5AV5C

Human nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av5C00
3MVDC 1HTAA 3WAAB 4G91C 4YS3B 3MVDA 1B67A 5B0ZC 5CPJD 4H9SC 3KWQB 1HQ3C 4H9SA 4WU9B 1P3MD 2F8NH 1HQ3A 1EQZC 3TU4C 4JJNC 5AV6B 5AV9B 5B31D 4XZQB 1P3PB 1EQZA 3TU4A 4JJNA 3C1CC 2CV5C 2F8NK 3X1SB 4R8PB 3R45A 4WNNA 4LD9B 3C1CA 3B0CW 2CV5A 3X1VC 2NQBD 4WU8B 3W97D 5JRGD 1ZLAD 3MGPC 2HIOC 1ID3B 3X1UC 1P3LD 5B33D 3MGPA 1P3IC 3UTAD 2HIOA 3LZ1C 4H9QB 3X1UA 3LZ0B 1P3IA 2HUEB 3LZ1A 5B24D 5BO0B 5AVCB 2RVQC 3C1CD 4H9NB 5B2JB 3WA9D 3NQJA 3REKD 3B6GC 5B0YB 3A6ND 1JFIB 3B6GA 3RELA 3MGPD 3B6FC 5B32C 3LELA 5AVBD 4WU9C 3B6FA 5B32A 3AZIB 1TZYB 5C3IC 2IO5B 1M1AC 4QLCC 2FJ7B 1BH8B 1M1AA 4QLCA 2NZDB 5AV8B 5DNNC 5CP6C 3RELD 3B6GD 4J8WB 5CPIC 3AZKD 2BYMA 4NFTA 5AY8C 3LELD 5DNNA 3AV1A 5CP6A 3LJAB 3AZJB 2AROB 5B2ID 5CPIA 4NE6A 5AY8A 3VH6T 3AN2C 2PYOC 1BFMA 3W99C 3UTBA 1P3OC 4YM6A 1KX5D 2PYOA 1P3OA 3W99A 5GXQC 5GT3D 1M1AD 1F66C 3VH6A 4QLCD 5GXQA 1F66A 2YFWB 4ZUXA 3AV1D 3O62C 4Z5TD 3MGSC 3AZHD 4DRBA 3O62A 4J8UB 3MVDB 3UTBD 3MGSA 4YM6D 4J8VC 4G91B 5E5AC 3AZGD 3AZFD 4EO5C 1H3OA 5B0ZB 3W98C 4J8VA 1KX3D 5E5AA 3W96D 5BT1C 3W98A 1HQ3B 5B1LC 3AZLD 4ZUXD 1AOIC 1P3FD 5F99D 5B1LA 2F8ND 3KXBA 4J8XA 1EQZB 4ZBJC 3TU4B 4JJNB 1AOIA 1P3GC 3MGSD 1P3GA 3R45B 4WNNB 1P34D 3C1CB 2CV5B 4J8VD 3X1VB 5CPJC 3MGPB 5B1LD 3KXBD 4J8XD 2HIOB 4KHAA 1BH9A 3X1UB 1P3IB 1P3MC 3LZ1B 1P3GD 5B31C 4KUDA 3NQJB 5B31A 3X1TD 4M6BA 3B6GB 5FUGA 3LELB 2NQBC 3W97C 5JRGC 4Z66D 3REJC 5B32B 1ZLAC 3B6FB 3WKJD 2NQBA 3W97A 5JRGA 3REJA 1P3LC 5B33C 1ZLAA 4X23D 3UTAC 3MGRD 4KUDD 5C3IB 1P3LA 5B33A 1M1AB 3UTAA 4QLCB 2BYKA 1KX4D 5B24C 4G92C 1M19C 3WTPC 2BYMB 3AV1B 5B24A 1M18C 5DNNB 1M19A 5CP6B 3WA9C 3WTPA 3REKC 5CPIB 3VH5A 1M18A 5AY8B 3WA9A 3A6NC 3REKA 4YM6B 1WWIA 1Q9CA 3REJD 3AN2B 2PYOB 3REHD 3A6NA 1P3OB 3W99B 5AVBC 3UT9A 5GXQB 1F66B 5AVBA 4ZUXB 4H9OA 1M19D 2CWEA 3WTPD 1M18D 3O62B 4AWLC 3MGSB 3RELC 1S32D 3AZKC 3B0CT 1H3OB 3LELC 3AZMD 4J8VB 5E5AB 5B2IC 4EO5B 3MGQD 3REID 2LY8A 3UT9D 3AZKA 3AZED 1U35D 1P3AD 3W98B 5B1MD 1KX5C 4DRAA 5B2IA 5B1LB 1P3BD 4J8XB 1KX5A 3AFAD 5GT3C 1AOIB 1WWSA 5DNMD 4ZBJB 5GT3A 1P3GB 3MNNC 3AV1C 4Z5TC 3C1BC 3AZHC 5JA4A 3MNNA 1TAFA 4Z5TA 3WAAA 3C1BA 4KGCC 3UTBC 4YM6C 3AZHA 3AV2D 5BNXA 3AZFC 3AZGC 4KGCA 4CSRA 4XUJD 5AV5D 1KX3C 3AZGA 4KHAB 1BH9B 3AZFA 3W96C 5CPJB 1KX3A 3AYWD 3W96A 3AZLC 5B32G 4ZUXC 1P3MB 1P3FC 5F99C 4E45A 3AZLA 5GT0C 1P3FA 3MNND 5F99A 5B31B 5B40C 3C1BD 2F8NA 3WAAD 5GT0A 4YS3D 1R4VA 4KGCD 5B40A 5FUGB 1P34C 3KWQD 3KSYA 1P34A 4WU8A 2NQBB 1KU5A 3W97B 5JRGB 3REJB 1ZLAB 3KXBC 4J8XC 5AV6D 5AV9D 4XZQD 1P3PD 1P3LB 5B33B 3UTAB 5GT0D 2BYKB 1N1JA 5B40D 3X1SD 4R8PD 5BO0A 5B24B 4LD9D 4G92B 1M19B 4NE3A 3AZNC 1P3KC 3WTPB 3X1TC 1M18B 4WU8D 3WA9B 3AZNA 1P3KA 3REKB 3X1TA 1JFIA 1ID3D 3A6NB 4Z66C 3LZ0D 3WKJC 3B0BA 3V9RA 5AVBB 4Z66A 5AVCD 4H9OB 4X23C 3WKJA 3MGRC 4KUDC 5BNVA 5B2JD 4X23A 3MGRA 4E44A 3AZND 1KX4C 1P3KD 2NZDA 4AWLB 1KX4A 4J8WA 3RELB 3AZKB 4H9PA 3AZID 5B2IB 3REHC 1KX5B 2FJ7D 5GSUC 5KDMA 3REHA 2NZDD 5AV8D 5GT3B 3NQUA 5GSUA 3VH5T 4CAYA 4J8WD 1B6WA 5G49A 3LJAD 5JA4B 3MNNB 1TAFB 2AROD 4Z5TB 3C1BB 3AZJD 4J8UA 5B31G 3AZHB 5BNXB 4KGCB 4CSRB 1S32C 3AZMC 3UTBB 3AZFB 3AZGB 5B0ZA 1A7WA 1S32A 3AZEC 3REIC 3MGQC 3AZMA 3UT9C 1U35C 1P3AC 5CPKC 1KX3B 4HGAC 5GSUD 5B1MC 3W96B 3AZEA 1F1EA 3MGQA 4UUZA 3REIA 1U35A 1P3AA 5CPKA 5B1MA 3AZLB 1P3BC 3AFAC 5BS7C 1P3FB 5DNMC 5F99B 2F8NB 4H9RA 1P3BA 3KUYC 5GT0B 3AFAA 5BS7A 3MVDD 4J8UD 5DNMA 5B40B 4Z2MG 3KUYA 5B0ZD 1P34B 2YFVA 3AV2C 1HQ3D 3X1VA 5CPKD 4XUJC 5AV5C 3AV2A 1EQZD 4XUJA 3TU4D 3KXBB 5AV5A 4JJND 3AYWC 1N1JB 3KUYD 3AYWA 3B0DC 2CV5D 3WAAC 4YS3C 3AZNB 1P3KB 3X1VD 3X1TB 4YS3A 3VH6W 2HIOD 3KWQC 3X1UD 1P3ID 3KWQA 3V9RB 3LZ1D 