3KXBC

Structural characterization of h3k56q nucleosomes and nucleosomal arrays
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transcription/dna
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2009-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3kxbC00
1U35B 1KX3A 3X1VD 4XZQB 3X1TC 3MGPB 3TU4A 4H9NA 5AV6A 2NQBD 5B1MB 3A6NA 1N1JB 3B0DC 3RELA 2HIOA 5AV5D 3AZHD 3LZ1D 3LZ1A 2IO5C 4J8WD 2PYOC 5JRGD 3W98C 5B32G 3AZIA 3MGSD 5GT0A 5B31D 5AY8B 3AV2B 3B0DB 4Z66B 5AV8A 1P3BA 4YM6D 5B2IC 3KXBD 2FJ7C 3AYWA 3W98B 5AVCC 2BYMB 1S32C 3AFAC 3UTAD 3UTAA 3LJAA 4KGCC 2NZDD 1F1EA 3MGQA 5BNVB 3REHC 1HQ3C 4X23A 1F66C 1B67A 5KDMA 3B0CW 5GSUA 3KUYD 1P3KD 4UUZA 3AZLC 3AZGB 5GT3D 1S32B 3AZMA 3REIA 5CPJC 2F8NG 3X1VC 5F99A 1P3AC 1TZYD 4H9SA 5CP6A 1P3PD 5B31G 1KX5D 1KX5A 5CPIC 2NQBC 1M19B 4M6BA 1BH8A 3X1SA 3WTPE 1F66B 3AZNA 1EQZC 1P3LB 3VH5W 3W97D 2JSSA 3LELA 3REKA 3MVDA 3O62D 3AZLB 5B0ZA 3B6GA 5JRGC 3AV1D 1ID3C 5B1LA 2HUEC 1M1AA 5DNMA 3MGRD 5CPIB 5B31C 3AZKD 5E5AD 4Z5TA 4KUDD 1KU5A 3AZFB 5B2JA 1P3MC 3KWQD 3W96C 2L5AA 3AN2D 3C1CA 1P3FD 4WU9A 2AROD 1M18A 2F8NB 1ID3B 1P3IA 2HUEB 2CV5D 3WAAD 3UT9D 5AVBD 3REJA 3WA9D 4JJND 3UTBD 4J8UC 1AOID 4WU8D 4E45A 5BS7C 3W96B 4XUJB 3X1UA 1U35A 5B33D 4XZQA 1P3KC 1B6WA 3MGPA 4CAYB 4G91C 5B1MA 3WTPC 3C1BC 4J8UB 1N1JA 3R45B 1P3GD 5B40C 5DNNC 4YS3C 4J8VD 5B0YD 5C3IB 3W97C 5GXQC 4G91B 3WTPB 3C1BB 5AY8A 1P3OD 4H9OB 3MNNB 3MGRC 3W99C 3AV2A 1ZLAC 4Z66A 5B40B 5DNNB 5AV9D 3AZKC 4YS3B 4J8XB 5E5AC 4R8PD 5CPKB 4DRAA 4QLCD 3LZ0B 1KX4C 3W98A 5GXQB 2BYMA 2AROC 5B24B 5AVBC 3W99B 3NQUB 1BH9B 1ZLAB 5BNVA 1KX3D 1KX4B 3TU4D 4WU8C 5AV6D 3AZGD 3AZGA 1S32A 3A6ND 5B33C 3B0CT 3RELD 2HIOD 3B6FC 4NE3A 4ZUXC 4CSRB 1M19A 3REHA 4Z2MH 5BO0B 1WWSA 3X1TB 1F66A 3AZID 1P3LA 5BT1C 5G49B 5GT0D 3AZLA 4J8VC 4WZSB 3AZEC 4LD9C 4NE5A 3VH5T 3AZJC 1TAFB 1P3AA 3WKJC 5AV8D 1P3BD 3B6FB 4ZUXB 2IO5B 5CPIA 2PYOB 3AYWD 4KHAB 5B32C 3AZFA 2F8NH 4EO5C 3AZEB 4R8PC 3LJAD 3AZJB 2F8NA 1ID3A 4ZBJC 3WKJB 1ULYA 3MGQD 5B2IB 2FJ7B 4X23D 5AVCB 5GSUD 1P34C 5B32B 3AZMD 3REID 3AFAB 5F99D 3W96A 4XUJA 4KGCB 4WNNB 5CP6D 3TU4C 4ZBJB 2LY8A 5AV6C 4H9QB 3A6NC 3REHB 1HQ3B 3X1SD 3KSYA 4CAYA 3AZND 1P34B 5AV5C 3LELD 4J8UA 3REKD 3LZ1C 3MVDD 3AZHC 5B0ZD 4J8WC 5CPJB 3R45A 3B6GD 5BS7A 3X1VB 1P3AB 5B1LD 1M1AD 5DNMD 3MGSC 2NQBB 1R4VA 4Z5TD 1EQZB 4H9RB 3WTPA 3C1BA 1BFMA 5B2JD 5AV8C 5AV5B 3AZHB 4H9OA 3MNNA 3VH6T 4YM6C 3KXBC 4J8WB 3C1CD 5JRGB 5B40A 5DNNA 4WU9D 4YS3A 1M18D 4J8XA 1P3ID 5CPKD 5CPKA 3LZ0A 3MGSB 3REJD 5B31B 5GXQA 3UTAC 4DRBA 2NZDC 5B24A 1P3MB 3MGQC 4YM6B 3W99A 1BH9A 3NQUA 3KXBB 1ZLAA 4H9PB 3X1UD 1U35D 2CWEA 5BNXB 4XZQD 3KUYC 1KX4A 5GT3C 3MGPD 2BYKB 5B1MD 1TZYC 4H9SC 5CP6C 1P3PC 2NZDB 4HGAC 1KX5C 4AWLC 4E44A 3X1SC 4CSRA 3KUYB 1P3KB 5BO0A 3MVDC 3X1TA 3O62C 5GT3B 3VH6W 5G49A 3AV1C 5B1LC 1TZYB 5CHLB 5AY8D 2F8NK 1P3PB 4HGAB 3B0BA 3AV2D 1TAFA 4AWLB 4Z66D 3B6FA 4ZUXA 4Z5TC 2PYOA 4KUDC 3W97B 3W98D 4KHAA 3KWQC 3O62B 1P3FC 3AN2C 3AV1B 3NQJB 3WAAC 3AZEA 2CV5C 3UT9C 3MGRB 3REJC 1H3OB 3AZJA 3WA9C 4JJNC 3WKJA 3AZKB 5E5AB 5B2IA 2FJ7A 3UTBC 4KUDB 1AOIC 5AVCA 3KWQB 2RVQD 1P3FB 5B32A 3AN2B 1S32D 3AFAA 2AROB 1U35C 3WAAB 2CV5B 4XZQC 3UT9B 5AVBB 4KGCD 4KGCA 4WNNA 3WA9B 4JJNB 4H9QA 1M19D 3REHD 1HQ3A 3UTBB 1F66D 1AOIB 1P3LD 4WU8B 1P3GC 1P34A 3AZLD 5B0YC 5CPJA 1Q9CA 5B33B 3X1VA 1P3AD 1JFIB 5CPID 2YFWB 2NQBA 5AY8C 1P3OC 4G92C 3AV2C 1EQZA 4H9RA 1EQZD 4Z66C 3AZFD 1P3GB 5JA4B 5AV5A 3AZHA 5AV9C 4J8VB 4LD9B 5B0YB 4QLCC 4J8WA 5JRGA 2F8ND 1ID3D 3V9RB 3MGSA 5B31A 1P3OB 4G92B 1P3MD 1P3MA 5AV9B 4YM6A 4EO5B 1KX3C 4R8PB 3KXBA 4XUJD 4H9PA 4QLCB 3W96D 5FUGB 2YFVB 4Z2MG 5BNXA 2RVQC 3AZGC 2BYKA 3RELC 2HIOC 4J8UD 2NZDA 1M19C 1KX3B 3AZIC 3TU4B 1P3LC 5GT0C 3KUYA 1P3KA 4H9NB 5AV6B 1A7WA 5GT3A 3A6NB 3WTPD 1TZYA 3C1BD 3RELB 2HIOB 1P3PA 1P3BC 3MNND 3LZ1B 5B40D 5DNND 3AYWC 4YS3D 4J8XD 3AZIB 3LZ0D 3W97A 3AZFC 5GT0B 5GXQD 3O62A 3LJAC 4NFTA 3AV1A 3NQJA 5B24D 5AV8B 1P3BB 3MGRA 3W99D 1H3OA 1ZLAD 4X23C 4NE6A 3VH5A 3AYWB 3AZKA 5E5AA 5GSUC 1KX4D 4KUDA 3AZMC 3REIC 3KWQA 1WWIA 5F99C 4XUJC 3LJAB 3UTAB 3AN2A 1P3FA 2AROA 3WAAA 2CV5A 3UT9A 5AVBA 3MGQB 3WA9A 1HTAA 4X23B 4JJNA 3AZNC 5KDMB 5GSUB 3LELC 3REKC 4UUZB 3X1TD 3UTBA 1AOIA 3AZMB 5B0ZC 3REIB 3B6GC 4WU8A 4WV4B 5F99B 5C3IC 5CP6B 1M1AC 5DNMC 5B33A 1KX5B 1JFIA 3B6FD 1BH8B 4ZUXD 3X1SB 2PYOD 3AZNB 2YFWA 5B2JC 3LELB 3REKB 3MNNC 3MVDB 5B0ZB 5BT1D 3B6GB 3C1CC 1P3GA 5JA4A 4WU9C 1M18C 4J8XC 5B1LB 4J8VA 3AZED 5CPKC 5B0YA 1P3IC 1M1AB 4LD9A 3LZ0C 4LD9D 5DNMB 3AZJD 3WKJD 3V9RA 5B2ID 2FJ7D 4Z5TB 5AVCD 5B24C 5B2JB 1P3OA 5B32D 3C1CB 3X1UC 3AFAD 4WU9B 5AV9A 1M18B 1P3IB 4R8PA 4QLCA 5FUGA 3VH6A 3REJB 2YFVA 3MGPC 5B1MC 1HQ3D 1P34D 5CPJD 3X1UB
