3C1CA

The effect of h3 k79 dimethylation and h4 k20 trimethylation on nucleosome and chromatin structure
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFTDLRFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3-like
publication title The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 97
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3c1cA00
5AV5B 3W98B 4DRBA 3B0CT 5AVBD 4R8PA 5C3IC 5E5AC 3NQUA 3TU4B 3AZKA 4ZUXC 3B6FB 4NFTA 3MGPC 3WKJD 3W99B 2BYMB 2HIOC 1P3OA 4LD9A 5GT0D 3REHD 3V9RA 2F8NH 4J8VD 1M1AA 3REJC 2BYKA 5AVCC 4KUDD 2YFWA 3RELC 3AZMC 4H9QA 3AV2A 4KHAA 5AV9B 3X1UB 3AZIA 3AZNA 3AZJA 4KGCA 4QLCA 3REKD 3AZGD 2CV5C 3W96D 5AY8C 3REIB 3LJAA 5KDMB 5F99B 4Z66D 4XUJA 3C1BB 3AV1D 4WU8A 3LZ0B 1ULYA 2FJ7D 5B40C 1AOIA 5DNND 5AV6A 5B31B 1BFMA 4J8UD 3KUYC 5JRGD 5GSUC 5B0ZD 4J8WC 1U35A 3AZHB 1P3PB 1TAFA 3WA9D 5B33C 3WTPC 4Z2MG 3KWQC 3AZEA 1P34B 1P3KB 1HQ3C 4XZQD 1KX4B 3LZ1C 3LELD 1TZYA 5B0YB 2PYOA 3B6GB 2HUEB 1EQZA 4EO5C 3UT9C 3AFAC 4YM6A 3C1CD 4ZUXA 4H9PB 3O62B 5G49B 5CPID 4Z5TD 4X23C 1KU5A 3MGPA 3W97D 5BO0A 3X1TD 5CP6D 3AN2D 5AV5D 3UTAB 3W98D 4JJNC 1P3BA 3KXBA 4G91C 4J8VB 3TU4D 3AZMA 1P3MD 5FUGB 5B1LB 1KX5B 1ZLAD 3NQJB 4J8XB 1P3LC 5B1MC 5GXQD 4H9NB 4CAYB 2F8NG 5AY8A 3AZGB 3W96B 3X1TB 4WNNB 3MVDA 4Z66B 5B32C 4H9OB 5BNVB 5AV8C 1M19A 3AZIC 3X1VA 3AZJC 5GT3A 4QLCC 2FJ7B 2LY8A 3VH6A 1B67A 5E5AB 3KUYA 2F8NA 5DNNB 3C1BD 3WAAC 4J8UB 4J8WA 3MGRC 4XUJC 3R45A 4WU8C 5B33A 2HIOB 1S32A 1HQ3A 3A6NA 3REJB 5AVCB 4R8PD 5B31D 3LZ1A 1AOIC 3RELB 1H3OA 5AV6C 5CPJC 3AZLA 3AZHD 4G92B 2CV5B 1P3KD 3UT9A 1U35C 1P34D 4LD9D 1KX4D 1KX3C 1M18A 1M1AD 2YFVB 5B2IA 3C1CB 5BNXB 1HTAA 5B24C 4CSRA 3AV2D 1R4VA 1TZYC 5B2JA 3AZND 3AZFA 2PYOC 1P3IA 4KGCD 5CPKA 4DRAA 5CHLB 5B32G 5B40B 5CP6B 1P3FA 3AN2B 1P3GA 1BH8A 3LJAD 3O62D 4YM6C 5GSUB 1P3MB 1P3LA 5B1MA 1ZLAB 2NQBA 1P3AC 4YS3C 3UTAD 5GXQB 2L5AA 3WTPB 3KWQB 5BS7C 2AROC 3MNNA 4WU9C 1ID3A 1P3BC 5B32A 3KXBC 5B1LD 1KX5D 5DNMA 4J8XD 5AV8A 3MGSA 3UTBA 2RVQD 3AYWA 4AWLB 3AZED 1F66B 3AFAB 3MGQA 3WAAA 3MGRA 4X23B 3X1SC 3MVDC 4JJNB 3WA9C 1M19C 3X1VC 5E5AD 4NE6A 5GT3C 5JA4A 4G91B 4E45A 4ZUXD 4R8PB 5CPJA 4HGAC 3NQUB 3AZKB 3MGPD 2HIOD 3VH6W 5AVBA 1KX3A 1Q9CA 3REJD 1S32C 3VH5A 5AVCD 1P3OB 4LD9B 3V9RB 3A6NC 3RELD 5B24A 3AZMD 2BYKB 1M1AB 2JSSA 1A7WA 2NZDC 2YFWB 3WKJA 4H9QB 3AV2B 4KHAB 3AZIB 3AZNB 5GT0A 4NE5A 3REHA 3AZLC 3AZJB 3X1TC 4QLCB 2CV5D 4KGCB 5AY8D 4KUDA 1WWIA 3B6FC 3LJAB 1M18C 5B2IC 4XUJB 1P3AA 4YS3A 4WU8B 3REKA 3W99C 5BS7A 5B40D 5B2JC 2AROA 4WU9A 4ZBJC 3AZFC 1P3IC 5CPKC 1P3FC 4Z66A 3KUYD 1P3GC 1AOIB 3AV1A 5GSUD 2IO5B 5AV6B 5AV9C 3X1UC 4J8WD 5B33D 3WTPD 3KWQD 1U35B 1JFIB 2NQBC 3REIC 1TAFB 3AZEB 4H9RB 5F99C 5JRGA 3MNNC 3X1SA 3LZ1D 5B0ZA 1ID3C 5BT1C 3LZ0C 1TZYB 5DNMC 2PYOB 3MGSC 3UTBC 3AYWC 1EQZB 3WA9A 4XZQA 3UT9D 1F66D 3AFAD 3B0DC 5C3IB 3LELA 4YM6B 3MGQC 4ZUXB 4X23D 4UUZA 2CWEA 1P3PC 3MGPB 4JJND 5BO0B 1P34C 5CPIA 1P3BB 2NZDA 3KXBB 4Z5TA 3B0CW 1BH9A 5B0YC 3AZKD 3AZMB 3B6GC 3W97A 1P3LD 5B1MD 1N1JA 3X1TA 5AV5A 3W98A 1P3OD 3TU4A 5AY8B 5AVBC 3B6FA 5B32D 3MVDB 2BYMA 3W99A 3VH5W 3AZID 3AZJD 4QLCD 3WKJC 1M19B 3X1VB 5GT0C 3REHC 5GT3B 4J8VC 3WAAD 5AV9A 5B1LC 3X1UA 3KUYB 3MGRD 2F8NB 4KUDC 4XUJD 4WU8D 5B31G 4J8WB 3REIA 3R45B 3REKC 5B33B 3AZGC 5KDMA 1S32B 3W96C 1HQ3B 5F99A 1AOID 3C1BA 3A6NB 5AV6D 4Z66C 5CPJD 3LZ0A 3LZ1B 1WWSA 3AV1C 1H3OB 4H9SA 1U35D 3AZLB 4NE3A 2FJ7C 4EO5B 1KX3D 5B31A 3UT9B 5DNNC 1M18B 5B24D 4J8UC 5B2IB 5JRGC 1TZYD 5B0ZC 3AZHA 1P3PA 3B0BA 2PYOD 1EQZD 1P3KA 4CSRB 1P34A 5B2JB 4ZBJB 3AZFB 1P3IB 1KX4A 5CPKB 1P3FB 4XZQC 5B0YA 1P3GB 1BH8B 4YM6D 3B6GA 3VH5T 3LELC 4M6BA 1P3AD 1P3LB 4YS3D 5B1MB 4G92C 2NQBB 2AROD 4WU9D 4H9PA 3O62A 5G49A 1P3BD 3KXBD 3MNNB 3C1CC 4WZSB 1ID3B 5CPIC 5B32B 4Z5TC 5DNMB 5AV8B 3UTAA 3MGSB 3UTBB 3AYWB 3W97C 5CP6C 3AN2C 5AV5C 3W98C 4J8VA 3B0DB 5FUGA 5B1LA 1KX5A 3NQJA 4J8XA 3TU4C 3MGQB 3X1SD 1P3MC 3WAAB 4H9NA 4CAYA 3MVDD 3MGRB 1ZLAC 1JFIA 3AZGA 5GXQC 1M19D 3W96A 4H9RA 3X1VD 5GT3D 4WNNA 2F8ND 5JA4B 4H9OA 5BNVA 3WTPE 5CPJB 4AWLC 4E44A 2FJ7A 5E5AA 1S32D 1HQ3D 5DNNA 1F66C 5AVBB 1KX3B 3A6ND 4J8UA 2NZDD 3VH6T 3C1BC 5B24B 4WV4B 2HIOA 3AZLD 3WKJB 4H9SC 3REJA 5AVCA 5GT0B 3REHB 3RELA 3B6FD 4R8PC 5B31C 1M18D 4KUDB 5B2ID 3AZKC 3W99D 2CV5A 5B2JD 1P3AB 3AZHC 4YS3B 3AZFD 1P3ID 3REKB 1P3KC 5CPKD 1P3OC 2YFVA 2AROB 1P3FD 3C1CA 4WU9B 3KSYA 1KX4C 5BNXA 1P3GD 4LD9C 1M1AC 5AV9D 3X1UD 3AV1B 2HUEC 3AV2C 5B40A 5CP6A 3AZNC 3AN2A 4KGCC 2NQBD 3REID 5F99D 3MNND 5GSUA 1P3MA 3LJAC 1ZLAA 3O62C 1ID3D 5BT1D 5JRGB 3LZ0D 3X1SB 5DNMD 5B0ZB 5AV8D 2F8NK 5GXQA 3MGSD 3UTBD 3WTPA 3KWQA 1F1EA 3AYWD 3UTAC 3WA9B 4XZQB 4Z2MH 3MGQD 2IO5C 4HGAB 1KX5C 3LELB 4J8XC 2RVQC 1P3PD 4UUZB 1F66A 3AFAA 3AZEC 4X23A 5B0YD 3B6GD 5CPIB 2NZDB 4Z5TB 1B6WA 1BH9B 4JJNA 3W97B 1EQZC 1N1JB