4Z66B 4WU9A 3WKJB 5AV6C 5AV9C 5BNVB 4XZQC 1P3PC 4X23B 2RVQD 5AV6A 5AV9A 3MGRB 4KUDB 4XZQA 1P3PA 3X1SC 2JSSA 4R8PC 1ULYA 1KX4B 4LD9C 3X1SA 4WV4B 4R8PA 4H9PB 4WU8C 4NE5A 4LD9A 3B6FD 5B32D 4WU9D 1ID3C 3AN2A 4Z2MH 3REHB 5KDMB 1ID3A 3LZ0C 2HUEC 3NQUB 5GSUB 4H9QA 3LZ0A 5AVCC 4CAYB 5CHLB 2L5AA 5G49B 5DNND 5CP6D 5B2JC 5AVCA 4H9NA 5CPID 5AY8D 4WZSB 5B2JA 5B0YC 2F8NG 3AN2D 2PYOD 5B0YA 3W99D 1P3OD 1S32B 3AZMB 3AZIC 1TZYC 5GXQD 3AZEB 3REIB 3MGQB 4UUZB 3UT9B 1U35B 1P3AB 1F66D 5CPKB 2IO5C 4HGAB 5B1MB 3AZIA 1TZYA 2FJ7C 4H9RB 1P3BB 3O62D 3AFAB 5AV8C 3WTPE 2FJ7A 2NZDC 5DNMB 1BH8A 3KUYB 5AV8A 4J8WC 5B0YD 5E5AD 3LJAC 3AZJC 2AROC 2YFVB 3W98D 3LJAA 3AZJA 2AROA 5BT1D 1TZYD 3AV2B 4XUJB 5CPJA 5AV5B 1AOID 3AYWB 1P3MA 3VH5W 2YFWA 3B0DB 4J8UC
chains in the Genus database with same CATH superfamily
3MVDC 2RIQA 1HTAA 3WAAB 4G91C 4YS3B 3MVDA 1B67A 5B0ZC 5CPJD 4H9SC 2W8SA 3KWQB 1HQ3C 4H9SA 4WU9B 1P3MD 2F8NH 1HQ3A 1EQZC 3TU4C 4JJNC 5AV6B 5AV9B 5B31D 4XZQB 1P3PB 1EQZA 3TU4A 4JJNA 2ZY4A 3C1CC 2CV5C 3X1SB 2F8NK 4R8PB 3R45A 4WNNA 4LD9B 3C1CA 3B0CW 2CV5A 3X1VC 2NQBD 4WU8B 3W97D 2F2AC 5JRGD 1ZLAD 3MGPC 2HIOC 1ID3B 3X1UC 1P3LD 5B33D 3MGPA 1P3IC 3UTAD 2Y2KA 2HIOA 3LZ1C 4H9QB 3X1UA 3LZ0B 1P3IA 2HUEB 3LZ1A 5B24D 5BO0B 5AVCB 2RVQC 3C1CD 3EG5B 4H9NB 5B2JB 3WA9D 3NQJA 3REKD 3B6GC 5B0YB 3A6ND 1JFIB 3B6GA 3RELA 3MGPD 3B6FC 5B32C 3LELA 5AVBD 4WU9C 3B6FA 5B32A 3AZIB 1TZYB 5C3IC 2IO5B 1M1AC 4QLCC 2FJ7B 2Y2LA 1BH8B 1M1AA 4QLCA 2NZDB 5AV8B 1W2EA 5DNNC 5CP6C 3RELD 3B6GD 4J8WB 5CPIC 3AZKD 2BYMA 4NFTA 5AY8C 3LELD 5DNNA 3AV1A 5CP6A 3LJAB 3AZJB 2AROB 5B2ID 5CPIA 4NE6A 5AY8A 3VH6T 3AN2C 2PYOC 3KFUG 1BFMA 3AL0C 3W99C 3UTBA 1P3OC 4YM6A 1KX5D 2PYOA 1P3OA 3W99A 5GXQC 5GT3D 1M1AD 1F66C 3VH6A 4QLCD 5GXQA 1F66A 2YFWB 4ZUXA 3AV1D 3O62C 4Z5TD 4WJ3C 3MGSC 3AZHD 4DRBA 3O62A 4J8UB 3MVDB 3UTBD 3MGSA 4YM6D 4J8VC 4G91B 5E5AC 3AZGD 3AZFD 4EO5C 1H3OA 5B0ZB 3W98C 4J8VA 1KX3D 5E5AA 2Y2OA 3W96D 5BT1C 3W98A 1HQ3B 5B1LC 3AZLD 4ZUXD 1AOIC 1P3FD 5F99D 5B1LA 2F8ND 3KXBA 4J8XA 1EQZB 4ZBJC 3TU4B 4JJNB 1AOIA 1P3GC 3MGSD 1P3GA 3R45B 4WNNB 1P34D 3C1CB 2CV5B 4J8VD 3X1VB 5CPJC 3MGPB 5B1LD 2JCHA 3KXBD 2HIOB 4J8XD 4KHAA 1BH9A 3X1UB 1P3IB 1P3MC 3LZ1B 2Y2PA 1P3GD 5B31C 4KUDA 2FFFB 3NQJB 5B31A 3X1TD 3EPKA 4M6BA 3B6GB 5FUGA 3A1IA 3LELB 2NQBC 3W97C 5JRGC 4Z66D 3REJC 5B32B 1ZLAC 3B6FB 2DF4C 3WKJD 2NQBA 3W97A 5JRGA 3REJA 1P3LC 5B33C 1ZLAA 4X23D 3UTAC 3MGRD 4KUDD 5C3IB 1P3LA 5B33A 1M1AB 3UTAA 4QLCB 2BYKA 1KX4D 3H0MC 5B24C 4G92C 1M19C 2Y2MA 3WTPC 2BYMB 3AV1B 5B24A 1M18C 5DNNB 1M19A 5CP6B 3F6TA 3WA9C 3WTPA 3REKC 5CPIB 3VH5A 1M18A 5AY8B 3WA9A 3A6NC 3REKA 4YM6B 1WWIA 1Q9CA 3REJD 3AN2B 2PYOB 3REHD 3A6NA 1P3OB 3W99B 5AVBC 2ZY5A 3UT9A 5GXQB 1F66B 5AVBA 4ZUXB 4H9OA 1M19D 2CWEA 3WTPD 1M18D 3O62B 4AWLC 3IP4C 2Y2IA 3MGSB 3RELC 1S32D 3AZKC 3B0CT 1H3OB 3LELC 3AZMD 4J8VB 5E5AB 5B2IC 4EO5B 3MGQD 3REID 2LY8A 3UT9D 3AZKA 3A1KA 3AZED 1U35D 1P3AD 3W98B 5B1MD 1KX5C 4DRAA 5B2IA 5B1LB 1P3BD 4J8XB 1KX5A 3AFAD 5GT3C 1AOIB 1WWSA 5DNMD 4ZBJB 5GT3A 1P3GB 3MNNC 3AV1C 4Z5TC 3C1BC 3AZHC 3H0LC 5JA4A 3MNNA 1TAFA 4Z5TA 3WAAA 3C1BA 4KGCC 3UTBC 4YM6C 3AZHA 3AV2D 5BNXA 3AZFC 3AZGC 4KGCA 4CSRA 4XUJD 5AV5D 1KX3C 3AZGA 4KHAB 1BH9B 3AZFA 3W96C 5CPJB 1KX3A 3AYWD 3W96A 3AZLC 5B32G 4ZUXC 1P3MB 1P3FC 5F99C 4E45A 3AZLA 5GT0C 1P3FA 3MNND 5F99A 5B31B 5B40C 3C1BD 2F8NA 3WAAD 5GT0A 4YS3D 1R4VA 4KGCD 5B40A 5FUGB 1P34C 3EPHA 3KWQD 3KSYA 1P34A 4WU8A 2NQBB 1KU5A 3W97B 5JRGB 3REJB 1ZLAB 3KXBC 4J8XC 5AV6D 5AV9D 4XZQD 1P3PD 1P3LB 5B33B 3UTAB 5GT0D 2BYKB 1N1JA 5B40D 4UPKA 3X1SD 4R8PD 5BO0A 5B24B 4LD9D 4G92B 1M19B 4NE3A 3AZNC 1P3KC 3WTPB 3X1TC 1M18B 4WU8D 3WA9B 3AZNA 1P3KA 3REKB 3X1TA 1JFIA 1ID3D 3A6NB 2DQNC 4Z66C 