chains in the Genus database with same CATH superfamily
1U35B 1KX3A 3X1VD 4XZQB 3X1TC 3MGPB 3TU4A 3A1KA 4H9NA 5AV6A 2NQBD 5B1MB 3A6NA 1N1JB 3B0DC 3RELA 2HIOA 5AV5D 3AZHD 3LZ1D 3LZ1A 2IO5C 4J8WD 2PYOC 5JRGD 3W98C 5B32G 3AZIA 3MGSD 3KFUG 1T3UA 5GT0A 5B31D 5AY8B 3AV2B 3B0DB 4Z66B 5AV8A 1P3BA 4YM6D 2Y2GA 5B2IC 3KXBD 2FJ7C 3AYWA 3W98B 5AVCC 2BYMB 1S32C 1Z2CB 2F2AC 3AFAC 3UTAD 3UTAA 3LJAA 4KGCC 2NZDD 1F1EA 3H0RC 3MGQA 5BNVB 3REHC 1HQ3C 4X23A 3FDDA 1F66C 1B67A 5KDMA 2ZY4A 5GSUA 3B0CW 3KUYD 1P3KD 4UUZA 3AZLC 3AZGB 5GT3D 1S32B 3AZMA 3REIA 5CPJC 2F8NG 3X1VC 5F99A 1P3AC 1TZYD 4H9SA 5CP6A 1P3PD 5B31G 1KX5D 1KX5A 5CPIC 2NQBC 1M19B 4M6BA 1BH8A 3X1SA 3WTPE 3H0LC 3AZNA 1EQZC 1P3LB 3VH5W 1F66B 3W97D 2JSSA 3LELA 3REKA 3MVDA 3O62D 3AZLB 5B0ZA 3B6GA 5JRGC 3AV1D 1ID3C 5B1LA 2HUEC 1M1AA 5DNMA 3MGRD 5CPIB 5B31C 3AZKD 5E5AD 4Z5TA 4KUDD 1KU5A 3AZFB 5B2JA 1P3MC 3KWQD 2Y2HA 3W96C 2L5AA 3AN2D 3C1CA 1P3FD 4WU9A 3H0MC 2AROD 1M18A 2F8NB 1ID3B 1P3IA 2HUEB 2CV5D 3WAAD 3UT9D 5AVBD 3REJA 3WA9D 4JJND 3UTBD 4J8UC 2Y2JA 1AOID 4WU8D 4E45A 5BS7C 3W96B 4XUJB 3EPJA 2Y2QA 3X1UA 1U35A 5B33D 4XZQA 1P3KC 1B6WA 3MGPA 4CAYB 4G91C 5B1MA 3WTPC 3C1BC 4J8UB 1N1JA 3R45B 1P3GD 5B40C 5DNNC 4YS3C 4J8VD 5B0YD 5C3IB 3W97C 5GXQC 4G91B 3WTPB 3C1BB 5AY8A 1P3OD 4H9OB 3MNNB 3MGRC 3W99C 3AV2A 1ZLAC 4Z66A 2J8PA 5DNNB 5B40B 5AV9D 3AZKC 4YS3B 4J8XB 5E5AC 4R8PD 5CPKB 4DRAA 4QLCD 2XD5A 3LZ0B 1KX4C 3W98A 5GXQB 2BYMA 3AL0C 2AROC 3EG5B 5B24B 5AVBC 2ZY5A 3W99B 1BH9B 3NQUB 1ZLAB 5BNVA 1KX3D 1KX4B 3TU4D 4WU8C 3IP4C 5AV6D 3AZGD 3AZGA 1S32A 3A6ND 5B33C 3B0CT 3RELD 2HIOD 3B6FC 4NE3A 4ZUXC 4CSRB 1M19A 3REHA 2BG1A 2ZY2A 4Z2MH 5BO0B 1WWSA 1W2EA 3X1TB 1F66A 2JCHA 3AZID 1P3LA 5BT1C 5G49B 5GT0D 3AZLA 4J8VC 4WZSB 3AZEC 4LD9C 4NE5A 3VH5T 3AZJC 1TAFB 1P3AA 3WKJC 2Y2PA 5AV8D 1P3BD 3B6FB 4ZUXB 2IO5B 5CPIA 2PYOB 3AYWD 4KHAB 5B32C 3AZFA 2F8NH 4EO5C 3AZEB 4R8PC 3LJAD 3AZJB 2F8NA 1ID3A 4ZBJC 3WKJB 1ULYA 3MGQD 5B2IB 2FJ7B 4X23D 5AVCB 5GSUD 1P34C 5B32B 3AZMD 3REID 3AFAB 5F99D 3W96A 4XUJA 4KGCB 4WNNB 5CP6D 3TU4C 4ZBJB 2LY8A 5AV6C 4H9QB 3A6NC 3REHB 1HQ3B 3X1SD 3KSYA 4CAYA 3AZND 1P34B 5AV5C 3LELD 4J8UA 3REKD 3LZ1C 3MVDD 3AZHC 2Y2LA 5B0ZD 4J8WC 3R45A 5CPJB 3B6GD 5BS7A 3X1VB 1P3AB 5B1LD 1M1AD 5DNMD 3MGSC 2NQBB 1R4VA 4Z5TD 1EQZB 4H9RB 3WTPA 3C1BA 1BFMA 3F6TA 5B2JD 5AV8C 5AV5B 4H9OA 3MNNA 3VH6T 4YM6C 3AZHB 3KXBC 4J8WB 3C1CD 5JRGB 5B40A 5DNNA 2FFFB 4WU9D 4YS3A 1M18D 4J8XA 1P3ID 5CPKD 5CPKA 2Y2KA 3LZ0A 3MGSB 3REJD 5B31B 5GXQA 3UTAC 4DRBA 2NZDC 5B24A 1P3MB 3MGQC 4YM6B 3W99A 1BH9A 3NQUA 3KXBB 1ZLAA 4H9PB 3X1UD 1U35D 2CWEA 5BNXB 4XZQD 3KUYC 1KX4A 5GT3C 3MGPD 2BYKB 5B1MD 1TZYC 4H9SC 5CP6C 1P3PC 2NZDB 4HGAC 1KX5C 4AWLC 4E44A 3X1SC 4CSRA 2JE5A 3KUYB 1P3KB 5BO0A 3MVDC 3X1TA 3O62C 5GT3B 3VH6W 5G49A 3AV1C 5B1LC 1TZYB 5CHLB 5AY8D 2F8NK 1P3PB 4HGAB 3B0BA 3AV2D 1TAFA 4AWLB 4Z66D 3B6FA 4ZUXA 4Z5TC 2PYOA 4KUDC 3W97B 3W98D 4KHAA 3KWQC 3O62B 1P3FC 3AN2C 3P5JB 3EPLA 3AV1B 3NQJB 3WAAC 3AZEA 2CV5C 2UWXA 3UT9C 3MGRB 3REJC 1H3OB 3AZJA 3WA9C 4JJNC 3WKJA 3AZKB 5E5AB 5B2IA 2FJ7A 3UTBC 4KUDB 1AOIC 5AVCA 3KWQB 2Y2NA 2RVQD 1P3FB 5B32A 3AN2B 1S32D 3AFAA 2AROB 1U35C 3WAAB 2CV5B 4UPKA 4XZQC 3UT9B 5AVBB 4KGCD 4KGCA 4WNNA 3WA9B 4JJNB 4H9QA 1M19D 3REHD 1HQ3A 3UTBB 3EPHA 1F66D 1AOIB 1P3LD 4WU8B 1P3GC 1P34A 3AZLD 2VQRA 5B0YC 5CPJA 2Y2IA 1Q9CA 5B33B 3X1VA 1P3AD 2DF4C 1JFIB 5CPID 2YFWB 2NQBA 5AY8C 1P3OC 4G92C 3AV2C 1EQZA 4H9RA 1EQZD 4Z66C 3AZFD 1P3GB 5JA4B 5AV5A 3AZHA 5AV9C 4J8VB 4LD9B 5B0YB 4QLCC 4J8WA 5JRGA 2F8ND 1ID3D 2ZM5A 3V9RB 3MGSA 5B31A 1P3OB 4G92B 1PZRA 2XD1A 1P3MD 1P3MA 5AV9B 4YM6A 4EO5B 1KX3C 4R8PB 3KXBA 4XUJD 4H9PA 4QLCB 3W96D 5FUGB 2YFVB 4Z2MG 5BNXA 2RVQC 3AZGC 2BYKA 3RELC 2HIOC 4J8UD 2NZDA 1M19C 1KX3B 3AZIC 3TU4B 1P3LC 5GT0C 3KUYA 1P3KA 4H9NB 5AV6B 1A7WA 5GT3A 3A6NB 3WTPD 1TZYA 3C1BD 3RELB 2HIOB 1P3PA 1P3BC 3MNND 3LZ1B 4DQYB 2DQNC 5B40D 5DNND 3AYWC 4YS3D 4J8XD 3AZIB 3LZ0D 3W97A 3AZFC 5GT0B 2W8SA 5GXQD 3O62A 2ZY3A 3LJAC 4NFTA 3AV1A 3NQJA 5B24D 5AV8B 1P3BB 3MGRA 3W99D 1H3OA 1ZLAD 4X23C 4NE6A 3VH5A 3AYWB 3AZKA 5E5AA 5GSUC 1KX4D 4KUDA 3EPKA 3AZMC 3REIC 2RIQA 3KWQA 1WWIA 5F99C 4XUJC 3LJAB 3UTAB 3AN2A 1P3FA 2AROA 3WAAA 2CV5A 3UT9A 5AVBA 3MGQB 3WA9A 1HTAA 4X23B 4JJNA 3AZNC 5KDMB 5GSUB 3LELC 3REKC 4UUZB 3X1TD 3UTBA 1AOIA 3AZMB 5B0ZC 3REIB 3B6GC 4WU8A 4WV4B 5F99B 5C3IC 5CP6B 1M1AC 5DNMC 5B33A 1KX5B 2Y2MA 1JFIA 2Y2OA 3B6FD 1BH8B 4ZUXD 3X1SB 2PYOD 3AZNB 2YFWA 5B2JC 3LELB 3REKB 3MNNC 3MVDB 5B0ZB 5BT1D 3B6GB 3C1CC 1P3GA 5JA4A 4WU9C 1M18C 4J8XC 5B1LB 4J8VA 3AZED 5CPKC 5B0YA 1P3IC 1M1AB 4LD9A 3LZ0C 4LD9D 5DNMB 3AZJD 3A1IA 3WKJD 2G5HC 3V9RA 5B2ID 2FJ7D 4Z5TB 5AVCD 5B24C 5B2JB 1P3OA 5B32D 3C1CB 3X1UC 3AFAD 4WU9B 5AV9A 1M18B 1P3IB 4R8PA 4QLCA 5FUGA 3VH6A 3REJB 2G5IC 2YFVA 3MGPC 5B1MC 1HQ3D 1P34D 4WJ3C 5CPJD 3X1UB
