3C1CA

The effect of h3 k79 dimethylation and h4 k20 trimethylation on nucleosome and chromatin structure
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFTDLRFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3-like
molecule tags Structural protein/dna
source organism Xenopus laevis
publication title The effect of H3K79 dimethylation and H4K20 trimethylation on nucleosome and chromatin structure.
pubmed doi rcsb
total genus 31
structure length 97
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3c1cA00
1P3IC 5B2JD 4WU9A 5B1LB 5B0ZB 3MGSD 3B6FD 5GSUB 3LELC 4YM6A 3WAAD 5FUGB 5CP6C 4Z66B 1U35A 3X1TA 3B0CW 1U35D 3LELB 1M18A 4R8PC 1KX4C 3B6FB 2BYKA 3AV1C 4G92B 5JA4B 1N1JA 3WKJD 5B40B 3LZ0D 4QLCB 3MGSC 4H9QA 2NQBA 1HQ3D 3AZJA 3WAAB 5B0YB 4WU8B 4YS3A 2NZDC 2F8NB 3LZ1D 1M19A 5DNMB 3AZLC 4DRAA 1M1AC 1P3LD 3B0DB 4JJNB 5DNMD 3RELC 5CPIA 3AZGB 3KXBB 3WA9A 5DNNA 3W97D 1KX4A 5JRGD 3AZGD 3AZGA 5BT1C 3W99A 1TZYB 3UTBA 3X1TB 1A7WA 5AVBB 4XZQD 3KUYC 4WU9C 5CP6B 2CV5D 1ID3B 1P3MD 4NE5A 3O62C 1P3PD 5JRGB 1P3OD 3AZJB 4E45A 1KX5A 4CSRA 1AOIC 3AZFA 4QLCC 3W97A 5DNND 4WU8C 2NQBC 2LY8A 3MVDA 4LD9C 3MVDD 3MGSA 4X23B 3MGRC 5BT1D 3AZGC 3AZKC 4J8UD 5B1LA 5B1LC 3VH6W 1KX5B 3AZMB 3REHC 1P3PA 3X1SD 3LZ0A 1P3LC 3MGPD 1H3OB 4J8WB 3REJB 1TAFA 3AV2B 4J8WC 1JFIB 4E44A 1P3BB 2NZDD 3REIB 2CWEA 4ZUXA 3MGSB 5B40C 1P3FA 1EQZA 4J8VC 3MGPC 3REHA 3REHD 1P3GB 5CPID 1B67A 5B1LD 3AZNB 3W98A 3AZID 1P3KB 3AZKD 2F8NK 5GT0B 2F8NG 5JRGA 3WAAC 3AZIB 1P3KD 3LELD 2JSSA 5B2JB 4KUDD 5B24A 5AY8A 4WU8A 4YS3B 4WU8D 5B2JC 3X1VA 3C1CB 1P3ID 1P3IA 5AV8B 3C1BA 4QLCD 3B0DC 5BNXB 2YFVA 5AV8A 3X1SA 1P34A 2PYOA 5BO0A 2HUEB 3O62D 2F8ND 4KUDB 5B1MD 3B0BA 4H9SA 4YS3D 3WTPC 3AZIA 1U35B 1P3MC 4JJNA 2CV5C 1TZYC 3REJA 5B2JA 4WU9D 3MNNA 4M6BA 5B32A 4H9RA 5AY8C 4XZQC 4YM6C 1P3BC 4Z66C 3KUYB 3REIC 4WU9B 3WAAA 1HTAA 5AV6A 5B31C 5B33B 1HQ3B 3AZHA 5CPJA 5CPJD 5GT0C 3AZHD 3AN2C 3AN2A 5B2IA 3AZEA 1P3AA 3AZNC 4KHAB 5KDMB 5AV5A 1M1AA 1M1AD 3MGPA 3LZ1B 4XUJC 3LELA 5B0YC 1ZLAB 1P3BA 1P34C 3LZ1C 4H9OA 5B24D 4XZQA 5AV8C 4G91C 5GT3B 3TU4C 4CAYA 4JJND 3NQUB 5B0ZA 2NZDA 4H9SC 1P3PB 3W96A 3NQJA 2FJ7B 3WKJC 2FJ7C 3NQJB 3AYWA 4HGAC 5F99B 5AV5C 3WA9D 5B1MA 5CPKA 3UT9C 3MVDB 3AZKA 1KX4D 3X1TC 1U35C 4Z5TC 1P3MB 3VH5T 3UTBD 1BFMA 3MGPB 2YFWA 1KX4B 3B6FC 2RVQD 4J8XD 4J8XA 3AN2B 1P3FC 1EQZC 4UUZA 4G92C 4ZBJB 3VH5A 4X23D 3AZFB 1S32D 3C1BD 4J8VB 5B33C 4DRBA 3B0CT 4WZSB 1KX5D 2PYOD 5GT3A 4G91B 5GT3C 3MNNB 4ZUXC 2PYOC 4H9OB 2AROC 2PYOB 2AROB 3W99B 3MNND 3REJD 5B32D 3C1BC 3MGQD 3X1UB 4X23C 3MGRB 3W96D 3X1VC 3AZMD 5B2IB 2YFVB 3R45A 3UTAD 3MGRA 3KSYA 5AV6D 3WTPB 3UT9B 1P3IB 4Z2MH 4Z5TD 3AFAA 4Z5TA 1BH9B 5AY8B 3B6GD 3AZED 1P3AD 3UT9D 5GSUC 5B32B 5AV5D 3WTPE 3AV2C 5B32G 5BS7A 4KUDA 3REKC 5AV9A 5B0ZD 5BO0B 3LJAC 3REKB 4QLCA 3AZFC 3AFAC 1KX3D 4XUJB 3TU4D 5G49A 5AV8D 3KWQA 4WNNA 1F1EA 5CPKB 1BH8B 1F66B 5B0YD 3O62A 4XUJD 3TU4B 1F66D 3LZ0B 3AZLB 5GT0A 1P3KA 4KGCB 2HIOC 3RELB 3AZLA 2BYMA 4H9PA 5AVCD 3AZMC 3X1VD 4X23A 3KWQC 5B32C 1M1AB 3V9RA 1P3LB 1TZYD 3B6GA 3TU4A 3A6NC 5F99C 4WNNB 5AVBC 3KXBC 5GT3D 3W97B 5AV9C 4KGCD 4KHAA 5KDMA 2CV5B 1R4VA 5AV9B 1H3OA 1ZLAD 5B33D 3MGQA 4H9NB 3LJAB 3AZJC 5CPKC 3AZMA 1P3FD 1AOIB 1KX3A 1EQZD 5CP6A 1ID3A 3AFAB 3UTAA 4ZBJC 1P3KC 3UTBC 3W98D 1F66A 1TZYA 3UTBB 3AZJD 3WTPA 5GXQC 3AZIC 3WA9C 1ZLAC 1P34B 1BH8A 5BNXA 3C1CA 3C1CC 2FJ7D 4KGCC 3C1BB 4J8VD 4CSRB 3X1UC 3KXBA 5E5AA 4LD9B 5F99D 3A6ND 3A6NA 1S32A 4JJNC 4EO5B 4J8WD 4WV4B 3KWQD 5B24C 4J8UB 1P34D 1S32B 5B0YA 1Q9CA 3AYWD 1KU5A 2F8NA 3REHB 2HIOD 1P3GD 3X1SC 1ULYA 3MGQB 1BH9A 4Z5TB 3AZND 5GT0D 3AZHC 5CPJC 1P3MA 1N1JB 4R8PA 1F66C 4NFTA 1P3GC 5B31B 5CPIB 2IO5C 3AYWC 3MGRD 3REID 4Z66A 3VH5W 3WKJA 4Z66D 5AVCA 4AWLB 2NQBD 5GXQB 1KX3C 3UTAB 5FUGA 4H9PB 3WTPD 1KX3B 4J8WA 3X1UD 3W96B 3LJAA 1WWIA 4KGCA 3REKD 1AOIA 3C1CD 1P3PC 4J8VA 1ZLAA 5B40A 4CAYB 5GXQA 5GSUD 5GXQD 3AZEC 5JA4A 1P3AC 3B6GC 3WKJB 3W98C 3AZEB 1P3AB 3AZKB 3KUYD 5B31A 2BYKB 5BS7C 4KUDC 5AV5B 5AV6C 5B1MB 2HIOA 5CPKD 1HQ3A 3AZHB 5CPJB 3MGQC 3W97C 3REJC 3RELD 5CPIC 3RELA 4NE3A 2FJ7A 3NQUA 3AZLD 5AV9D 4AWLC 5AVBA 3KXBD 4XZQB 5AVBD 5B40D 1P3OA 3O62B 5BNVA 5AVCB 4R8PB 3R45B 5AVCC 1HQ3C 3AV1B 4XUJA 4J8XC 3REKA 3LZ0C 1ID3C 2RVQC 5B31G 3WA9B 3AV1D 3X1VB 5B33A 3X1TD 4EO5C 4J8UA 5B24B 4J8UC 4H9RB 3VH6T 4R8PD 4HGAB 3KUYA 5CP6D 1ID3D 5C3IB 1M19B 3W98B 5E5AB 3MVDC 4LD9A 4LD9D 3A6NB 3AFAD 5CHLB 3AZFD 3UT9A 1B6WA 5DNNC 4Z2MG 3LJAD 5B0ZC 3X1UA 3X1SB 5DNNB 1P3FB 1AOID 1EQZB 2AROA 1P3OC 3B6FA 1M19D 1TAFB 3AV2A 3AV2D 1P3OB 4YM6B 3V9RB 5E5AD 1P3LA 5BNVB 1WWSA 5GSUA 1JFIA 1M18B 5DNMA 2IO5B 1M18C 3AYWB 3AN2D 5B2ID 4NE6A 5B31D 3UTAC 3W99C 3W99D 1P3GA 5JRGC 4H9QB 4H9NA 4J8XB 2NQBB 1P3BD 2NZDB 3AZNA 4YM6D 3W96C 5AY8D 3AV1A 4UUZB 2YFWB 5B2IC 1M18D 4ZUXB 2HIOB 2L5AA 3MNNC 2CV5A 4YS3C 5DNMC 5B1MC 3LZ1A 2AROD 5E5AC 4ZUXD 5G49B 3KWQB 3VH6A 1KX5C 3REIA 5C3IC 1M19C 3B6GB 5F99A 2BYMB 2F8NH 1S32C 2HUEC 5AV6B
