5AV5C

Human nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
b'KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av5C00
5AV9A 3A6NC 4ZUXA 5B1LB 5E5AB 4H9RB 3UT9A 1P3BB 3RELD 4J8WC 1M19B 4J8VB 3LJAC 3X1TA 5BNVB 1P3IB 1TAFB 3LJAD 1P3AD 4EO5C 2F8NK 3TU4C 3LZ0C 1HQ3D 1KX3C 2PYOD 5FUGB 4KGCC 3AZGC 3LZ0D 1P3PC 4R8PC 5KDMA 1EQZC 4H9QB 5AVCC 4R8PD 3B0CW 2JSSA 1WWSA 5G49B 5B24C 5B0YC 5AY8C 3REIA 3C1BC 3AZIA 3AZJB 1S32D 3AZFC 5DNMA 3KUYC 3WTPB 5B1MA 3AYWA 4Z66B 5BT1C 1P3KB 4H9NB 5JRGB 3KXBD 3REJC 3RELA 3REKA 5AV5B 5JA4B 3X1VD 4H9SC 5B33B 4WZSB 1P3AA 3VH6T 5DNNC 3AZMD 1HQ3A 2PYOA 4H9OA 5DNND 5GT0B 3W98B 2YFWA 4G92C 5CPID 2NQBC 3C1CD 1ZLAC 3B0CT 2BYKA 2CWEA 2CV5D 5GXQB 4AWLB 4E44A 4J8XC 1S32A 3WKJC 3WA9B 3UTBB 2LY8A 5AV9B 4ZUXB 3B6FD 4HGAB 4X23D 3MNNC 2F8NH 5GSUC 2HUEC 5CPKC 3KXBA 5BS7A 1P3GC 5AV6C 2YFVA 3X1TB 1P3FA 3X1VA 3MGQC 3NQUA 5CP6D 1ID3C 5B32D 1M18C 3AFAA 3AZMA 1M18D 4KUDD 3AZLA 3X1UD 5KDMB 3AN2A 5CPIA 5B1LA 3W99A 3C1CA 1M19A 3AZHB 3LELD 1B6WA 1B67A 2CV5A 3REHC 1P3OC 3REHD 4YM6A 1P3OD 1AOIC 3B6FA 5FUGA 4X23A 3RELB 4QLCD 3AZNC 2HIOC 3R45A 3LJAB 5CP6A 1P3AB 5B32A 1HQ3B 5G49A 2PYOB 4EO5B 4KUDA 3MVDD 2YFWB 4G91B 4H9PB 3X1UA 4YS3D 3W96C 4UUZA 2AROC 1BH8A 1KX5C 1P3MD 5GT3D 3MGPA 3X1SC 4WNNA 3MGRD 5B2IC 3X1SD 1S32B 4LD9C 5B0ZC 4Z5TC 5BNXA 4Z5TD 3O62C 3KXBB 3W98A 3W97C 2YFVB 2NZDC 4QLCA 3X1VB 3W97D 3KWQC 3UT9C 3AFAB 3AZMB 3AZLB 5DNNB 5B31C 3MVDA 4WU8D 3AN2B 4J8UD 4YS3A 4G92B 5CPIB 3W99B 2RVQC 3C1CB 3WAAC 4CAYA 3A6ND 3MGSC 1BH9A 1P3MA 3LZ1C 3MGSD 3MGRA 1H3OA 4J8WD 3VH6W 2CV5B 4XZQC 3LZ1D 5AV8C 1F66C 4XZQD 4Z2MH 4YM6B 3AZEC 1F66D 3B6FB 4X23B 1BFMA 3TU4D 3B6GC 1KX3D 4KGCD 3REIC 3AZIC 3AZGD 1P3PD 5B40C 3R45B 3AYWC 1U35C 5CP6B 1EQZD 5B32B 5AVCD 3AZHA 4KUDB 5B24D 5B0YD 5AY8D 3X1UB 4WU8A 2F8ND 3C1BD 3AZFD 1P3LC 4UUZB 3KUYD 5CPJC 1BH8B 5B32G 5CPJD 3MGPB 4ZBJC 1KX4C 5BT1D 3A6NA 4WNNB 5C3IB 3LELB 3REJD 4J8WA 3LJAA 3REHB 1P3OB 5BNXB 1M1AC 3NQJB 1TZYC 2IO5C 3TU4A 3AV2C 3LZ0A 1KX3A 4KGCA 4H9PA 3AV2D 3AZGA 1P3PA 4QLCB 1P34C 4R8PA 1P34D 5AVCA 2NQBD 5BS7C 3UTAC 1ZLAD 4XUJC 3MVDB 5B24A 5F99C 5B0YA 5AY8A 1P3FC 4YS3B 4WU9C 2FJ7C 5F99D 2F8NA 3C1BA 4J8XD 5CHLB 3WKJD 3AZFA 3B0DC 2FJ7D 3KUYA 1P3MB 4CAYB 1BH9B 5GT3B 3MNND 5GSUD 3MGRB 1R4VA 1H3OB 5CPKD 3REJA 1P3GD 5AV6D 5E5AC 3MGQD 4H9SA 1ID3D 5AVBC 1P3BC 3V9RA 4Z5TB 4J8VC 5AVBD 5DNNA 1P3IC 1F1EA 2NQBA 1ZLAA 3VH5A 4JJNC 4NE3A 4WU8B 4J8UB 4JJND 4J8XA 4NFTA 1AOID 3A6NB 3MNNA 3AZJC 4J8WB 5CPKA 3WTPC 5AV6A 5B31G 2HIOD 4Z66C 3AZND 1P3KC 3MGQA 1F66B 5JRGC 5B2JC 3TU4B 1M18A 4M6BA 3LZ0B 1KX3B 5AV5C 5B2JD 4KGCB 3AZGB 3AV1C 1P3PB 5B33C 3AV1D 4R8PB 4NE6A 3W96D 1EQZB 5AVCB 2AROD 1KX5D 5GT0C 2NZDA 3LELA 5B24B 4WV4B 5B0YB 5AY8B 5B2ID 2F8NB 3C1BB 3AZFB 4LD9D 3KUYB 3REHA 1P3OA 3NQJA 5B0ZD 5CPJB 3AZKC 5GXQC 4AWLC 3O62D 3REJB 3WA9C 3UTBC 3AZKD 5AV9C 4ZUXC 2F8NG 4HGAC 2NZDD 2HIOA 3KWQD 3V9RB 3UT9D 3X1TC 1KU5A 5B31D 4NE5A 3W96A 5GT3A 3B0BA 2AROA 2NQBB 2RVQD 1KX5A 1ZLAB 3WAAD 5BO0B 3X1SA 5F99B 4J8XB 3WKJB 5AV8D 4LD9A 5B0ZA 3AZHC 3B0DB 4Z5TA 3AZED 3MNNB 5GSUB 2HUEB 3B6GD 5DNMC 3REID 5CPKB 3O62A 4CSRA 3AZID 5AV6B 1P3GB 3W97A 5B1MC 5B40D 5DNMD 5B1MD 3AYWD 3MGQB 1U35D 3KWQA 1ID3B 3RELC 1M18B 2BYMA 4KHAA 3REKC 5AVBB 3VH6A 4E45A 3REKD 4J8UA 5B31A 1P3AC 1P3LD 1HQ3C 2PYOC 1N1JA 4G91C 1KX4D 3WAAA 3MGSA 3LZ1A 4JJNB 4XZQA 4DRBA 5AV8A 1F66A 1M1AD 1AOIB 1TZYD 3AZEA 1S32C 3B6GA 5B40A 1EQZA 3AZNB 2HIOB 1U35A 3KXBC 1JFIA 5B2JB 3UTAD 4XUJD 3X1VC 1Q9CA 1P3FD 3AV1B 4WU9D 3W96B 3AFAC 3AZMC 1P3LA 5CPJA 2AROB 3AZLC 3AFAD 1KX5B 3AN2C 3AZLD 1KX4A 3X1SB 3AN2D 5B2IB 5CPIC 5B1LC 3W99C 3C1CC 4LD9B 5B1LD 5B0ZB 3W99D 5E5AD 1M19C 1M1AA 1P3BD 1M19D 1TZYA 2CV5C 4J8VD 3AV2A 3O62B 4CSRB 3AZKB 3W97B 4Z2MG 4YM6C 1P3ID 3B6FC 2NZDB 4X23C 4YM6D 3KWQB 1P34A 2BYMB 4KHAB 3UT9B 5BO0A 3UTAA 5B31B 4XUJA 3VH5W 5F99A 5CP6C 5B32C 3WKJA 4WU9A 2FJ7A 4KUDC 1N1JB 3X1UC 5GSUA 3WAAB 3MGSB 3AZJD 1P3GA 3LZ1B 3WTPD 3KSYA 4XZQB 5AV8B 3MGPC 4Z66D 1ID3A 1P3KD 5C3IC 5E5AA 3AZEB 4H9RA 5JRGD 3LELC 5AVBA 3MGPD 1P3BA 4J8VA 3B6GB 5AV5D 3REIB 3AZIB 5B40B 5BNVA 5DNMB 5B33D 1P3IA 1TAFA 4DRAA 1ULYA 5B1MB 3AYWB 1U35B 3W98C 1JFIB 5GT0D 3W98D 4QLCC 3REKB 4JJNA 4H9QA 1P3LB 3VH5T 1AOIA 3MVDC 1KX4B 4ZBJB 4H9OB 3WTPE 4YS3C 5GXQD 3AZJA 3WA9D 3UTBD 3AZNA 3WTPA 5AV9D 1P3MC 4ZUXD 5GT3C 4Z66A 1P3KA 1M1AB 3MGRC 1HTAA 1TZYB 4H9NA 5JRGA 5B2JA 2IO5B 3AV2B 2BYKB 5AV5A 3X1TD 5JA4A 3AV1A 5B33A 1P34B 1WWIA 5GT0A 3UTAB 4XUJB 5B2IA 1P3FB 4WU9B 2FJ7B 3NQUB 1A7WA 3AZHD 4WU8C 4J8UC 3AZKA 2L5AA 5GXQA 3WA9A 3UTBA