3LZ0D 3WKJC 3B0BA 3V9RA 5AVBB 4Z66A 5AVCD 4H9OB 4X23C 3WKJA 3MGRC 4KUDC 4DQYB 5BNVA 5B2JD 4X23A 3MGRA 2UWXA 4E44A 3AZND 1KX4C 1P3KD 2NZDA 4AWLB 1KX4A 4J8WA 3RELB 2XD5A 2BG1A 3AZKB 4H9PA 3AZID 5B2IB 3REHC 1KX5B 2FJ7D 5GSUC 5KDMA 3REHA 2NZDD 5AV8D 5GT3B 3NQUA 5GSUA 3VH5T 3EPLA 4CAYA 2XD1A 4J8WD 2Y2JA 1B6WA 5G49A 3EPJA 3LJAD 5JA4B 3MNNB 1TAFB 2AROD 4Z5TB 3C1BB 3AZJD 4J8UA 5B31G 3AZHB 5BNXB 4KGCB 4CSRB 1S32C 3AZMC 3UTBB 3AZFB 3AZGB 5B0ZA 1A7WA 1S32A 3AZEC 3REIC 3MGQC 3AZMA 3UT9C 1U35C 2VQRA 1P3AC 5CPKC 1KX3B 4HGAC 5GSUD 5B1MC 3W96B 3AZEA 1F1EA 3MGQA 4UUZA 3REIA 1U35A 1P3AA 5CPKA 5B1MA 3AZLB 1P3BC 3AFAC 5BS7C 1P3FB 5DNMC 5F99B 2F8NB 4H9RA 1P3BA 3KUYC 5GT0B 3AFAA 5BS7A 3MVDD 4J8UD 5DNMA 5B40B 4Z2MG 3KUYA 5B0ZD 1P34B 2YFVA 3AV2C 1HQ3D 3X1VA 5CPKD 4XUJC 5AV5C 3AV2A 2ZM5A 1EQZD 4XUJA 3TU4D 3KXBB 5AV5A 4JJND 3AYWC 2Y2NA 1N1JB 2G5IC 3KUYD 3AYWA 3B0DC 2CV5D 3WAAC 4YS3C 3AZNB 1P3KB 3X1VD 3X1TB 2Y2QA 4YS3A 1PZRA 3VH6W 2HIOD 3KWQC 3X1UD 1P3ID 3KWQA 3V9RB 3LZ1D 4Z66B 4WU9A 3WKJB 5AV6C 5AV9C 2G5HC 5BNVB 4XZQC 1P3PC 4X23B 2RVQD 5AV6A 5AV9A 3MGRB 4KUDB 4XZQA 1P3PA 3X1SC 2JSSA 4R8PC 1ULYA 1KX4B 4LD9C 3X1SA 4WV4B 4R8PA 3H0RC 2J8PA 4H9PB 4NE5A 4WU8C 4LD9A 3B6FD 5B32D 4WU9D 2ZY3A 1ID3C 3AN2A 4Z2MH 3REHB 5KDMB 1ID3A 3LZ0C 2HUEC 3NQUB 5GSUB 4H9QA 3LZ0A 5AVCC 4CAYB 5CHLB 2L5AA 5G49B 5DNND 5CP6D 5B2JC 5AVCA 4H9NA 5CPID 5AY8D 4WZSB 5B2JA 5B0YC 2F8NG 3AN2D 2PYOD 5B0YA 3W99D 1P3OD 1S32B 3AZMB 2JE5A 2Y2HA 3AZIC 1TZYC 3P5JB 5GXQD 3REIB 3MGQB 4UUZB 3UT9B 3AZEB 1U35B 1P3AB 5CPKB 1F66D 2IO5C 4HGAB 5B1MB 3AZIA 1TZYA 2FJ7C 4H9RB 1P3BB 3O62D 3AFAB 5AV8C 3WTPE 2FJ7A 2NZDC 5DNMB 1T3UA 1BH8A 3KUYB 5AV8A 4J8WC 5B0YD 2ZY2A 5E5AD 3LJAC 3AZJC 2AROC 2YFVB 3W98D 3LJAA 3AZJA 2AROA 5BT1D 1TZYD 3FDDA 3AV2B 4XUJB 5CPJA 5AV5B 1AOID 3AYWB 1P3MA 3VH5W 1Z2CB 2YFWA 3B0DB 4J8UC 2Y2GA
chains in the Genus database with same CATH topology
3MVDC 2RIQA 1HTAA 3WAAB 4G91C 4YS3B 3MVDA 1B67A 5B0ZC 5CPJD 4H9SC 2W8SA 3KWQB 1HQ3C 4H9SA 4WU9B 1P3MD 2F8NH 1HQ3A 1EQZC 3TU4C 4JJNC 5AV6B 5AV9B 5B31D 4XZQB 1P3PB 1EQZA 3TU4A 4JJNA 2ZY4A 3C1CC 2CV5C 3X1SB 2F8NK 4R8PB 3R45A 4WNNA 4LD9B 3C1CA 3B0CW 2CV5A 3X1VC 2NQBD 4WU8B 3W97D 2F2AC 5JRGD 1ZLAD 3MGPC 2HIOC 1ID3B 3X1UC 1P3LD 5B33D 3MGPA 1P3IC 3UTAD 2Y2KA 2HIOA 3LZ1C 4H9QB 3X1UA 3LZ0B 1P3IA 2HUEB 3LZ1A 5B24D 5BO0B 5AVCB 2RVQC 3C1CD 3EG5B 4H9NB 5B2JB 3WA9D 3NQJA 3REKD 3B6GC 5B0YB 3A6ND 1JFIB 3B6GA 3RELA 3MGPD 3B6FC 5B32C 3LELA 5AVBD 4WU9C 3B6FA 5B32A 3AZIB 1TZYB 5C3IC 2IO5B 1M1AC 4QLCC 2FJ7B 2Y2LA 1BH8B 1M1AA 4QLCA 2NZDB 5AV8B 1W2EA 5DNNC 5CP6C 3RELD 3B6GD 4J8WB 5CPIC 3AZKD 2BYMA 4NFTA 5AY8C 3LELD 5DNNA 3AV1A 5CP6A 3LJAB 3AZJB 2AROB 5B2ID 5CPIA 4NE6A 5AY8A 3VH6T 3AN2C 2PYOC 3KFUG 1BFMA 3AL0C 3W99C 3UTBA 1P3OC 4YM6A 1KX5D 2PYOA 1P3OA 3W99A 5GXQC 5GT3D 1M1AD 1F66C 3VH6A 4QLCD 5GXQA 1F66A 2YFWB 4ZUXA 3AV1D 3O62C 4Z5TD 4WJ3C 3MGSC 3AZHD 4DRBA 3O62A 4J8UB 3MVDB 3UTBD 3MGSA 4YM6D 4J8VC 4G91B 5E5AC 3AZGD 3AZFD 4EO5C 1H3OA 5B0ZB 3W98C 4J8VA 1KX3D 5E5AA 2Y2OA 3W96D 5BT1C 3W98A 1HQ3B 5B1LC 3AZLD 4ZUXD 1AOIC 1P3FD 5F99D 5B1LA 2F8ND 3KXBA 4J8XA 1EQZB 4ZBJC 3TU4B 4JJNB 1AOIA 1P3GC 3MGSD 1P3GA 3R45B 4WNNB 1P34D 3C1CB 2CV5B 4J8VD 3X1VB 5CPJC 3MGPB 5B1LD 2JCHA 3KXBD 2HIOB 4J8XD 4KHAA 1BH9A 3X1UB 1P3IB 1P3MC 3LZ1B 2Y2PA 1P3GD 5B31C 4KUDA 2FFFB 3NQJB 5B31A 3X1TD 3EPKA 4M6BA 3B6GB 5FUGA 3A1IA 3LELB 2NQBC 3W97C 5JRGC 4Z66D 3REJC 5B32B 1ZLAC 3B6FB 2DF4C 3WKJD 2NQBA 3W97A 5JRGA 3REJA 1P3LC 5B33C 1ZLAA 4X23D 3UTAC 3MGRD 4KUDD 5C3IB 1P3LA 5B33A 1M1AB 3UTAA 4QLCB 2BYKA 1KX4D 3H0MC 5B24C 4G92C 1M19C 2Y2MA 3WTPC 2BYMB 3AV1B 5B24A 1M18C 5DNNB 1M19A 5CP6B 3F6TA 3WA9C 3WTPA 3REKC 5CPIB 3VH5A 1M18A 5AY8B 3WA9A 3A6NC 