chains in the Genus database with same CATH superfamily
5AV5B 3W98B 4DRBA 3B0CT 5AVBD 1Z2CB 4R8PA 5C3IC 5E5AC 3NQUA 3TU4B 3AZKA 4ZUXC 3B6FB 2F2AC 1T3UA 4NFTA 2RIQA 2ZY5A 3MGPC 2DQNC 3W99B 2BYMB 2HIOC 1P3OA 3WKJD 4LD9A 5GT0D 3REHD 3V9RA 2F8NH 4J8VD 1M1AA 3REJC 2BYKA 5AVCC 4KUDD 2YFWA 3RELC 3AZMC 2ZY2A 4H9QA 3AV2A 3F6TA 4KHAA 5AV9B 3X1UB 3AZIA 3AZNA 3AZJA 4KGCA 4QLCA 3REKD 3AZGD 2CV5C 3W96D 5AY8C 3REIB 3LJAA 5KDMB 5F99B 4Z66D 4XUJA 3C1BB 3AV1D 4WU8A 3LZ0B 2Y2NA 1ULYA 2FJ7D 5B40C 1AOIA 5DNND 5AV6A 5B31B 1BFMA 4J8UD 3KUYC 5JRGD 5GSUC 5B0ZD 2Y2HA 4J8WC 1U35A 3AZHB 1P3PB 1TAFA 3WA9D 5B33C 3WTPC 4Z2MG 3KWQC 3AZEA 1P34B 1P3KB 1HQ3C 4XZQD 1KX4B 3EPHA 3LZ1C 3LELD 1TZYA 5B0YB 2PYOA 3B6GB 2HUEB 1EQZA 4EO5C 3UT9C 3AFAC 4YM6A 2Y2JA 4ZUXA 3C1CD 4H9PB 3O62B 5G49B 5CPID 4Z5TD 4X23C 1KU5A 1PZRA 3MGPA 3W97D 5BO0A 2Y2KA 3X1TD 5CP6D 3AN2D 5AV5D 3UTAB 3W98D 4JJNC 2UWXA 1P3BA 3KXBA 4G91C 4J8VB 3TU4D 3AZMA 1P3MD 5FUGB 5B1LB 1KX5B 1ZLAD 3NQJB 4J8XB 3H0MC 1P3LC 5B1MC 5GXQD 4H9NB 4CAYB 2F8NG 5AY8A 3AZGB 3W96B 3X1TB 4WNNB 3EPJA 3MVDA 4Z66B 5B32C 4H9OB 5BNVB 5AV8C 1M19A 3AZIC 3X1VA 3AZJC 5GT3A 4QLCC 3H0LC 2FJ7B 2LY8A 3VH6A 1B67A 5E5AB 3KUYA 2F8NA 5DNNB 3C1BD 3WAAC 4J8UB 4J8WA 3MGRC 4XUJC 3R45A 4WU8C 5B33A 2HIOB 1S32A 1HQ3A 3A6NA 3REJB 5AVCB 4R8PD 5B31D 3LZ1A 1AOIC 3RELB 1H3OA 1W2EA 5AV6C 5CPJC 3AZLA 3AZHD 4G92B 2CV5B 1P3KD 3UT9A 1U35C 1P34D 4LD9D 1KX4D 1KX3C 1M18A 1M1AD 2YFVB 5B2IA 3C1CB 5BNXB 1HTAA 5B24C 4CSRA 3AV2D 1R4VA 1TZYC 5B2JA 3AZND 3AZFA 2PYOC 1P3IA 4KGCD 5CPKA 4DRAA 5CHLB 5B32G 5B40B 5CP6B 1P3FA 3AN2B 1P3GA 1BH8A 2G5IC 2Y2MA 3LJAD 3O62D 4YM6C 5GSUB 1P3MB 1P3LA 5B1MA 1ZLAB 2NQBA 1P3AC 2Y2LA 4YS3C 3UTAD 5GXQB 2L5AA 3WTPB 3KWQB 5BS7C 2AROC 3MNNA 4WU9C 1ID3A 1P3BC 5B32A 3KXBC 5B1LD 1KX5D 5DNMA 4J8XD 5AV8A 3MGSA 3UTBA 2RVQD 3AYWA 4AWLB 3FDDA 3AZED 1F66B 3AFAB 3MGQA 3WAAA 3MGRA 4X23B 3X1SC 3MVDC 2ZY3A 3EG5B 4JJNB 3WA9C 1M19C 3X1VC 5E5AD 4NE6A 5GT3C 5JA4A 4G91B 4E45A 4ZUXD 4R8PB 5CPJA 4HGAC 3NQUB 3AZKB 3IP4C 3MGPD 2HIOD 3VH6W 3H0RC 5AVBA 1KX3A 1Q9CA 3REJD 1S32C 3VH5A 5AVCD 1P3OB 4LD9B 3V9RB 2ZM5A 3A6NC 3RELD 5B24A 3AZMD 2BYKB 1M1AB 2JSSA 1A7WA 2NZDC 2YFWB 2G5HC 3KFUG 3WKJA 4H9QB 3AV2B 4KHAB 3AZIB 3AZNB 5GT0A 4NE5A 3REHA 3AZLC 3AZJB 3X1TC 4QLCB 2CV5D 4KGCB 5AY8D 4KUDA 2BG1A 1WWIA 3B6FC 3LJAB 2VQRA 1M18C 5B2IC 4XUJB 1P3AA 4YS3A 4WU8B 3REKA 3W99C 5BS7A 5B40D 5B2JC 2AROA 4WU9A 4ZBJC 3AZFC 1P3IC 5CPKC 1P3FC 4Z66A 3KUYD 1P3GC 2XD5A 1AOIB 3AV1A 5GSUD 2IO5B 5AV6B 5AV9C 3X1UC 4J8WD 2Y2IA 5B33D 3WTPD 3KWQD 4DQYB 1U35B 1JFIB 2NQBC 3REIC 1TAFB 2FFFB 3AZEB 4H9RB 5F99C 5JRGA 2XD1A 3X1SA 3MNNC 5B0ZA 3LZ1D 1ID3C 2JCHA 5BT1C 3EPKA 3LZ0C 1TZYB 5DNMC 2PYOB 3MGSC 3UTBC 3AYWC 1EQZB 3WA9A 4XZQA 3UT9D 1F66D 3AFAD 3B0DC 5C3IB 3EPLA 3LELA 4YM6B 3MGQC 4ZUXB 4X23D 2J8PA 4UUZA 2CWEA 1P3PC 3MGPB 4JJND 5BO0B 1P34C 5CPIA 1P3BB 2NZDA 3KXBB 4Z5TA 3B0CW 2DF4C 1BH9A 5B0YC 3AZKD 3AZMB 3B6GC 3W97A 1P3LD 5B1MD 1N1JA 3X1TA 5AV5A 3W98A 1P3OD 3TU4A 5AY8B 5AVBC 3B6FA 5B32D 4UPKA 3MVDB 2BYMA 3W99A 3VH5W 3AZID 2Y2GA 3AZJD 4QLCD 3WKJC 1M19B 3X1VB 5GT0C 3REHC 5GT3B 4J8VC 3WAAD 5AV9A 5B1LC 3X1UA 3KUYB 3MGRD 2F8NB 4KUDC 4XUJD 4WU8D 5B31G 4J8WB 2ZY4A 3A1IA 3REIA 3R45B 3REKC 5B33B 3AZGC 5KDMA 1S32B 3W96C 1HQ3B 5F99A 1AOID 3C1BA 3A6NB 5AV6D 4Z66C 5CPJD 3LZ0A 3LZ1B 1WWSA 3AV1C 1H3OB 4H9SA 4WJ3C 1U35D 3AZLB 2Y2QA 4NE3A 2FJ7C 4EO5B 1KX3D 5B31A 3UT9B 3P5JB 5DNNC 1M18B 5B24D 4J8UC 5B2IB 5JRGC 1TZYD 5B0ZC 3AZHA 1P3PA 3B0BA 2PYOD 1EQZD 1P3KA 4CSRB 1P34A 5B2JB 4ZBJB 3AZFB 1P3IB 1KX4A 5CPKB 1P3FB 4XZQC 5B0YA 1P3GB 1BH8B 4YM6D 3AL0C 3B6GA 3VH5T 3LELC 4M6BA 1P3AD 1P3LB 4YS3D 5B1MB 4G92C 2NQBB 2AROD 4WU9D 4H9PA 3O62A 5G49A 1P3BD 3KXBD 3MNNB 3C1CC 4WZSB 1ID3B 5CPIC 5B32B 4Z5TC 5DNMB 5AV8B 3UTAA 3MGSB 3UTBB 3AYWB 3W97C 5CP6C 3AN2C 5AV5C 3W98C 4J8VA 3B0DB 5FUGA 5B1LA 1KX5A 3NQJA 4J8XA 3TU4C 3MGQB 3X1SD 1P3MC 3WAAB 4H9NA 4CAYA 3MVDD 3MGRB 1ZLAC 1JFIA 3AZGA 5GXQC 1M19D 3W96A 4H9RA 3X1VD 5GT3D 4WNNA 2F8ND 5JA4B 4H9OA 5BNVA 3WTPE 5CPJB 4AWLC 4E44A 2FJ7A 2JE5A 2Y2PA 5E5AA 1S32D 1HQ3D 5DNNA 