chains in the Genus database with same CATH topology
1U35B 1KX3A 3X1VD 4XZQB 3X1TC 3MGPB 3TU4A 3A1KA 4H9NA 5AV6A 2NQBD 5B1MB 3A6NA 1N1JB 3B0DC 3RELA 2HIOA 5AV5D 3AZHD 3LZ1D 3LZ1A 2IO5C 4J8WD 2PYOC 5JRGD 3W98C 5B32G 3AZIA 3MGSD 3KFUG 1T3UA 5GT0A 5B31D 5AY8B 3AV2B 3B0DB 4Z66B 5AV8A 1P3BA 4YM6D 2Y2GA 5B2IC 3KXBD 2FJ7C 3AYWA 3W98B 5AVCC 2BYMB 1S32C 1Z2CB 2F2AC 3AFAC 3UTAD 3UTAA 3LJAA 4KGCC 2NZDD 1F1EA 3H0RC 3MGQA 5BNVB 3REHC 1HQ3C 4X23A 3FDDA 1F66C 1B67A 5KDMA 2ZY4A 5GSUA 3B0CW 3KUYD 1P3KD 4UUZA 3AZLC 3AZGB 5GT3D 1S32B 3AZMA 3REIA 5CPJC 2F8NG 3X1VC 5F99A 1P3AC 1TZYD 4H9SA 5CP6A 1P3PD 5B31G 1KX5D 1KX5A 5CPIC 2NQBC 1M19B 4M6BA 1BH8A 3X1SA 3WTPE 3H0LC 3AZNA 1EQZC 1P3LB 3VH5W 1F66B 3W97D 2JSSA 3LELA 3REKA 3MVDA 3O62D 3AZLB 5B0ZA 3B6GA 5JRGC 3AV1D 1ID3C 5B1LA 2HUEC 1M1AA 5DNMA 3MGRD 5CPIB 5B31C 3AZKD 5E5AD 4Z5TA 4KUDD 1KU5A 3AZFB 5B2JA 1P3MC 3KWQD 2Y2HA 3W96C 2L5AA 3AN2D 3C1CA 1P3FD 4WU9A 3H0MC 2AROD 1M18A 2F8NB 1ID3B 1P3IA 2HUEB 2CV5D 3WAAD 3UT9D 5AVBD 3REJA 3WA9D 4JJND 3UTBD 4J8UC 2Y2JA 1AOID 4WU8D 4E45A 5BS7C 3W96B 4XUJB 3EPJA 2Y2QA 3X1UA 1U35A 5B33D 4XZQA 1P3KC 1B6WA 3MGPA 4CAYB 4G91C 5B1MA 3WTPC 3C1BC 4J8UB 1N1JA 3R45B 1P3GD 5B40C 5DNNC 4YS3C 4J8VD 5B0YD 5C3IB 3W97C 5GXQC 4G91B 3WTPB 3C1BB 5AY8A 1P3OD 4H9OB 3MNNB 3MGRC 3W99C 3AV2A 1ZLAC 4Z66A 2J8PA 5DNNB 5B40B 5AV9D 3AZKC 4YS3B 4J8XB 5E5AC 4R8PD 5CPKB 4DRAA 4QLCD 2XD5A 3LZ0B 1KX4C 3W98A 5GXQB 2BYMA 3AL0C 2AROC 3EG5B 5B24B 5AVBC 2ZY5A 3W99B 1BH9B 3NQUB 1ZLAB 5BNVA 1KX3D 1KX4B 3TU4D 4WU8C 3IP4C 5AV6D 3AZGD 3AZGA 1S32A 3A6ND 5B33C 3B0CT 3RELD 2HIOD 3B6FC 4NE3A 4ZUXC 4CSRB 1M19A 3REHA 2BG1A 2ZY2A 4Z2MH 5BO0B 1WWSA 1W2EA 3X1TB 1F66A 2JCHA 3AZID 1P3LA 5BT1C 5G49B 5GT0D 3AZLA 4J8VC 4WZSB 3AZEC 4LD9C 4NE5A 3VH5T 3AZJC 1TAFB 1P3AA 3WKJC 2Y2PA 5AV8D 1P3BD 3B6FB 4ZUXB 2IO5B 5CPIA 2PYOB 3AYWD 4KHAB 5B32C 3AZFA 2F8NH 4EO5C 3AZEB 4R8PC 3LJAD 3AZJB 2F8NA 1ID3A 4ZBJC 3WKJB 1ULYA 3MGQD 5B2IB 2FJ7B 4X23D 5AVCB 5GSUD 1P34C 5B32B 3AZMD 3REID 3AFAB 5F99D 3W96A 4XUJA 4KGCB 4WNNB 5CP6D 3TU4C 4ZBJB 2LY8A 5AV6C 4H9QB 3A6NC 3REHB 1HQ3B 3X1SD 3KSYA 4CAYA 3AZND 1P34B 5AV5C 3LELD 4J8UA 3REKD 3LZ1C 3MVDD 3AZHC 2Y2LA 5B0ZD 4J8WC 3R45A 5CPJB 3B6GD 5BS7A 3X1VB 1P3AB 5B1LD 1M1AD 5DNMD 3MGSC 2NQBB 1R4VA 4Z5TD 1EQZB 4H9RB 3WTPA 3C1BA 1BFMA 3F6TA 5B2JD 5AV8C 5AV5B 4H9OA 3MNNA 3VH6T 4YM6C 3AZHB 3KXBC 4J8WB 3C1CD 5JRGB 5B40A 5DNNA 2FFFB 4WU9D 4YS3A 1M18D 4J8XA 1P3ID 5CPKD 5CPKA 2Y2KA 3LZ0A 3MGSB 3REJD 5B31B 5GXQA 3UTAC 4DRBA 2NZDC 5B24A 1P3MB 3MGQC 4YM6B 3W99A 1BH9A 3NQUA 3KXBB 1ZLAA 4H9PB 3X1UD 1U35D 2CWEA 5BNXB 4XZQD 3KUYC 1KX4A 5GT3C 3MGPD 2BYKB 5B1MD 1TZYC 4H9SC 5CP6C 1P3PC 2NZDB 4HGAC 1KX5C 4AWLC 4E44A 3X1SC 4CSRA 2JE5A 3KUYB 1P3KB 5BO0A 3MVDC 3X1TA 3O62C 5GT3B 3VH6W 5G49A 3AV1C 5B1LC 1TZYB 5CHLB 5AY8D 2F8NK 1P3PB 4HGAB 3B0BA 3AV2D 1TAFA 4AWLB 4Z66D 3B6FA 4ZUXA 4Z5TC 2PYOA 4KUDC 3W97B 3W98D 4KHAA 3KWQC 3O62B 1P3FC 3AN2C 3P5JB 3EPLA 3AV1B 3NQJB 3WAAC 3AZEA 2CV5C 2UWXA 3UT9C 3MGRB 3REJC 1H3OB 3AZJA 3WA9C 4JJNC 3WKJA 3AZKB 5E5AB 5B2IA 2FJ7A 3UTBC 4KUDB 1AOIC 5AVCA 3KWQB 2Y2NA 2RVQD 1P3FB 5B32A 3AN2B 1S32D 3AFAA 2AROB 1U35C 3WAAB 2CV5B 4UPKA 4XZQC 3UT9B 5AVBB 4KGCD 4KGCA 4WNNA 3WA9B 4JJNB 4H9QA 1M19D 3REHD 1HQ3A 3UTBB 3EPHA 1F66D 1AOIB 1P3LD 4WU8B 1P3GC 1P34A 3AZLD 2VQRA 5B0YC 5CPJA 2Y2IA 1Q9CA 5B33B 3X1VA 1P3AD 2DF4C 1JFIB 5CPID 2YFWB 2NQBA 5AY8C 1P3OC 4G92C 3AV2C 1EQZA 4H9RA 1EQZD 4Z66C 3AZFD 1P3GB 5JA4B 5AV5A 3AZHA 5AV9C 4J8VB 4LD9B 5B0YB 4QLCC 4J8WA 5JRGA 2F8ND 1ID3D 2ZM5A 3V9RB 3MGSA 5B31A 1P3OB 4G92B 1PZRA 2XD1A 1P3MD 1P3MA 5AV9B 4YM6A 4EO5B 1KX3C 4R8PB 3KXBA 4XUJD 4H9PA 4QLCB 3W96D 5FUGB 2YFVB 4Z2MG 5BNXA 2RVQC 3AZGC 2BYKA 3RELC 2HIOC 4J8UD 2NZDA 1M19C 1KX3B 3AZIC 3TU4B 1P3LC 5GT0C 3KUYA 1P3KA 