chains in the Genus database with same CATH superfamily
5AV9A 3A6NC 4ZUXA 5B1LB 5E5AB 4H9RB 3UT9A 1P3BB 3RELD 4J8WC 1M19B 4J8VB 3LJAC 3X1TA 5BNVB 1P3IB 1TAFB 3LJAD 2FFFB 1P3AD 4EO5C 2F8NK 3TU4C 3LZ0C 1HQ3D 1KX3C 2PYOD 5FUGB 4KGCC 3AZGC 2UWXA 3LZ0D 1P3PC 4R8PC 5KDMA 1EQZC 4H9QB 5AVCC 4R8PD 3B0CW 2JSSA 1WWSA 5G49B 5B24C 5B0YC 5AY8C 3REIA 3C1BC 3AZIA 3AZJB 1S32D 3AZFC 5DNMA 3KUYC 3WTPB 5B1MA 3AYWA 4Z66B 5BT1C 1P3KB 4H9NB 5JRGB 3KXBD 3REJC 3RELA 3REKA 5AV5B 5JA4B 3X1VD 4H9SC 5B33B 3EPHA 4WZSB 1P3AA 3VH6T 5DNNC 3AZMD 1HQ3A 2PYOA 3AL0C 4H9OA 5DNND 5GT0B 3W98B 2YFWA 4G92C 5CPID 2NQBC 3C1CD 1ZLAC 4DQYB 3B0CT 2BYKA 1T3UA 2CWEA 5GXQB 1W2EA 4AWLB 4E44A 4J8XC 2CV5D 1S32A 3WKJC 3WA9B 3UTBB 2LY8A 5AV9B 4ZUXB 3B6FD 4HGAB 4X23D 3MNNC 2F8NH 5GSUC 2HUEC 5CPKC 3KXBA 5BS7A 1P3GC 5AV6C 2YFVA 3X1TB 1P3FA 2XD5A 2Y2JA 3MGQC 3X1VA 3NQUA 5CP6D 1ID3C 5B32D 1M18C 3AFAA 3AZMA 1M18D 4KUDD 3AZLA 3X1UD 5KDMB 3AN2A 5CPIA 5B1LA 3W99A 3C1CA 1M19A 3AZHB 3LELD 1B6WA 1B67A 2CV5A 3REHC 1P3OC 1Z2CB 4UPKA 4YM6A 3REHD 1P3OD 1AOIC 3B6FA 5FUGA 4X23A 3RELB 4QLCD 3AZNC 2HIOC 3R45A 3LJAB 5CP6A 1P3AB 5B32A 1HQ3B 5G49A 2PYOB 4EO5B 2VQRA 4KUDA 3MVDD 2YFWB 4G91B 4H9PB 3X1UA 4YS3D 3W96C 1PZRA 4UUZA 2AROC 1BH8A 1KX5C 1P3MD 5GT3D 3MGPA 3X1SC 4WNNA 3MGRD 5B2IC 3X1SD 1S32B 4LD9C 5B0ZC 4Z5TC 5BNXA 4Z5TD 3O62C 3KXBB 3W98A 3W97C 2YFVB 2NZDC 4QLCA 3X1VB 3W97D 3KWQC 2ZY3A 3UT9C 3AFAB 3AZMB 3AZLB 5DNNB 5B31C 3MVDA 4WU8D 3AN2B 4J8UD 4YS3A 4G92B 5CPIB 3W99B 2RVQC 3C1CB 3WAAC 4CAYA 3A6ND 3MGSC 1BH9A 2JE5A 1P3MA 3LZ1C 3MGSD 3MGRA 1H3OA 4J8WD 3VH6W 2CV5B 4XZQC 3LZ1D 5AV8C 1F66C 4XZQD 4Z2MH 4YM6B 3AZEC 1F66D 3B6FB 4X23B 1BFMA 3TU4D 3B6GC 1KX3D 4KGCD 3REIC 3AZIC 3AZGD 1P3PD 5B40C 3R45B 3AYWC 1U35C 2Y2PA 5CP6B 1EQZD 5B32B 5AVCD 3AZHA 4KUDB 5B24D 5B0YD 5AY8D 3X1UB 4WU8A 2F8ND 3C1BD 2DQNC 3AZFD 1P3LC 4UUZB 3KUYD 5CPJC 1BH8B 5B32G 5CPJD 3MGPB 4ZBJC 1KX4C 2Y2QA 5BT1D 4WNNB 3A6NA 5C3IB 3LELB 3REJD 4J8WA 3LJAA 3REHB 1P3OB 5BNXB 1M1AC 3NQJB 1TZYC 2IO5C 3TU4A 3AV2C 3LZ0A 1KX3A 4KGCA 4H9PA 3AV2D 3AZGA 1P3PA 4QLCB 1P34C 4R8PA 2ZY4A 1P34D 5AVCA 2NQBD 5BS7C 3UTAC 1ZLAD 4XUJC 3MVDB 5B24A 5F99C 5B0YA 5AY8A 1P3FC 4YS3B 4WU9C 2FJ7C 5F99D 2F8NA 3C1BA 4J8XD 5CHLB 3WKJD 3AZFA 3B0DC 2FJ7D 3KUYA 2G5IC 1P3MB 4CAYB 1BH9B 5GT3B 3MNND 5GSUD 3MGRB 1R4VA 1H3OB 5CPKD 2ZM5A 3REJA 1P3GD 5AV6D 5E5AC 2Y2GA 3MGQD 4H9SA 1ID3D 5AVBC 1P3BC 3V9RA 4Z5TB 4J8VC 5AVBD 5DNNA 3EPLA 1P3IC 1F1EA 2NQBA 1ZLAA 3VH5A 4JJNC 4NE3A 4WU8B 4J8UB 4JJND 2Y2KA 4J8XA 2RIQA 3F6TA 2Y2OA 4NFTA 1AOID 3A6NB 3MNNA 3AZJC 4J8WB 5CPKA 3WTPC 5AV6A 5B31G 2HIOD 4Z66C 3AZND 1P3KC 3MGQA 1F66B 5JRGC 5B2JC 3TU4B 1M18A 4M6BA 3LZ0B 1KX3B 5AV5C 5B2JD 4KGCB 3AZGB 3AV1C 1P3PB 5B33C 3AV1D 4R8PB 4NE6A 3W96D 1EQZB 5AVCB 2AROD 1KX5D 5GT0C 3IP4C 2NZDA 3LELA 5B24B 4WV4B 5B0YB 5AY8B 5B2ID 2F8NB 3C1BB 3AZFB 2Y2MA 2J8PA 4LD9D 3KUYB 3REHA 1P3OA 3NQJA 5B0ZD 5CPJB 3AZKC 5GXQC 4AWLC 2JCHA 3O62D 3REJB 3WA9C 3UTBC 3AZKD 5AV9C 4ZUXC 2F8NG 4HGAC 2NZDD 2HIOA 3KWQD 3V9RB 3UT9D 3H0MC 3X1TC 1KU5A 5B31D 4NE5A 3W96A 5GT3A 3B0BA 2AROA 2NQBB 2RVQD 1KX5A 1ZLAB 3WAAD 5BO0B 2G5HC 3X1SA 5F99B 4J8XB 3WKJB 5AV8D 4LD9A 5B0ZA 3AZHC 3B0DB 4Z5TA 3AZED 3MNNB 3H0LC 2W8SA 5GSUB 2HUEB 3B6GD 5DNMC 3REID 5CPKB 3O62A 4CSRA 3AZID 5AV6B 2Y2HA 3W97A 5B1MC 5B40D 1P3GB 5DNMD 5B1MD 3AYWD 3MGQB 1U35D 3KWQA 1ID3B 3RELC 1M18B 2BYMA 4KHAA 3REKC 5AVBB 3VH6A 4E45A 3REKD 4J8UA 5B31A 1P3AC 1P3LD 1HQ3C 2PYOC 3P5JB 1N1JA 4G91C 1KX4D 3FDDA 3WAAA 3MGSA 3LZ1A 4JJNB 4XZQA 4DRBA 5AV8A 1F66A 1M1AD 1AOIB 1TZYD 3AZEA 2Y2IA 1S32C 4WJ3C 3B6GA 5B40A 1EQZA 3AZNB 2HIOB 1U35A 3KXBC 1JFIA 5B2JB 3UTAD 3EG5B 4XUJD 3X1VC 1Q9CA 1P3FD 2ZY2A 3AV1B 2Y2LA 4WU9D 3W96B 3AFAC 3AZMC 1P3LA 5CPJA 2AROB 3AZLC 3AFAD 3A1KA 1KX5B 3AN2C 3AZLD 1KX4A 2BG1A 3X1SB 3AN2D 5B2IB 5CPIC 5B1LC 3W99C 3C1CC 4LD9B 5B1LD 5B0ZB 3W99D 5E5AD 1M19C 1M1AA 1P3BD 2DF4C 1M19D 1TZYA 2CV5C 4J8VD 3AV2A 3O62B 4CSRB 3AZKB 3W97B 2XD1A 4Z2MG 4YM6C 1P3ID 3B6FC 2F2AC 2NZDB 4X23C 4YM6D 3KWQB 1P34A 2BYMB 4KHAB 3UT9B 5BO0A 3UTAA 5B31B 4XUJA 3VH5W 5F99A 5CP6C 5B32C 3WKJA 4WU9A 2FJ7A 4KUDC 1N1JB 3X1UC 5GSUA 3WAAB 3MGSB 3AZJD 1P3GA 3LZ1B 3WTPD 3KSYA 4XZQB 5AV8B 3MGPC 4Z66D 1ID3A 1P3KD 5C3IC 5E5AA 3AZEB 4H9RA 5JRGD 3LELC 5AVBA 3MGPD 1P3BA 4J8VA 3B6GB 5AV5D 3REIB 3AZIB 5B40B 5BNVA 5DNMB 5B33D 1P3IA 1TAFA 4DRAA 1ULYA 5B1MB 3AYWB 1U35B 3W98C 1JFIB 5GT0D 3W98D 4QLCC 3REKB 4JJNA 4H9QA 1P3LB 3KFUG 3VH5T 1AOIA 3MVDC 1KX4B 4ZBJB 4H9OB 3WTPE 4YS3C 5GXQD 3H0RC 2Y2NA 3AZJA 3WA9D 3UTBD 3AZNA 3WTPA 5AV9D 1P3MC 4ZUXD 5GT3C 4Z66A 1P3KA 1M1AB 3MGRC 1HTAA 1TZYB 4H9NA 5JRGA 5B2JA 2IO5B 3AV2B 2BYKB 5AV5A 3X1TD 5JA4A 3AV1A 5B33A 1P34B 1WWIA 2ZY5A 5GT0A 3UTAB 4XUJB 5B2IA 1P3FB 3A1IA 4WU9B 2FJ7B 3NQUB 1A7WA 3EPKA 3AZHD 4WU8C 3EPJA 4J8UC 3AZKA 2L5AA 5GXQA 3WA9A 3UTBA