1F66C 2Y2OA 5AVBB 1KX3B 3A6ND 4J8UA 2NZDD 3VH6T 3C1BC 5B24B 4WV4B 2HIOA 3AZLD 3WKJB 4H9SC 3REJA 5AVCA 5GT0B 3REHB 3RELA 3B6FD 4R8PC 5B31C 1M18D 4KUDB 5B2ID 3AZKC 3W99D 2CV5A 5B2JD 1P3AB 3AZHC 4YS3B 3AZFD 1P3ID 3REKB 1P3KC 5CPKD 1P3OC 2YFVA 2AROB 1P3FD 3C1CA 4WU9B 3KSYA 1KX4C 5BNXA 1P3GD 4LD9C 1M1AC 5AV9D 3X1UD 3AV1B 2HUEC 3AV2C 3A1KA 5CP6A 5B40A 3AZNC 3AN2A 4KGCC 2NQBD 3REID 5F99D 3MNND 5GSUA 1P3MA 3LJAC 1ZLAA 3O62C 1ID3D 5BT1D 5JRGB 3LZ0D 3X1SB 5DNMD 5B0ZB 5AV8D 2F8NK 5GXQA 3MGSD 3UTBD 3WTPA 3KWQA 1F1EA 3AYWD 3UTAC 3WA9B 4XZQB 4Z2MH 3MGQD 2IO5C 4HGAB 1KX5C 3LELB 4J8XC 2RVQC 1P3PD 4UUZB 1F66A 3AFAA 3AZEC 2W8SA 4X23A 5B0YD 3B6GD 5CPIB 2NZDB 4Z5TB 1B6WA 1BH9B 4JJNA 3W97B 1EQZC 1N1JB
chains in the Genus database with same CATH topology
5AV5B 3W98B 4DRBA 3B0CT 5AVBD 1Z2CB 4R8PA 5C3IC 5E5AC 3NQUA 3TU4B 3AZKA 4ZUXC 3B6FB 2F2AC 1T3UA 4NFTA 2RIQA 2ZY5A 3MGPC 2DQNC 3W99B 2BYMB 2HIOC 1P3OA 3WKJD 4LD9A 5GT0D 3REHD 3V9RA 2F8NH 4J8VD 1M1AA 3REJC 2BYKA 5AVCC 4KUDD 2YFWA 3RELC 3AZMC 2ZY2A 4H9QA 3AV2A 3F6TA 4KHAA 5AV9B 3X1UB 3AZIA 3AZNA 3AZJA 4KGCA 4QLCA 3REKD 3AZGD 2CV5C 3W96D 5AY8C 3REIB 3LJAA 5KDMB 5F99B 4Z66D 4XUJA 3C1BB 3AV1D 4WU8A 3LZ0B 2Y2NA 1ULYA 2FJ7D 5B40C 1AOIA 5DNND 5AV6A 5B31B 1BFMA 4J8UD 3KUYC 5JRGD 5GSUC 5B0ZD 2Y2HA 4J8WC 1U35A 3AZHB 1P3PB 1TAFA 3WA9D 5B33C 3WTPC 4Z2MG 3KWQC 3AZEA 1P34B 1P3KB 1HQ3C 4XZQD 1KX4B 3EPHA 3LZ1C 3LELD 1TZYA 5B0YB 2PYOA 3B6GB 2HUEB 1EQZA 4EO5C 3UT9C 3AFAC 4YM6A 2Y2JA 4ZUXA 3C1CD 4H9PB 3O62B 5G49B 5CPID 4Z5TD 4X23C 1KU5A 1PZRA 3MGPA 3W97D 5BO0A 2Y2KA 3X1TD 5CP6D 3AN2D 5AV5D 3UTAB 3W98D 4JJNC 2UWXA 1P3BA 3KXBA 4G91C 4J8VB 3TU4D 3AZMA 1P3MD 5FUGB 5B1LB 1KX5B 1ZLAD 3NQJB 4J8XB 3H0MC 1P3LC 5B1MC 5GXQD 4H9NB 4CAYB 2F8NG 5AY8A 3AZGB 3W96B 3X1TB 4WNNB 3EPJA 3MVDA 4Z66B 5B32C 4H9OB 5BNVB 5AV8C 1M19A 3AZIC 3X1VA 3AZJC 5GT3A 4QLCC 3H0LC 2FJ7B 2LY8A 3VH6A 1B67A 5E5AB 3KUYA 2F8NA 5DNNB 3C1BD 3WAAC 4J8UB 4J8WA 3MGRC 4XUJC 3R45A 4WU8C 5B33A 2HIOB 1S32A 1HQ3A 3A6NA 3REJB 5AVCB 4R8PD 5B31D 3LZ1A 1AOIC 3RELB 1H3OA 1W2EA 5AV6C 5CPJC 3AZLA 3AZHD 4G92B 2CV5B 1P3KD 3UT9A 1U35C 1P34D 4LD9D 1KX4D 1KX3C 1M18A 1M1AD 2YFVB 5B2IA 3C1CB 5BNXB 1HTAA 5B24C 4CSRA 3AV2D 1R4VA 1TZYC 5B2JA 3AZND 3AZFA 2PYOC 1P3IA 4KGCD 5CPKA 4DRAA 5CHLB 5B32G 5B40B 5CP6B 1P3FA 3AN2B 1P3GA 1BH8A 2G5IC 2Y2MA 3LJAD 3O62D 4YM6C 5GSUB 1P3MB 1P3LA 5B1MA 1ZLAB 2NQBA 1P3AC 2Y2LA 4YS3C 3UTAD 5GXQB 2L5AA 3WTPB 3KWQB 5BS7C 2AROC 3MNNA 4WU9C 1ID3A 1P3BC 5B32A 3KXBC 5B1LD 1KX5D 5DNMA 4J8XD 5AV8A 3MGSA 3UTBA 2RVQD 3AYWA 4AWLB 3FDDA 3AZED 1F66B 3AFAB 3MGQA 3WAAA 3MGRA 4X23B 3X1SC 3MVDC 2ZY3A 3EG5B 4JJNB 3WA9C 1M19C 3X1VC 5E5AD 4NE6A 5GT3C 5JA4A 4G91B 4E45A 4ZUXD 4R8PB 5CPJA 4HGAC 3NQUB 3AZKB 3IP4C 3MGPD 2HIOD 3VH6W 3H0RC 5AVBA 1KX3A 1Q9CA 3REJD 1S32C 3VH5A 5AVCD 1P3OB 4LD9B 3V9RB 2ZM5A 3A6NC 3RELD 5B24A 3AZMD 2BYKB 1M1AB 2JSSA 1A7WA 2NZDC 2YFWB 2G5HC 3KFUG 3WKJA 4H9QB 3AV2B 4KHAB 3AZIB 3AZNB 5GT0A 4NE5A 3REHA 3AZLC 3AZJB 3X1TC 4QLCB 2CV5D 4KGCB 5AY8D 4KUDA 2BG1A 1WWIA 3B6FC 3LJAB 2VQRA 1M18C 5B2IC 4XUJB 1P3AA 4YS3A 4WU8B 3REKA 3W99C 5BS7A 5B40D 5B2JC 2AROA 4WU9A 4ZBJC 3AZFC 1P3IC 5CPKC 1P3FC 4Z66A 3KUYD 1P3GC 2XD5A 1AOIB 3AV1A 5GSUD 2IO5B 5AV6B 5AV9C 3X1UC 4J8WD 2Y2IA 5B33D 3WTPD 3KWQD 4DQYB 1U35B 1JFIB 2NQBC 3REIC 1TAFB 2FFFB 3AZEB 4H9RB 5F99C 5JRGA 2XD1A 3X1SA 3MNNC 5B0ZA 3LZ1D 1ID3C 2JCHA 5BT1C 3EPKA 3LZ0C 1TZYB 5DNMC 2PYOB 3MGSC 3UTBC 3AYWC 1EQZB 3WA9A 4XZQA 3UT9D 1F66D 3AFAD 3B0DC 5C3IB 3EPLA 3LELA 4YM6B 3MGQC 4ZUXB 4X23D 2J8PA 4UUZA 2CWEA 1P3PC 3MGPB 4JJND 5BO0B 1P34C 5CPIA 1P3BB 2NZDA 3KXBB 4Z5TA 3B0CW 2DF4C 1BH9A 5B0YC 3AZKD 3AZMB 3B6GC 3W97A 1P3LD 5B1MD 1N1JA 3X1TA 5AV5A 3W98A 1P3OD 3TU4A 5AY8B 5AVBC 3B6FA 5B32D 4UPKA 3MVDB 2BYMA 3W99A 3VH5W 3AZID 2Y2GA 3AZJD 4QLCD 3WKJC 1M19B 3X1VB 5GT0C 3REHC 5GT3B 4J8VC 3WAAD 5AV9A 5B1LC 3X1UA 3KUYB 3MGRD 2F8NB 4KUDC 4XUJD 4WU8D 5B31G 4J8WB 2ZY4A 3A1IA 3REIA 3R45B 3REKC 5B33B 3AZGC 5KDMA 1S32B 3W96C 1HQ3B 5F99A 1AOID 3C1BA 3A6NB 5AV6D 4Z66C 5CPJD 3LZ0A 3LZ1B 1WWSA 3AV1C 1H3OB 4H9SA 4WJ3C 1U35D 3AZLB 2Y2QA 4NE3A 2FJ7C 4EO5B 1KX3D 5B31A 3UT9B 3P5JB 5DNNC 1M18B 5B24D 4J8UC 5B2IB 5JRGC 1TZYD 5B0ZC 3AZHA 1P3PA 3B0BA 2PYOD 1EQZD 1P3KA 4CSRB 1P34A 5B2JB 4ZBJB 3AZFB 1P3IB 1KX4A 5CPKB 1P3FB 4XZQC 5B0YA 1P3GB 1BH8B 4YM6D 3AL0C 3B6GA 3VH5T 3LELC 4M6BA 1P3AD 1P3LB 4YS3D 5B1MB 4G92C 2NQBB 2AROD 4WU9D 4H9PA 3O62A 5G49A 1P3BD 3KXBD 3MNNB 