4H9NB 5AV6B 1A7WA 5GT3A 3A6NB 3WTPD 1TZYA 3C1BD 3RELB 2HIOB 1P3PA 1P3BC 3MNND 3LZ1B 4DQYB 2DQNC 5B40D 5DNND 3AYWC 4YS3D 4J8XD 3AZIB 3LZ0D 3W97A 3AZFC 5GT0B 2W8SA 5GXQD 3O62A 2ZY3A 3LJAC 4NFTA 3AV1A 3NQJA 5B24D 5AV8B 1P3BB 3MGRA 3W99D 1H3OA 1ZLAD 4X23C 4NE6A 3VH5A 3AYWB 3AZKA 5E5AA 5GSUC 1KX4D 4KUDA 3EPKA 3AZMC 3REIC 2RIQA 3KWQA 1WWIA 5F99C 4XUJC 3LJAB 3UTAB 3AN2A 1P3FA 2AROA 3WAAA 2CV5A 3UT9A 5AVBA 3MGQB 3WA9A 1HTAA 4X23B 4JJNA 3AZNC 5KDMB 5GSUB 3LELC 3REKC 4UUZB 3X1TD 3UTBA 1AOIA 3AZMB 5B0ZC 3REIB 3B6GC 4WU8A 4WV4B 5F99B 5C3IC 5CP6B 1M1AC 5DNMC 5B33A 1KX5B 2Y2MA 1JFIA 2Y2OA 3B6FD 1BH8B 4ZUXD 3X1SB 2PYOD 3AZNB 2YFWA 5B2JC 3LELB 3REKB 3MNNC 3MVDB 5B0ZB 5BT1D 3B6GB 3C1CC 1P3GA 5JA4A 4WU9C 1M18C 4J8XC 5B1LB 4J8VA 3AZED 5CPKC 5B0YA 1P3IC 1M1AB 4LD9A 3LZ0C 4LD9D 5DNMB 3AZJD 3A1IA 3WKJD 2G5HC 3V9RA 5B2ID 2FJ7D 4Z5TB 5AVCD 5B24C 5B2JB 1P3OA 5B32D 3C1CB 3X1UC 3AFAD 4WU9B 5AV9A 1M18B 1P3IB 4R8PA 4QLCA 5FUGA 3VH6A 3REJB 2G5IC 2YFVA 3MGPC 5B1MC 1HQ3D 1P34D 4WJ3C 5CPJD 3X1UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U35 B;  1KX3 A;  3X1V D;  4XZQ B;  3X1T C;  3MGP B;  3TU4 A;  4H9N A;  5AV6 A;  2NQB D;  5B1M B;  3A6N A;  1N1J B;  3B0D C;  3REL A;  2HIO A;  5AV5 D;  3AZH D;  3LZ1 D;  3LZ1 A;  2IO5 C;  4J8W D;  2PYO C;  5JRG D;  3W98 C;  5B32 G;  3AZI A;  3MGS D;  5GT0 A;  5B31 D;  5AY8 B;  3AV2 B;  3B0D B;  4Z66 B;  5AV8 A;  1P3B A;  4YM6 D;  5B2I C;  3KXB D;  2FJ7 C;  3AYW A;  3W98 B;  5AVC C;  2BYM B;  1S32 C;  3AFA C;  3UTA D;  3UTA A;  3LJA A;  4KGC C;  2NZD D;  1F1E A;  3MGQ A;  5BNV B;  3REH C;  1HQ3 C;  4X23 A;  1F66 C;  1B67 A;  5KDM A;  3B0C W;  5GSU A;  3KUY D;  1P3K D;  4UUZ A;  3AZL C;  3AZG B;  5GT3 D;  1S32 B;  3AZM A;  3REI A;  5CPJ C;  2F8N G;  3X1V C;  5F99 A;  1P3A C;  1TZY D;  4H9S A;  5CP6 A;  1P3P D;  5B31 G;  1KX5 D;  1KX5 A;  5CPI C;  2NQB C;  1M19 B;  4M6B A;  1BH8 A;  3X1S A;  3WTP E;  1F66 B;  3AZN A;  1EQZ C;  1P3L B;  3VH5 W;  3W97 D;  2JSS A;  3LEL A;  3REK A;  3MVD A;  3O62 D;  3AZL B;  5B0Z A;  3B6G A;  5JRG C;  3AV1 D;  1ID3 C;  5B1L A;  2HUE C;  1M1A A;  5DNM A;  3MGR D;  5CPI B;  5B31 C;  3AZK D;  5E5A D;  4Z5T A;  4KUD D;  1KU5 A;  3AZF B;  5B2J A;  1P3M C;  3KWQ D;  3W96 C;  2L5A A;  3AN2 D;  3C1C A;  1P3F D;  4WU9 A;  2ARO D;  1M18 A;  2F8N B;  1ID3 B;  1P3I A;  2HUE B;  2CV5 D;  3WAA D;  3UT9 D;  5AVB D;  3REJ A;  3WA9 D;  4JJN D;  3UTB D;  4J8U C;  1AOI D;  4WU8 D;  4E45 A;  5BS7 C;  3W96 B;  4XUJ B;  3X1U A;  1U35 A;  5B33 D;  4XZQ A;  1P3K C;  1B6W A;  3MGP A;  4CAY B;  4G91 C;  5B1M A;  3WTP C;  3C1B C;  4J8U B;  1N1J A;  3R45 B;  1P3G D;  5B40 C;  5DNN C;  4YS3 C;  4J8V D;  5B0Y D;  5C3I B;  3W97 C;  5GXQ C;  4G91 B;  3WTP B;  3C1B B;  5AY8 A;  1P3O D;  4H9O B;  3MNN B;  3MGR C;  3W99 C;  3AV2 A;  1ZLA C;  4Z66 A;  5B40 B;  5DNN B;  5AV9 D;  3AZK C;  4YS3 B;  4J8X B;  5E5A C;  4R8P D;  5CPK B;  4DRA A;  4QLC D;  3LZ0 B;  1KX4 C;  3W98 A;  5GXQ B;  2BYM A;  2ARO C;  5B24 B;  5AVB C;  3W99 B;  3NQU B;  1BH9 B;  1ZLA B;  5BNV A;  1KX3 D;  1KX4 B;  3TU4 D;  4WU8 C;  5AV6 D;  3AZG D;  3AZG A;  1S32 A;  3A6N D;  5B33 C;  3B0C T;  3REL D;  2HIO D;  3B6F C;  4NE3 A;  4ZUX C;  4CSR B;  1M19 A;  3REH A;  4Z2M H;  5BO0 B;  1WWS A;  3X1T B;  1F66 A;  3AZI D;  1P3L A;  5BT1 C;  5G49 B;  5GT0 D;  3AZL A;  4J8V C;  4WZS B;  3AZE C;  4LD9 C;  4NE5 A;  3VH5 T;  3AZJ C;  1TAF B;  1P3A A;  3WKJ C;  5AV8 D;  1P3B D;  3B6F B;  4ZUX B;  2IO5 B;  5CPI A;  2PYO B;  3AYW D;  4KHA B;  5B32 C;  3AZF A;  2F8N H;  4EO5 C;  3AZE B;  4R8P C;  3LJA D;  3AZJ B;  2F8N A;  1ID3 A;  4ZBJ C;  3WKJ B;  1ULY A;  3MGQ D;  5B2I B;  2FJ7 B;  4X23 D;  5AVC B;  5GSU D;  1P34 C;  5B32 B;  3AZM D;  3REI D;  3AFA B;  5F99 D;  3W96 A;  4XUJ A;  4KGC B;  4WNN B;  5CP6 D;  3TU4 C;  4ZBJ B;  2LY8 A;  5AV6 C;  4H9Q B;  3A6N C;  3REH B;  1HQ3 B;  3X1S D;  3KSY A;  4CAY A;  3AZN D;  1P34 B;  5AV5 C;  3LEL D;  4J8U A;  3REK D;  3LZ1 C;  3MVD D;  3AZH C;  5B0Z D;  4J8W C;  5CPJ B;  3R45 A;  3B6G D;  5BS7 A;  3X1V B;  1P3A B;  5B1L D;  1M1A D;  5DNM D;  3MGS C;  2NQB B;  1R4V A;  4Z5T D;  1EQZ B;  4H9R B;  3WTP A;  3C1B A;  1BFM A;  5B2J D;  5AV8 C;  5AV5 B;  3AZH B;  4H9O A;  3MNN A;  3VH6 T;  4YM6 C;  3KXB C;  4J8W B;  3C1C D;  5JRG B;  5B40 A;  5DNN A;  4WU9 D;  4YS3 A;  1M18 D;  4J8X A;  1P3I D;  5CPK D;  5CPK A;  3LZ0 A;  