chains in the Genus database with same CATH superfamily
1P3IC 5B2JD 4WU9A 5B1LB 5B0ZB 3MGSD 3B6FD 5GSUB 2Y2OA 3LELC 4YM6A 3WAAD 3KFUG 5FUGB 5CP6C 4Z66B 1U35A 3X1TA 3B0CW 1U35D 3LELB 1M18A 4R8PC 1KX4C 3B6FB 2BYKA 2W8SA 3AV1C 4G92B 3H0LC 5JA4B 2Y2NA 1N1JA 3WKJD 5B40B 3LZ0D 4QLCB 3MGSC 4H9QA 2NQBA 2Y2GA 1HQ3D 3AZJA 3WAAB 5B0YB 4WU8B 4YS3A 2NZDC 2F8NB 2G5HC 3LZ1D 1M19A 2Y2JA 5DNMB 2ZY5A 3AZLC 4DRAA 1M1AC 1P3LD 3B0DB 3A1KA 4JJNB 5DNMD 3P5JB 3RELC 5CPIA 3AZGB 3KXBB 3WA9A 5DNNA 3W97D 2ZY2A 1KX4A 5JRGD 3AZGD 3AZGA 5BT1C 3W99A 1TZYB 3UTBA 3X1TB 1A7WA 5AVBB 4XZQD 3KUYC 4WU9C 5CP6B 2CV5D 1ID3B 1P3MD 4NE5A 3O62C 4UPKA 5JRGB 1P3PD 2Y2LA 1P3OD 3AZJB 4E45A 1KX5A 4CSRA 1AOIC 3AZFA 4QLCC 3W97A 5DNND 2RIQA 4WU8C 2NQBC 2LY8A 3MVDA 4LD9C 3MVDD 3MGSA 4X23B 3MGRC 3H0RC 5BT1D 3AZGC 3AZKC 1Z2CB 4J8UD 5B1LA 5B1LC 3VH6W 1KX5B 3A1IA 3AZMB 3REHC 1P3PA 3X1SD 3LZ0A 1P3LC 3MGPD 1H3OB 4J8WB 3REJB 2Y2MA 1TAFA 3AV2B 4J8WC 1JFIB 4E44A 1P3BB 2NZDD 3REIB 2CWEA 4ZUXA 1W2EA 3MGSB 5B40C 1P3FA 1EQZA 4J8VC 3MGPC 3REHA 2XD1A 3REHD 1P3GB 5CPID 1B67A 5B1LD 3AZNB 3W98A 3AZID 1P3KB 3AZKD 2F8NK 5GT0B 2F8NG 5JRGA 3WAAC 3AZIB 1P3KD 3LELD 2JSSA 5B2JB 4KUDD 5B24A 5AY8A 4WU8A 4YS3B 4WU8D 5B2JC 3X1VA 3C1CB 1P3ID 1P3IA 5AV8B 3C1BA 4QLCD 3B0DC 5BNXB 2YFVA 5AV8A 3X1SA 1P34A 2PYOA 5BO0A 2HUEB 3O62D 2F8ND 4KUDB 5B1MD 3B0BA 4H9SA 4YS3D 3WTPC 3AZIA 1U35B 1P3MC 4JJNA 2CV5C 1TZYC 3REJA 4WJ3C 5B2JA 4WU9D 3MNNA 2Y2PA 4M6BA 5B32A 4H9RA 5AY8C 4XZQC 4YM6C 1P3BC 4Z66C 3KUYB 3REIC 4WU9B 3WAAA 1HTAA 5AV6A 5B31C 5B33B 1HQ3B 3AZHA 5CPJA 5CPJD 5GT0C 3AZHD 3AN2C 3AN2A 5B2IA 3AZEA 1P3AA 3AZNC 4KHAB 5KDMB 5AV5A 1M1AA 1M1AD 3MGPA 3LZ1B 4XUJC 3LELA 5B0YC 1ZLAB 1P3BA 1P34C 2BG1A 3LZ1C 4H9OA 5B24D 4XZQA 5AV8C 4G91C 5GT3B 3TU4C 4CAYA 4JJND 3NQUB 5B0ZA 2NZDA 4H9SC 1P3PB 3W96A 3NQJA 2FJ7B 2Y2HA 2ZY4A 3WKJC 2FJ7C 3NQJB 3AYWA 4HGAC 5F99B 5AV5C 3F6TA 3WA9D 5B1MA 5CPKA 3UT9C 3MVDB 3AZKA 1KX4D 3X1TC 1U35C 4Z5TC 1P3MB 3VH5T 3UTBD 1BFMA 3MGPB 2YFWA 1KX4B 3B6FC 2RVQD 4J8XD 4J8XA 3AN2B 1P3FC 1EQZC 4UUZA 4G92C 4ZBJB 3VH5A 4X23D 3AZFB 2Y2QA 1S32D 3C1BD 4J8VB 5B33C 4DRBA 4DQYB 3B0CT 4WZSB 1KX5D 2PYOD 5GT3A 4G91B 5GT3C 4ZUXC 3MNNB 2PYOC 4H9OB 2AROC 2PYOB 2AROB 3W99B 1PZRA 3MNND 3REJD 5B32D 3C1BC 3MGQD 3X1UB 4X23C 3MGRB 3W96D 3X1VC 3AZMD 5B2IB 2YFVB 3R45A 3UTAD 3MGRA 3KSYA 5AV6D 3WTPB 3UT9B 2JE5A 1P3IB 4Z2MH 4Z5TD 3AFAA 4Z5TA 1BH9B 5AY8B 3B6GD 3AZED 1P3AD 3UT9D 5GSUC 5B32B 5AV5D 3WTPE 3AV2C 5B32G 5BS7A 4KUDA 3REKC 5AV9A 5B0ZD 5BO0B 3LJAC 3REKB 4QLCA 3AZFC 3AFAC 1KX3D 4XUJB 3TU4D 5G49A 5AV8D 3KWQA 4WNNA 1F1EA 5CPKB 1BH8B 1F66B 5B0YD 3O62A 4XUJD 3TU4B 1F66D 3FDDA 3LZ0B 3AZLB 5GT0A 1P3KA 4KGCB 2HIOC 3RELB 3AZLA 2BYMA 4H9PA 5AVCD 3AZMC 3X1VD 4X23A 3KWQC 5B32C 1M1AB 3V9RA 1P3LB 1TZYD 3B6GA 3TU4A 3A6NC 5F99C 4WNNB 5AVBC 3KXBC 5GT3D 3W97B 5AV9C 4KGCD 4KHAA 5KDMA 2CV5B 1R4VA 5AV9B 3EPJA 1H3OA 1ZLAD 5B33D 3MGQA 4H9NB 3LJAB 2DF4C 3AZJC 5CPKC 3AZMA 1P3FD 1AOIB 1KX3A 1EQZD 3EPHA 5CP6A 1ID3A 3AFAB 3EPKA 3UTAA 2ZY3A 4ZBJC 1P3KC 3UTBC 3IP4C 3W98D 1F66A 1TZYA 3UTBB 3AZJD 3WTPA 5GXQC 3AZIC 3WA9C 1ZLAC 1P34B 1BH8A 5BNXA 3C1CA 3C1CC 2FJ7D 4KGCC 3C1BB 4J8VD 4CSRB 3X1UC 3KXBA 5E5AA 4LD9B 5F99D 3A6ND 3A6NA 1S32A 4JJNC 4EO5B 4J8WD 4WV4B 3KWQD 5B24C 4J8UB 1T3UA 2F2AC 1P34D 1S32B 5B0YA 1Q9CA 3AYWD 1KU5A 2F8NA 3REHB 2HIOD 1P3GD 3X1SC 1ULYA 3MGQB 1BH9A 4Z5TB 3AZND 3AL0C 5GT0D 3AZHC 5CPJC 1P3MA 1N1JB 4R8PA 1F66C 4NFTA 1P3GC 5B31B 5CPIB 2IO5C 2Y2KA 3AYWC 3MGRD 3REID 4Z66A 3VH5W 3WKJA 4Z66D 5AVCA 4AWLB 2NQBD 5GXQB 1KX3C 3UTAB 5FUGA 4H9PB 3WTPD 1KX3B 4J8WA 2G5IC 2XD5A 3X1UD 3W96B 3LJAA 1WWIA 4KGCA 3REKD 1AOIA 3C1CD 1P3PC 4J8VA 1ZLAA 5B40A 4CAYB 5GXQA 5GSUD 5GXQD 3AZEC 5JA4A 1P3AC 3B6GC 3WKJB 3W98C 3AZEB 1P3AB 3AZKB 3KUYD 5B31A 2BYKB 5BS7C 4KUDC 5AV5B 5AV6C 5B1MB 2DQNC 2HIOA 2UWXA 5CPKD 1HQ3A 3AZHB 5CPJB 3MGQC 3W97C 3REJC 3RELD 5CPIC 3EPLA 3RELA 4NE3A 2FJ7A 3NQUA 3AZLD 5AV9D 4AWLC 5AVBA 3KXBD 4XZQB 5AVBD 5B40D 