3C1CC 4WZSB 1ID3B 5CPIC 5B32B 4Z5TC 5DNMB 5AV8B 3UTAA 3MGSB 3UTBB 3AYWB 3W97C 5CP6C 3AN2C 5AV5C 3W98C 4J8VA 3B0DB 5FUGA 5B1LA 1KX5A 3NQJA 4J8XA 3TU4C 3MGQB 3X1SD 1P3MC 3WAAB 4H9NA 4CAYA 3MVDD 3MGRB 1ZLAC 1JFIA 3AZGA 5GXQC 1M19D 3W96A 4H9RA 3X1VD 5GT3D 4WNNA 2F8ND 5JA4B 4H9OA 5BNVA 3WTPE 5CPJB 4AWLC 4E44A 2FJ7A 2JE5A 2Y2PA 5E5AA 1S32D 1HQ3D 5DNNA 1F66C 2Y2OA 5AVBB 1KX3B 3A6ND 4J8UA 2NZDD 3VH6T 3C1BC 5B24B 4WV4B 2HIOA 3AZLD 3WKJB 4H9SC 3REJA 5AVCA 5GT0B 3REHB 3RELA 3B6FD 4R8PC 5B31C 1M18D 4KUDB 5B2ID 3AZKC 3W99D 2CV5A 5B2JD 1P3AB 3AZHC 4YS3B 3AZFD 1P3ID 3REKB 1P3KC 5CPKD 1P3OC 2YFVA 2AROB 1P3FD 3C1CA 4WU9B 3KSYA 1KX4C 5BNXA 1P3GD 4LD9C 1M1AC 5AV9D 3X1UD 3AV1B 2HUEC 3AV2C 3A1KA 5CP6A 5B40A 3AZNC 3AN2A 4KGCC 2NQBD 3REID 5F99D 3MNND 5GSUA 1P3MA 3LJAC 1ZLAA 3O62C 1ID3D 5BT1D 5JRGB 3LZ0D 3X1SB 5DNMD 5B0ZB 5AV8D 2F8NK 5GXQA 3MGSD 3UTBD 3WTPA 3KWQA 1F1EA 3AYWD 3UTAC 3WA9B 4XZQB 4Z2MH 3MGQD 2IO5C 4HGAB 1KX5C 3LELB 4J8XC 2RVQC 1P3PD 4UUZB 1F66A 3AFAA 3AZEC 2W8SA 4X23A 5B0YD 3B6GD 5CPIB 2NZDB 4Z5TB 1B6WA 1BH9B 4JJNA 3W97B 1EQZC 1N1JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV5 B;  3W98 B;  4DRB A;  3B0C T;  5AVB D;  4R8P A;  5C3I C;  5E5A C;  3NQU A;  3TU4 B;  3AZK A;  4ZUX C;  3B6F B;  4NFT A;  3MGP C;  3WKJ D;  3W99 B;  2BYM B;  2HIO C;  1P3O A;  4LD9 A;  5GT0 D;  3REH D;  3V9R A;  2F8N H;  4J8V D;  1M1A A;  3REJ C;  2BYK A;  5AVC C;  4KUD D;  2YFW A;  3REL C;  3AZM C;  4H9Q A;  3AV2 A;  4KHA A;  5AV9 B;  3X1U B;  3AZI A;  3AZN A;  3AZJ A;  4KGC A;  4QLC A;  3REK D;  3AZG D;  2CV5 C;  3W96 D;  5AY8 C;  3REI B;  3LJA A;  5KDM B;  5F99 B;  4Z66 D;  4XUJ A;  3C1B B;  3AV1 D;  4WU8 A;  3LZ0 B;  1ULY A;  2FJ7 D;  5B40 C;  1AOI A;  5DNN D;  5AV6 A;  5B31 B;  1BFM A;  4J8U D;  3KUY C;  5JRG D;  5GSU C;  5B0Z D;  4J8W C;  1U35 A;  3AZH B;  1P3P B;  1TAF A;  3WA9 D;  5B33 C;  3WTP C;  4Z2M G;  3KWQ C;  3AZE A;  1P34 B;  1P3K B;  1HQ3 C;  4XZQ D;  1KX4 B;  3LZ1 C;  3LEL D;  1TZY A;  5B0Y B;  2PYO A;  3B6G B;  2HUE B;  1EQZ A;  4EO5 C;  3UT9 C;  3AFA C;  4YM6 A;  3C1C D;  4ZUX A;  4H9P B;  3O62 B;  5G49 B;  5CPI D;  4Z5T D;  4X23 C;  1KU5 A;  3MGP A;  3W97 D;  5BO0 A;  3X1T D;  5CP6 D;  3AN2 D;  5AV5 D;  3UTA B;  3W98 D;  4JJN C;  1P3B A;  3KXB A;  4G91 C;  4J8V B;  3TU4 D;  3AZM A;  1P3M D;  5FUG B;  5B1L B;  1KX5 B;  1ZLA D;  3NQJ B;  4J8X B;  1P3L C;  5B1M C;  5GXQ D;  4H9N B;  4CAY B;  2F8N G;  5AY8 A;  3AZG B;  3W96 B;  3X1T B;  4WNN B;  3MVD A;  4Z66 B;  5B32 C;  4H9O B;  5BNV B;  5AV8 C;  1M19 A;  3AZI C;  3X1V A;  3AZJ C;  5GT3 A;  4QLC C;  2FJ7 B;  2LY8 A;  3VH6 A;  1B67 A;  5E5A B;  3KUY A;  2F8N A;  5DNN B;  3C1B D;  3WAA C;  4J8U B;  4J8W A;  3MGR C;  4XUJ C;  3R45 A;  4WU8 C;  5B33 A;  2HIO B;  1S32 A;  1HQ3 A;  3A6N A;  3REJ B;  5AVC B;  4R8P D;  5B31 D;  3LZ1 A;  1AOI C;  3REL B;  1H3O A;  5AV6 C;  5CPJ C;  3AZL A;  3AZH D;  4G92 B;  2CV5 B;  1P3K D;  3UT9 A;  1U35 C;  1P34 D;  4LD9 D;  1KX4 D;  1KX3 C;  1M18 A;  1M1A D;  2YFV B;  5B2I A;  3C1C B;  5BNX B;  1HTA A;  5B24 C;  4CSR A;  3AV2 D;  1R4V A;  1TZY C;  5B2J A;  3AZN D;  3AZF A;  2PYO C;  1P3I A;  4KGC D;  5CPK A;  4DRA A;  5CHL B;  5B32 G;  5B40 B;  5CP6 B;  1P3F A;  3AN2 B;  1P3G A;  1BH8 A;  3LJA D;  3O62 D;  4YM6 C;  5GSU B;  1P3M B;  1P3L A;  5B1M A;  1ZLA B;  2NQB A;  1P3A C;  4YS3 C;  3UTA D;  5GXQ B;  2L5A A;  3WTP B;  3KWQ B;  5BS7 C;  2ARO C;  3MNN A;  4WU9 C;  1ID3 A;  1P3B C;  5B32 A;  3KXB C;  5B1L D;  1KX5 D;  5DNM A;  4J8X D;  5AV8 A;  3MGS A;  3UTB A;  2RVQ D;  3AYW A;  4AWL B;  3AZE D;  1F66 B;  3AFA B;  3MGQ A;  3WAA A;  3MGR A;  4X23 B;  3X1S C;  3MVD C;  4JJN B;  3WA9 C;  1M19 C;  3X1V C;  5E5A D;  4NE6 A;  5GT3 C;  5JA4 A;  4G91 B;  4E45 A;  4ZUX D;  4R8P B;  5CPJ A;  4HGA C;  3NQU B;  3AZK B;  3MGP D;  2HIO D;  3VH6 W;  5AVB A;  1KX3 A;  1Q9C A;  3REJ D;  1S32 C;  3VH5 A;  5AVC D;  1P3O B;  4LD9 B;  3V9R B;  3A6N C;  3REL D;  5B24 A;  3AZM D;  2BYK B;  1M1A B;  2JSS A;  1A7W A;  2NZD C;  2YFW B;  3WKJ A;  4H9Q B;  3AV2 B;  4KHA B;  3AZI B;  3AZN B;  5GT0 A;  4NE5 A;  3REH A;  3AZL C;  3AZJ B;  3X1T C;  4QLC B;  2CV5 D;  4KGC B;  5AY8 D;  4KUD A;  1WWI A;  3B6F C;  3LJA B;  1M18 C;  5B2I C;  4XUJ B;  1P3A A;  4YS3 A;  4WU8 B;  3REK A;  3W99 C;  5BS7 A;  5B40 D;  5B2J C;  2ARO A;  4WU9 A;  4ZBJ C;  3AZF C;  1P3I C;  5CPK C;  1P3F C;  4Z66 