3MGS B;  3REJ D;  5B31 B;  5GXQ A;  3UTA C;  4DRB A;  2NZD C;  5B24 A;  1P3M B;  3MGQ C;  4YM6 B;  3W99 A;  1BH9 A;  3NQU A;  3KXB B;  1ZLA A;  4H9P B;  3X1U D;  1U35 D;  2CWE A;  5BNX B;  4XZQ D;  3KUY C;  1KX4 A;  5GT3 C;  3MGP D;  2BYK B;  5B1M D;  1TZY C;  4H9S C;  5CP6 C;  1P3P C;  2NZD B;  4HGA C;  1KX5 C;  4AWL C;  4E44 A;  3X1S C;  4CSR A;  3KUY B;  1P3K B;  5BO0 A;  3MVD C;  3X1T A;  3O62 C;  5GT3 B;  3VH6 W;  5G49 A;  3AV1 C;  5B1L C;  1TZY B;  5CHL B;  5AY8 D;  2F8N K;  1P3P B;  4HGA B;  3B0B A;  3AV2 D;  1TAF A;  4AWL B;  4Z66 D;  3B6F A;  4ZUX A;  4Z5T C;  2PYO A;  4KUD C;  3W97 B;  3W98 D;  4KHA A;  3KWQ C;  3O62 B;  1P3F C;  3AN2 C;  3AV1 B;  3NQJ B;  3WAA C;  3AZE A;  2CV5 C;  3UT9 C;  3MGR B;  3REJ C;  1H3O B;  3AZJ A;  3WA9 C;  4JJN C;  3WKJ A;  3AZK B;  5E5A B;  5B2I A;  2FJ7 A;  3UTB C;  4KUD B;  1AOI C;  5AVC A;  3KWQ B;  2RVQ D;  1P3F B;  5B32 A;  3AN2 B;  1S32 D;  3AFA A;  2ARO B;  1U35 C;  3WAA B;  2CV5 B;  4XZQ C;  3UT9 B;  5AVB B;  4KGC D;  4KGC A;  4WNN A;  3WA9 B;  4JJN B;  4H9Q A;  1M19 D;  3REH D;  1HQ3 A;  3UTB B;  1F66 D;  1AOI B;  1P3L D;  4WU8 B;  1P3G C;  1P34 A;  3AZL D;  5B0Y C;  5CPJ A;  1Q9C A;  5B33 B;  3X1V A;  1P3A D;  1JFI B;  5CPI D;  2YFW B;  2NQB A;  5AY8 C;  1P3O C;  4G92 C;  3AV2 C;  1EQZ A;  4H9R A;  1EQZ D;  4Z66 C;  3AZF D;  1P3G B;  5JA4 B;  5AV5 A;  3AZH A;  5AV9 C;  4J8V B;  4LD9 B;  5B0Y B;  4QLC C;  4J8W A;  5JRG A;  2F8N D;  1ID3 D;  3V9R B;  3MGS A;  5B31 A;  1P3O B;  4G92 B;  1P3M D;  1P3M A;  5AV9 B;  4YM6 A;  4EO5 B;  1KX3 C;  4R8P B;  3KXB A;  4XUJ D;  4H9P A;  4QLC B;  3W96 D;  5FUG B;  2YFV B;  4Z2M G;  5BNX A;  2RVQ C;  3AZG C;  2BYK A;  3REL C;  2HIO C;  4J8U D;  2NZD A;  1M19 C;  1KX3 B;  3AZI C;  3TU4 B;  1P3L C;  5GT0 C;  3KUY A;  1P3K A;  4H9N B;  5AV6 B;  1A7W A;  5GT3 A;  3A6N B;  3WTP D;  1TZY A;  3C1B D;  3REL B;  2HIO B;  1P3P A;  1P3B C;  3MNN D;  3LZ1 B;  5B40 D;  5DNN D;  3AYW C;  4YS3 D;  4J8X D;  3AZI B;  3LZ0 D;  3W97 A;  3AZF C;  5GT0 B;  5GXQ D;  3O62 A;  3LJA C;  4NFT A;  3AV1 A;  3NQJ A;  5B24 D;  5AV8 B;  1P3B B;  3MGR A;  3W99 D;  1H3O A;  1ZLA D;  4X23 C;  4NE6 A;  3VH5 A;  3AYW B;  3AZK A;  5E5A A;  5GSU C;  1KX4 D;  4KUD A;  3AZM C;  3REI C;  3KWQ A;  1WWI A;  5F99 C;  4XUJ C;  3LJA B;  3UTA B;  3AN2 A;  1P3F A;  2ARO A;  3WAA A;  2CV5 A;  3UT9 A;  5AVB A;  3MGQ B;  3WA9 A;  1HTA A;  4X23 B;  4JJN A;  3AZN C;  5KDM B;  5GSU B;  3LEL C;  3REK C;  4UUZ B;  3X1T D;  3UTB A;  1AOI A;  3AZM B;  5B0Z C;  3REI B;  3B6G C;  4WU8 A;  4WV4 B;  5F99 B;  5C3I C;  5CP6 B;  1M1A C;  5DNM C;  5B33 A;  1KX5 B;  1JFI A;  3B6F D;  1BH8 B;  4ZUX D;  3X1S B;  2PYO D;  3AZN B;  2YFW A;  5B2J C;  3LEL B;  3REK B;  3MNN C;  3MVD B;  5B0Z B;  5BT1 D;  3B6G B;  3C1C C;  1P3G A;  5JA4 A;  4WU9 C;  1M18 C;  4J8X C;  5B1L B;  4J8V A;  3AZE D;  5CPK C;  5B0Y A;  1P3I C;  1M1A B;  4LD9 A;  3LZ0 C;  4LD9 D;  5DNM B;  3AZJ D;  3WKJ D;  3V9R A;  5B2I D;  2FJ7 D;  4Z5T B;  5AVC D;  5B24 C;  5B2J B;  1P3O A;  5B32 D;  3C1C B;  3X1U C;  3AFA D;  4WU9 B;  5AV9 A;  1M18 B;  1P3I B;  4R8P A;  4QLC A;  5FUG A;  3VH6 A;  3REJ B;  2YFV A;  3MGP C;  5B1M C;  1HQ3 D;  1P34 D;  5CPJ D;  3X1U B; 
#chains in the Genus database with same CATH topology
 1U35 B;  1KX3 A;  3X1V D;  4XZQ B;  3X1T C;  3MGP B;  3TU4 A;  3A1K A;  4H9N A;  5AV6 A;  2NQB D;  5B1M B;  3A6N A;  1N1J B;  3B0D C;  3REL A;  2HIO A;  5AV5 D;  3AZH D;  3LZ1 D;  3LZ1 A;  2IO5 C;  4J8W D;  2PYO C;  5JRG D;  3W98 C;  5B32 G;  3AZI A;  3MGS D;  3KFU G;  1T3U A;  5GT0 A;  5B31 D;  5AY8 B;  3AV2 B;  3B0D B;  4Z66 B;  5AV8 A;  1P3B A;  4YM6 D;  2Y2G A;  5B2I C;  3KXB D;  2FJ7 C;  3AYW A;  3W98 B;  5AVC C;  2BYM B;  1S32 C;  1Z2C B;  2F2A C;  3AFA C;  3UTA D;  3UTA A;  3LJA A;  4KGC C;  2NZD D;  1F1E A;  3H0R C;  3MGQ A;  5BNV B;  3REH C;  1HQ3 C;  4X23 A;  3FDD A;  1F66 C;  1B67 A;  5KDM A;  2ZY4 A;  5GSU A;  3B0C W;  3KUY D;  1P3K D;  4UUZ A;  3AZL C;  3AZG B;  5GT3 D;  1S32 B;  3AZM A;  3REI A;  5CPJ C;  2F8N G;  3X1V C;  5F99 A;  1P3A C;  1TZY D;  4H9S A;  5CP6 A;  1P3P D;  5B31 G;  1KX5 D;  1KX5 A;  5CPI C;  2NQB C;  1M19 B;  4M6B A;  1BH8 A;  3X1S A;  3WTP E;  3H0L C;  3AZN A;  1EQZ C;  1P3L B;  3VH5 W;  1F66 B;  3W97 D;  2JSS A;  3LEL A;  3REK A;  3MVD A;  3O62 D;  3AZL B;  5B0Z A;  3B6G A;  5JRG C;  3AV1 