3REKA 4YM6B 1WWIA 1Q9CA 3REJD 3AN2B 2PYOB 3REHD 3A6NA 1P3OB 3W99B 5AVBC 2ZY5A 3UT9A 5GXQB 1F66B 5AVBA 4ZUXB 4H9OA 1M19D 2CWEA 3WTPD 1M18D 3O62B 4AWLC 3IP4C 2Y2IA 3MGSB 3RELC 1S32D 3AZKC 3B0CT 1H3OB 3LELC 3AZMD 4J8VB 5E5AB 5B2IC 4EO5B 3MGQD 3REID 2LY8A 3UT9D 3AZKA 3A1KA 3AZED 1U35D 1P3AD 3W98B 5B1MD 1KX5C 4DRAA 5B2IA 5B1LB 1P3BD 4J8XB 1KX5A 3AFAD 5GT3C 1AOIB 1WWSA 5DNMD 4ZBJB 5GT3A 1P3GB 3MNNC 3AV1C 4Z5TC 3C1BC 3AZHC 3H0LC 5JA4A 3MNNA 1TAFA 4Z5TA 3WAAA 3C1BA 4KGCC 3UTBC 4YM6C 3AZHA 3AV2D 5BNXA 3AZFC 3AZGC 4KGCA 4CSRA 4XUJD 5AV5D 1KX3C 3AZGA 4KHAB 1BH9B 3AZFA 3W96C 5CPJB 1KX3A 3AYWD 3W96A 3AZLC 5B32G 4ZUXC 1P3MB 1P3FC 5F99C 4E45A 3AZLA 5GT0C 1P3FA 3MNND 5F99A 5B31B 5B40C 3C1BD 2F8NA 3WAAD 5GT0A 4YS3D 1R4VA 4KGCD 5B40A 5FUGB 1P34C 3EPHA 3KWQD 3KSYA 1P34A 4WU8A 2NQBB 1KU5A 3W97B 5JRGB 3REJB 1ZLAB 3KXBC 4J8XC 5AV6D 5AV9D 4XZQD 1P3PD 1P3LB 5B33B 3UTAB 5GT0D 2BYKB 1N1JA 5B40D 4UPKA 3X1SD 4R8PD 5BO0A 5B24B 4LD9D 4G92B 1M19B 4NE3A 3AZNC 1P3KC 3WTPB 3X1TC 1M18B 4WU8D 3WA9B 3AZNA 1P3KA 3REKB 3X1TA 1JFIA 1ID3D 3A6NB 2DQNC 4Z66C 3LZ0D 3WKJC 3B0BA 3V9RA 5AVBB 4Z66A 5AVCD 4H9OB 4X23C 3WKJA 3MGRC 4KUDC 4DQYB 5BNVA 5B2JD 4X23A 3MGRA 2UWXA 4E44A 3AZND 1KX4C 1P3KD 2NZDA 4AWLB 1KX4A 4J8WA 3RELB 2XD5A 2BG1A 3AZKB 4H9PA 3AZID 5B2IB 3REHC 1KX5B 2FJ7D 5GSUC 5KDMA 3REHA 2NZDD 5AV8D 5GT3B 3NQUA 5GSUA 3VH5T 3EPLA 4CAYA 2XD1A 4J8WD 2Y2JA 1B6WA 5G49A 3EPJA 3LJAD 5JA4B 3MNNB 1TAFB 2AROD 4Z5TB 3C1BB 3AZJD 4J8UA 5B31G 3AZHB 5BNXB 4KGCB 4CSRB 1S32C 3AZMC 3UTBB 3AZFB 3AZGB 5B0ZA 1A7WA 1S32A 3AZEC 3REIC 3MGQC 3AZMA 3UT9C 1U35C 2VQRA 1P3AC 5CPKC 1KX3B 4HGAC 5GSUD 5B1MC 3W96B 3AZEA 1F1EA 3MGQA 4UUZA 3REIA 1U35A 1P3AA 5CPKA 5B1MA 3AZLB 1P3BC 3AFAC 5BS7C 1P3FB 5DNMC 5F99B 2F8NB 4H9RA 1P3BA 3KUYC 5GT0B 3AFAA 5BS7A 3MVDD 4J8UD 5DNMA 5B40B 4Z2MG 3KUYA 5B0ZD 1P34B 2YFVA 3AV2C 1HQ3D 3X1VA 5CPKD 4XUJC 5AV5C 3AV2A 2ZM5A 1EQZD 4XUJA 3TU4D 3KXBB 5AV5A 4JJND 3AYWC 2Y2NA 1N1JB 2G5IC 3KUYD 3AYWA 3B0DC 2CV5D 3WAAC 4YS3C 3AZNB 1P3KB 3X1VD 3X1TB 2Y2QA 4YS3A 1PZRA 3VH6W 2HIOD 3KWQC 3X1UD 1P3ID 3KWQA 3V9RB 3LZ1D 4Z66B 4WU9A 3WKJB 5AV6C 5AV9C 2G5HC 5BNVB 4XZQC 1P3PC 4X23B 2RVQD 5AV6A 5AV9A 3MGRB 4KUDB 4XZQA 1P3PA 3X1SC 2JSSA 4R8PC 1ULYA 1KX4B 4LD9C 3X1SA 4WV4B 4R8PA 3H0RC 2J8PA 4H9PB 4NE5A 4WU8C 4LD9A 3B6FD 5B32D 4WU9D 2ZY3A 1ID3C 3AN2A 4Z2MH 3REHB 5KDMB 1ID3A 3LZ0C 2HUEC 3NQUB 5GSUB 4H9QA 3LZ0A 5AVCC 4CAYB 5CHLB 2L5AA 5G49B 5DNND 5CP6D 5B2JC 5AVCA 4H9NA 5CPID 5AY8D 4WZSB 5B2JA 5B0YC 2F8NG 3AN2D 2PYOD 5B0YA 3W99D 1P3OD 1S32B 3AZMB 2JE5A 2Y2HA 3AZIC 1TZYC 3P5JB 5GXQD 3REIB 3MGQB 4UUZB 3UT9B 3AZEB 1U35B 1P3AB 5CPKB 1F66D 2IO5C 4HGAB 5B1MB 3AZIA 1TZYA 2FJ7C 4H9RB 1P3BB 3O62D 3AFAB 5AV8C 3WTPE 2FJ7A 2NZDC 5DNMB 1T3UA 1BH8A 3KUYB 5AV8A 4J8WC 5B0YD 2ZY2A 5E5AD 3LJAC 3AZJC 2AROC 2YFVB 3W98D 3LJAA 3AZJA 2AROA 5BT1D 1TZYD 3FDDA 3AV2B 4XUJB 5CPJA 5AV5B 1AOID 3AYWB 1P3MA 3VH5W 1Z2CB 2YFWA 3B0DB 4J8UC 2Y2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVD C;  1HTA A;  3WAA B;  4G91 C;  4YS3 B;  3MVD A;  1B67 A;  5B0Z C;  5CPJ D;  4H9S C;  3KWQ B;  1HQ3 C;  4H9S A;  4WU9 B;  1P3M D;  2F8N H;  1HQ3 A;  1EQZ C;  3TU4 C;  4JJN C;  5AV6 B;  5AV9 B;  5B31 D;  4XZQ B;  1P3P B;  1EQZ A;  3TU4 A;  4JJN A;  3C1C C;  2CV5 C;  2F8N K;  3X1S B;  4R8P B;  3R45 A;  4WNN A;  4LD9 B;  3C1C A;  3B0C W;  2CV5 A;  3X1V C;  2NQB D;  4WU8 B;  3W97 D;  5JRG D;  1ZLA D;  3MGP C;  2HIO C;  1ID3 B;  3X1U C;  1P3L D;  5B33 D;  3MGP A;  1P3I C;  3UTA D;  2HIO A;  3LZ1 C;  4H9Q B;  3X1U A;  3LZ0 B;  1P3I A;  2HUE B;  3LZ1 A;  5B24 D;  5BO0 B;  5AVC B;  2RVQ C;  3C1C D;  4H9N B;  5B2J B;  3WA9 D;  3NQJ A;  3REK D;  3B6G C;  5B0Y B;  3A6N D;  1JFI