A;  3KUY D;  1P3G C;  1AOI B;  3AV1 A;  5GSU D;  2IO5 B;  5AV6 B;  5AV9 C;  3X1U C;  4J8W D;  5B33 D;  3WTP D;  3KWQ D;  1U35 B;  1JFI B;  2NQB C;  3REI C;  1TAF B;  3AZE B;  4H9R B;  5F99 C;  5JRG A;  3MNN C;  3X1S A;  3LZ1 D;  5B0Z A;  1ID3 C;  5BT1 C;  3LZ0 C;  1TZY B;  5DNM C;  2PYO B;  3MGS C;  3UTB C;  3AYW C;  1EQZ B;  3WA9 A;  4XZQ A;  3UT9 D;  1F66 D;  3AFA D;  3B0D C;  5C3I B;  3LEL A;  4YM6 B;  3MGQ C;  4ZUX B;  4X23 D;  4UUZ A;  2CWE A;  1P3P C;  3MGP B;  4JJN D;  5BO0 B;  1P34 C;  5CPI A;  1P3B B;  2NZD A;  3KXB B;  4Z5T A;  3B0C W;  1BH9 A;  5B0Y C;  3AZK D;  3AZM B;  3B6G C;  3W97 A;  1P3L D;  5B1M D;  1N1J A;  3X1T A;  5AV5 A;  3W98 A;  1P3O D;  3TU4 A;  5AY8 B;  5AVB C;  3B6F A;  5B32 D;  3MVD B;  2BYM A;  3W99 A;  3VH5 W;  3AZI D;  3AZJ D;  4QLC D;  3WKJ C;  1M19 B;  3X1V B;  5GT0 C;  3REH C;  5GT3 B;  4J8V C;  3WAA D;  5AV9 A;  5B1L C;  3X1U A;  3KUY B;  3MGR D;  2F8N B;  4KUD C;  4XUJ D;  4WU8 D;  5B31 G;  4J8W B;  3REI A;  3R45 B;  3REK C;  5B33 B;  3AZG C;  5KDM A;  1S32 B;  3W96 C;  1HQ3 B;  5F99 A;  1AOI D;  3C1B A;  3A6N B;  5AV6 D;  4Z66 C;  5CPJ D;  3LZ0 A;  3LZ1 B;  1WWS A;  3AV1 C;  1H3O B;  4H9S A;  1U35 D;  3AZL B;  4NE3 A;  2FJ7 C;  4EO5 B;  1KX3 D;  5B31 A;  3UT9 B;  5DNN C;  1M18 B;  5B24 D;  4J8U C;  5B2I B;  5JRG C;  1TZY D;  5B0Z C;  3AZH A;  1P3P A;  3B0B A;  2PYO D;  1EQZ D;  1P3K A;  4CSR B;  1P34 A;  5B2J B;  4ZBJ B;  3AZF B;  1P3I B;  1KX4 A;  5CPK B;  1P3F B;  4XZQ C;  5B0Y A;  1P3G B;  1BH8 B;  4YM6 D;  3B6G A;  3VH5 T;  3LEL C;  4M6B A;  1P3A D;  1P3L B;  4YS3 D;  5B1M B;  4G92 C;  2NQB B;  2ARO D;  4WU9 D;  4H9P A;  3O62 A;  5G49 A;  1P3B D;  3KXB D;  3MNN B;  3C1C C;  4WZS B;  1ID3 B;  5CPI C;  5B32 B;  4Z5T C;  5DNM B;  5AV8 B;  3UTA A;  3MGS B;  3UTB B;  3AYW B;  3W97 C;  5CP6 C;  3AN2 C;  5AV5 C;  3W98 C;  4J8V A;  3B0D B;  5FUG A;  5B1L A;  1KX5 A;  3NQJ A;  4J8X A;  3TU4 C;  3MGQ B;  3X1S D;  1P3M C;  3WAA B;  4H9N A;  4CAY A;  3MVD D;  3MGR B;  1ZLA C;  1JFI A;  3AZG A;  5GXQ C;  1M19 D;  3W96 A;  4H9R A;  3X1V D;  5GT3 D;  4WNN A;  2F8N D;  5JA4 B;  4H9O A;  5BNV A;  3WTP E;  5CPJ B;  4AWL C;  4E44 A;  2FJ7 A;  5E5A A;  1S32 D;  1HQ3 D;  5DNN A;  1F66 C;  5AVB B;  1KX3 B;  3A6N D;  4J8U A;  2NZD D;  3VH6 T;  3C1B C;  5B24 B;  4WV4 B;  2HIO A;  3AZL D;  3WKJ B;  4H9S C;  3REJ A;  5AVC A;  5GT0 B;  3REH B;  3REL A;  3B6F D;  4R8P C;  5B31 C;  1M18 D;  4KUD B;  5B2I D;  3AZK C;  3W99 D;  2CV5 A;  5B2J D;  1P3A B;  3AZH C;  4YS3 B;  3AZF D;  1P3I D;  3REK B;  1P3K C;  5CPK D;  1P3O C;  2YFV A;  2ARO B;  1P3F D;  3C1C A;  4WU9 B;  3KSY A;  1KX4 C;  5BNX A;  1P3G D;  4LD9 C;  1M1A C;  5AV9 D;  3X1U D;  3AV1 B;  2HUE C;  3AV2 C;  5B40 A;  5CP6 A;  3AZN C;  3AN2 A;  4KGC C;  2NQB D;  3REI D;  5F99 D;  3MNN D;  5GSU A;  1P3M A;  3LJA C;  1ZLA A;  3O62 C;  1ID3 D;  5BT1 D;  5JRG B;  3LZ0 D;  3X1S B;  5DNM D;  5B0Z B;  5AV8 D;  2F8N K;  5GXQ A;  3MGS D;  3UTB D;  3WTP A;  3KWQ A;  1F1E A;  3AYW D;  3UTA C;  3WA9 B;  4XZQ B;  4Z2M H;  3MGQ D;  2IO5 C;  4HGA B;  1KX5 C;  3LEL B;  4J8X C;  2RVQ C;  1P3P D;  4UUZ B;  1F66 A;  3AFA A;  3AZE C;  4X23 A;  5B0Y D;  3B6G D;  5CPI B;  2NZD B;  4Z5T B;  1B6W A;  1BH9 B;  4JJN A;  3W97 B;  1EQZ C;  1N1J B; 
#chains in the Genus database with same CATH topology
 5AV5 B;  3W98 B;  4DRB A;  3B0C T;  5AVB D;  1Z2C B;  4R8P A;  5C3I C;  5E5A C;  3NQU A;  3TU4 B;  3AZK A;  4ZUX C;  3B6F B;  2F2A C;  1T3U A;  4NFT A;  2RIQ A;  2ZY5 A;  3MGP C;  2DQN C;  3W99 B;  2BYM B;  2HIO C;  1P3O A;  3WKJ D;  4LD9 A;  5GT0 D;  3REH D;  3V9R A;  2F8N H;  4J8V D;  1M1A A;  3REJ C;  2BYK A;  5AVC C;  4KUD D;  2YFW A;  3REL C;  3AZM C;  2ZY2 A;  4H9Q A;  3AV2 A;  3F6T A;  4KHA A;  5AV9 B;  3X1U B;  3AZI A;  3AZN A;  3AZJ A;  4KGC A;  4QLC A;  3REK D;  3AZG D;  2CV5 C;  3W96 D;  5AY8 C;  3REI B;  3LJA A;  5KDM B;  5F99 B;  4Z66 D;  4XUJ A;  3C1B B;  3AV1 D;  4WU8 A;  3LZ0 B;  2Y2N A;  1ULY A;  2FJ7 D;  5B40 C;  1AOI A;  5DNN D;  5AV6 A;  5B31 B;  1BFM A;  4J8U D;  3KUY C;  5JRG D;  5GSU C;  5B0Z D;  2Y2H A;  4J8W C;  1U35 A;  3AZH B;  1P3P B;  1TAF A;  3WA9 D;  5B33 C;  3WTP C;  4Z2M G;  3KWQ C;  3AZE A;  1P34 B;  1P3K B;  1HQ3 C;  4XZQ D;  1KX4 B;  3EPH A;  3LZ1 C;  3LEL D;  1TZY A;  5B0Y B;  2PYO A;  3B6G B;  2HUE B;  1EQZ A;  4EO5 C;  3UT9 C;  3AFA C;  4YM6 A;  2Y2J