D;  1ID3 C;  5B1L A;  2HUE C;  1M1A A;  5DNM A;  3MGR D;  5CPI B;  5B31 C;  3AZK D;  5E5A D;  4Z5T A;  4KUD D;  1KU5 A;  3AZF B;  5B2J A;  1P3M C;  3KWQ D;  2Y2H A;  3W96 C;  2L5A A;  3AN2 D;  3C1C A;  1P3F D;  4WU9 A;  3H0M C;  2ARO D;  1M18 A;  2F8N B;  1ID3 B;  1P3I A;  2HUE B;  2CV5 D;  3WAA D;  3UT9 D;  5AVB D;  3REJ A;  3WA9 D;  4JJN D;  3UTB D;  4J8U C;  2Y2J A;  1AOI D;  4WU8 D;  4E45 A;  5BS7 C;  3W96 B;  4XUJ B;  3EPJ A;  2Y2Q A;  3X1U A;  1U35 A;  5B33 D;  4XZQ A;  1P3K C;  1B6W A;  3MGP A;  4CAY B;  4G91 C;  5B1M A;  3WTP C;  3C1B C;  4J8U B;  1N1J A;  3R45 B;  1P3G D;  5B40 C;  5DNN C;  4YS3 C;  4J8V D;  5B0Y D;  5C3I B;  3W97 C;  5GXQ C;  4G91 B;  3WTP B;  3C1B B;  5AY8 A;  1P3O D;  4H9O B;  3MNN B;  3MGR C;  3W99 C;  3AV2 A;  1ZLA C;  4Z66 A;  2J8P A;  5DNN B;  5B40 B;  5AV9 D;  3AZK C;  4YS3 B;  4J8X B;  5E5A C;  4R8P D;  5CPK B;  4DRA A;  4QLC D;  2XD5 A;  3LZ0 B;  1KX4 C;  3W98 A;  5GXQ B;  2BYM A;  3AL0 C;  2ARO C;  3EG5 B;  5B24 B;  5AVB C;  2ZY5 A;  3W99 B;  1BH9 B;  3NQU B;  1ZLA B;  5BNV A;  1KX3 D;  1KX4 B;  3TU4 D;  4WU8 C;  3IP4 C;  5AV6 D;  3AZG D;  3AZG A;  1S32 A;  3A6N D;  5B33 C;  3B0C T;  3REL D;  2HIO D;  3B6F C;  4NE3 A;  4ZUX C;  4CSR B;  1M19 A;  3REH A;  2BG1 A;  2ZY2 A;  4Z2M H;  5BO0 B;  1WWS A;  1W2E A;  3X1T B;  1F66 A;  2JCH A;  3AZI D;  1P3L A;  5BT1 C;  5G49 B;  5GT0 D;  3AZL A;  4J8V C;  4WZS B;  3AZE C;  4LD9 C;  4NE5 A;  3VH5 T;  3AZJ C;  1TAF B;  1P3A A;  3WKJ C;  2Y2P A;  5AV8 D;  1P3B D;  3B6F B;  4ZUX B;  2IO5 B;  5CPI A;  2PYO B;  3AYW D;  4KHA B;  5B32 C;  3AZF A;  2F8N H;  4EO5 C;  3AZE B;  4R8P C;  3LJA D;  3AZJ B;  2F8N A;  1ID3 A;  4ZBJ C;  3WKJ B;  1ULY A;  3MGQ D;  5B2I B;  2FJ7 B;  4X23 D;  5AVC B;  5GSU D;  1P34 C;  5B32 B;  3AZM D;  3REI D;  3AFA B;  5F99 D;  3W96 A;  4XUJ A;  4KGC B;  4WNN B;  5CP6 D;  3TU4 C;  4ZBJ B;  2LY8 A;  5AV6 C;  4H9Q B;  3A6N C;  3REH B;  1HQ3 B;  3X1S D;  3KSY A;  4CAY A;  3AZN D;  1P34 B;  5AV5 C;  3LEL D;  4J8U A;  3REK D;  3LZ1 C;  3MVD D;  3AZH C;  2Y2L A;  5B0Z D;  4J8W C;  3R45 A;  5CPJ B;  3B6G D;  5BS7 A;  3X1V B;  1P3A B;  5B1L D;  1M1A D;  5DNM D;  3MGS C;  2NQB B;  1R4V A;  4Z5T D;  1EQZ B;  4H9R B;  3WTP A;  3C1B A;  1BFM A;  3F6T A;  5B2J D;  5AV8 C;  5AV5 B;  4H9O A;  3MNN A;  3VH6 T;  4YM6 C;  3AZH B;  3KXB C;  4J8W B;  3C1C D;  5JRG B;  5B40 A;  5DNN A;  2FFF B;  4WU9 D;  4YS3 A;  1M18 D;  4J8X A;  1P3I D;  5CPK D;  5CPK A;  2Y2K A;  3LZ0 A;  3MGS B;  3REJ D;  5B31 B;  5GXQ A;  3UTA C;  4DRB A;  2NZD C;  5B24 A;  1P3M B;  3MGQ C;  4YM6 B;  3W99 A;  1BH9 A;  3NQU A;  3KXB B;  1ZLA A;  4H9P B;  3X1U D;  1U35 D;  2CWE A;  5BNX B;  4XZQ D;  3KUY C;  1KX4 A;  5GT3 C;  3MGP D;  2BYK B;  5B1M D;  1TZY C;  4H9S C;  5CP6 C;  1P3P C;  2NZD B;  4HGA C;  1KX5 C;  4AWL C;  4E44 A;  3X1S C;  4CSR A;  2JE5 A;  3KUY B;  1P3K B;  5BO0 A;  3MVD C;  3X1T A;  3O62 C;  5GT3 B;  3VH6 W;  5G49 A;  3AV1 C;  5B1L C;  1TZY B;  5CHL B;  5AY8 D;  2F8N K;  1P3P B;  4HGA B;  3B0B A;  3AV2 D;  1TAF A;  4AWL B;  4Z66 D;  3B6F A;  4ZUX A;  4Z5T C;  2PYO A;  4KUD C;  3W97 B;  3W98 D;  4KHA A;  3KWQ C;  3O62 B;  1P3F C;  3AN2 C;  3P5J B;  3EPL A;  3AV1 B;  3NQJ B;  3WAA C;  3AZE A;  2CV5 C;  2UWX A;  3UT9 C;  3MGR B;  3REJ C;  1H3O B;  3AZJ A;  3WA9 C;  4JJN C;  3WKJ A;  3AZK B;  5E5A B;  5B2I A;  2FJ7 A;  3UTB C;  4KUD B;  1AOI C;  5AVC A;  3KWQ B;  2Y2N A;  2RVQ D;  1P3F B;  5B32 A;  3AN2 B;  1S32 D;  3AFA A;  2ARO B;  1U35 C;  3WAA B;  2CV5 B;  4UPK A;  4XZQ C;  3UT9 B;  5AVB B;  4KGC D;  4KGC A;  4WNN A;  3WA9 B;  4JJN B;  4H9Q A;  1M19 D;  3REH D;  1HQ3 A;  3UTB B;  3EPH A;  1F66 D;  1AOI B;  1P3L D;  4WU8 B;  1P3G C;  1P34 A;  3AZL D;  2VQR A;  5B0Y C;  5CPJ A;  2Y2I A;  1Q9C A;  5B33 B;  3X1V A;  1P3A D;  2DF4 C;  1JFI B;  5CPI D;  2YFW B;  2NQB A;  5AY8 C;  1P3O C;  4G92 C;  3AV2 C;  1EQZ A;  4H9R A;  1EQZ D;  4Z66 C;  3AZF D;  1P3G B;  5JA4 B;  5AV5 A;  3AZH A;  5AV9 C;  4J8V B;  4LD9 B;  5B0Y B;  4QLC C;  4J8W A;  5JRG A;  2F8N D;  1ID3 D;  2ZM5 A;  3V9R B;  3MGS A;  5B31 A;  1P3O B;  4G92 B;  1PZR A;  2XD1 A;  1P3M D;  1P3M A;  5AV9 B;  4YM6 A;  4EO5 B;  1KX3 C;  4R8P B;  3KXB A;  4XUJ D;  4H9P A;  4QLC B;  3W96 D;  5FUG B;  2YFV B;  4Z2M G;  5BNX A;  2RVQ C;  3AZG C;  2BYK A;  3REL C;  2HIO C;  4J8U D;  2NZD A;  1M19 C;  1KX3 B;  