1P3OA 3O62B 2FFFB 5BNVA 5AVCB 4R8PB 3R45B 5AVCC 1HQ3C 3EG5B 3AV1B 4XUJA 4J8XC 3REKA 3LZ0C 1ID3C 2RVQC 2JCHA 5B31G 3WA9B 3AV1D 3X1VB 5B33A 3X1TD 4EO5C 4J8UA 5B24B 4J8UC 4H9RB 3VH6T 2VQRA 4R8PD 4HGAB 3KUYA 5CP6D 1ID3D 5C3IB 1M19B 3W98B 5E5AB 3MVDC 4LD9A 4LD9D 2J8PA 3A6NB 3AFAD 5CHLB 3AZFD 3UT9A 1B6WA 5DNNC 4Z2MG 3LJAD 5B0ZC 3X1UA 3X1SB 5DNNB 1P3FB 1AOID 1EQZB 2AROA 1P3OC 3B6FA 1M19D 1TAFB 3AV2A 3AV2D 1P3OB 4YM6B 3V9RB 5E5AD 1P3LA 5BNVB 1WWSA 5GSUA 1JFIA 1M18B 5DNMA 2IO5B 1M18C 3AYWB 3AN2D 5B2ID 4NE6A 5B31D 3UTAC 3W99C 3W99D 1P3GA 3H0MC 5JRGC 4H9QB 4H9NA 4J8XB 2NQBB 1P3BD 2NZDB 3AZNA 2ZM5A 4YM6D 3W96C 2Y2IA 5AY8D 4UUZB 2YFWB 5B2IC 3AV1A 1M18D 4ZUXB 2HIOB 2L5AA 3MNNC 2CV5A 4YS3C 5DNMC 5B1MC 3LZ1A 2AROD 5E5AC 4ZUXD 5G49B 3KWQB 3VH6A 1KX5C 3REIA 5C3IC 1M19C 3B6GB 5F99A 2BYMB 2F8NH 1S32C 2HUEC 5AV6B
chains in the Genus database with same CATH topology
1P3IC 5B2JD 4WU9A 5B1LB 5B0ZB 3MGSD 3B6FD 5GSUB 2Y2OA 3LELC 4YM6A 3WAAD 3KFUG 5FUGB 5CP6C 4Z66B 1U35A 3X1TA 3B0CW 1U35D 3LELB 1M18A 4R8PC 1KX4C 3B6FB 2BYKA 2W8SA 3AV1C 4G92B 3H0LC 5JA4B 2Y2NA 1N1JA 3WKJD 5B40B 3LZ0D 4QLCB 3MGSC 4H9QA 2NQBA 2Y2GA 1HQ3D 3AZJA 3WAAB 5B0YB 4WU8B 4YS3A 2NZDC 2F8NB 2G5HC 3LZ1D 1M19A 2Y2JA 5DNMB 2ZY5A 3AZLC 4DRAA 1M1AC 1P3LD 3B0DB 3A1KA 4JJNB 5DNMD 3P5JB 3RELC 5CPIA 3AZGB 3KXBB 3WA9A 5DNNA 3W97D 2ZY2A 1KX4A 5JRGD 3AZGD 3AZGA 5BT1C 3W99A 1TZYB 3UTBA 3X1TB 1A7WA 5AVBB 4XZQD 3KUYC 4WU9C 5CP6B 2CV5D 1ID3B 1P3MD 4NE5A 3O62C 4UPKA 5JRGB 1P3PD 2Y2LA 1P3OD 3AZJB 4E45A 1KX5A 4CSRA 1AOIC 3AZFA 4QLCC 3W97A 5DNND 2RIQA 4WU8C 2NQBC 2LY8A 3MVDA 4LD9C 3MVDD 3MGSA 4X23B 3MGRC 3H0RC 5BT1D 3AZGC 3AZKC 1Z2CB 4J8UD 5B1LA 5B1LC 3VH6W 1KX5B 3A1IA 3AZMB 3REHC 1P3PA 3X1SD 3LZ0A 1P3LC 3MGPD 1H3OB 4J8WB 3REJB 2Y2MA 1TAFA 3AV2B 4J8WC 1JFIB 4E44A 1P3BB 2NZDD 3REIB 2CWEA 4ZUXA 1W2EA 3MGSB 5B40C 1P3FA 1EQZA 4J8VC 3MGPC 3REHA 2XD1A 3REHD 1P3GB 5CPID 1B67A 5B1LD 3AZNB 3W98A 3AZID 1P3KB 3AZKD 2F8NK 5GT0B 2F8NG 5JRGA 3WAAC 3AZIB 1P3KD 3LELD 2JSSA 5B2JB 4KUDD 5B24A 5AY8A 4WU8A 4YS3B 4WU8D 5B2JC 3X1VA 3C1CB 1P3ID 1P3IA 5AV8B 3C1BA 4QLCD 3B0DC 5BNXB 2YFVA 5AV8A 3X1SA 1P34A 2PYOA 5BO0A 2HUEB 3O62D 2F8ND 4KUDB 5B1MD 3B0BA 4H9SA 4YS3D 3WTPC 3AZIA 1U35B 1P3MC 4JJNA 2CV5C 1TZYC 3REJA 4WJ3C 5B2JA 4WU9D 3MNNA 2Y2PA 4M6BA 5B32A 4H9RA 5AY8C 4XZQC 4YM6C 1P3BC 4Z66C 3KUYB 3REIC 4WU9B 3WAAA 1HTAA 5AV6A 5B31C 5B33B 1HQ3B 3AZHA 5CPJA 5CPJD 5GT0C 3AZHD 3AN2C 3AN2A 5B2IA 3AZEA 1P3AA 3AZNC 4KHAB 5KDMB 5AV5A 1M1AA 1M1AD 3MGPA 3LZ1B 4XUJC 3LELA 5B0YC 1ZLAB 1P3BA 1P34C 2BG1A 3LZ1C 4H9OA 5B24D 4XZQA 5AV8C 4G91C 5GT3B 3TU4C 4CAYA 4JJND 3NQUB 5B0ZA 2NZDA 4H9SC 1P3PB 3W96A 3NQJA 2FJ7B 2Y2HA 2ZY4A 3WKJC 2FJ7C 3NQJB 3AYWA 4HGAC 5F99B 5AV5C 3F6TA 3WA9D 5B1MA 5CPKA 3UT9C 3MVDB 3AZKA 1KX4D 3X1TC 1U35C 4Z5TC 1P3MB 3VH5T 3UTBD 1BFMA 3MGPB 2YFWA 1KX4B 3B6FC 2RVQD 4J8XD 4J8XA 3AN2B 1P3FC 1EQZC 4UUZA 4G92C 4ZBJB 3VH5A 4X23D 3AZFB 2Y2QA 1S32D 3C1BD 4J8VB 5B33C 4DRBA 4DQYB 3B0CT 4WZSB 1KX5D 2PYOD 5GT3A 4G91B 5GT3C 4ZUXC 3MNNB 2PYOC 4H9OB 2AROC 2PYOB 2AROB 3W99B 1PZRA 3MNND 3REJD 5B32D 3C1BC 3MGQD 3X1UB 4X23C 3MGRB 3W96D 3X1VC 3AZMD 5B2IB 2YFVB 3R45A 3UTAD 3MGRA 3KSYA 5AV6D 3WTPB 3UT9B 2JE5A 1P3IB 4Z2MH 4Z5TD 3AFAA 4Z5TA 1BH9B 5AY8B 3B6GD 3AZED 1P3AD 3UT9D 5GSUC 5B32B 5AV5D 3WTPE 3AV2C 5B32G 5BS7A 4KUDA 3REKC 5AV9A 5B0ZD 5BO0B 3LJAC 3REKB 4QLCA 3AZFC 3AFAC 1KX3D 4XUJB 3TU4D 5G49A 5AV8D 3KWQA 4WNNA 1F1EA 5CPKB 1BH8B 1F66B 5B0YD 3O62A 4XUJD 3TU4B 1F66D 3FDDA 3LZ0B 3AZLB 5GT0A 1P3KA 4KGCB 2HIOC 3RELB 3AZLA 2BYMA 4H9PA 5AVCD 3AZMC 3X1VD 4X23A 3KWQC 5B32C 1M1AB 3V9RA 1P3LB 1TZYD 3B6GA 3TU4A 3A6NC 5F99C 4WNNB 5AVBC 3KXBC 5GT3D 3W97B 5AV9C 4KGCD 4KHAA 5KDMA 2CV5B 1R4VA 5AV9B 3EPJA 1H3OA 1ZLAD 5B33D 3MGQA 4H9NB 3LJAB 2DF4C 3AZJC 5CPKC 3AZMA 1P3FD 1AOIB 1KX3A 1EQZD 3EPHA 5CP6A 1ID3A 3AFAB 3EPKA 3UTAA 2ZY3A 4ZBJC 1P3KC 3UTBC 3IP4C 3W98D 1F66A 1TZYA 3UTBB 3AZJD 3WTPA 5GXQC 3AZIC 3WA9C 1ZLAC 1P34B 1BH8A 5BNXA 3C1CA 3C1CC 2FJ7D 4KGCC 3C1BB 4J8VD 4CSRB 3X1UC 3KXBA 5E5AA 4LD9B 5F99D 3A6ND 3A6NA 1S32A 4JJNC 4EO5B 4J8WD 4WV4B 3KWQD 5B24C 4J8UB 1T3UA 2F2AC 1P34D 1S32B 5B0YA 1Q9CA 3AYWD 1KU5A 2F8NA 3REHB 2HIOD 1P3GD 3X1SC 1ULYA 3MGQB 1BH9A 4Z5TB 3AZND 3AL0C 5GT0D 3AZHC 5CPJC 1P3MA 1N1JB 4R8PA 1F66C 4NFTA 1P3GC 5B31B 5CPIB 2IO5C 2Y2KA 3AYWC 3MGRD 3REID 4Z66A 3VH5W 3WKJA 4Z66D 5AVCA 4AWLB 2NQBD 5GXQB 1KX3C 3UTAB 5FUGA 4H9PB 3WTPD 1KX3B 4J8WA 2G5IC 2XD5A 3X1UD 3W96B 