chains in the Genus database with same CATH topology
5AV9A 3A6NC 4ZUXA 5B1LB 5E5AB 4H9RB 3UT9A 1P3BB 3RELD 4J8WC 1M19B 4J8VB 3LJAC 3X1TA 5BNVB 1P3IB 1TAFB 3LJAD 2FFFB 1P3AD 4EO5C 2F8NK 3TU4C 3LZ0C 1HQ3D 1KX3C 2PYOD 5FUGB 4KGCC 3AZGC 2UWXA 3LZ0D 1P3PC 4R8PC 5KDMA 1EQZC 4H9QB 5AVCC 4R8PD 3B0CW 2JSSA 1WWSA 5G49B 5B24C 5B0YC 5AY8C 3REIA 3C1BC 3AZIA 3AZJB 1S32D 3AZFC 5DNMA 3KUYC 3WTPB 5B1MA 3AYWA 4Z66B 5BT1C 1P3KB 4H9NB 5JRGB 3KXBD 3REJC 3RELA 3REKA 5AV5B 5JA4B 3X1VD 4H9SC 5B33B 3EPHA 4WZSB 1P3AA 3VH6T 5DNNC 3AZMD 1HQ3A 2PYOA 3AL0C 4H9OA 5DNND 5GT0B 3W98B 2YFWA 4G92C 5CPID 2NQBC 3C1CD 1ZLAC 4DQYB 3B0CT 2BYKA 1T3UA 2CWEA 5GXQB 1W2EA 4AWLB 4E44A 4J8XC 2CV5D 1S32A 3WKJC 3WA9B 3UTBB 2LY8A 5AV9B 4ZUXB 3B6FD 4HGAB 4X23D 3MNNC 2F8NH 5GSUC 2HUEC 5CPKC 3KXBA 5BS7A 1P3GC 5AV6C 2YFVA 3X1TB 1P3FA 2XD5A 2Y2JA 3MGQC 3X1VA 3NQUA 5CP6D 1ID3C 5B32D 1M18C 3AFAA 3AZMA 1M18D 4KUDD 3AZLA 3X1UD 5KDMB 3AN2A 5CPIA 5B1LA 3W99A 3C1CA 1M19A 3AZHB 3LELD 1B6WA 1B67A 2CV5A 3REHC 1P3OC 1Z2CB 4UPKA 4YM6A 3REHD 1P3OD 1AOIC 3B6FA 5FUGA 4X23A 3RELB 4QLCD 3AZNC 2HIOC 3R45A 3LJAB 5CP6A 1P3AB 5B32A 1HQ3B 5G49A 2PYOB 4EO5B 2VQRA 4KUDA 3MVDD 2YFWB 4G91B 4H9PB 3X1UA 4YS3D 3W96C 1PZRA 4UUZA 2AROC 1BH8A 1KX5C 1P3MD 5GT3D 3MGPA 3X1SC 4WNNA 3MGRD 5B2IC 3X1SD 1S32B 4LD9C 5B0ZC 4Z5TC 5BNXA 4Z5TD 3O62C 3KXBB 3W98A 3W97C 2YFVB 2NZDC 4QLCA 3X1VB 3W97D 3KWQC 2ZY3A 3UT9C 3AFAB 3AZMB 3AZLB 5DNNB 5B31C 3MVDA 4WU8D 3AN2B 4J8UD 4YS3A 4G92B 5CPIB 3W99B 2RVQC 3C1CB 3WAAC 4CAYA 3A6ND 3MGSC 1BH9A 2JE5A 1P3MA 3LZ1C 3MGSD 3MGRA 1H3OA 4J8WD 3VH6W 2CV5B 4XZQC 3LZ1D 5AV8C 1F66C 4XZQD 4Z2MH 4YM6B 3AZEC 1F66D 3B6FB 4X23B 1BFMA 3TU4D 3B6GC 1KX3D 4KGCD 3REIC 3AZIC 3AZGD 1P3PD 5B40C 3R45B 3AYWC 1U35C 2Y2PA 5CP6B 1EQZD 5B32B 5AVCD 3AZHA 4KUDB 5B24D 5B0YD 5AY8D 3X1UB 4WU8A 2F8ND 3C1BD 2DQNC 3AZFD 1P3LC 4UUZB 3KUYD 5CPJC 1BH8B 5B32G 5CPJD 3MGPB 4ZBJC 1KX4C 2Y2QA 5BT1D 4WNNB 3A6NA 5C3IB 3LELB 3REJD 4J8WA 3LJAA 3REHB 1P3OB 5BNXB 1M1AC 3NQJB 1TZYC 2IO5C 3TU4A 3AV2C 3LZ0A 1KX3A 4KGCA 4H9PA 3AV2D 3AZGA 1P3PA 4QLCB 1P34C 4R8PA 2ZY4A 1P34D 5AVCA 2NQBD 5BS7C 3UTAC 1ZLAD 4XUJC 3MVDB 5B24A 5F99C 5B0YA 5AY8A 1P3FC 4YS3B 4WU9C 2FJ7C 5F99D 2F8NA 3C1BA 4J8XD 5CHLB 3WKJD 3AZFA 3B0DC 2FJ7D 3KUYA 2G5IC 1P3MB 4CAYB 1BH9B 5GT3B 3MNND 5GSUD 3MGRB 1R4VA 1H3OB 5CPKD 2ZM5A 3REJA 1P3GD 5AV6D 5E5AC 2Y2GA 3MGQD 4H9SA 1ID3D 5AVBC 1P3BC 3V9RA 4Z5TB 4J8VC 5AVBD 5DNNA 3EPLA 1P3IC 1F1EA 2NQBA 1ZLAA 3VH5A 4JJNC 4NE3A 4WU8B 4J8UB 4JJND 2Y2KA 4J8XA 2RIQA 3F6TA 2Y2OA 4NFTA 1AOID 3A6NB 3MNNA 3AZJC 4J8WB 5CPKA 3WTPC 5AV6A 5B31G 2HIOD 4Z66C 3AZND 1P3KC 3MGQA 1F66B 5JRGC 5B2JC 3TU4B 1M18A 4M6BA 3LZ0B 1KX3B 5AV5C 5B2JD 4KGCB 3AZGB 3AV1C 1P3PB 5B33C 3AV1D 4R8PB 4NE6A 3W96D 1EQZB 5AVCB 2AROD 1KX5D 5GT0C 3IP4C 2NZDA 3LELA 5B24B 4WV4B 5B0YB 5AY8B 5B2ID 2F8NB 3C1BB 3AZFB 2Y2MA 2J8PA 4LD9D 3KUYB 3REHA 1P3OA 3NQJA 5B0ZD 5CPJB 3AZKC 5GXQC 4AWLC 2JCHA 3O62D 3REJB 3WA9C 3UTBC 3AZKD 5AV9C 4ZUXC 2F8NG 4HGAC 2NZDD 2HIOA 3KWQD 3V9RB 3UT9D 3H0MC 3X1TC 1KU5A 5B31D 4NE5A 3W96A 5GT3A 3B0BA 2AROA 2NQBB 2RVQD 1KX5A 1ZLAB 3WAAD 5BO0B 2G5HC 3X1SA 5F99B 4J8XB 3WKJB 5AV8D 4LD9A 5B0ZA 3AZHC 3B0DB 4Z5TA 3AZED 3MNNB 3H0LC 2W8SA 5GSUB 2HUEB 3B6GD 5DNMC 3REID 5CPKB 3O62A 4CSRA 3AZID 5AV6B 2Y2HA 3W97A 5B1MC 5B40D 1P3GB 5DNMD 5B1MD 3AYWD 3MGQB 1U35D 3KWQA 1ID3B 3RELC 1M18B 2BYMA 4KHAA 3REKC 5AVBB 3VH6A 4E45A 3REKD 4J8UA 5B31A 1P3AC 1P3LD 1HQ3C 2PYOC 3P5JB 1N1JA 4G91C 1KX4D 3FDDA 3WAAA 3MGSA 3LZ1A 4JJNB 4XZQA 4DRBA 5AV8A 1F66A 1M1AD 1AOIB 1TZYD 3AZEA 2Y2IA 1S32C 4WJ3C 3B6GA 5B40A 1EQZA 3AZNB 2HIOB 1U35A 3KXBC 1JFIA 5B2JB 3UTAD 3EG5B 4XUJD 3X1VC 1Q9CA 1P3FD 2ZY2A 3AV1B 2Y2LA 4WU9D 3W96B 3AFAC 3AZMC 1P3LA 5CPJA 2AROB 3AZLC 3AFAD 3A1KA 1KX5B 3AN2C 3AZLD 1KX4A 2BG1A 3X1SB 3AN2D 5B2IB 5CPIC 5B1LC 3W99C 3C1CC 4LD9B 5B1LD 5B0ZB 3W99D 5E5AD 1M19C 