A;  4ZUX A;  3C1C D;  4H9P B;  3O62 B;  5G49 B;  5CPI D;  4Z5T D;  4X23 C;  1KU5 A;  1PZR A;  3MGP A;  3W97 D;  5BO0 A;  2Y2K A;  3X1T D;  5CP6 D;  3AN2 D;  5AV5 D;  3UTA B;  3W98 D;  4JJN C;  2UWX A;  1P3B A;  3KXB A;  4G91 C;  4J8V B;  3TU4 D;  3AZM A;  1P3M D;  5FUG B;  5B1L B;  1KX5 B;  1ZLA D;  3NQJ B;  4J8X B;  3H0M C;  1P3L C;  5B1M C;  5GXQ D;  4H9N B;  4CAY B;  2F8N G;  5AY8 A;  3AZG B;  3W96 B;  3X1T B;  4WNN B;  3EPJ A;  3MVD A;  4Z66 B;  5B32 C;  4H9O B;  5BNV B;  5AV8 C;  1M19 A;  3AZI C;  3X1V A;  3AZJ C;  5GT3 A;  4QLC C;  3H0L C;  2FJ7 B;  2LY8 A;  3VH6 A;  1B67 A;  5E5A B;  3KUY A;  2F8N A;  5DNN B;  3C1B D;  3WAA C;  4J8U B;  4J8W A;  3MGR C;  4XUJ C;  3R45 A;  4WU8 C;  5B33 A;  2HIO B;  1S32 A;  1HQ3 A;  3A6N A;  3REJ B;  5AVC B;  4R8P D;  5B31 D;  3LZ1 A;  1AOI C;  3REL B;  1H3O A;  1W2E A;  5AV6 C;  5CPJ C;  3AZL A;  3AZH D;  4G92 B;  2CV5 B;  1P3K D;  3UT9 A;  1U35 C;  1P34 D;  4LD9 D;  1KX4 D;  1KX3 C;  1M18 A;  1M1A D;  2YFV B;  5B2I A;  3C1C B;  5BNX B;  1HTA A;  5B24 C;  4CSR A;  3AV2 D;  1R4V A;  1TZY C;  5B2J A;  3AZN D;  3AZF A;  2PYO C;  1P3I A;  4KGC D;  5CPK A;  4DRA A;  5CHL B;  5B32 G;  5B40 B;  5CP6 B;  1P3F A;  3AN2 B;  1P3G A;  1BH8 A;  2G5I C;  2Y2M A;  3LJA D;  3O62 D;  4YM6 C;  5GSU B;  1P3M B;  1P3L A;  5B1M A;  1ZLA B;  2NQB A;  1P3A C;  2Y2L A;  4YS3 C;  3UTA D;  5GXQ B;  2L5A A;  3WTP B;  3KWQ B;  5BS7 C;  2ARO C;  3MNN A;  4WU9 C;  1ID3 A;  1P3B C;  5B32 A;  3KXB C;  5B1L D;  1KX5 D;  5DNM A;  4J8X D;  5AV8 A;  3MGS A;  3UTB A;  2RVQ D;  3AYW A;  4AWL B;  3FDD A;  3AZE D;  1F66 B;  3AFA B;  3MGQ A;  3WAA A;  3MGR A;  4X23 B;  3X1S C;  3MVD C;  2ZY3 A;  3EG5 B;  4JJN B;  3WA9 C;  1M19 C;  3X1V C;  5E5A D;  4NE6 A;  5GT3 C;  5JA4 A;  4G91 B;  4E45 A;  4ZUX D;  4R8P B;  5CPJ A;  4HGA C;  3NQU B;  3AZK B;  3IP4 C;  3MGP D;  2HIO D;  3VH6 W;  3H0R C;  5AVB A;  1KX3 A;  1Q9C A;  3REJ D;  1S32 C;  3VH5 A;  5AVC D;  1P3O B;  4LD9 B;  3V9R B;  2ZM5 A;  3A6N C;  3REL D;  5B24 A;  3AZM D;  2BYK B;  1M1A B;  2JSS A;  1A7W A;  2NZD C;  2YFW B;  2G5H C;  3KFU G;  3WKJ A;  4H9Q B;  3AV2 B;  4KHA B;  3AZI B;  3AZN B;  5GT0 A;  4NE5 A;  3REH A;  3AZL C;  3AZJ B;  3X1T C;  4QLC B;  2CV5 D;  4KGC B;  5AY8 D;  4KUD A;  2BG1 A;  1WWI A;  3B6F C;  3LJA B;  2VQR A;  1M18 C;  5B2I C;  4XUJ B;  1P3A A;  4YS3 A;  4WU8 B;  3REK A;  3W99 C;  5BS7 A;  5B40 D;  5B2J C;  2ARO A;  4WU9 A;  4ZBJ C;  3AZF C;  1P3I C;  5CPK C;  1P3F C;  4Z66 A;  3KUY D;  1P3G C;  2XD5 A;  1AOI B;  3AV1 A;  5GSU D;  2IO5 B;  5AV6 B;  5AV9 C;  3X1U C;  4J8W D;  2Y2I A;  5B33 D;  3WTP D;  3KWQ D;  4DQY B;  1U35 B;  1JFI B;  2NQB C;  3REI C;  1TAF B;  2FFF B;  3AZE B;  4H9R B;  5F99 C;  5JRG A;  2XD1 A;  3X1S A;  3MNN C;  5B0Z A;  3LZ1 D;  1ID3 C;  2JCH A;  5BT1 C;  3EPK A;  3LZ0 C;  1TZY B;  5DNM C;  2PYO B;  3MGS C;  3UTB C;  3AYW C;  1EQZ B;  3WA9 A;  4XZQ A;  3UT9 D;  1F66 D;  3AFA D;  3B0D C;  5C3I B;  3EPL A;  3LEL A;  4YM6 B;  3MGQ C;  4ZUX B;  4X23 D;  2J8P A;  4UUZ A;  2CWE A;  1P3P C;  3MGP B;  4JJN D;  5BO0 B;  1P34 C;  5CPI A;  1P3B B;  2NZD A;  3KXB B;  4Z5T A;  3B0C W;  2DF4 C;  1BH9 A;  5B0Y C;  3AZK D;  3AZM B;  3B6G C;  3W97 A;  1P3L D;  5B1M D;  1N1J A;  3X1T A;  5AV5 A;  3W98 A;  1P3O D;  3TU4 A;  5AY8 B;  5AVB C;  3B6F A;  5B32 D;  4UPK A;  3MVD B;  2BYM A;  3W99 A;  3VH5 W;  3AZI D;  2Y2G A;  3AZJ D;  4QLC D;  3WKJ C;  1M19 B;  3X1V B;  5GT0 C;  3REH C;  5GT3 B;  4J8V C;  3WAA D;  5AV9 A;  5B1L C;  3X1U A;  3KUY B;  3MGR D;  2F8N B;  4KUD C;  4XUJ D;  4WU8 D;  5B31 G;  4J8W B;  2ZY4 A;  3A1I A;  3REI A;  3R45 B;  3REK C;  5B33 B;  3AZG C;  5KDM A;  1S32 B;  3W96 C;  1HQ3 B;  5F99 A;  1AOI D;  3C1B A;  3A6N B;  5AV6 D;  4Z66 C;  5CPJ D;  3LZ0 A;  3LZ1 B;  1WWS A;  3AV1 C;  1H3O B;  4H9S A;  4WJ3 C;  1U35 D;  3AZL B;  2Y2Q A;  4NE3 A;  2FJ7 C;  4EO5 B;  1KX3 D;  5B31 A;  3UT9 B;  3P5J B;  5DNN C;  1M18 B;  5B24 D;  4J8U C;  5B2I B;  5JRG C;  1TZY D;  5B0Z C;  3AZH A;  1P3P A;  3B0B A;  2PYO D;  1EQZ D;  1P3K A;  4CSR B;  1P34 A;  5B2J B;  4ZBJ B;  3AZF B;  1P3I B;  1KX4 A;  5CPK B;  1P3F B;  4XZQ C;  5B0Y A;  1P3G B;  1BH8 B;  4YM6 D;  3AL0 C;  3B6G A;  3VH5 T;  3LEL C;  4M6B A;  1P3A D;  1P3L B;  4YS3 D;  5B1M B;  4G92 C;  2NQB B;  2ARO D;  4WU9 D;  4H9P A;  3O62 A;  5G49 A;  1P3B D;  3KXB D;  3MNN B;  3C1C C;  