3AZI C;  3TU4 B;  1P3L C;  5GT0 C;  3KUY A;  1P3K A;  4H9N B;  5AV6 B;  1A7W A;  5GT3 A;  3A6N B;  3WTP D;  1TZY A;  3C1B D;  3REL B;  2HIO B;  1P3P A;  1P3B C;  3MNN D;  3LZ1 B;  4DQY B;  2DQN C;  5B40 D;  5DNN D;  3AYW C;  4YS3 D;  4J8X D;  3AZI B;  3LZ0 D;  3W97 A;  3AZF C;  5GT0 B;  2W8S A;  5GXQ D;  3O62 A;  2ZY3 A;  3LJA C;  4NFT A;  3AV1 A;  3NQJ A;  5B24 D;  5AV8 B;  1P3B B;  3MGR A;  3W99 D;  1H3O A;  1ZLA D;  4X23 C;  4NE6 A;  3VH5 A;  3AYW B;  3AZK A;  5E5A A;  5GSU C;  1KX4 D;  4KUD A;  3EPK A;  3AZM C;  3REI C;  2RIQ A;  3KWQ A;  1WWI A;  5F99 C;  4XUJ C;  3LJA B;  3UTA B;  3AN2 A;  1P3F A;  2ARO A;  3WAA A;  2CV5 A;  3UT9 A;  5AVB A;  3MGQ B;  3WA9 A;  1HTA A;  4X23 B;  4JJN A;  3AZN C;  5KDM B;  5GSU B;  3LEL C;  3REK C;  4UUZ B;  3X1T D;  3UTB A;  1AOI A;  3AZM B;  5B0Z C;  3REI B;  3B6G C;  4WU8 A;  4WV4 B;  5F99 B;  5C3I C;  5CP6 B;  1M1A C;  5DNM C;  5B33 A;  1KX5 B;  2Y2M A;  1JFI A;  2Y2O A;  3B6F D;  1BH8 B;  4ZUX D;  3X1S B;  2PYO D;  3AZN B;  2YFW A;  5B2J C;  3LEL B;  3REK B;  3MNN C;  3MVD B;  5B0Z B;  5BT1 D;  3B6G B;  3C1C C;  1P3G A;  5JA4 A;  4WU9 C;  1M18 C;  4J8X C;  5B1L B;  4J8V A;  3AZE D;  5CPK C;  5B0Y A;  1P3I C;  1M1A B;  4LD9 A;  3LZ0 C;  4LD9 D;  5DNM B;  3AZJ D;  3A1I A;  3WKJ D;  2G5H C;  3V9R A;  5B2I D;  2FJ7 D;  4Z5T B;  5AVC D;  5B24 C;  5B2J B;  1P3O A;  5B32 D;  3C1C B;  3X1U C;  3AFA D;  4WU9 B;  5AV9 A;  1M18 B;  1P3I B;  4R8P A;  4QLC A;  5FUG A;  3VH6 A;  3REJ B;  2G5I C;  2YFV A;  3MGP C;  5B1M C;  1HQ3 D;  1P34 D;  4WJ3 C;  5CPJ D;  3X1U B; 
#chains in the Genus database with same CATH homology
 1U35 B;  1KX3 A;  3X1V D;  4XZQ B;  3X1T C;  3MGP B;  3TU4 A;  3A1K A;  4H9N A;  5AV6 A;  2NQB D;  5B1M B;  3A6N A;  1N1J B;  3B0D C;  3REL A;  2HIO A;  5AV5 D;  3AZH D;  3LZ1 D;  3LZ1 A;  2IO5 C;  4J8W D;  2PYO C;  5JRG D;  3W98 C;  5B32 G;  3AZI A;  3MGS D;  3KFU G;  1T3U A;  5GT0 A;  5B31 D;  5AY8 B;  3AV2 B;  3B0D B;  4Z66 B;  5AV8 A;  1P3B A;  4YM6 D;  2Y2G A;  5B2I C;  3KXB D;  2FJ7 C;  3AYW A;  3W98 B;  5AVC C;  2BYM B;  1S32 C;  1Z2C B;  2F2A C;  3AFA C;  3UTA D;  3UTA A;  3LJA A;  4KGC C;  2NZD D;  1F1E A;  3H0R C;  3MGQ A;  5BNV B;  3REH C;  1HQ3 C;  4X23 A;  3FDD A;  1F66 C;  1B67 A;  5KDM A;  2ZY4 A;  5GSU A;  3B0C W;  3KUY D;  1P3K D;  4UUZ A;  3AZL C;  3AZG B;  5GT3 D;  1S32 B;  3AZM A;  3REI A;  5CPJ C;  2F8N G;  3X1V C;  5F99 A;  1P3A C;  1TZY D;  4H9S A;  5CP6 A;  1P3P D;  5B31 G;  1KX5 D;  1KX5 A;  5CPI C;  2NQB C;  1M19 B;  4M6B A;  1BH8 A;  3X1S A;  3WTP E;  3H0L C;  3AZN A;  1EQZ C;  1P3L B;  3VH5 W;  1F66 B;  3W97 D;  2JSS A;  3LEL A;  3REK A;  3MVD A;  3O62 D;  3AZL B;  5B0Z A;  3B6G A;  5JRG C;  3AV1 D;  1ID3 C;  5B1L A;  2HUE C;  1M1A A;  5DNM A;  3MGR D;  5CPI B;  5B31 C;  3AZK D;  5E5A D;  4Z5T A;  4KUD D;  1KU5 A;  3AZF B;  5B2J A;  1P3M C;  3KWQ D;  2Y2H A;  3W96 C;  2L5A A;  3AN2 D;  3C1C A;  1P3F D;  4WU9 A;  3H0M C;  2ARO D;  1M18 A;  2F8N B;  1ID3 B;  1P3I A;  2HUE B;  2CV5 D;  3WAA D;  3UT9 D;  5AVB D;  3REJ A;  3WA9 D;  4JJN D;  3UTB D;  4J8U C;  2Y2J A;  1AOI D;  4WU8 D;  4E45 A;  5BS7 C;  3W96 B;  4XUJ B;  3EPJ A;  2Y2Q A;  3X1U A;  1U35 A;  5B33 D;  4XZQ A;  1P3K C;  1B6W A;  3MGP A;  4CAY B;  4G91 C;  5B1M A;  3WTP C;  3C1B C;  4J8U B;  1N1J A;  3R45 B;  1P3G D;  5B40 C;  5DNN C;  4YS3 C;  4J8V D;  5B0Y D;  5C3I B;  3W97 C;  5GXQ C;  4G91 B;  3WTP B;  3C1B B;  5AY8 A;  1P3O D;  4H9O B;  3MNN B;  3MGR C;  3W99 C;  3AV2 A;  1ZLA C;  4Z66 A;  2J8P A;  5DNN B;  5B40 B;  5AV9 D;  3AZK C;  4YS3 B;  4J8X B;  5E5A C;  4R8P D;  5CPK B;  4DRA A;  4QLC D;  2XD5 A;  3LZ0 B;  1KX4 C;  3W98 A;  5GXQ B;  2BYM A;  3AL0 C;  2ARO C;  3EG5 B;  5B24 B;  5AVB C;  2ZY5 A;  3W99 B;  1BH9 B;  3NQU B;  1ZLA B;  5BNV A;  1KX3 D;  1KX4 B;  3TU4 D;  4WU8 C;  3IP4 C;  5AV6 D;  3AZG D;  3AZG A;  1S32 A;  3A6N D;  5B33 C;  3B0C T;  3REL D;  2HIO D;  3B6F C;  4NE3 A;  4ZUX C;  4CSR B;  1M19 A;  3REH A;  2BG1 A;  2ZY2 A;  4Z2M H;  5BO0 B;  1WWS A;  1W2E A;  3X1T B;  1F66 A;  2JCH A;  3AZI D;  1P3L A;  5BT1 C;  5G49 B;  5GT0 D;  3AZL A;  4J8V C;  4WZS B;  3AZE C;  4LD9 C;  4NE5 A;  3VH5 T;  3AZJ C;  1TAF B;  1P3A A;  3WKJ C;  2Y2P A;  5AV8 D;  1P3B D;  3B6F B;  4ZUX B;  2IO5 B;  5CPI A;  2PYO B;  3AYW D;  4KHA B;  5B32 C;  3AZF A;  2F8N H;  4EO5 C;  3AZE B;  