1M1AA 1P3BD 2DF4C 1M19D 1TZYA 2CV5C 4J8VD 3AV2A 3O62B 4CSRB 3AZKB 3W97B 2XD1A 4Z2MG 4YM6C 1P3ID 3B6FC 2F2AC 2NZDB 4X23C 4YM6D 3KWQB 1P34A 2BYMB 4KHAB 3UT9B 5BO0A 3UTAA 5B31B 4XUJA 3VH5W 5F99A 5CP6C 5B32C 3WKJA 4WU9A 2FJ7A 4KUDC 1N1JB 3X1UC 5GSUA 3WAAB 3MGSB 3AZJD 1P3GA 3LZ1B 3WTPD 3KSYA 4XZQB 5AV8B 3MGPC 4Z66D 1ID3A 1P3KD 5C3IC 5E5AA 3AZEB 4H9RA 5JRGD 3LELC 5AVBA 3MGPD 1P3BA 4J8VA 3B6GB 5AV5D 3REIB 3AZIB 5B40B 5BNVA 5DNMB 5B33D 1P3IA 1TAFA 4DRAA 1ULYA 5B1MB 3AYWB 1U35B 3W98C 1JFIB 5GT0D 3W98D 4QLCC 3REKB 4JJNA 4H9QA 1P3LB 3KFUG 3VH5T 1AOIA 3MVDC 1KX4B 4ZBJB 4H9OB 3WTPE 4YS3C 5GXQD 3H0RC 2Y2NA 3AZJA 3WA9D 3UTBD 3AZNA 3WTPA 5AV9D 1P3MC 4ZUXD 5GT3C 4Z66A 1P3KA 1M1AB 3MGRC 1HTAA 1TZYB 4H9NA 5JRGA 5B2JA 2IO5B 3AV2B 2BYKB 5AV5A 3X1TD 5JA4A 3AV1A 5B33A 1P34B 1WWIA 2ZY5A 5GT0A 3UTAB 4XUJB 5B2IA 1P3FB 3A1IA 4WU9B 2FJ7B 3NQUB 1A7WA 3EPKA 3AZHD 4WU8C 3EPJA 4J8UC 3AZKA 2L5AA 5GXQA 3WA9A 3UTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV9 A;  3A6N C;  4ZUX A;  5B1L B;  5E5A B;  4H9R B;  3UT9 A;  1P3B B;  3REL D;  4J8W C;  1M19 B;  4J8V B;  3LJA C;  3X1T A;  5BNV B;  1P3I B;  1TAF B;  3LJA D;  1P3A D;  4EO5 C;  2F8N K;  3TU4 C;  3LZ0 C;  1HQ3 D;  1KX3 C;  2PYO D;  5FUG B;  4KGC C;  3AZG C;  3LZ0 D;  1P3P C;  4R8P C;  5KDM A;  1EQZ C;  4H9Q B;  5AVC C;  4R8P D;  3B0C W;  2JSS A;  1WWS A;  5G49 B;  5B24 C;  5B0Y C;  5AY8 C;  3REI A;  3C1B C;  3AZI A;  3AZJ B;  1S32 D;  3AZF C;  5DNM A;  3KUY C;  3WTP B;  5B1M A;  3AYW A;  4Z66 B;  5BT1 C;  1P3K B;  4H9N B;  5JRG B;  3KXB D;  3REJ C;  3REL A;  3REK A;  5AV5 B;  5JA4 B;  3X1V D;  4H9S C;  5B33 B;  4WZS B;  1P3A A;  3VH6 T;  5DNN C;  3AZM D;  1HQ3 A;  2PYO A;  4H9O A;  5DNN D;  5GT0 B;  3W98 B;  2YFW A;  4G92 C;  5CPI D;  2NQB C;  3C1C D;  1ZLA C;  3B0C T;  2BYK A;  2CWE A;  2CV5 D;  5GXQ B;  4AWL B;  4E44 A;  4J8X C;  1S32 A;  3WKJ C;  3WA9 B;  3UTB B;  2LY8 A;  5AV9 B;  4ZUX B;  3B6F D;  4HGA B;  4X23 D;  3MNN C;  2F8N H;  5GSU C;  2HUE C;  5CPK C;  3KXB A;  5BS7 A;  1P3G C;  5AV6 C;  2YFV A;  3X1T B;  1P3F A;  3X1V A;  3MGQ C;  3NQU A;  5CP6 D;  1ID3 C;  5B32 D;  1M18 C;  3AFA A;  3AZM A;  1M18 D;  4KUD D;  3AZL A;  3X1U D;  5KDM B;  3AN2 A;  5CPI A;  5B1L A;  3W99 A;  3C1C A;  1M19 A;  3AZH B;  3LEL D;  1B6W A;  1B67 A;  2CV5 A;  3REH C;  1P3O C;  3REH D;  4YM6 A;  1P3O D;  1AOI C;  3B6F A;  5FUG A;  4X23 A;  3REL B;  4QLC D;  3AZN C;  2HIO C;  3R45 A;  3LJA B;  5CP6 A;  1P3A B;  5B32 A;  1HQ3 B;  5G49 A;  2PYO B;  4EO5 B;  4KUD A;  3MVD D;  2YFW B;  4G91 B;  4H9P B;  3X1U A;  4YS3 D;  3W96 C;  4UUZ A;  2ARO C;  1BH8 A;  1KX5 C;  1P3M D;  5GT3 D;  3MGP A;  3X1S C;  4WNN A;  3MGR D;  5B2I C;  3X1S D;  1S32 B;  4LD9 C;  5B0Z C;  4Z5T C;  5BNX A;  4Z5T D;  3O62 C;  3KXB B;  3W98 A;  3W97 C;  2YFV B;  2NZD C;  4QLC A;  3X1V B;  3W97 D;  3KWQ C;  3UT9 C;  3AFA B;  3AZM B;  3AZL B;  5DNN B;  5B31 C;  3MVD A;  4WU8 D;  3AN2 B;  4J8U D;  4YS3 A;  4G92 B;  5CPI B;  3W99 B;  2RVQ C;  3C1C B;  3WAA C;  4CAY A;  3A6N D;  3MGS C;  1BH9 A;  1P3M A;  3LZ1 C;  3MGS D;  3MGR A;  1H3O A;  4J8W D;  3VH6 W;  2CV5 B;  4XZQ C;  3LZ1 D;  5AV8 C;  1F66 C;  4XZQ D;  4Z2M H;  4YM6 B;  3AZE C;  1F66 D;  3B6F B;  4X23 B;  1BFM A;  3TU4 D;  3B6G C;  1KX3 D;  4KGC D;  3REI C;  3AZI C;  3AZG D;  1P3P D;  5B40 C;  3R45 B;  3AYW C;  1U35 C;  5CP6 B;  1EQZ D;  5B32 B;  5AVC D;  3AZH A;  4KUD B;  5B24 D;  5B0Y D;  5AY8 D;  3X1U B;  4WU8 A;  2F8N D;  3C1B D;  3AZF D;  1P3L C;  4UUZ B;  3KUY D;  5CPJ C;  1BH8 B;  5B32 G;  5CPJ D;  3MGP B;  4ZBJ C;  1KX4 C;  5BT1 D;  3A6N A;  4WNN B;  5C3I B;  3LEL B;  3REJ D;  4J8W A;  3LJA A;  3REH B;  1P3O B;  5BNX B;  1M1A C;  3NQJ B;  1TZY C;  2IO5 C;  3TU4 A;  3AV2 C;  3LZ0 A;  1KX3 A;  4KGC A;  4H9P A;  3AV2 D;  3AZG A;  1P3P A;  4QLC B;  1P34 C;  4R8P A;  1P34 D;  5AVC A;  2NQB D;  5BS7 C;  3UTA C;  1ZLA D;  4XUJ C;  3MVD B;  5B24 A;  5F99 C;  5B0Y A;  5AY8 A;  1P3F C;  4YS3 B;  4WU9 C;  2FJ7 C;  5F99 D;  2F8N A;  3C1B A;  4J8X D;  5CHL B;  3WKJ D;  3AZF A;  3B0D C;  2FJ7 D;  3KUY A;  1P3M B;  4CAY B;  1BH9 B;  5GT3 B;  3MNN D;  5GSU D;  3MGR B;  1R4V A;  1H3O B;  5CPK D;  3REJ A;  1P3G D;  5AV6 D;  5E5A C;  3MGQ D;  4H9S A;  1ID3 D;  5AVB C;  1P3B C;  3V9R A;  4Z5T B;  4J8V C;  5AVB D;  5DNN A;  1P3I C;  1F1E A;  2NQB A;  1ZLA A;  3VH5 A;  4JJN