B;  3B6G A;  3REL A;  3MGP D;  3B6F C;  5B32 C;  3LEL A;  5AVB D;  4WU9 C;  3B6F A;  5B32 A;  3AZI B;  1TZY B;  5C3I C;  2IO5 B;  1M1A C;  4QLC C;  2FJ7 B;  1BH8 B;  1M1A A;  4QLC A;  2NZD B;  5AV8 B;  5DNN C;  5CP6 C;  3REL D;  3B6G D;  4J8W B;  5CPI C;  3AZK D;  2BYM A;  4NFT A;  5AY8 C;  3LEL D;  5DNN A;  3AV1 A;  5CP6 A;  3LJA B;  3AZJ B;  2ARO B;  5B2I D;  5CPI A;  4NE6 A;  5AY8 A;  3VH6 T;  3AN2 C;  2PYO C;  1BFM A;  3W99 C;  3UTB A;  1P3O C;  4YM6 A;  1KX5 D;  2PYO A;  1P3O A;  3W99 A;  5GXQ C;  5GT3 D;  1M1A D;  1F66 C;  3VH6 A;  4QLC D;  5GXQ A;  1F66 A;  2YFW B;  4ZUX A;  3AV1 D;  3O62 C;  4Z5T D;  3MGS C;  3AZH D;  4DRB A;  3O62 A;  4J8U B;  3MVD B;  3UTB D;  3MGS A;  4YM6 D;  4J8V C;  4G91 B;  5E5A C;  3AZG D;  3AZF D;  4EO5 C;  1H3O A;  5B0Z B;  3W98 C;  4J8V A;  1KX3 D;  5E5A A;  3W96 D;  5BT1 C;  3W98 A;  1HQ3 B;  5B1L C;  3AZL D;  4ZUX D;  1AOI C;  1P3F D;  5F99 D;  5B1L A;  2F8N D;  3KXB A;  4J8X A;  1EQZ B;  4ZBJ C;  3TU4 B;  4JJN B;  1AOI A;  1P3G C;  3MGS D;  1P3G A;  3R45 B;  4WNN B;  1P34 D;  3C1C B;  2CV5 B;  4J8V D;  3X1V B;  5CPJ C;  3MGP B;  5B1L D;  3KXB D;  4J8X D;  2HIO B;  4KHA A;  1BH9 A;  3X1U B;  1P3I B;  1P3M C;  3LZ1 B;  1P3G D;  5B31 C;  4KUD A;  3NQJ B;  5B31 A;  3X1T D;  4M6B A;  3B6G B;  5FUG A;  3LEL B;  2NQB C;  3W97 C;  5JRG C;  4Z66 D;  3REJ C;  5B32 B;  1ZLA C;  3B6F B;  3WKJ D;  2NQB A;  3W97 A;  5JRG A;  3REJ A;  1P3L C;  5B33 C;  1ZLA A;  4X23 D;  3UTA C;  3MGR D;  4KUD D;  5C3I B;  1P3L A;  5B33 A;  1M1A B;  3UTA A;  4QLC B;  2BYK A;  1KX4 D;  5B24 C;  4G92 C;  1M19 C;  3WTP C;  2BYM B;  3AV1 B;  5B24 A;  1M18 C;  5DNN B;  1M19 A;  5CP6 B;  3WA9 C;  3WTP A;  3REK C;  5CPI B;  3VH5 A;  1M18 A;  5AY8 B;  3WA9 A;  3A6N C;  3REK A;  4YM6 B;  1WWI A;  1Q9C A;  3REJ D;  3AN2 B;  2PYO B;  3REH D;  3A6N A;  1P3O B;  3W99 B;  5AVB C;  3UT9 A;  5GXQ B;  1F66 B;  5AVB A;  4ZUX B;  4H9O A;  1M19 D;  2CWE A;  3WTP D;  1M18 D;  3O62 B;  4AWL C;  3MGS B;  3REL C;  1S32 D;  3AZK C;  3B0C T;  1H3O B;  3LEL C;  3AZM D;  4J8V B;  5E5A B;  5B2I C;  4EO5 B;  3MGQ D;  3REI D;  2LY8 A;  3UT9 D;  3AZK A;  3AZE D;  1U35 D;  1P3A D;  3W98 B;  5B1M D;  1KX5 C;  4DRA A;  5B2I A;  5B1L B;  1P3B D;  4J8X B;  1KX5 A;  3AFA D;  5GT3 C;  1AOI B;  1WWS A;  5DNM D;  4ZBJ B;  5GT3 A;  1P3G B;  3MNN C;  3AV1 C;  4Z5T C;  3C1B C;  3AZH C;  5JA4 A;  3MNN A;  1TAF A;  4Z5T A;  3WAA A;  3C1B A;  4KGC C;  3UTB C;  4YM6 C;  3AZH A;  3AV2 D;  5BNX A;  3AZF C;  3AZG C;  4KGC A;  4CSR A;  4XUJ D;  5AV5 D;  1KX3 C;  3AZG A;  4KHA B;  1BH9 B;  3AZF A;  3W96 C;  5CPJ B;  1KX3 A;  3AYW D;  3W96 A;  3AZL C;  5B32 G;  4ZUX C;  1P3M B;  1P3F C;  5F99 C;  4E45 A;  3AZL A;  5GT0 C;  1P3F A;  3MNN D;  5F99 A;  5B31 B;  5B40 C;  3C1B D;  2F8N A;  3WAA D;  5GT0 A;  4YS3 D;  1R4V A;  4KGC D;  5B40 A;  5FUG B;  1P34 C;  3KWQ D;  3KSY A;  1P34 A;  4WU8 A;  2NQB B;  1KU5 A;  3W97 B;  5JRG B;  3REJ B;  1ZLA B;  3KXB C;  4J8X C;  5AV6 D;  5AV9 D;  4XZQ D;  1P3P D;  1P3L B;  5B33 B;  3UTA B;  5GT0 D;  2BYK B;  1N1J A;  5B40 D;  3X1S D;  4R8P D;  5BO0 A;  5B24 B;  4LD9 D;  4G92 B;  1M19 B;  4NE3 A;  3AZN C;  1P3K C;  3WTP B;  3X1T C;  1M18 B;  4WU8 D;  3WA9 B;  3AZN A;  1P3K A;  3REK B;  3X1T A;  1JFI A;  1ID3 D;  3A6N B;  4Z66 C;  3LZ0 D;  3WKJ C;  3B0B A;  3V9R A;  5AVB B;  4Z66 A;  5AVC D;  4H9O B;  4X23 C;  3WKJ A;  3MGR C;  4KUD C;  5BNV A;  5B2J D;  4X23 A;  3MGR A;  4E44 A;  3AZN D;  1KX4 C;  1P3K D;  2NZD A;  4AWL B;  1KX4 A;  4J8W A;  3REL B;  3AZK B;  4H9P A;  3AZI D;  5B2I B;  3REH C;  1KX5 B;  2FJ7 D;  5GSU C;  5KDM A;  3REH A;  2NZD D;  5AV8 D;  5GT3 B;  3NQU A;  