4R8P C;  3LJA D;  3AZJ B;  2F8N A;  1ID3 A;  4ZBJ C;  3WKJ B;  1ULY A;  3MGQ D;  5B2I B;  2FJ7 B;  4X23 D;  5AVC B;  5GSU D;  1P34 C;  5B32 B;  3AZM D;  3REI D;  3AFA B;  5F99 D;  3W96 A;  4XUJ A;  4KGC B;  4WNN B;  5CP6 D;  3TU4 C;  4ZBJ B;  2LY8 A;  5AV6 C;  4H9Q B;  3A6N C;  3REH B;  1HQ3 B;  3X1S D;  3KSY A;  4CAY A;  3AZN D;  1P34 B;  5AV5 C;  3LEL D;  4J8U A;  3REK D;  3LZ1 C;  3MVD D;  3AZH C;  2Y2L A;  5B0Z D;  4J8W C;  3R45 A;  5CPJ B;  3B6G D;  5BS7 A;  3X1V B;  1P3A B;  5B1L D;  1M1A D;  5DNM D;  3MGS C;  2NQB B;  1R4V A;  4Z5T D;  1EQZ B;  4H9R B;  3WTP A;  3C1B A;  1BFM A;  3F6T A;  5B2J D;  5AV8 C;  5AV5 B;  4H9O A;  3MNN A;  3VH6 T;  4YM6 C;  3AZH B;  3KXB C;  4J8W B;  3C1C D;  5JRG B;  5B40 A;  5DNN A;  2FFF B;  4WU9 D;  4YS3 A;  1M18 D;  4J8X A;  1P3I D;  5CPK D;  5CPK A;  2Y2K A;  3LZ0 A;  3MGS B;  3REJ D;  5B31 B;  5GXQ A;  3UTA C;  4DRB A;  2NZD C;  5B24 A;  1P3M B;  3MGQ C;  4YM6 B;  3W99 A;  1BH9 A;  3NQU A;  3KXB B;  1ZLA A;  4H9P B;  3X1U D;  1U35 D;  2CWE A;  5BNX B;  4XZQ D;  3KUY C;  1KX4 A;  5GT3 C;  3MGP D;  2BYK B;  5B1M D;  1TZY C;  4H9S C;  5CP6 C;  1P3P C;  2NZD B;  4HGA C;  1KX5 C;  4AWL C;  4E44 A;  3X1S C;  4CSR A;  2JE5 A;  3KUY B;  1P3K B;  5BO0 A;  3MVD C;  3X1T A;  3O62 C;  5GT3 B;  3VH6 W;  5G49 A;  3AV1 C;  5B1L C;  1TZY B;  5CHL B;  5AY8 D;  2F8N K;  1P3P B;  4HGA B;  3B0B A;  3AV2 D;  1TAF A;  4AWL B;  4Z66 D;  3B6F A;  4ZUX A;  4Z5T C;  2PYO A;  4KUD C;  3W97 B;  3W98 D;  4KHA A;  3KWQ C;  3O62 B;  1P3F C;  3AN2 C;  3P5J B;  3EPL A;  3AV1 B;  3NQJ B;  3WAA C;  3AZE A;  2CV5 C;  2UWX A;  3UT9 C;  3MGR B;  3REJ C;  1H3O B;  3AZJ A;  3WA9 C;  4JJN C;  3WKJ A;  3AZK B;  5E5A B;  5B2I A;  2FJ7 A;  3UTB C;  4KUD B;  1AOI C;  5AVC A;  3KWQ B;  2Y2N A;  2RVQ D;  1P3F B;  5B32 A;  3AN2 B;  1S32 D;  3AFA A;  2ARO B;  1U35 C;  3WAA B;  2CV5 B;  4UPK A;  4XZQ C;  3UT9 B;  5AVB B;  4KGC D;  4KGC A;  4WNN A;  3WA9 B;  4JJN B;  4H9Q A;  1M19 D;  3REH D;  1HQ3 A;  3UTB B;  3EPH A;  1F66 D;  1AOI B;  1P3L D;  4WU8 B;  1P3G C;  1P34 A;  3AZL D;  2VQR A;  5B0Y C;  5CPJ A;  2Y2I A;  1Q9C A;  5B33 B;  3X1V A;  1P3A D;  2DF4 C;  1JFI B;  5CPI D;  2YFW B;  2NQB A;  5AY8 C;  1P3O C;  4G92 C;  3AV2 C;  1EQZ A;  4H9R A;  1EQZ D;  4Z66 C;  3AZF D;  1P3G B;  5JA4 B;  5AV5 A;  3AZH A;  5AV9 C;  4J8V B;  4LD9 B;  5B0Y B;  4QLC C;  4J8W A;  5JRG A;  2F8N D;  1ID3 D;  2ZM5 A;  3V9R B;  3MGS A;  5B31 A;  1P3O B;  4G92 B;  1PZR A;  2XD1 A;  1P3M D;  1P3M A;  5AV9 B;  4YM6 A;  4EO5 B;  1KX3 C;  4R8P B;  3KXB A;  4XUJ D;  4H9P A;  4QLC B;  3W96 D;  5FUG B;  2YFV B;  4Z2M G;  5BNX A;  2RVQ C;  3AZG C;  2BYK A;  3REL C;  2HIO C;  4J8U D;  2NZD A;  1M19 C;  1KX3 B;  3AZI C;  3TU4 B;  1P3L C;  5GT0 C;  3KUY A;  1P3K A;  4H9N B;  5AV6 B;  1A7W A;  5GT3 A;  3A6N B;  3WTP D;  1TZY A;  3C1B D;  3REL B;  2HIO B;  1P3P A;  1P3B C;  3MNN D;  3LZ1 B;  4DQY B;  2DQN C;  5B40 D;  5DNN D;  3AYW C;  4YS3 D;  4J8X D;  3AZI B;  3LZ0 D;  3W97 A;  3AZF C;  5GT0 B;  2W8S A;  5GXQ D;  3O62 A;  2ZY3 A;  3LJA C;  4NFT A;  3AV1 A;  3NQJ A;  5B24 D;  5AV8 B;  1P3B B;  3MGR A;  3W99 D;  1H3O A;  1ZLA D;  4X23 C;  4NE6 A;  3VH5 A;  3AYW B;  3AZK A;  5E5A A;  5GSU C;  1KX4 D;  4KUD A;  3EPK A;  3AZM C;  3REI C;  2RIQ A;  3KWQ A;  1WWI A;  5F99 C;  4XUJ C;  3LJA B;  3UTA B;  3AN2 A;  1P3F A;  2ARO A;  3WAA A;  2CV5 A;  3UT9 A;  5AVB A;  3MGQ B;  3WA9 A;  1HTA A;  4X23 B;  4JJN A;  3AZN C;  5KDM B;  5GSU B;  3LEL C;  3REK C;  4UUZ B;  3X1T D;  3UTB A;  1AOI A;  3AZM B;  5B0Z C;  3REI B;  3B6G C;  4WU8 A;  4WV4 B;  5F99 B;  5C3I C;  5CP6 B;  1M1A C;  5DNM C;  5B33 A;  1KX5 B;  2Y2M A;  1JFI A;  2Y2O A;  3B6F D;  1BH8 B;  4ZUX D;  3X1S B;  2PYO D;  3AZN B;  2YFW A;  5B2J C;  3LEL B;  3REK B;  3MNN C;  3MVD B;  5B0Z B;  5BT1 D;  3B6G B;  3C1C C;  1P3G A;  5JA4 A;  4WU9 C;  1M18 C;  4J8X C;  5B1L B;  4J8V A;  3AZE D;  5CPK C;  5B0Y A;  1P3I C;  1M1A B;  4LD9 A;  3LZ0 C;  4LD9 D;  5DNM B;  3AZJ D;  3A1I A;  3WKJ D;  2G5H C;  3V9R A;  5B2I D;  2FJ7 D;  4Z5T B;  5AVC D;  5B24 C;  5B2J B;  1P3O A;  5B32 D;  3C1C B;  3X1U C;  3AFA D;  4WU9 B;  5AV9 A;  1M18 B;  1P3I B;  4R8P A;  4QLC A;  5FUG A;  3VH6 A;  3REJ B;  2G5I C;  2YFV A;  3MGP C;  5B1M C;  1HQ3 D;  1P34 D;  4WJ3 C;  5CPJ D;  3X1U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...