C;  4NE3 A;  4WU8 B;  4J8U B;  4JJN D;  4J8X A;  4NFT A;  1AOI D;  3A6N B;  3MNN A;  3AZJ C;  4J8W B;  5CPK A;  3WTP C;  5AV6 A;  5B31 G;  2HIO D;  4Z66 C;  3AZN D;  1P3K C;  3MGQ A;  1F66 B;  5JRG C;  5B2J C;  3TU4 B;  1M18 A;  4M6B A;  3LZ0 B;  1KX3 B;  5AV5 C;  5B2J D;  4KGC B;  3AZG B;  3AV1 C;  1P3P B;  5B33 C;  3AV1 D;  4R8P B;  4NE6 A;  3W96 D;  1EQZ B;  5AVC B;  2ARO D;  1KX5 D;  5GT0 C;  2NZD A;  3LEL A;  5B24 B;  4WV4 B;  5B0Y B;  5AY8 B;  5B2I D;  2F8N B;  3C1B B;  3AZF B;  4LD9 D;  3KUY B;  3REH A;  1P3O A;  3NQJ A;  5B0Z D;  5CPJ B;  3AZK C;  5GXQ C;  4AWL C;  3O62 D;  3REJ B;  3WA9 C;  3UTB C;  3AZK D;  5AV9 C;  4ZUX C;  2F8N G;  4HGA C;  2NZD D;  2HIO A;  3KWQ D;  3V9R B;  3UT9 D;  3X1T C;  1KU5 A;  5B31 D;  4NE5 A;  3W96 A;  5GT3 A;  3B0B A;  2ARO A;  2NQB B;  2RVQ D;  1KX5 A;  1ZLA B;  3WAA D;  5BO0 B;  3X1S A;  5F99 B;  4J8X B;  3WKJ B;  5AV8 D;  4LD9 A;  5B0Z A;  3AZH C;  3B0D B;  4Z5T A;  3AZE D;  3MNN B;  5GSU B;  2HUE B;  3B6G D;  5DNM C;  3REI D;  5CPK B;  3O62 A;  4CSR A;  3AZI D;  5AV6 B;  1P3G B;  3W97 A;  5B1M C;  5B40 D;  5DNM D;  5B1M D;  3AYW D;  3MGQ B;  1U35 D;  3KWQ A;  1ID3 B;  3REL C;  1M18 B;  2BYM A;  4KHA A;  3REK C;  5AVB B;  3VH6 A;  4E45 A;  3REK D;  4J8U A;  5B31 A;  1P3A C;  1P3L D;  1HQ3 C;  2PYO C;  1N1J A;  4G91 C;  1KX4 D;  3WAA A;  3MGS A;  3LZ1 A;  4JJN B;  4XZQ A;  4DRB A;  5AV8 A;  1F66 A;  1M1A D;  1AOI B;  1TZY D;  3AZE A;  1S32 C;  3B6G A;  5B40 A;  1EQZ A;  3AZN B;  2HIO B;  1U35 A;  3KXB C;  1JFI A;  5B2J B;  3UTA D;  4XUJ D;  3X1V C;  1Q9C A;  1P3F D;  3AV1 B;  4WU9 D;  3W96 B;  3AFA C;  3AZM C;  1P3L A;  5CPJ A;  2ARO B;  3AZL C;  3AFA D;  1KX5 B;  3AN2 C;  3AZL D;  1KX4 A;  3X1S B;  3AN2 D;  5B2I B;  5CPI C;  5B1L C;  3W99 C;  3C1C C;  4LD9 B;  5B1L D;  5B0Z B;  3W99 D;  5E5A D;  1M19 C;  1M1A A;  1P3B D;  1M19 D;  1TZY A;  2CV5 C;  4J8V D;  3AV2 A;  3O62 B;  4CSR B;  3AZK B;  3W97 B;  4Z2M G;  4YM6 C;  1P3I D;  3B6F C;  2NZD B;  4X23 C;  4YM6 D;  3KWQ B;  1P34 A;  2BYM B;  4KHA B;  3UT9 B;  5BO0 A;  3UTA A;  5B31 B;  4XUJ A;  3VH5 W;  5F99 A;  5CP6 C;  5B32 C;  3WKJ A;  4WU9 A;  2FJ7 A;  4KUD C;  1N1J B;  3X1U C;  5GSU A;  3WAA B;  3MGS B;  3AZJ D;  1P3G A;  3LZ1 B;  3WTP D;  3KSY A;  4XZQ B;  5AV8 B;  3MGP C;  4Z66 D;  1ID3 A;  1P3K D;  5C3I C;  5E5A A;  3AZE B;  4H9R A;  5JRG D;  3LEL C;  5AVB A;  3MGP D;  1P3B A;  4J8V A;  3B6G B;  5AV5 D;  3REI B;  3AZI B;  5B40 B;  5BNV A;  5DNM B;  5B33 D;  1P3I A;  1TAF A;  4DRA A;  1ULY A;  5B1M B;  3AYW B;  1U35 B;  3W98 C;  1JFI B;  5GT0 D;  3W98 D;  4QLC C;  3REK B;  4JJN A;  4H9Q A;  1P3L B;  3VH5 T;  1AOI A;  3MVD C;  1KX4 B;  4ZBJ B;  4H9O B;  3WTP E;  4YS3 C;  5GXQ D;  3AZJ A;  3WA9 D;  3UTB D;  3AZN A;  3WTP A;  5AV9 D;  1P3M C;  4ZUX D;  5GT3 C;  4Z66 A;  1P3K A;  1M1A B;  3MGR C;  1HTA A;  1TZY B;  4H9N A;  5JRG A;  5B2J A;  2IO5 B;  3AV2 B;  2BYK B;  5AV5 A;  3X1T D;  5JA4 A;  3AV1 A;  5B33 A;  1P34 B;  1WWI A;  5GT0 A;  3UTA B;  4XUJ B;  5B2I A;  1P3F B;  4WU9 B;  2FJ7 B;  3NQU B;  1A7W A;  3AZH D;  4WU8 C;  4J8U C;  3AZK A;  2L5A A;  5GXQ A;  3WA9 A;  3UTB A; 
#chains in the Genus database with same CATH topology
 5AV9 A;  3A6N C;  4ZUX A;  5B1L B;  5E5A B;  4H9R B;  3UT9 A;  1P3B B;  3REL D;  4J8W C;  1M19 B;  4J8V B;  3LJA C;  3X1T A;  5BNV B;  1P3I B;  1TAF B;  3LJA D;  2FFF B;  1P3A D;  4EO5 C;  2F8N K;  3TU4 C;  3LZ0 C;  1HQ3 D;  1KX3 C;  2PYO D;  5FUG B;  4KGC C;  3AZG C;  2UWX A;  3LZ0 D;  1P3P C;  4R8P C;  5KDM A;  1EQZ C;  4H9Q B;  5AVC C;  4R8P D;  3B0C W;  2JSS A;  1WWS A;  5G49 B;  5B24 C;  5B0Y C;  5AY8 C;  3REI A;  3C1B C;  3AZI A;  3AZJ B;  1S32 D;  3AZF C;  5DNM A;  3KUY C;  3WTP B;  5B1M A;  3AYW A;  4Z66 B;  5BT1 C;  1P3K B;  4H9N B;  5JRG B;  3KXB D;  3REJ C;  3REL A;  3REK A;  5AV5 B;  5JA4 B;  3X1V D;  4H9S C;  5B33 B;  3EPH A;  4WZS B;  1P3A A;  3VH6 T;  5DNN C;  3AZM D;  1HQ3 A;  2PYO A;  3AL0 C;  4H9O A;  5DNN D;  5GT0 B;  3W98 B;  2YFW A;  4G92 C;  5CPI D;  2NQB C;  3C1C D;  1ZLA C;  4DQY B;  3B0C T;  2BYK A;  1T3U A;  2CWE A;  5GXQ B;  1W2E A;  4AWL B;  4E44 A;  4J8X C;  2CV5 D;  1S32 A;  3WKJ C;  3WA9 B;  3UTB B;  2LY8 A;  5AV9 B;  4ZUX B;  3B6F D;  4HGA B;  4X23 D;  3MNN C;  2F8N H;  5GSU C;  2HUE C;  5CPK C;  3KXB A;  5BS7 A;  1P3G C;  5AV6 C;  2YFV A;  