4WZS B;  1ID3 B;  5CPI C;  5B32 B;  4Z5T C;  5DNM B;  5AV8 B;  3UTA A;  3MGS B;  3UTB B;  3AYW B;  3W97 C;  5CP6 C;  3AN2 C;  5AV5 C;  3W98 C;  4J8V A;  3B0D B;  5FUG A;  5B1L A;  1KX5 A;  3NQJ A;  4J8X A;  3TU4 C;  3MGQ B;  3X1S D;  1P3M C;  3WAA B;  4H9N A;  4CAY A;  3MVD D;  3MGR B;  1ZLA C;  1JFI A;  3AZG A;  5GXQ C;  1M19 D;  3W96 A;  4H9R A;  3X1V D;  5GT3 D;  4WNN A;  2F8N D;  5JA4 B;  4H9O A;  5BNV A;  3WTP E;  5CPJ B;  4AWL C;  4E44 A;  2FJ7 A;  2JE5 A;  2Y2P A;  5E5A A;  1S32 D;  1HQ3 D;  5DNN A;  1F66 C;  2Y2O A;  5AVB B;  1KX3 B;  3A6N D;  4J8U A;  2NZD D;  3VH6 T;  3C1B C;  5B24 B;  4WV4 B;  2HIO A;  3AZL D;  3WKJ B;  4H9S C;  3REJ A;  5AVC A;  5GT0 B;  3REH B;  3REL A;  3B6F D;  4R8P C;  5B31 C;  1M18 D;  4KUD B;  5B2I D;  3AZK C;  3W99 D;  2CV5 A;  5B2J D;  1P3A B;  3AZH C;  4YS3 B;  3AZF D;  1P3I D;  3REK B;  1P3K C;  5CPK D;  1P3O C;  2YFV A;  2ARO B;  1P3F D;  3C1C A;  4WU9 B;  3KSY A;  1KX4 C;  5BNX A;  1P3G D;  4LD9 C;  1M1A C;  5AV9 D;  3X1U D;  3AV1 B;  2HUE C;  3AV2 C;  3A1K A;  5CP6 A;  5B40 A;  3AZN C;  3AN2 A;  4KGC C;  2NQB D;  3REI D;  5F99 D;  3MNN D;  5GSU A;  1P3M A;  3LJA C;  1ZLA A;  3O62 C;  1ID3 D;  5BT1 D;  5JRG B;  3LZ0 D;  3X1S B;  5DNM D;  5B0Z B;  5AV8 D;  2F8N K;  5GXQ A;  3MGS D;  3UTB D;  3WTP A;  3KWQ A;  1F1E A;  3AYW D;  3UTA C;  3WA9 B;  4XZQ B;  4Z2M H;  3MGQ D;  2IO5 C;  4HGA B;  1KX5 C;  3LEL B;  4J8X C;  2RVQ C;  1P3P D;  4UUZ B;  1F66 A;  3AFA A;  3AZE C;  2W8S A;  4X23 A;  5B0Y D;  3B6G D;  5CPI B;  2NZD B;  4Z5T B;  1B6W A;  1BH9 B;  4JJN A;  3W97 B;  1EQZ C;  1N1J B; 
#chains in the Genus database with same CATH homology
 5AV5 B;  3W98 B;  4DRB A;  3B0C T;  5AVB D;  1Z2C B;  4R8P A;  5C3I C;  5E5A C;  3NQU A;  3TU4 B;  3AZK A;  4ZUX C;  3B6F B;  2F2A C;  1T3U A;  4NFT A;  2RIQ A;  2ZY5 A;  3MGP C;  2DQN C;  3W99 B;  2BYM B;  2HIO C;  1P3O A;  3WKJ D;  4LD9 A;  5GT0 D;  3REH D;  3V9R A;  2F8N H;  4J8V D;  1M1A A;  3REJ C;  2BYK A;  5AVC C;  4KUD D;  2YFW A;  3REL C;  3AZM C;  2ZY2 A;  4H9Q A;  3AV2 A;  3F6T A;  4KHA A;  5AV9 B;  3X1U B;  3AZI A;  3AZN A;  3AZJ A;  4KGC A;  4QLC A;  3REK D;  3AZG D;  2CV5 C;  3W96 D;  5AY8 C;  3REI B;  3LJA A;  5KDM B;  5F99 B;  4Z66 D;  4XUJ A;  3C1B B;  3AV1 D;  4WU8 A;  3LZ0 B;  2Y2N A;  1ULY A;  2FJ7 D;  5B40 C;  1AOI A;  5DNN D;  5AV6 A;  5B31 B;  1BFM A;  4J8U D;  3KUY C;  5JRG D;  5GSU C;  5B0Z D;  2Y2H A;  4J8W C;  1U35 A;  3AZH B;  1P3P B;  1TAF A;  3WA9 D;  5B33 C;  3WTP C;  4Z2M G;  3KWQ C;  3AZE A;  1P34 B;  1P3K B;  1HQ3 C;  4XZQ D;  1KX4 B;  3EPH A;  3LZ1 C;  3LEL D;  1TZY A;  5B0Y B;  2PYO A;  3B6G B;  2HUE B;  1EQZ A;  4EO5 C;  3UT9 C;  3AFA C;  4YM6 A;  2Y2J A;  4ZUX A;  3C1C D;  4H9P B;  3O62 B;  5G49 B;  5CPI D;  4Z5T D;  4X23 C;  1KU5 A;  1PZR A;  3MGP A;  3W97 D;  5BO0 A;  2Y2K A;  3X1T D;  5CP6 D;  3AN2 D;  5AV5 D;  3UTA B;  3W98 D;  4JJN C;  2UWX A;  1P3B A;  3KXB A;  4G91 C;  4J8V B;  3TU4 D;  3AZM A;  1P3M D;  5FUG B;  5B1L B;  1KX5 B;  1ZLA D;  3NQJ B;  4J8X B;  3H0M C;  1P3L C;  5B1M C;  5GXQ D;  4H9N B;  4CAY B;  2F8N G;  5AY8 A;  3AZG B;  3W96 B;  3X1T B;  4WNN B;  3EPJ A;  3MVD A;  4Z66 B;  5B32 C;  4H9O B;  5BNV B;  5AV8 C;  1M19 A;  3AZI C;  3X1V A;  3AZJ C;  5GT3 A;  4QLC C;  3H0L C;  2FJ7 B;  2LY8 A;  3VH6 A;  1B67 A;  5E5A B;  3KUY A;  2F8N A;  5DNN B;  3C1B D;  3WAA C;  4J8U B;  4J8W A;  3MGR C;  4XUJ C;  3R45 A;  4WU8 C;  5B33 A;  2HIO B;  1S32 A;  1HQ3 A;  3A6N A;  3REJ B;  5AVC B;  4R8P D;  5B31 D;  3LZ1 A;  1AOI C;  3REL B;  1H3O A;  1W2E A;  5AV6 C;  5CPJ C;  3AZL A;  3AZH D;  4G92 B;  2CV5 B;  1P3K D;  3UT9 A;  1U35 C;  1P34 D;  4LD9 D;  1KX4 D;  1KX3 C;  1M18 A;  1M1A D;  2YFV B;  5B2I A;  3C1C B;  5BNX B;  1HTA A;  5B24 C;  4CSR A;  3AV2 D;  1R4V A;  1TZY C;  5B2J A;  3AZN D;  3AZF A;  2PYO C;  1P3I A;  4KGC D;  5CPK A;  4DRA A;  5CHL B;  5B32 G;  5B40 B;  5CP6 B;  1P3F A;  3AN2 B;  1P3G A;  1BH8 A;  2G5I C;  2Y2M A;  3LJA D;  3O62 D;  4YM6 C;  5GSU B;  1P3M B;  1P3L A;  5B1M A;  1ZLA B;  2NQB A;  1P3A C;  2Y2L A;  4YS3 C;  3UTA D;  5GXQ B;  2L5A A;  3WTP B;  3KWQ B;  5BS7 C;  2ARO C;  3MNN A;  4WU9 C;  1ID3 A;  1P3B C;  5B32 A;  3KXB C;  5B1L D;  1KX5 D;  5DNM A;  4J8X D;  5AV8 A;  3MGS A;  3UTB A;  2RVQ D;  3AYW A;  4AWL B;  3FDD A;  3AZE D;  1F66 B;  3AFA B;  3MGQ A;  3WAA A;  3MGR A;  4X23 B;  