3LJAA 1WWIA 4KGCA 3REKD 1AOIA 3C1CD 1P3PC 4J8VA 1ZLAA 5B40A 4CAYB 5GXQA 5GSUD 5GXQD 3AZEC 5JA4A 1P3AC 3B6GC 3WKJB 3W98C 3AZEB 1P3AB 3AZKB 3KUYD 5B31A 2BYKB 5BS7C 4KUDC 5AV5B 5AV6C 5B1MB 2DQNC 2HIOA 2UWXA 5CPKD 1HQ3A 3AZHB 5CPJB 3MGQC 3W97C 3REJC 3RELD 5CPIC 3EPLA 3RELA 4NE3A 2FJ7A 3NQUA 3AZLD 5AV9D 4AWLC 5AVBA 3KXBD 4XZQB 5AVBD 5B40D 1P3OA 3O62B 2FFFB 5BNVA 5AVCB 4R8PB 3R45B 5AVCC 1HQ3C 3EG5B 3AV1B 4XUJA 4J8XC 3REKA 3LZ0C 1ID3C 2RVQC 2JCHA 5B31G 3WA9B 3AV1D 3X1VB 5B33A 3X1TD 4EO5C 4J8UA 5B24B 4J8UC 4H9RB 3VH6T 2VQRA 4R8PD 4HGAB 3KUYA 5CP6D 1ID3D 5C3IB 1M19B 3W98B 5E5AB 3MVDC 4LD9A 4LD9D 2J8PA 3A6NB 3AFAD 5CHLB 3AZFD 3UT9A 1B6WA 5DNNC 4Z2MG 3LJAD 5B0ZC 3X1UA 3X1SB 5DNNB 1P3FB 1AOID 1EQZB 2AROA 1P3OC 3B6FA 1M19D 1TAFB 3AV2A 3AV2D 1P3OB 4YM6B 3V9RB 5E5AD 1P3LA 5BNVB 1WWSA 5GSUA 1JFIA 1M18B 5DNMA 2IO5B 1M18C 3AYWB 3AN2D 5B2ID 4NE6A 5B31D 3UTAC 3W99C 3W99D 1P3GA 3H0MC 5JRGC 4H9QB 4H9NA 4J8XB 2NQBB 1P3BD 2NZDB 3AZNA 2ZM5A 4YM6D 3W96C 2Y2IA 5AY8D 4UUZB 2YFWB 5B2IC 3AV1A 1M18D 4ZUXB 2HIOB 2L5AA 3MNNC 2CV5A 4YS3C 5DNMC 5B1MC 3LZ1A 2AROD 5E5AC 4ZUXD 5G49B 3KWQB 3VH6A 1KX5C 3REIA 5C3IC 1M19C 3B6GB 5F99A 2BYMB 2F8NH 1S32C 2HUEC 5AV6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3I C;  5B2J D;  4WU9 A;  5B1L B;  5B0Z B;  3MGS D;  3B6F D;  5GSU B;  3LEL C;  4YM6 A;  3WAA D;  5FUG B;  5CP6 C;  4Z66 B;  1U35 A;  3X1T A;  3B0C W;  1U35 D;  3LEL B;  1M18 A;  4R8P C;  1KX4 C;  3B6F B;  2BYK A;  3AV1 C;  4G92 B;  5JA4 B;  1N1J A;  3WKJ D;  5B40 B;  3LZ0 D;  4QLC B;  3MGS C;  4H9Q A;  2NQB A;  1HQ3 D;  3AZJ A;  3WAA B;  5B0Y B;  4WU8 B;  4YS3 A;  2NZD C;  2F8N B;  3LZ1 D;  1M19 A;  5DNM B;  3AZL C;  4DRA A;  1M1A C;  1P3L D;  3B0D B;  4JJN B;  5DNM D;  3REL C;  5CPI A;  3AZG B;  3KXB B;  3WA9 A;  5DNN A;  3W97 D;  1KX4 A;  5JRG D;  3AZG D;  3AZG A;  5BT1 C;  3W99 A;  1TZY B;  3UTB A;  3X1T B;  1A7W A;  5AVB B;  4XZQ D;  3KUY C;  4WU9 C;  5CP6 B;  2CV5 D;  1ID3 B;  1P3M D;  4NE5 A;  3O62 C;  1P3P D;  5JRG B;  1P3O D;  3AZJ B;  4E45 A;  1KX5 A;  4CSR A;  1AOI C;  3AZF A;  4QLC C;  3W97 A;  5DNN D;  4WU8 C;  2NQB C;  2LY8 A;  3MVD A;  4LD9 C;  3MVD D;  3MGS A;  4X23 B;  3MGR C;  5BT1 D;  3AZG C;  3AZK C;  4J8U D;  5B1L A;  5B1L C;  3VH6 W;  1KX5 B;  3AZM B;  3REH C;  1P3P A;  3X1S D;  3LZ0 A;  1P3L C;  3MGP D;  1H3O B;  4J8W B;  3REJ B;  1TAF A;  3AV2 B;  4J8W C;  1JFI B;  4E44 A;  1P3B B;  2NZD D;  3REI B;  2CWE A;  4ZUX A;  3MGS B;  5B40 C;  1P3F A;  1EQZ A;  4J8V C;  3MGP C;  3REH A;  3REH D;  1P3G B;  5CPI D;  1B67 A;  5B1L D;  3AZN B;  3W98 A;  3AZI D;  1P3K B;  3AZK D;  2F8N K;  5GT0 B;  2F8N G;  5JRG A;  3WAA C;  3AZI B;  1P3K D;  3LEL D;  2JSS A;  5B2J B;  4KUD D;  5B24 A;  5AY8 A;  4WU8 A;  4YS3 B;  4WU8 D;  5B2J C;  3X1V A;  3C1C B;  1P3I D;  1P3I A;  5AV8 B;  3C1B A;  4QLC D;  3B0D C;  5BNX B;  2YFV A;  5AV8 A;  3X1S A;  1P34 A;  2PYO A;  5BO0 A;  2HUE B;  3O62 D;  2F8N D;  4KUD B;  5B1M D;  3B0B A;  4H9S A;  4YS3 D;  3WTP C;  3AZI A;  1U35 B;  1P3M C;  4JJN A;  2CV5 C;  1TZY C;  3REJ A;  5B2J A;  4WU9 D;  3MNN A;  4M6B A;  5B32 A;  4H9R A;  5AY8 C;  4XZQ C;  4YM6 C;  1P3B C;  4Z66 C;  3KUY B;  3REI C;  4WU9 B;  3WAA A;  1HTA A;  5AV6 A;  5B31 C;  5B33 B;  1HQ3 B;  3AZH A;  5CPJ A;  5CPJ D;  5GT0 C;  3AZH D;  3AN2 C;  3AN2 A;  5B2I A;  3AZE A;  1P3A A;  3AZN C;  4KHA B;  5KDM B;  5AV5 A;  1M1A A;  1M1A D;  3MGP A;  3LZ1 B;  4XUJ C;  3LEL A;  5B0Y C;  1ZLA B;  1P3B A;  1P34 C;  3LZ1 C;  4H9O A;  5B24 D;  4XZQ A;  5AV8 C;  4G91 C;  5GT3 B;  3TU4 C;  4CAY A;  4JJN D;  3NQU B;  5B0Z A;  2NZD A;  4H9S C;  1P3P B;  3W96 A;  3NQJ A;  2FJ7 B;  3WKJ C;  2FJ7 C;  3NQJ B;  3AYW A;  4HGA C;  5F99 B;  5AV5 C;  3WA9 D;  5B1M A;  5CPK A;  3UT9 C;  3MVD B;  3AZK A;  1KX4 D;  3X1T C;  1U35 C;  4Z5T C;  1P3M B;  3VH5 T;  3UTB D;  1BFM A;  3MGP B;  2YFW A;  1KX4 B;  3B6F C;  2RVQ D;  4J8X D;  4J8X A;  3AN2 B;  1P3F C;  1EQZ C;  4UUZ A;  4G92 C;  4ZBJ B;  3VH5 A;  4X23 D;  3AZF B;  1S32 D;  3C1B D;  4J8V B;  5B33 C;  4DRB A;  3B0C T;  4WZS B;  1KX5 D;  2PYO D;  5GT3 A;  4G91 B;  5GT3 C;  3MNN B;  4ZUX C;  2PYO C;  4H9O B;  2ARO C;  2PYO B;  2ARO B;  3W99 B;  3MNN D;  3REJ D;  5B32 D;  3C1B C;  3MGQ D;  3X1U B;  4X23 C;  3MGR B;  3W96 D;  3X1V C;  3AZM D;  5B2I B;  2YFV B;  3R45 A;  3UTA D;  3MGR A;  3KSY A;  5AV6 D;  3WTP B;  3UT9 B;  1P3I B;  4Z2M H;  4Z5T D;  3AFA A;  