5GSU A;  3VH5 T;  4CAY A;  4J8W D;  1B6W A;  5G49 A;  3LJA D;  5JA4 B;  3MNN B;  1TAF B;  2ARO D;  4Z5T B;  3C1B B;  3AZJ D;  4J8U A;  5B31 G;  3AZH B;  5BNX B;  4KGC B;  4CSR B;  1S32 C;  3AZM C;  3UTB B;  3AZF B;  3AZG B;  5B0Z A;  1A7W A;  1S32 A;  3AZE C;  3REI C;  3MGQ C;  3AZM A;  3UT9 C;  1U35 C;  1P3A C;  5CPK C;  1KX3 B;  4HGA C;  5GSU D;  5B1M C;  3W96 B;  3AZE A;  1F1E A;  3MGQ A;  4UUZ A;  3REI A;  1U35 A;  1P3A A;  5CPK A;  5B1M A;  3AZL B;  1P3B C;  3AFA C;  5BS7 C;  1P3F B;  5DNM C;  5F99 B;  2F8N B;  4H9R A;  1P3B A;  3KUY C;  5GT0 B;  3AFA A;  5BS7 A;  3MVD D;  4J8U D;  5DNM A;  5B40 B;  4Z2M G;  3KUY A;  5B0Z D;  1P34 B;  2YFV A;  3AV2 C;  1HQ3 D;  3X1V A;  5CPK D;  4XUJ C;  5AV5 C;  3AV2 A;  1EQZ D;  4XUJ A;  3TU4 D;  3KXB B;  5AV5 A;  4JJN D;  3AYW C;  1N1J B;  3KUY D;  3AYW A;  3B0D C;  2CV5 D;  3WAA C;  4YS3 C;  3AZN B;  1P3K B;  3X1V D;  3X1T B;  4YS3 A;  3VH6 W;  2HIO D;  3KWQ C;  3X1U D;  1P3I D;  3KWQ A;  3V9R B;  3LZ1 D;  4Z66 B;  4WU9 A;  3WKJ B;  5AV6 C;  5AV9 C;  5BNV B;  4XZQ C;  1P3P C;  4X23 B;  2RVQ D;  5AV6 A;  5AV9 A;  3MGR B;  4KUD B;  4XZQ A;  1P3P A;  3X1S C;  2JSS A;  4R8P C;  1ULY A;  1KX4 B;  4LD9 C;  3X1S A;  4WV4 B;  4R8P A;  4H9P B;  4WU8 C;  4NE5 A;  4LD9 A;  3B6F D;  5B32 D;  4WU9 D;  1ID3 C;  3AN2 A;  4Z2M H;  3REH B;  5KDM B;  1ID3 A;  3LZ0 C;  2HUE C;  3NQU B;  5GSU B;  4H9Q A;  3LZ0 A;  5AVC C;  4CAY B;  5CHL B;  2L5A A;  5G49 B;  5DNN D;  5CP6 D;  5B2J C;  5AVC A;  4H9N A;  5CPI D;  5AY8 D;  4WZS B;  5B2J A;  5B0Y C;  2F8N G;  3AN2 D;  2PYO D;  5B0Y A;  3W99 D;  1P3O D;  1S32 B;  3AZM B;  3AZI C;  1TZY C;  5GXQ D;  3AZE B;  3REI B;  3MGQ B;  4UUZ B;  3UT9 B;  1U35 B;  1P3A B;  1F66 D;  5CPK B;  2IO5 C;  4HGA B;  5B1M B;  3AZI A;  1TZY A;  2FJ7 C;  4H9R B;  1P3B B;  3O62 D;  3AFA B;  5AV8 C;  3WTP E;  2FJ7 A;  2NZD C;  5DNM B;  1BH8 A;  3KUY B;  5AV8 A;  4J8W C;  5B0Y D;  5E5A D;  3LJA C;  3AZJ C;  2ARO C;  2YFV B;  3W98 D;  3LJA A;  3AZJ A;  2ARO A;  5BT1 D;  1TZY D;  3AV2 B;  4XUJ B;  5CPJ A;  5AV5 B;  1AOI D;  3AYW B;  1P3M A;  3VH5 W;  2YFW A;  3B0D B;  4J8U C; 
#chains in the Genus database with same CATH topology
 3MVD C;  2RIQ A;  1HTA A;  3WAA B;  4G91 C;  4YS3 B;  3MVD A;  1B67 A;  5B0Z C;  5CPJ D;  4H9S C;  2W8S A;  3KWQ B;  1HQ3 C;  4H9S A;  4WU9 B;  1P3M D;  2F8N H;  1HQ3 A;  1EQZ C;  3TU4 C;  4JJN C;  5AV6 B;  5AV9 B;  5B31 D;  4XZQ B;  1P3P B;  1EQZ A;  3TU4 A;  4JJN A;  2ZY4 A;  3C1C C;  2CV5 C;  3X1S B;  2F8N K;  4R8P B;  3R45 A;  4WNN A;  4LD9 B;  3C1C A;  3B0C W;  2CV5 A;  3X1V C;  2NQB D;  4WU8 B;  3W97 D;  2F2A C;  5JRG D;  1ZLA D;  3MGP C;  2HIO C;  1ID3 B;  3X1U C;  1P3L D;  5B33 D;  3MGP A;  1P3I C;  3UTA D;  2Y2K A;  2HIO A;  3LZ1 C;  4H9Q B;  3X1U A;  3LZ0 B;  1P3I A;  2HUE B;  3LZ1 A;  5B24 D;  5BO0 B;  5AVC B;  2RVQ C;  3C1C D;  3EG5 B;  4H9N B;  5B2J B;  3WA9 D;  3NQJ A;  3REK D;  3B6G C;  5B0Y B;  3A6N D;  1JFI B;  3B6G A;  3REL A;  3MGP D;  3B6F C;  5B32 C;  3LEL A;  5AVB D;  4WU9 C;  3B6F A;  5B32 A;  3AZI B;  1TZY B;  5C3I C;  2IO5 B;  1M1A C;  4QLC C;  2FJ7 B;  2Y2L A;  1BH8 B;  1M1A A;  4QLC A;  2NZD B;  5AV8 B;  1W2E A;  5DNN C;  5CP6 C;  3REL D;  3B6G D;  4J8W B;  5CPI C;  3AZK D;  2BYM A;  4NFT A;  5AY8 C;  3LEL D;  5DNN A;  3AV1 A;  5CP6 A;  3LJA B;  3AZJ B;  2ARO B;  5B2I D;  5CPI A;  4NE6 A;  5AY8 A;  3VH6 T;  3AN2 C;  2PYO C;  3KFU G;  1BFM A;  3AL0 C;  3W99 C;  3UTB A;  1P3O C;  4YM6 A;  1KX5 D;  2PYO A;  1P3O A;  3W99 A;  5GXQ C;  5GT3 D;  1M1A D;  1F66 C;  3VH6 A;  4QLC D;  5GXQ A;  1F66 A;  2YFW B;  4ZUX A;  3AV1 D;  3O62 C;  4Z5T D;  4WJ3 C;  3MGS C;  3AZH D;  