3X1T B;  1P3F A;  2XD5 A;  2Y2J A;  3MGQ C;  3X1V A;  3NQU A;  5CP6 D;  1ID3 C;  5B32 D;  1M18 C;  3AFA A;  3AZM A;  1M18 D;  4KUD D;  3AZL A;  3X1U D;  5KDM B;  3AN2 A;  5CPI A;  5B1L A;  3W99 A;  3C1C A;  1M19 A;  3AZH B;  3LEL D;  1B6W A;  1B67 A;  2CV5 A;  3REH C;  1P3O C;  1Z2C B;  4UPK A;  4YM6 A;  3REH D;  1P3O D;  1AOI C;  3B6F A;  5FUG A;  4X23 A;  3REL B;  4QLC D;  3AZN C;  2HIO C;  3R45 A;  3LJA B;  5CP6 A;  1P3A B;  5B32 A;  1HQ3 B;  5G49 A;  2PYO B;  4EO5 B;  2VQR A;  4KUD A;  3MVD D;  2YFW B;  4G91 B;  4H9P B;  3X1U A;  4YS3 D;  3W96 C;  1PZR A;  4UUZ A;  2ARO C;  1BH8 A;  1KX5 C;  1P3M D;  5GT3 D;  3MGP A;  3X1S C;  4WNN A;  3MGR D;  5B2I C;  3X1S D;  1S32 B;  4LD9 C;  5B0Z C;  4Z5T C;  5BNX A;  4Z5T D;  3O62 C;  3KXB B;  3W98 A;  3W97 C;  2YFV B;  2NZD C;  4QLC A;  3X1V B;  3W97 D;  3KWQ C;  2ZY3 A;  3UT9 C;  3AFA B;  3AZM B;  3AZL B;  5DNN B;  5B31 C;  3MVD A;  4WU8 D;  3AN2 B;  4J8U D;  4YS3 A;  4G92 B;  5CPI B;  3W99 B;  2RVQ C;  3C1C B;  3WAA C;  4CAY A;  3A6N D;  3MGS C;  1BH9 A;  2JE5 A;  1P3M A;  3LZ1 C;  3MGS D;  3MGR A;  1H3O A;  4J8W D;  3VH6 W;  2CV5 B;  4XZQ C;  3LZ1 D;  5AV8 C;  1F66 C;  4XZQ D;  4Z2M H;  4YM6 B;  3AZE C;  1F66 D;  3B6F B;  4X23 B;  1BFM A;  3TU4 D;  3B6G C;  1KX3 D;  4KGC D;  3REI C;  3AZI C;  3AZG D;  1P3P D;  5B40 C;  3R45 B;  3AYW C;  1U35 C;  2Y2P A;  5CP6 B;  1EQZ D;  5B32 B;  5AVC D;  3AZH A;  4KUD B;  5B24 D;  5B0Y D;  5AY8 D;  3X1U B;  4WU8 A;  2F8N D;  3C1B D;  2DQN C;  3AZF D;  1P3L C;  4UUZ B;  3KUY D;  5CPJ C;  1BH8 B;  5B32 G;  5CPJ D;  3MGP B;  4ZBJ C;  1KX4 C;  2Y2Q A;  5BT1 D;  4WNN B;  3A6N A;  5C3I B;  3LEL B;  3REJ D;  4J8W A;  3LJA A;  3REH B;  1P3O B;  5BNX B;  1M1A C;  3NQJ B;  1TZY C;  2IO5 C;  3TU4 A;  3AV2 C;  3LZ0 A;  1KX3 A;  4KGC A;  4H9P A;  3AV2 D;  3AZG A;  1P3P A;  4QLC B;  1P34 C;  4R8P A;  2ZY4 A;  1P34 D;  5AVC A;  2NQB D;  5BS7 C;  3UTA C;  1ZLA D;  4XUJ C;  3MVD B;  5B24 A;  5F99 C;  5B0Y A;  5AY8 A;  1P3F C;  4YS3 B;  4WU9 C;  2FJ7 C;  5F99 D;  2F8N A;  3C1B A;  4J8X D;  5CHL B;  3WKJ D;  3AZF A;  3B0D C;  2FJ7 D;  3KUY A;  2G5I C;  1P3M B;  4CAY B;  1BH9 B;  5GT3 B;  3MNN D;  5GSU D;  3MGR B;  1R4V A;  1H3O B;  5CPK D;  2ZM5 A;  3REJ A;  1P3G D;  5AV6 D;  5E5A C;  2Y2G A;  3MGQ D;  4H9S A;  1ID3 D;  5AVB C;  1P3B C;  3V9R A;  4Z5T B;  4J8V C;  5AVB D;  5DNN A;  3EPL A;  1P3I C;  1F1E A;  2NQB A;  1ZLA A;  3VH5 A;  4JJN C;  4NE3 A;  4WU8 B;  4J8U B;  4JJN D;  2Y2K A;  4J8X A;  2RIQ A;  3F6T A;  2Y2O A;  4NFT A;  1AOI D;  3A6N B;  3MNN A;  3AZJ C;  4J8W B;  5CPK A;  3WTP C;  5AV6 A;  5B31 G;  2HIO D;  4Z66 C;  3AZN D;  1P3K C;  3MGQ A;  1F66 B;  5JRG C;  5B2J C;  3TU4 B;  1M18 A;  4M6B A;  3LZ0 B;  1KX3 B;  5AV5 C;  5B2J D;  4KGC B;  3AZG B;  3AV1 C;  1P3P B;  5B33 C;  3AV1 D;  4R8P B;  4NE6 A;  3W96 D;  1EQZ B;  5AVC B;  2ARO D;  1KX5 D;  5GT0 C;  3IP4 C;  2NZD A;  3LEL A;  5B24 B;  4WV4 B;  5B0Y B;  5AY8 B;  5B2I D;  2F8N B;  3C1B B;  3AZF B;  2Y2M A;  2J8P A;  4LD9 D;  3KUY B;  3REH A;  1P3O A;  3NQJ A;  5B0Z D;  5CPJ B;  3AZK C;  5GXQ C;  4AWL C;  2JCH A;  3O62 D;  3REJ B;  3WA9 C;  3UTB C;  3AZK D;  5AV9 C;  4ZUX C;  2F8N G;  4HGA C;  2NZD D;  2HIO A;  3KWQ D;  3V9R B;  3UT9 D;  3H0M C;  3X1T C;  1KU5 A;  5B31 D;  4NE5 A;  3W96 A;  5GT3 A;  3B0B A;  2ARO A;  2NQB B;  2RVQ D;  1KX5 A;  1ZLA B;  3WAA D;  5BO0 B;  2G5H C;  3X1S A;  5F99 B;  4J8X B;  3WKJ B;  5AV8 D;  4LD9 A;  5B0Z A;  3AZH C;  3B0D B;  4Z5T A;  3AZE D;  3MNN B;  3H0L C;  2W8S A;  5GSU B;  2HUE B;  3B6G D;  5DNM C;  3REI D;  5CPK B;  3O62 A;  4CSR A;  3AZI D;  5AV6 B;  2Y2H A;  3W97 A;  5B1M C;  5B40 D;  1P3G B;  5DNM D;  5B1M D;  3AYW D;  3MGQ B;  1U35 D;  3KWQ A;  1ID3 B;  3REL C;  1M18 B;  2BYM A;  4KHA A;  3REK C;  5AVB B;  3VH6 A;  4E45 A;  3REK D;  4J8U A;  5B31 A;  1P3A C;  1P3L D;  1HQ3 C;  2PYO C;  3P5J B;  1N1J A;  4G91 C;  1KX4 D;  3FDD A;  3WAA A;  3MGS A;  3LZ1 A;  4JJN B;  4XZQ A;  4DRB A;  5AV8 A;  1F66 A;  1M1A D;  1AOI B;  1TZY D;  3AZE A;  2Y2I A;  1S32 C;  4WJ3 C;  3B6G A;  5B40 A;  1EQZ A;  3AZN B;  2HIO B;  1U35 A;  3KXB C;  1JFI A;  5B2J B;  3UTA D;  3EG5 B;  4XUJ D;  3X1V C;  1Q9C A;  1P3F D;  2ZY2 A;  3AV1 B;  2Y2L A;  4WU9 D;  3W96 B;  3AFA C;  3AZM C;  1P3L A;  5CPJ A;  2ARO B;  3AZL C;  3AFA D;  3A1K A;  1KX5 B;  3AN2 