4Z5T A;  1BH9 B;  5AY8 B;  3B6G D;  3AZE D;  1P3A D;  3UT9 D;  5GSU C;  5B32 B;  5AV5 D;  3WTP E;  3AV2 C;  5B32 G;  5BS7 A;  4KUD A;  3REK C;  5AV9 A;  5B0Z D;  5BO0 B;  3LJA C;  3REK B;  4QLC A;  3AZF C;  3AFA C;  1KX3 D;  4XUJ B;  3TU4 D;  5G49 A;  5AV8 D;  3KWQ A;  4WNN A;  1F1E A;  5CPK B;  1BH8 B;  1F66 B;  5B0Y D;  3O62 A;  4XUJ D;  3TU4 B;  1F66 D;  3LZ0 B;  3AZL B;  5GT0 A;  1P3K A;  4KGC B;  2HIO C;  3REL B;  3AZL A;  2BYM A;  4H9P A;  5AVC D;  3AZM C;  3X1V D;  4X23 A;  3KWQ C;  5B32 C;  1M1A B;  3V9R A;  1P3L B;  1TZY D;  3B6G A;  3TU4 A;  3A6N C;  5F99 C;  4WNN B;  5AVB C;  3KXB C;  5GT3 D;  3W97 B;  5AV9 C;  4KGC D;  4KHA A;  5KDM A;  2CV5 B;  1R4V A;  5AV9 B;  1H3O A;  1ZLA D;  5B33 D;  3MGQ A;  4H9N B;  3LJA B;  3AZJ C;  5CPK C;  3AZM A;  1P3F D;  1AOI B;  1KX3 A;  1EQZ D;  5CP6 A;  1ID3 A;  3AFA B;  3UTA A;  4ZBJ C;  1P3K C;  3UTB C;  3W98 D;  1F66 A;  1TZY A;  3UTB B;  3AZJ D;  3WTP A;  5GXQ C;  3AZI C;  3WA9 C;  1ZLA C;  1P34 B;  1BH8 A;  5BNX A;  3C1C A;  3C1C C;  2FJ7 D;  4KGC C;  3C1B B;  4J8V D;  4CSR B;  3X1U C;  3KXB A;  5E5A A;  4LD9 B;  5F99 D;  3A6N D;  3A6N A;  1S32 A;  4JJN C;  4EO5 B;  4J8W D;  4WV4 B;  3KWQ D;  5B24 C;  4J8U B;  1P34 D;  1S32 B;  5B0Y A;  1Q9C A;  3AYW D;  1KU5 A;  2F8N A;  3REH B;  2HIO D;  1P3G D;  3X1S C;  1ULY A;  3MGQ B;  1BH9 A;  4Z5T B;  3AZN D;  5GT0 D;  3AZH C;  5CPJ C;  1P3M A;  1N1J B;  4R8P A;  1F66 C;  4NFT A;  1P3G C;  5B31 B;  5CPI B;  2IO5 C;  3AYW C;  3MGR D;  3REI D;  4Z66 A;  3VH5 W;  3WKJ A;  4Z66 D;  5AVC A;  4AWL B;  2NQB D;  5GXQ B;  1KX3 C;  3UTA B;  5FUG A;  4H9P B;  3WTP D;  1KX3 B;  4J8W A;  3X1U D;  3W96 B;  3LJA A;  1WWI A;  4KGC A;  3REK D;  1AOI A;  3C1C D;  1P3P C;  4J8V A;  1ZLA A;  5B40 A;  4CAY B;  5GXQ A;  5GSU D;  5GXQ D;  3AZE C;  5JA4 A;  1P3A C;  3B6G C;  3WKJ B;  3W98 C;  3AZE B;  1P3A B;  3AZK B;  3KUY D;  5B31 A;  2BYK B;  5BS7 C;  4KUD C;  5AV5 B;  5AV6 C;  5B1M B;  2HIO A;  5CPK D;  1HQ3 A;  3AZH B;  5CPJ B;  3MGQ C;  3W97 C;  3REJ C;  3REL D;  5CPI C;  3REL A;  4NE3 A;  2FJ7 A;  3NQU A;  3AZL D;  5AV9 D;  4AWL C;  5AVB A;  3KXB D;  4XZQ B;  5AVB D;  5B40 D;  1P3O A;  3O62 B;  5BNV A;  5AVC B;  4R8P B;  3R45 B;  5AVC C;  1HQ3 C;  3AV1 B;  4XUJ A;  4J8X C;  3REK A;  3LZ0 C;  1ID3 C;  2RVQ C;  5B31 G;  3WA9 B;  3AV1 D;  3X1V B;  5B33 A;  3X1T D;  4EO5 C;  4J8U A;  5B24 B;  4J8U C;  4H9R B;  3VH6 T;  4R8P D;  4HGA B;  3KUY A;  5CP6 D;  1ID3 D;  5C3I B;  1M19 B;  3W98 B;  5E5A B;  3MVD C;  4LD9 A;  4LD9 D;  3A6N B;  3AFA D;  5CHL B;  3AZF D;  3UT9 A;  1B6W A;  5DNN C;  4Z2M G;  3LJA D;  5B0Z C;  3X1U A;  3X1S B;  5DNN B;  1P3F B;  1AOI D;  1EQZ B;  2ARO A;  1P3O C;  3B6F A;  1M19 D;  1TAF B;  3AV2 A;  3AV2 D;  1P3O B;  4YM6 B;  3V9R B;  5E5A D;  1P3L A;  5BNV B;  1WWS A;  5GSU A;  1JFI A;  1M18 B;  5DNM A;  2IO5 B;  1M18 C;  3AYW B;  3AN2 D;  5B2I D;  4NE6 A;  5B31 D;  3UTA C;  3W99 C;  3W99 D;  1P3G A;  5JRG C;  4H9Q B;  4H9N A;  4J8X B;  2NQB B;  1P3B D;  2NZD B;  3AZN A;  4YM6 D;  3W96 C;  5AY8 D;  3AV1 A;  4UUZ B;  2YFW B;  5B2I C;  1M18 D;  4ZUX B;  2HIO B;  2L5A A;  3MNN C;  2CV5 A;  4YS3 C;  5DNM C;  5B1M C;  3LZ1 A;  2ARO D;  5E5A C;  4ZUX D;  5G49 B;  3KWQ B;  3VH6 A;  1KX5 C;  3REI A;  5C3I C;  1M19 C;  3B6G B;  5F99 A;  2BYM B;  2F8N H;  1S32 C;  2HUE C;  5AV6 B; 
#chains in the Genus database with same CATH topology
 1P3I C;  5B2J D;  4WU9 A;  5B1L B;  5B0Z B;  3MGS D;  3B6F D;  5GSU B;  2Y2O A;  3LEL C;  4YM6 A;  3WAA D;  3KFU G;  5FUG B;  5CP6 C;  4Z66 B;  1U35 A;  3X1T A;  3B0C W;  1U35 D;  3LEL B;  1M18 A;  4R8P C;  1KX4 C;  3B6F B;  2BYK A;  2W8S A;  3AV1 C;  4G92 B;  3H0L C;  5JA4 B;  2Y2N A;  1N1J A;  3WKJ D;  5B40 B;  3LZ0 D;  4QLC B;  3MGS C;  4H9Q A;  2NQB A;  2Y2G A;  1HQ3 D;  3AZJ A;  3WAA B;  5B0Y B;  4WU8 B;  4YS3 A;  2NZD C;  2F8N B;  2G5H C;  3LZ1 D;  1M19 A;  2Y2J A;  5DNM B;  2ZY5 A;  3AZL C;  4DRA A;  1M1A C;  1P3L D;  3B0D B;  3A1K A;  4JJN B;  5DNM D;  3P5J B;  3REL C;  5CPI A;  3AZG B;  3KXB B;  3WA9 A;  5DNN A;  3W97 D;  2ZY2 A;  1KX4 A;  5JRG D;  3AZG D;  3AZG A;  5BT1 C;  3W99 A;  1TZY B;  3UTB A;  3X1T B;  1A7W A;  5AVB B;  4XZQ D;  3KUY C;  4WU9 C;  5CP6 B;  2CV5 D;  1ID3 B;  1P3M D;  4NE5 A;  3O62 C;  4UPK A;  5JRG B;  1P3P D;  2Y2L A;  1P3O D;  3AZJ B;  4E45 A;  1KX5 A;  4CSR A;  1AOI C;  3AZF A;  4QLC C;  3W97 A;  