4DRB A;  3O62 A;  4J8U B;  3MVD B;  3UTB D;  3MGS A;  4YM6 D;  4J8V C;  4G91 B;  5E5A C;  3AZG D;  3AZF D;  4EO5 C;  1H3O A;  5B0Z B;  3W98 C;  4J8V A;  1KX3 D;  5E5A A;  2Y2O A;  3W96 D;  5BT1 C;  3W98 A;  1HQ3 B;  5B1L C;  3AZL D;  4ZUX D;  1AOI C;  1P3F D;  5F99 D;  5B1L A;  2F8N D;  3KXB A;  4J8X A;  1EQZ B;  4ZBJ C;  3TU4 B;  4JJN B;  1AOI A;  1P3G C;  3MGS D;  1P3G A;  3R45 B;  4WNN B;  1P34 D;  3C1C B;  2CV5 B;  4J8V D;  3X1V B;  5CPJ C;  3MGP B;  5B1L D;  2JCH A;  3KXB D;  2HIO B;  4J8X D;  4KHA A;  1BH9 A;  3X1U B;  1P3I B;  1P3M C;  3LZ1 B;  2Y2P A;  1P3G D;  5B31 C;  4KUD A;  2FFF B;  3NQJ B;  5B31 A;  3X1T D;  3EPK A;  4M6B A;  3B6G B;  5FUG A;  3A1I A;  3LEL B;  2NQB C;  3W97 C;  5JRG C;  4Z66 D;  3REJ C;  5B32 B;  1ZLA C;  3B6F B;  2DF4 C;  3WKJ D;  2NQB A;  3W97 A;  5JRG A;  3REJ A;  1P3L C;  5B33 C;  1ZLA A;  4X23 D;  3UTA C;  3MGR D;  4KUD D;  5C3I B;  1P3L A;  5B33 A;  1M1A B;  3UTA A;  4QLC B;  2BYK A;  1KX4 D;  3H0M C;  5B24 C;  4G92 C;  1M19 C;  2Y2M A;  3WTP C;  2BYM B;  3AV1 B;  5B24 A;  1M18 C;  5DNN B;  1M19 A;  5CP6 B;  3F6T A;  3WA9 C;  3WTP A;  3REK C;  5CPI B;  3VH5 A;  1M18 A;  5AY8 B;  3WA9 A;  3A6N C;  3REK A;  4YM6 B;  1WWI A;  1Q9C A;  3REJ D;  3AN2 B;  2PYO B;  3REH D;  3A6N A;  1P3O B;  3W99 B;  5AVB C;  2ZY5 A;  3UT9 A;  5GXQ B;  1F66 B;  5AVB A;  4ZUX B;  4H9O A;  1M19 D;  2CWE A;  3WTP D;  1M18 D;  3O62 B;  4AWL C;  3IP4 C;  2Y2I A;  3MGS B;  3REL C;  1S32 D;  3AZK C;  3B0C T;  1H3O B;  3LEL C;  3AZM D;  4J8V B;  5E5A B;  5B2I C;  4EO5 B;  3MGQ D;  3REI D;  2LY8 A;  3UT9 D;  3AZK A;  3A1K A;  3AZE D;  1U35 D;  1P3A D;  3W98 B;  5B1M D;  1KX5 C;  4DRA A;  5B2I A;  5B1L B;  1P3B D;  4J8X B;  1KX5 A;  3AFA D;  5GT3 C;  1AOI B;  1WWS A;  5DNM D;  4ZBJ B;  5GT3 A;  1P3G B;  3MNN C;  3AV1 C;  4Z5T C;  3C1B C;  3AZH C;  3H0L C;  5JA4 A;  3MNN A;  1TAF A;  4Z5T A;  3WAA A;  3C1B A;  4KGC C;  3UTB C;  4YM6 C;  3AZH A;  3AV2 D;  5BNX A;  3AZF C;  3AZG C;  4KGC A;  4CSR A;  4XUJ D;  5AV5 D;  1KX3 C;  3AZG A;  4KHA B;  1BH9 B;  3AZF A;  3W96 C;  5CPJ B;  1KX3 A;  3AYW D;  3W96 A;  3AZL C;  5B32 G;  4ZUX C;  1P3M B;  1P3F C;  5F99 C;  4E45 A;  3AZL A;  5GT0 C;  1P3F A;  3MNN D;  5F99 A;  5B31 B;  5B40 C;  3C1B D;  2F8N A;  3WAA D;  5GT0 A;  4YS3 D;  1R4V A;  4KGC D;  5B40 A;  5FUG B;  1P34 C;  3EPH A;  3KWQ D;  3KSY A;  1P34 A;  4WU8 A;  2NQB B;  1KU5 A;  3W97 B;  5JRG B;  3REJ B;  1ZLA B;  3KXB C;  4J8X C;  5AV6 D;  5AV9 D;  4XZQ D;  1P3P D;  1P3L B;  5B33 B;  3UTA B;  5GT0 D;  2BYK B;  1N1J A;  5B40 D;  4UPK A;  3X1S D;  4R8P D;  5BO0 A;  5B24 B;  4LD9 D;  4G92 B;  1M19 B;  4NE3 A;  3AZN C;  1P3K C;  3WTP B;  3X1T C;  1M18 B;  4WU8 D;  3WA9 B;  3AZN A;  1P3K A;  3REK B;  3X1T A;  1JFI A;  1ID3 D;  3A6N B;  2DQN C;  4Z66 C;  3LZ0 D;  3WKJ C;  3B0B A;  3V9R A;  5AVB B;  4Z66 A;  5AVC D;  4H9O B;  4X23 C;  3WKJ A;  3MGR C;  4KUD C;  4DQY B;  5BNV A;  5B2J D;  4X23 A;  3MGR A;  2UWX A;  4E44 A;  3AZN D;  1KX4 C;  1P3K D;  2NZD A;  4AWL B;  1KX4 A;  4J8W A;  3REL B;  2XD5 A;  2BG1 A;  3AZK B;  4H9P A;  3AZI D;  5B2I B;  3REH C;  1KX5 B;  2FJ7 D;  5GSU C;  5KDM A;  3REH A;  2NZD D;  5AV8 D;  5GT3 B;  3NQU A;  5GSU A;  3VH5 T;  3EPL A;  4CAY A;  2XD1 A;  4J8W D;  2Y2J A;  1B6W A;  5G49 A;  3EPJ A;  3LJA D;  5JA4 B;  3MNN B;  1TAF B;  2ARO D;  4Z5T B;  3C1B B;  3AZJ D;  4J8U A;  5B31 G;  3AZH B;  5BNX B;  4KGC B;  4CSR B;  1S32 C;  3AZM C;  3UTB B;  3AZF B;  3AZG B;  5B0Z A;  1A7W A;  1S32 A;  3AZE C;  3REI C;  3MGQ C;  3AZM A;  3UT9 C;  1U35 C;  2VQR A;  1P3A C;  5CPK C;  1KX3 B;  4HGA C;  5GSU D;  5B1M C;  3W96 B;  3AZE A;  1F1E A;  