3X1S C;  3MVD C;  2ZY3 A;  3EG5 B;  4JJN B;  3WA9 C;  1M19 C;  3X1V C;  5E5A D;  4NE6 A;  5GT3 C;  5JA4 A;  4G91 B;  4E45 A;  4ZUX D;  4R8P B;  5CPJ A;  4HGA C;  3NQU B;  3AZK B;  3IP4 C;  3MGP D;  2HIO D;  3VH6 W;  3H0R C;  5AVB A;  1KX3 A;  1Q9C A;  3REJ D;  1S32 C;  3VH5 A;  5AVC D;  1P3O B;  4LD9 B;  3V9R B;  2ZM5 A;  3A6N C;  3REL D;  5B24 A;  3AZM D;  2BYK B;  1M1A B;  2JSS A;  1A7W A;  2NZD C;  2YFW B;  2G5H C;  3KFU G;  3WKJ A;  4H9Q B;  3AV2 B;  4KHA B;  3AZI B;  3AZN B;  5GT0 A;  4NE5 A;  3REH A;  3AZL C;  3AZJ B;  3X1T C;  4QLC B;  2CV5 D;  4KGC B;  5AY8 D;  4KUD A;  2BG1 A;  1WWI A;  3B6F C;  3LJA B;  2VQR A;  1M18 C;  5B2I C;  4XUJ B;  1P3A A;  4YS3 A;  4WU8 B;  3REK A;  3W99 C;  5BS7 A;  5B40 D;  5B2J C;  2ARO A;  4WU9 A;  4ZBJ C;  3AZF C;  1P3I C;  5CPK C;  1P3F C;  4Z66 A;  3KUY D;  1P3G C;  2XD5 A;  1AOI B;  3AV1 A;  5GSU D;  2IO5 B;  5AV6 B;  5AV9 C;  3X1U C;  4J8W D;  2Y2I A;  5B33 D;  3WTP D;  3KWQ D;  4DQY B;  1U35 B;  1JFI B;  2NQB C;  3REI C;  1TAF B;  2FFF B;  3AZE B;  4H9R B;  5F99 C;  5JRG A;  2XD1 A;  3X1S A;  3MNN C;  5B0Z A;  3LZ1 D;  1ID3 C;  2JCH A;  5BT1 C;  3EPK A;  3LZ0 C;  1TZY B;  5DNM C;  2PYO B;  3MGS C;  3UTB C;  3AYW C;  1EQZ B;  3WA9 A;  4XZQ A;  3UT9 D;  1F66 D;  3AFA D;  3B0D C;  5C3I B;  3EPL A;  3LEL A;  4YM6 B;  3MGQ C;  4ZUX B;  4X23 D;  2J8P A;  4UUZ A;  2CWE A;  1P3P C;  3MGP B;  4JJN D;  5BO0 B;  1P34 C;  5CPI A;  1P3B B;  2NZD A;  3KXB B;  4Z5T A;  3B0C W;  2DF4 C;  1BH9 A;  5B0Y C;  3AZK D;  3AZM B;  3B6G C;  3W97 A;  1P3L D;  5B1M D;  1N1J A;  3X1T A;  5AV5 A;  3W98 A;  1P3O D;  3TU4 A;  5AY8 B;  5AVB C;  3B6F A;  5B32 D;  4UPK A;  3MVD B;  2BYM A;  3W99 A;  3VH5 W;  3AZI D;  2Y2G A;  3AZJ D;  4QLC D;  3WKJ C;  1M19 B;  3X1V B;  5GT0 C;  3REH C;  5GT3 B;  4J8V C;  3WAA D;  5AV9 A;  5B1L C;  3X1U A;  3KUY B;  3MGR D;  2F8N B;  4KUD C;  4XUJ D;  4WU8 D;  5B31 G;  4J8W B;  2ZY4 A;  3A1I A;  3REI A;  3R45 B;  3REK C;  5B33 B;  3AZG C;  5KDM A;  1S32 B;  3W96 C;  1HQ3 B;  5F99 A;  1AOI D;  3C1B A;  3A6N B;  5AV6 D;  4Z66 C;  5CPJ D;  3LZ0 A;  3LZ1 B;  1WWS A;  3AV1 C;  1H3O B;  4H9S A;  4WJ3 C;  1U35 D;  3AZL B;  2Y2Q A;  4NE3 A;  2FJ7 C;  4EO5 B;  1KX3 D;  5B31 A;  3UT9 B;  3P5J B;  5DNN C;  1M18 B;  5B24 D;  4J8U C;  5B2I B;  5JRG C;  1TZY D;  5B0Z C;  3AZH A;  1P3P A;  3B0B A;  2PYO D;  1EQZ D;  1P3K A;  4CSR B;  1P34 A;  5B2J B;  4ZBJ B;  3AZF B;  1P3I B;  1KX4 A;  5CPK B;  1P3F B;  4XZQ C;  5B0Y A;  1P3G B;  1BH8 B;  4YM6 D;  3AL0 C;  3B6G A;  3VH5 T;  3LEL C;  4M6B A;  1P3A D;  1P3L B;  4YS3 D;  5B1M B;  4G92 C;  2NQB B;  2ARO D;  4WU9 D;  4H9P A;  3O62 A;  5G49 A;  1P3B D;  3KXB D;  3MNN B;  3C1C C;  4WZS B;  1ID3 B;  5CPI C;  5B32 B;  4Z5T C;  5DNM B;  5AV8 B;  3UTA A;  3MGS B;  3UTB B;  3AYW B;  3W97 C;  5CP6 C;  3AN2 C;  5AV5 C;  3W98 C;  4J8V A;  3B0D B;  5FUG A;  5B1L A;  1KX5 A;  3NQJ A;  4J8X A;  3TU4 C;  3MGQ B;  3X1S D;  1P3M C;  3WAA B;  4H9N A;  4CAY A;  3MVD D;  3MGR B;  1ZLA C;  1JFI A;  3AZG A;  5GXQ C;  1M19 D;  3W96 A;  4H9R A;  3X1V D;  5GT3 D;  4WNN A;  2F8N D;  5JA4 B;  4H9O A;  5BNV A;  3WTP E;  5CPJ B;  4AWL C;  4E44 A;  2FJ7 A;  2JE5 A;  2Y2P A;  5E5A A;  1S32 D;  1HQ3 D;  5DNN A;  1F66 C;  2Y2O A;  5AVB B;  1KX3 B;  3A6N D;  4J8U A;  2NZD D;  3VH6 T;  3C1B C;  5B24 B;  4WV4 B;  2HIO A;  3AZL D;  3WKJ B;  4H9S C;  3REJ A;  5AVC A;  5GT0 B;  3REH B;  3REL A;  3B6F D;  4R8P C;  5B31 C;  1M18 D;  4KUD B;  5B2I D;  3AZK C;  3W99 D;  2CV5 A;  5B2J D;  1P3A B;  3AZH C;  4YS3 B;  3AZF D;  1P3I D;  3REK B;  1P3K C;  5CPK D;  1P3O C;  2YFV A;  2ARO B;  1P3F D;  3C1C A;  4WU9 B;  3KSY A;  1KX4 C;  5BNX A;  1P3G D;  4LD9 C;  1M1A C;  5AV9 D;  3X1U D;  3AV1 B;  2HUE C;  3AV2 C;  3A1K A;  5CP6 A;  5B40 A;  3AZN C;  3AN2 A;  4KGC C;  2NQB D;  3REI D;  5F99 D;  3MNN D;  5GSU A;  1P3M A;  3LJA C;  1ZLA A;  3O62 C;  1ID3 D;  5BT1 D;  5JRG B;  3LZ0 D;  3X1S B;  5DNM D;  5B0Z B;  5AV8 D;  2F8N K;  5GXQ A;  3MGS D;  3UTB D;  3WTP A;  3KWQ A;  1F1E A;  3AYW D;  3UTA C;  3WA9 B;  4XZQ B;  4Z2M H;  3MGQ D;  2IO5 C;  4HGA B;  1KX5 C;  3LEL B;  4J8X C;  2RVQ C;  1P3P D;  4UUZ B;  1F66 A;  3AFA A;  3AZE C;  2W8S A;  4X23 A;  5B0Y D;  3B6G D;  5CPI B;  2NZD B;  4Z5T B;  1B6W A;  1BH9 B;  4JJN A;  3W97 B;  1EQZ C;  1N1J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...