5DNN D;  2RIQ A;  4WU8 C;  2NQB C;  2LY8 A;  3MVD A;  4LD9 C;  3MVD D;  3MGS A;  4X23 B;  3MGR C;  3H0R C;  5BT1 D;  3AZG C;  3AZK C;  1Z2C B;  4J8U D;  5B1L A;  5B1L C;  3VH6 W;  1KX5 B;  3A1I A;  3AZM B;  3REH C;  1P3P A;  3X1S D;  3LZ0 A;  1P3L C;  3MGP D;  1H3O B;  4J8W B;  3REJ B;  2Y2M A;  1TAF A;  3AV2 B;  4J8W C;  1JFI B;  4E44 A;  1P3B B;  2NZD D;  3REI B;  2CWE A;  4ZUX A;  1W2E A;  3MGS B;  5B40 C;  1P3F A;  1EQZ A;  4J8V C;  3MGP C;  3REH A;  2XD1 A;  3REH D;  1P3G B;  5CPI D;  1B67 A;  5B1L D;  3AZN B;  3W98 A;  3AZI D;  1P3K B;  3AZK D;  2F8N K;  5GT0 B;  2F8N G;  5JRG A;  3WAA C;  3AZI B;  1P3K D;  3LEL D;  2JSS A;  5B2J B;  4KUD D;  5B24 A;  5AY8 A;  4WU8 A;  4YS3 B;  4WU8 D;  5B2J C;  3X1V A;  3C1C B;  1P3I D;  1P3I A;  5AV8 B;  3C1B A;  4QLC D;  3B0D C;  5BNX B;  2YFV A;  5AV8 A;  3X1S A;  1P34 A;  2PYO A;  5BO0 A;  2HUE B;  3O62 D;  2F8N D;  4KUD B;  5B1M D;  3B0B A;  4H9S A;  4YS3 D;  3WTP C;  3AZI A;  1U35 B;  1P3M C;  4JJN A;  2CV5 C;  1TZY C;  3REJ A;  4WJ3 C;  5B2J A;  4WU9 D;  3MNN A;  2Y2P A;  4M6B A;  5B32 A;  4H9R A;  5AY8 C;  4XZQ C;  4YM6 C;  1P3B C;  4Z66 C;  3KUY B;  3REI C;  4WU9 B;  3WAA A;  1HTA A;  5AV6 A;  5B31 C;  5B33 B;  1HQ3 B;  3AZH A;  5CPJ A;  5CPJ D;  5GT0 C;  3AZH D;  3AN2 C;  3AN2 A;  5B2I A;  3AZE A;  1P3A A;  3AZN C;  4KHA B;  5KDM B;  5AV5 A;  1M1A A;  1M1A D;  3MGP A;  3LZ1 B;  4XUJ C;  3LEL A;  5B0Y C;  1ZLA B;  1P3B A;  1P34 C;  2BG1 A;  3LZ1 C;  4H9O A;  5B24 D;  4XZQ A;  5AV8 C;  4G91 C;  5GT3 B;  3TU4 C;  4CAY A;  4JJN D;  3NQU B;  5B0Z A;  2NZD A;  4H9S C;  1P3P B;  3W96 A;  3NQJ A;  2FJ7 B;  2Y2H A;  2ZY4 A;  3WKJ C;  2FJ7 C;  3NQJ B;  3AYW A;  4HGA C;  5F99 B;  5AV5 C;  3F6T A;  3WA9 D;  5B1M A;  5CPK A;  3UT9 C;  3MVD B;  3AZK A;  1KX4 D;  3X1T C;  1U35 C;  4Z5T C;  1P3M B;  3VH5 T;  3UTB D;  1BFM A;  3MGP B;  2YFW A;  1KX4 B;  3B6F C;  2RVQ D;  4J8X D;  4J8X A;  3AN2 B;  1P3F C;  1EQZ C;  4UUZ A;  4G92 C;  4ZBJ B;  3VH5 A;  4X23 D;  3AZF B;  2Y2Q A;  1S32 D;  3C1B D;  4J8V B;  5B33 C;  4DRB A;  4DQY B;  3B0C T;  4WZS B;  1KX5 D;  2PYO D;  5GT3 A;  4G91 B;  5GT3 C;  4ZUX C;  3MNN B;  2PYO C;  4H9O B;  2ARO C;  2PYO B;  2ARO B;  3W99 B;  1PZR A;  3MNN D;  3REJ D;  5B32 D;  3C1B C;  3MGQ D;  3X1U B;  4X23 C;  3MGR B;  3W96 D;  3X1V C;  3AZM D;  5B2I B;  2YFV B;  3R45 A;  3UTA D;  3MGR A;  3KSY A;  5AV6 D;  3WTP B;  3UT9 B;  2JE5 A;  1P3I B;  4Z2M H;  4Z5T D;  3AFA A;  4Z5T A;  1BH9 B;  5AY8 B;  3B6G D;  3AZE D;  1P3A D;  3UT9 D;  5GSU C;  5B32 B;  5AV5 D;  3WTP E;  3AV2 C;  5B32 G;  5BS7 A;  4KUD A;  3REK C;  5AV9 A;  5B0Z D;  5BO0 B;  3LJA C;  3REK B;  4QLC A;  3AZF C;  3AFA C;  1KX3 D;  4XUJ B;  3TU4 D;  5G49 A;  5AV8 D;  3KWQ A;  4WNN A;  1F1E A;  5CPK B;  1BH8 B;  1F66 B;  5B0Y D;  3O62 A;  4XUJ D;  3TU4 B;  1F66 D;  3FDD A;  3LZ0 B;  3AZL B;  5GT0 A;  1P3K A;  4KGC B;  2HIO C;  3REL B;  3AZL A;  2BYM A;  4H9P A;  5AVC D;  3AZM C;  3X1V D;  4X23 A;  3KWQ C;  5B32 C;  1M1A B;  3V9R A;  1P3L B;  1TZY D;  3B6G A;  3TU4 A;  3A6N C;  5F99 C;  4WNN B;  5AVB C;  3KXB C;  5GT3 D;  3W97 B;  5AV9 C;  4KGC D;  4KHA A;  5KDM A;  2CV5 B;  1R4V A;  5AV9 B;  3EPJ A;  1H3O A;  1ZLA D;  5B33 D;  3MGQ A;  4H9N B;  3LJA B;  2DF4 C;  3AZJ C;  5CPK C;  3AZM A;  1P3F D;  1AOI B;  1KX3 A;  1EQZ D;  3EPH A;  5CP6 A;  1ID3 A;  3AFA B;  3EPK A;  3UTA A;  2ZY3 A;  4ZBJ C;  1P3K C;  3UTB C;  3IP4 C;  3W98 D;  1F66 A;  1TZY A;  3UTB B;  3AZJ D;  3WTP A;  5GXQ C;  3AZI C;  3WA9 C;  1ZLA C;  1P34 B;  1BH8 A;  5BNX A;  3C1C A;  3C1C C;  2FJ7 D;  4KGC C;  3C1B B;  4J8V D;  4CSR B;  3X1U C;  3KXB A;  5E5A A;  4LD9 B;  5F99 D;  3A6N D;  3A6N A;  1S32 A;  4JJN C;  4EO5 B;  4J8W D;  4WV4 B;  3KWQ D;  5B24 C;  4J8U B;  1T3U A;  2F2A C;  1P34 D;  1S32 B;  5B0Y A;  1Q9C A;  3AYW D;  1KU5 A;  2F8N A;  3REH B;  2HIO D;  1P3G D;  3X1S C;  1ULY A;  3MGQ B;  1BH9 A;  4Z5T B;  3AZN D;  3AL0 C;  5GT0 D;  3AZH C;  5CPJ C;  1P3M A;  1N1J B;  4R8P A;  1F66 C;  4NFT A;  1P3G C;  5B31 B;  5CPI B;  2IO5 C;  2Y2K A;  3AYW C;  3MGR D;  3REI D;  4Z66 A;  3VH5 W;  3WKJ A;  4Z66 D;  5AVC A;  4AWL B;  2NQB D;  5GXQ B;  1KX3 C;  3UTA B;  5FUG A;  4H9P B;  3WTP D;  1KX3 B;  4J8W A;  2G5I C;  2XD5 A;  3X1U D;  3W96 B;  3LJA A;  1WWI A;  4KGC A;  3REK D;  1AOI A;  3C1C D;  1P3P C;  4J8V A;  1ZLA A;  5B40 A;  4CAY B;  5GXQ A;  5GSU D;  5GXQ D;  