C;  3AZL D;  1KX4 A;  2BG1 A;  3X1S B;  3AN2 D;  5B2I B;  5CPI C;  5B1L C;  3W99 C;  3C1C C;  4LD9 B;  5B1L D;  5B0Z B;  3W99 D;  5E5A D;  1M19 C;  1M1A A;  1P3B D;  2DF4 C;  1M19 D;  1TZY A;  2CV5 C;  4J8V D;  3AV2 A;  3O62 B;  4CSR B;  3AZK B;  3W97 B;  2XD1 A;  4Z2M G;  4YM6 C;  1P3I D;  3B6F C;  2F2A C;  2NZD B;  4X23 C;  4YM6 D;  3KWQ B;  1P34 A;  2BYM B;  4KHA B;  3UT9 B;  5BO0 A;  3UTA A;  5B31 B;  4XUJ A;  3VH5 W;  5F99 A;  5CP6 C;  5B32 C;  3WKJ A;  4WU9 A;  2FJ7 A;  4KUD C;  1N1J B;  3X1U C;  5GSU A;  3WAA B;  3MGS B;  3AZJ D;  1P3G A;  3LZ1 B;  3WTP D;  3KSY A;  4XZQ B;  5AV8 B;  3MGP C;  4Z66 D;  1ID3 A;  1P3K D;  5C3I C;  5E5A A;  3AZE B;  4H9R A;  5JRG D;  3LEL C;  5AVB A;  3MGP D;  1P3B A;  4J8V A;  3B6G B;  5AV5 D;  3REI B;  3AZI B;  5B40 B;  5BNV A;  5DNM B;  5B33 D;  1P3I A;  1TAF A;  4DRA A;  1ULY A;  5B1M B;  3AYW B;  1U35 B;  3W98 C;  1JFI B;  5GT0 D;  3W98 D;  4QLC C;  3REK B;  4JJN A;  4H9Q A;  1P3L B;  3KFU G;  3VH5 T;  1AOI A;  3MVD C;  1KX4 B;  4ZBJ B;  4H9O B;  3WTP E;  4YS3 C;  5GXQ D;  3H0R C;  2Y2N A;  3AZJ A;  3WA9 D;  3UTB D;  3AZN A;  3WTP A;  5AV9 D;  1P3M C;  4ZUX D;  5GT3 C;  4Z66 A;  1P3K A;  1M1A B;  3MGR C;  1HTA A;  1TZY B;  4H9N A;  5JRG A;  5B2J A;  2IO5 B;  3AV2 B;  2BYK B;  5AV5 A;  3X1T D;  5JA4 A;  3AV1 A;  5B33 A;  1P34 B;  1WWI A;  2ZY5 A;  5GT0 A;  3UTA B;  4XUJ B;  5B2I A;  1P3F B;  3A1I A;  4WU9 B;  2FJ7 B;  3NQU B;  1A7W A;  3EPK A;  3AZH D;  4WU8 C;  3EPJ A;  4J8U C;  3AZK A;  2L5A A;  5GXQ A;  3WA9 A;  3UTB A; 
#chains in the Genus database with same CATH homology
 5AV9 A;  3A6N C;  4ZUX A;  5B1L B;  5E5A B;  4H9R B;  3UT9 A;  1P3B B;  3REL D;  4J8W C;  1M19 B;  4J8V B;  3LJA C;  3X1T A;  5BNV B;  1P3I B;  1TAF B;  3LJA D;  2FFF B;  1P3A D;  4EO5 C;  2F8N K;  3TU4 C;  3LZ0 C;  1HQ3 D;  1KX3 C;  2PYO D;  5FUG B;  4KGC C;  3AZG C;  2UWX A;  3LZ0 D;  1P3P C;  4R8P C;  5KDM A;  1EQZ C;  4H9Q B;  5AVC C;  4R8P D;  3B0C W;  2JSS A;  1WWS A;  5G49 B;  5B24 C;  5B0Y C;  5AY8 C;  3REI A;  3C1B C;  3AZI A;  3AZJ B;  1S32 D;  3AZF C;  5DNM A;  3KUY C;  3WTP B;  5B1M A;  3AYW A;  4Z66 B;  5BT1 C;  1P3K B;  4H9N B;  5JRG B;  3KXB D;  3REJ C;  3REL A;  3REK A;  5AV5 B;  5JA4 B;  3X1V D;  4H9S C;  5B33 B;  3EPH A;  4WZS B;  1P3A A;  3VH6 T;  5DNN C;  3AZM D;  1HQ3 A;  2PYO A;  3AL0 C;  4H9O A;  5DNN D;  5GT0 B;  3W98 B;  2YFW A;  4G92 C;  5CPI D;  2NQB C;  3C1C D;  1ZLA C;  4DQY B;  3B0C T;  2BYK A;  1T3U A;  2CWE A;  5GXQ B;  1W2E A;  4AWL B;  4E44 A;  4J8X C;  2CV5 D;  1S32 A;  3WKJ C;  3WA9 B;  3UTB B;  2LY8 A;  5AV9 B;  4ZUX B;  3B6F D;  4HGA B;  4X23 D;  3MNN C;  2F8N H;  5GSU C;  2HUE C;  5CPK C;  3KXB A;  5BS7 A;  1P3G C;  5AV6 C;  2YFV A;  3X1T B;  1P3F A;  2XD5 A;  2Y2J A;  3MGQ C;  3X1V A;  3NQU A;  5CP6 D;  1ID3 C;  5B32 D;  1M18 C;  3AFA A;  3AZM A;  1M18 D;  4KUD D;  3AZL A;  3X1U D;  5KDM B;  3AN2 A;  5CPI A;  5B1L A;  3W99 A;  3C1C A;  1M19 A;  3AZH B;  3LEL D;  1B6W A;  1B67 A;  2CV5 A;  3REH C;  1P3O C;  1Z2C B;  4UPK A;  4YM6 A;  3REH D;  1P3O D;  1AOI C;  3B6F A;  5FUG A;  4X23 A;  3REL B;  4QLC D;  3AZN C;  2HIO C;  3R45 A;  3LJA B;  5CP6 A;  1P3A B;  5B32 A;  1HQ3 B;  5G49 A;  2PYO B;  4EO5 B;  2VQR A;  4KUD A;  3MVD D;  2YFW B;  4G91 B;  4H9P B;  3X1U A;  4YS3 D;  3W96 C;  1PZR A;  4UUZ A;  2ARO C;  1BH8 A;  1KX5 C;  1P3M D;  5GT3 D;  3MGP A;  3X1S C;  4WNN A;  3MGR D;  5B2I C;  3X1S D;  1S32 B;  4LD9 C;  5B0Z C;  4Z5T C;  5BNX A;  4Z5T D;  3O62 C;  3KXB B;  3W98 A;  3W97 C;  2YFV B;  2NZD C;  4QLC A;  3X1V B;  3W97 D;  3KWQ C;  2ZY3 A;  3UT9 C;  3AFA B;  3AZM B;  3AZL B;  5DNN B;  5B31 C;  3MVD A;  4WU8 D;  3AN2 B;  4J8U D;  4YS3 A;  4G92 B;  5CPI B;  3W99 B;  2RVQ C;  3C1C B;  3WAA C;  4CAY A;  3A6N D;  3MGS C;  1BH9 A;  2JE5 A;  1P3M A;  3LZ1 C;  3MGS D;  3MGR A;  1H3O A;  4J8W D;  3VH6 W;  2CV5 B;  4XZQ C;  3LZ1 D;  5AV8 C;  1F66 C;  4XZQ D;  4Z2M H;  4YM6 B;  3AZE C;  1F66 D;  3B6F B;  4X23 B;  1BFM A;  3TU4 D;  3B6G C;  1KX3 D;  4KGC D;  3REI C;  3AZI C;  3AZG D;  1P3P D;  5B40 C;  3R45 B;  3AYW C;  1U35 C;  2Y2P A;  5CP6 B;  1EQZ D;  5B32 B;  5AVC D;  3AZH A;  4KUD B;  5B24 D;  5B0Y D;  5AY8 D;  3X1U B;  4WU8 A;  2F8N D;  3C1B D;  2DQN C;  3AZF D;  1P3L C;  4UUZ B;  3KUY D;  5CPJ C;  1BH8 B;  5B32 G;  5CPJ D;  3MGP B;  4ZBJ C;  