A6N C;  1P3M C;  2Y2J A;  3REI B;  1KX3 B;  3MGP C;  3MGR B;  3AZG C;  2NQB B;  2HIO B;  1WWI A;  5AVB C;  5BNX A;  4ZUX C;  5CPK D;  5B1M C;  5BNV A;  5FUG B;  4H9R A;  1P34 D;  4NFT A;  4HGA C;  3H0R C;  5B33 D;  3LJA C;  2BYK A;  4EO5 B;  5AVC D;  3X1S D;  3MGQ A;  1P3F B;  3W98 B;  3P5J B;  2BYK B;  4J8W B;  2Y2G A;  3AZH C;  3FDD A;  3KXB C;  5GXQ D;  1U35 D;  2ZY5 A;  3AZI D;  4ZBJ B;  5DNN B;  1TZY C;  1P3P D;  1P3A D;  3MGQ C;  2HUE B;  3W97 A;  2Y2L A;  3AZM D;  3AZF A;  2JCH A;  5F99 C;  3AN2 D;  4NE6 A;  1EQZ D;  1P3I D;  5AV8 C;  3EPJ A;  3VH5 A;  4UUZ A;  4YS3 D;  1P3G A;  2UWX A;  1KX5 A;  2F8N H;  4YM6 B;  4KHA A;  5B40 C;  2G5I C;  5CPI D;  1KX4 B;  3W97 C;  3TU4 A;  4Z5T C;  1P3O D;  3X1S B;  3B6G D;  2CV5 D;  5DNM A;  3AZF C;  3REJ A;  3W99 A;  3UTA D;  2IO5 C;  3AYW A;  1KX5 B;  5B32 C;  1S32 D;  1P3G C;  3KUY A;  3REJ B;  3X1T C;  5JRG B;  3TU4 C;  3AYW B;  5DNM C;  3B0C T;  3W99 C;  5BS7 A;  1ZLA A;  5C3I C;  3KUY B;  4LD9 C;  3VH6 W;  3C1C D;  1BH8 A;  3AFA C;  4DRA A;  4J8V B;  4CAY A;  3MGS D;  5GT3 A;  1P3L A;  1P3I B;  3X1U A;  3X1V A;  3W96 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...