3AZE C;  5JA4 A;  1P3A C;  3B6G C;  3WKJ B;  3W98 C;  3AZE B;  1P3A B;  3AZK B;  3KUY D;  5B31 A;  2BYK B;  5BS7 C;  4KUD C;  5AV5 B;  5AV6 C;  5B1M B;  2DQN C;  2HIO A;  2UWX A;  5CPK D;  1HQ3 A;  3AZH B;  5CPJ B;  3MGQ C;  3W97 C;  3REJ C;  3REL D;  5CPI C;  3EPL A;  3REL A;  4NE3 A;  2FJ7 A;  3NQU A;  3AZL D;  5AV9 D;  4AWL C;  5AVB A;  3KXB D;  4XZQ B;  5AVB D;  5B40 D;  1P3O A;  3O62 B;  2FFF B;  5BNV A;  5AVC B;  4R8P B;  3R45 B;  5AVC C;  1HQ3 C;  3EG5 B;  3AV1 B;  4XUJ A;  4J8X C;  3REK A;  3LZ0 C;  1ID3 C;  2RVQ C;  2JCH A;  5B31 G;  3WA9 B;  3AV1 D;  3X1V B;  5B33 A;  3X1T D;  4EO5 C;  4J8U A;  5B24 B;  4J8U C;  4H9R B;  3VH6 T;  2VQR A;  4R8P D;  4HGA B;  3KUY A;  5CP6 D;  1ID3 D;  5C3I B;  1M19 B;  3W98 B;  5E5A B;  3MVD C;  4LD9 A;  4LD9 D;  2J8P A;  3A6N B;  3AFA D;  5CHL B;  3AZF D;  3UT9 A;  1B6W A;  5DNN C;  4Z2M G;  3LJA D;  5B0Z C;  3X1U A;  3X1S B;  5DNN B;  1P3F B;  1AOI D;  1EQZ B;  2ARO A;  1P3O C;  3B6F A;  1M19 D;  1TAF B;  3AV2 A;  3AV2 D;  1P3O B;  4YM6 B;  3V9R B;  5E5A D;  1P3L A;  5BNV B;  1WWS A;  5GSU A;  1JFI A;  1M18 B;  5DNM A;  2IO5 B;  1M18 C;  3AYW B;  3AN2 D;  5B2I D;  4NE6 A;  5B31 D;  3UTA C;  3W99 C;  3W99 D;  1P3G A;  3H0M C;  5JRG C;  4H9Q B;  4H9N A;  4J8X B;  2NQB B;  1P3B D;  2NZD B;  3AZN A;  2ZM5 A;  4YM6 D;  3W96 C;  2Y2I A;  5AY8 D;  4UUZ B;  2YFW B;  5B2I C;  3AV1 A;  1M18 D;  4ZUX B;  2HIO B;  2L5A A;  3MNN C;  2CV5 A;  4YS3 C;  5DNM C;  5B1M C;  3LZ1 A;  2ARO D;  5E5A C;  4ZUX D;  5G49 B;  3KWQ B;  3VH6 A;  1KX5 C;  3REI A;  5C3I C;  1M19 C;  3B6G B;  5F99 A;  2BYM B;  2F8N H;  1S32 C;  2HUE C;  5AV6 B; 
#chains in the Genus database with same CATH homology
 1P3I C;  5B2J D;  4WU9 A;  5B1L B;  5B0Z B;  3MGS D;  3B6F D;  5GSU B;  2Y2O A;  3LEL C;  4YM6 A;  3WAA D;  3KFU G;  5FUG B;  5CP6 C;  4Z66 B;  1U35 A;  3X1T A;  3B0C W;  1U35 D;  3LEL B;  1M18 A;  4R8P C;  1KX4 C;  3B6F B;  2BYK A;  2W8S A;  3AV1 C;  4G92 B;  3H0L C;  5JA4 B;  2Y2N A;  1N1J A;  3WKJ D;  5B40 B;  3LZ0 D;  4QLC B;  3MGS C;  4H9Q A;  2NQB A;  2Y2G A;  1HQ3 D;  3AZJ A;  3WAA B;  5B0Y B;  4WU8 B;  4YS3 A;  2NZD C;  2F8N B;  2G5H C;  3LZ1 D;  1M19 A;  2Y2J A;  5DNM B;  2ZY5 A;  3AZL C;  4DRA A;  1M1A C;  1P3L D;  3B0D B;  3A1K A;  4JJN B;  5DNM D;  3P5J B;  3REL C;  5CPI A;  3AZG B;  3KXB B;  3WA9 A;  5DNN A;  3W97 D;  2ZY2 A;  1KX4 A;  5JRG D;  3AZG D;  3AZG A;  5BT1 C;  3W99 A;  1TZY B;  3UTB A;  3X1T B;  1A7W A;  5AVB B;  4XZQ D;  3KUY C;  4WU9 C;  5CP6 B;  2CV5 D;  1ID3 B;  1P3M D;  4NE5 A;  3O62 C;  4UPK A;  5JRG B;  1P3P D;  2Y2L A;  1P3O D;  3AZJ B;  4E45 A;  1KX5 A;  4CSR A;  1AOI C;  3AZF A;  4QLC C;  3W97 A;  5DNN D;  2RIQ A;  4WU8 C;  2NQB C;  2LY8 A;  3MVD A;  4LD9 C;  3MVD D;  3MGS A;  4X23 B;  3MGR C;  3H0R C;  5BT1 D;  3AZG C;  3AZK C;  1Z2C B;  4J8U D;  5B1L A;  5B1L C;  3VH6 W;  1KX5 B;  3A1I A;  3AZM B;  3REH C;  1P3P A;  3X1S D;  3LZ0 A;  1P3L C;  3MGP D;  1H3O B;  4J8W B;  3REJ B;  2Y2M A;  1TAF A;  3AV2 B;  4J8W C;  1JFI B;  4E44 A;  1P3B B;  2NZD D;  3REI B;  2CWE A;  4ZUX A;  1W2E A;  3MGS B;  5B40 C;  1P3F A;  1EQZ A;  4J8V C;  3MGP C;  3REH A;  2XD1 A;  3REH D;  1P3G B;  5CPI D;  1B67 A;  5B1L D;  3AZN B;  3W98 A;  3AZI D;  1P3K B;  3AZK D;  2F8N K;  5GT0 B;  2F8N G;  5JRG A;  3WAA C;  3AZI B;  1P3K D;  3LEL D;  2JSS A;  5B2J B;  4KUD D;  5B24 A;  5AY8 A;  4WU8 A;  4YS3 B;  4WU8 D;  5B2J C;  3X1V A;  3C1C B;  1P3I D;  1P3I A;  5AV8 B;  3C1B A;  4QLC D;  3B0D C;  5BNX B;  2YFV A;  5AV8 A;  3X1S A;  1P34 A;  2PYO A;  5BO0 A;  2HUE B;  3O62 D;  2F8N D;  4KUD B;  5B1M D;  3B0B A;  4H9S A;  4YS3 D;  3WTP C;  3AZI A;  1U35 B;  1P3M C;  4JJN A;  2CV5 C;  1TZY C;  3REJ A;  4WJ3 C;  5B2J A;  4WU9 D;  3MNN A;  2Y2P A;  4M6B A;  5B32 A;  4H9R A;  5AY8 C;  4XZQ C;  4YM6 C;  1P3B C;  4Z66 C;  3KUY B;  3REI C;  4WU9 B;  3WAA A;  1HTA A;  5AV6 A;  5B31 C;  5B33 B;  1HQ3 B;  3AZH A;  5CPJ A;  5CPJ D;  5GT0 C;  3AZH D;  3AN2 C;  3AN2 A;  5B2I A;  3AZE A;  1P3A A;  3AZN C;  4KHA B;  5KDM B;  5AV5 A;  1M1A A;  1M1A D;  3MGP A;  3LZ1 B;  4XUJ C;  3LEL A;  5B0Y C;  1ZLA B;  1P3B A;  1P34 C;  2BG1 A;  3LZ1 C;  4H9O A;  5B24 D;  4XZQ A;  5AV8 C;  4G91 C;  5GT3 B;  3TU4 C;  4CAY A;  4JJN D;  3NQU B;  5B0Z A;  2NZD A;  4H9S C;  1P3P B;  3W96 A;  3NQJ A;  2FJ7 B;  2Y2H A;  2ZY4 A;  3WKJ C;  2FJ7 C;  3NQJ B;  3AYW A;  4HGA