1KX4 C;  2Y2Q A;  5BT1 D;  4WNN B;  3A6N A;  5C3I B;  3LEL B;  3REJ D;  4J8W A;  3LJA A;  3REH B;  1P3O B;  5BNX B;  1M1A C;  3NQJ B;  1TZY C;  2IO5 C;  3TU4 A;  3AV2 C;  3LZ0 A;  1KX3 A;  4KGC A;  4H9P A;  3AV2 D;  3AZG A;  1P3P A;  4QLC B;  1P34 C;  4R8P A;  2ZY4 A;  1P34 D;  5AVC A;  2NQB D;  5BS7 C;  3UTA C;  1ZLA D;  4XUJ C;  3MVD B;  5B24 A;  5F99 C;  5B0Y A;  5AY8 A;  1P3F C;  4YS3 B;  4WU9 C;  2FJ7 C;  5F99 D;  2F8N A;  3C1B A;  4J8X D;  5CHL B;  3WKJ D;  3AZF A;  3B0D C;  2FJ7 D;  3KUY A;  2G5I C;  1P3M B;  4CAY B;  1BH9 B;  5GT3 B;  3MNN D;  5GSU D;  3MGR B;  1R4V A;  1H3O B;  5CPK D;  2ZM5 A;  3REJ A;  1P3G D;  5AV6 D;  5E5A C;  2Y2G A;  3MGQ D;  4H9S A;  1ID3 D;  5AVB C;  1P3B C;  3V9R A;  4Z5T B;  4J8V C;  5AVB D;  5DNN A;  3EPL A;  1P3I C;  1F1E A;  2NQB A;  1ZLA A;  3VH5 A;  4JJN C;  4NE3 A;  4WU8 B;  4J8U B;  4JJN D;  2Y2K A;  4J8X A;  2RIQ A;  3F6T A;  2Y2O A;  4NFT A;  1AOI D;  3A6N B;  3MNN A;  3AZJ C;  4J8W B;  5CPK A;  3WTP C;  5AV6 A;  5B31 G;  2HIO D;  4Z66 C;  3AZN D;  1P3K C;  3MGQ A;  1F66 B;  5JRG C;  5B2J C;  3TU4 B;  1M18 A;  4M6B A;  3LZ0 B;  1KX3 B;  5AV5 C;  5B2J D;  4KGC B;  3AZG B;  3AV1 C;  1P3P B;  5B33 C;  3AV1 D;  4R8P B;  4NE6 A;  3W96 D;  1EQZ B;  5AVC B;  2ARO D;  1KX5 D;  5GT0 C;  3IP4 C;  2NZD A;  3LEL A;  5B24 B;  4WV4 B;  5B0Y B;  5AY8 B;  5B2I D;  2F8N B;  3C1B B;  3AZF B;  2Y2M A;  2J8P A;  4LD9 D;  3KUY B;  3REH A;  1P3O A;  3NQJ A;  5B0Z D;  5CPJ B;  3AZK C;  5GXQ C;  4AWL C;  2JCH A;  3O62 D;  3REJ B;  3WA9 C;  3UTB C;  3AZK D;  5AV9 C;  4ZUX C;  2F8N G;  4HGA C;  2NZD D;  2HIO A;  3KWQ D;  3V9R B;  3UT9 D;  3H0M C;  3X1T C;  1KU5 A;  5B31 D;  4NE5 A;  3W96 A;  5GT3 A;  3B0B A;  2ARO A;  2NQB B;  2RVQ D;  1KX5 A;  1ZLA B;  3WAA D;  5BO0 B;  2G5H C;  3X1S A;  5F99 B;  4J8X B;  3WKJ B;  5AV8 D;  4LD9 A;  5B0Z A;  3AZH C;  3B0D B;  4Z5T A;  3AZE D;  3MNN B;  3H0L C;  2W8S A;  5GSU B;  2HUE B;  3B6G D;  5DNM C;  3REI D;  5CPK B;  3O62 A;  4CSR A;  3AZI D;  5AV6 B;  2Y2H A;  3W97 A;  5B1M C;  5B40 D;  1P3G B;  5DNM D;  5B1M D;  3AYW D;  3MGQ B;  1U35 D;  3KWQ A;  1ID3 B;  3REL C;  1M18 B;  2BYM A;  4KHA A;  3REK C;  5AVB B;  3VH6 A;  4E45 A;  3REK D;  4J8U A;  5B31 A;  1P3A C;  1P3L D;  1HQ3 C;  2PYO C;  3P5J B;  1N1J A;  4G91 C;  1KX4 D;  3FDD A;  3WAA A;  3MGS A;  3LZ1 A;  4JJN B;  4XZQ A;  4DRB A;  5AV8 A;  1F66 A;  1M1A D;  1AOI B;  1TZY D;  3AZE A;  2Y2I A;  1S32 C;  4WJ3 C;  3B6G A;  5B40 A;  1EQZ A;  3AZN B;  2HIO B;  1U35 A;  3KXB C;  1JFI A;  5B2J B;  3UTA D;  3EG5 B;  4XUJ D;  3X1V C;  1Q9C A;  1P3F D;  2ZY2 A;  3AV1 B;  2Y2L A;  4WU9 D;  3W96 B;  3AFA C;  3AZM C;  1P3L A;  5CPJ A;  2ARO B;  3AZL C;  3AFA D;  3A1K A;  1KX5 B;  3AN2 C;  3AZL D;  1KX4 A;  2BG1 A;  3X1S B;  3AN2 D;  5B2I B;  5CPI C;  5B1L C;  3W99 C;  3C1C C;  4LD9 B;  5B1L D;  5B0Z B;  3W99 D;  5E5A D;  1M19 C;  1M1A A;  1P3B D;  2DF4 C;  1M19 D;  1TZY A;  2CV5 C;  4J8V D;  3AV2 A;  3O62 B;  4CSR B;  3AZK B;  3W97 B;  2XD1 A;  4Z2M G;  4YM6 C;  1P3I D;  3B6F C;  2F2A C;  2NZD B;  4X23 C;  4YM6 D;  3KWQ B;  1P34 A;  2BYM B;  4KHA B;  3UT9 B;  5BO0 A;  3UTA A;  5B31 B;  4XUJ A;  3VH5 W;  5F99 A;  5CP6 C;  5B32 C;  3WKJ A;  4WU9 A;  2FJ7 A;  4KUD C;  1N1J B;  3X1U C;  5GSU A;  3WAA B;  3MGS B;  3AZJ D;  1P3G A;  3LZ1 B;  3WTP D;  3KSY A;  4XZQ B;  5AV8 B;  3MGP C;  4Z66 D;  1ID3 A;  1P3K D;  5C3I C;  5E5A A;  3AZE B;  4H9R A;  5JRG D;  3LEL C;  5AVB A;  3MGP D;  1P3B A;  4J8V A;  3B6G B;  5AV5 D;  3REI B;  3AZI B;  5B40 B;  5BNV A;  5DNM B;  5B33 D;  1P3I A;  1TAF A;  4DRA A;  1ULY A;  5B1M B;  3AYW B;  1U35 B;  3W98 C;  1JFI B;  5GT0 D;  3W98 D;  4QLC C;  3REK B;  4JJN A;  4H9Q A;  1P3L B;  3KFU G;  3VH5 T;  1AOI A;  3MVD C;  1KX4 B;  4ZBJ B;  4H9O B;  3WTP E;  4YS3 C;  5GXQ D;  3H0R C;  2Y2N A;  3AZJ A;  3WA9 D;  3UTB D;  3AZN A;  3WTP A;  5AV9 D;  1P3M C;  4ZUX D;  5GT3 C;  4Z66 A;  1P3K A;  1M1A B;  3MGR C;  1HTA A;  1TZY B;  4H9N A;  5JRG A;  5B2J A;  2IO5 B;  3AV2 B;  2BYK B;  5AV5 A;  3X1T D;  5JA4 A;  3AV1 A;  5B33 A;  1P34 B;  1WWI A;  2ZY5 A;  5GT0 A;  3UTA B;  4XUJ B;  5B2I A;  1P3F B;  3A1I A;  4WU9 B;  2FJ7 B;  3NQU B;  1A7W A;  3EPK A;  3AZH D;  4WU8 C;  3EPJ A;  4J8U C;  3AZK A;  2L5A A;  5GXQ A;  3WA9 A;  3UTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...