C;  5F99 B;  5AV5 C;  3F6T A;  3WA9 D;  5B1M A;  5CPK A;  3UT9 C;  3MVD B;  3AZK A;  1KX4 D;  3X1T C;  1U35 C;  4Z5T C;  1P3M B;  3VH5 T;  3UTB D;  1BFM A;  3MGP B;  2YFW A;  1KX4 B;  3B6F C;  2RVQ D;  4J8X D;  4J8X A;  3AN2 B;  1P3F C;  1EQZ C;  4UUZ A;  4G92 C;  4ZBJ B;  3VH5 A;  4X23 D;  3AZF B;  2Y2Q A;  1S32 D;  3C1B D;  4J8V B;  5B33 C;  4DRB A;  4DQY B;  3B0C T;  4WZS B;  1KX5 D;  2PYO D;  5GT3 A;  4G91 B;  5GT3 C;  4ZUX C;  3MNN B;  2PYO C;  4H9O B;  2ARO C;  2PYO B;  2ARO B;  3W99 B;  1PZR A;  3MNN D;  3REJ D;  5B32 D;  3C1B C;  3MGQ D;  3X1U B;  4X23 C;  3MGR B;  3W96 D;  3X1V C;  3AZM D;  5B2I B;  2YFV B;  3R45 A;  3UTA D;  3MGR A;  3KSY A;  5AV6 D;  3WTP B;  3UT9 B;  2JE5 A;  1P3I B;  4Z2M H;  4Z5T D;  3AFA A;  4Z5T A;  1BH9 B;  5AY8 B;  3B6G D;  3AZE D;  1P3A D;  3UT9 D;  5GSU C;  5B32 B;  5AV5 D;  3WTP E;  3AV2 C;  5B32 G;  5BS7 A;  4KUD A;  3REK C;  5AV9 A;  5B0Z D;  5BO0 B;  3LJA C;  3REK B;  4QLC A;  3AZF C;  3AFA C;  1KX3 D;  4XUJ B;  3TU4 D;  5G49 A;  5AV8 D;  3KWQ A;  4WNN A;  1F1E A;  5CPK B;  1BH8 B;  1F66 B;  5B0Y D;  3O62 A;  4XUJ D;  3TU4 B;  1F66 D;  3FDD A;  3LZ0 B;  3AZL B;  5GT0 A;  1P3K A;  4KGC B;  2HIO C;  3REL B;  3AZL A;  2BYM A;  4H9P A;  5AVC D;  3AZM C;  3X1V D;  4X23 A;  3KWQ C;  5B32 C;  1M1A B;  3V9R A;  1P3L B;  1TZY D;  3B6G A;  3TU4 A;  3A6N C;  5F99 C;  4WNN B;  5AVB C;  3KXB C;  5GT3 D;  3W97 B;  5AV9 C;  4KGC D;  4KHA A;  5KDM A;  2CV5 B;  1R4V A;  5AV9 B;  3EPJ A;  1H3O A;  1ZLA D;  5B33 D;  3MGQ A;  4H9N B;  3LJA B;  2DF4 C;  3AZJ C;  5CPK C;  3AZM A;  1P3F D;  1AOI B;  1KX3 A;  1EQZ D;  3EPH A;  5CP6 A;  1ID3 A;  3AFA B;  3EPK A;  3UTA A;  2ZY3 A;  4ZBJ C;  1P3K C;  3UTB C;  3IP4 C;  3W98 D;  1F66 A;  1TZY A;  3UTB B;  3AZJ D;  3WTP A;  5GXQ C;  3AZI C;  3WA9 C;  1ZLA C;  1P34 B;  1BH8 A;  5BNX A;  3C1C A;  3C1C C;  2FJ7 D;  4KGC C;  3C1B B;  4J8V D;  4CSR B;  3X1U C;  3KXB A;  5E5A A;  4LD9 B;  5F99 D;  3A6N D;  3A6N A;  1S32 A;  4JJN C;  4EO5 B;  4J8W D;  4WV4 B;  3KWQ D;  5B24 C;  4J8U B;  1T3U A;  2F2A C;  1P34 D;  1S32 B;  5B0Y A;  1Q9C A;  3AYW D;  1KU5 A;  2F8N A;  3REH B;  2HIO D;  1P3G D;  3X1S C;  1ULY A;  3MGQ B;  1BH9 A;  4Z5T B;  3AZN D;  3AL0 C;  5GT0 D;  3AZH C;  5CPJ C;  1P3M A;  1N1J B;  4R8P A;  1F66 C;  4NFT A;  1P3G C;  5B31 B;  5CPI B;  2IO5 C;  2Y2K A;  3AYW C;  3MGR D;  3REI D;  4Z66 A;  3VH5 W;  3WKJ A;  4Z66 D;  5AVC A;  4AWL B;  2NQB D;  5GXQ B;  1KX3 C;  3UTA B;  5FUG A;  4H9P B;  3WTP D;  1KX3 B;  4J8W A;  2G5I C;  2XD5 A;  3X1U D;  3W96 B;  3LJA A;  1WWI A;  4KGC A;  3REK D;  1AOI A;  3C1C D;  1P3P C;  4J8V A;  1ZLA A;  5B40 A;  4CAY B;  5GXQ A;  5GSU D;  5GXQ D;  3AZE C;  5JA4 A;  1P3A C;  3B6G C;  3WKJ B;  3W98 C;  3AZE B;  1P3A B;  3AZK B;  3KUY D;  5B31 A;  2BYK B;  5BS7 C;  4KUD C;  5AV5 B;  5AV6 C;  5B1M B;  2DQN C;  2HIO A;  2UWX A;  5CPK D;  1HQ3 A;  3AZH B;  5CPJ B;  3MGQ C;  3W97 C;  3REJ C;  3REL D;  5CPI C;  3EPL A;  3REL A;  4NE3 A;  2FJ7 A;  3NQU A;  3AZL D;  5AV9 D;  4AWL C;  5AVB A;  3KXB D;  4XZQ B;  5AVB D;  5B40 D;  1P3O A;  3O62 B;  2FFF B;  5BNV A;  5AVC B;  4R8P B;  3R45 B;  5AVC C;  1HQ3 C;  3EG5 B;  3AV1 B;  4XUJ A;  4J8X C;  3REK A;  3LZ0 C;  1ID3 C;  2RVQ C;  2JCH A;  5B31 G;  3WA9 B;  3AV1 D;  3X1V B;  5B33 A;  3X1T D;  4EO5 C;  4J8U A;  5B24 B;  4J8U C;  4H9R B;  3VH6 T;  2VQR A;  4R8P D;  4HGA B;  3KUY A;  5CP6 D;  1ID3 D;  5C3I B;  1M19 B;  3W98 B;  5E5A B;  3MVD C;  4LD9 A;  4LD9 D;  2J8P A;  3A6N B;  3AFA D;  5CHL B;  3AZF D;  3UT9 A;  1B6W A;  5DNN C;  4Z2M G;  3LJA D;  5B0Z C;  3X1U A;  3X1S B;  5DNN B;  1P3F B;  1AOI D;  1EQZ B;  2ARO A;  1P3O C;  3B6F A;  1M19 D;  1TAF B;  3AV2 A;  3AV2 D;  1P3O B;  4YM6 B;  3V9R B;  5E5A D;  1P3L A;  5BNV B;  1WWS A;  5GSU A;  1JFI A;  1M18 B;  5DNM A;  2IO5 B;  1M18 C;  3AYW B;  3AN2 D;  5B2I D;  4NE6 A;  5B31 D;  3UTA C;  3W99 C;  3W99 D;  1P3G A;  3H0M C;  5JRG C;  4H9Q B;  4H9N A;  4J8X B;  2NQB B;  1P3B D;  2NZD B;  3AZN A;  2ZM5 A;  4YM6 D;  3W96 C;  2Y2I A;  5AY8 D;  4UUZ B;  2YFW B;  5B2I C;  3AV1 A;  1M18 D;  4ZUX B;  2HIO B;  2L5A A;  3MNN C;  2CV5 A;  4YS3 C;  5DNM C;  5B1M C;  3LZ1 A;  2ARO D;  5E5A C;  4ZUX D;  5G49 B;  3KWQ B;  3VH6 A;  1KX5 C;  3REI A;  5C3I C;  1M19 C;  3B6G B;  5F99 A;  2BYM B;  2F8N H;  1S32 C;  2HUE C;  5AV6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...