3MGQ A;  4UUZ A;  3REI A;  1U35 A;  1P3A A;  5CPK A;  5B1M A;  3AZL B;  1P3B C;  3AFA C;  5BS7 C;  1P3F B;  5DNM C;  5F99 B;  2F8N B;  4H9R A;  1P3B A;  3KUY C;  5GT0 B;  3AFA A;  5BS7 A;  3MVD D;  4J8U D;  5DNM A;  5B40 B;  4Z2M G;  3KUY A;  5B0Z D;  1P34 B;  2YFV A;  3AV2 C;  1HQ3 D;  3X1V A;  5CPK D;  4XUJ C;  5AV5 C;  3AV2 A;  2ZM5 A;  1EQZ D;  4XUJ A;  3TU4 D;  3KXB B;  5AV5 A;  4JJN D;  3AYW C;  2Y2N A;  1N1J B;  2G5I C;  3KUY D;  3AYW A;  3B0D C;  2CV5 D;  3WAA C;  4YS3 C;  3AZN B;  1P3K B;  3X1V D;  3X1T B;  2Y2Q A;  4YS3 A;  1PZR A;  3VH6 W;  2HIO D;  3KWQ C;  3X1U D;  1P3I D;  3KWQ A;  3V9R B;  3LZ1 D;  4Z66 B;  4WU9 A;  3WKJ B;  5AV6 C;  5AV9 C;  2G5H C;  5BNV B;  4XZQ C;  1P3P C;  4X23 B;  2RVQ D;  5AV6 A;  5AV9 A;  3MGR B;  4KUD B;  4XZQ A;  1P3P A;  3X1S C;  2JSS A;  4R8P C;  1ULY A;  1KX4 B;  4LD9 C;  3X1S A;  4WV4 B;  4R8P A;  3H0R C;  2J8P A;  4H9P B;  4NE5 A;  4WU8 C;  4LD9 A;  3B6F D;  5B32 D;  4WU9 D;  2ZY3 A;  1ID3 C;  3AN2 A;  4Z2M H;  3REH B;  5KDM B;  1ID3 A;  3LZ0 C;  2HUE C;  3NQU B;  5GSU B;  4H9Q A;  3LZ0 A;  5AVC C;  4CAY B;  5CHL B;  2L5A A;  5G49 B;  5DNN D;  5CP6 D;  5B2J C;  5AVC A;  4H9N A;  5CPI D;  5AY8 D;  4WZS B;  5B2J A;  5B0Y C;  2F8N G;  3AN2 D;  2PYO D;  5B0Y A;  3W99 D;  1P3O D;  1S32 B;  3AZM B;  2JE5 A;  2Y2H A;  3AZI C;  1TZY C;  3P5J B;  5GXQ D;  3REI B;  3MGQ B;  4UUZ B;  3UT9 B;  3AZE B;  1U35 B;  1P3A B;  5CPK B;  1F66 D;  2IO5 C;  4HGA B;  5B1M B;  3AZI A;  1TZY A;  2FJ7 C;  4H9R B;  1P3B B;  3O62 D;  3AFA B;  5AV8 C;  3WTP E;  2FJ7 A;  2NZD C;  5DNM B;  1T3U A;  1BH8 A;  3KUY B;  5AV8 A;  4J8W C;  5B0Y D;  2ZY2 A;  5E5A D;  3LJA C;  3AZJ C;  2ARO C;  2YFV B;  3W98 D;  3LJA A;  3AZJ A;  2ARO A;  5BT1 D;  1TZY D;  3FDD A;  3AV2 B;  4XUJ B;  5CPJ A;  5AV5 B;  1AOI D;  3AYW B;  1P3M A;  3VH5 W;  1Z2C B;  2YFW A;  3B0D B;  4J8U C;  2Y2G A; 
#chains in the Genus database with same CATH homology
 3MVD C;  2RIQ A;  1HTA A;  3WAA B;  4G91 C;  4YS3 B;  3MVD A;  1B67 A;  5B0Z C;  5CPJ D;  4H9S C;  2W8S A;  3KWQ B;  1HQ3 C;  4H9S A;  4WU9 B;  1P3M D;  2F8N H;  1HQ3 A;  1EQZ C;  3TU4 C;  4JJN C;  5AV6 B;  5AV9 B;  5B31 D;  4XZQ B;  1P3P B;  1EQZ A;  3TU4 A;  4JJN A;  2ZY4 A;  3C1C C;  2CV5 C;  3X1S B;  2F8N K;  4R8P B;  3R45 A;  4WNN A;  4LD9 B;  3C1C A;  3B0C W;  2CV5 A;  3X1V C;  2NQB D;  4WU8 B;  3W97 D;  2F2A C;  5JRG D;  1ZLA D;  3MGP C;  2HIO C;  1ID3 B;  3X1U C;  1P3L D;  5B33 D;  3MGP A;  1P3I C;  3UTA D;  2Y2K A;  2HIO A;  3LZ1 C;  4H9Q B;  3X1U A;  3LZ0 B;  1P3I A;  2HUE B;  3LZ1 A;  5B24 D;  5BO0 B;  5AVC B;  2RVQ C;  3C1C D;  3EG5 B;  4H9N B;  5B2J B;  3WA9 D;  3NQJ A;  3REK D;  3B6G C;  5B0Y B;  3A6N D;  1JFI B;  3B6G A;  3REL A;  3MGP D;  3B6F C;  5B32 C;  3LEL A;  5AVB D;  4WU9 C;  3B6F A;  5B32 A;  3AZI B;  1TZY B;  5C3I C;  2IO5 B;  1M1A C;  4QLC C;  2FJ7 B;  2Y2L A;  1BH8 B;  1M1A A;  4QLC A;  2NZD B;  5AV8 B;  1W2E A;  5DNN C;  5CP6 C;  3REL D;  3B6G D;  4J8W B;  5CPI C;  3AZK D;  2BYM A;  4NFT A;  5AY8 C;  3LEL D;  5DNN A;  3AV1 A;  5CP6 A;  3LJA B;  3AZJ B;  2ARO B;  5B2I D;  5CPI A;  4NE6 A;  5AY8 A;  3VH6 T;  3AN2 C;  2PYO C;  3KFU G;  1BFM A;  3AL0 C;  3W99 C;  3UTB A;  1P3O C;  4YM6 A;  1KX5 D;  2PYO A;  1P3O A;  3W99 A;  5GXQ C;  5GT3 D;  1M1A D;  1F66 C;  3VH6 A;  4QLC D;  5GXQ A;  1F66 A;  2YFW B;  4ZUX A;  3AV1 D;  3O62 C;  4Z5T D;  4WJ3 C;  3MGS C;  3AZH D;  4DRB A;  3O62 A;  4J8U B;  3MVD B;  3UTB D;  3MGS A;  4YM6 D;  4J8V C;  4G91 B;  5E5A C;  3AZG D;  3AZF D;  4EO5 C;  1H3O A;  5B0Z B;  3W98 C;  4J8V A;  1KX3 D;  5E5A A;  2Y2O A;  3W96 D;  5BT1 C;  3W98 A;  1HQ3 B;  5B1L C;  3AZL D;  4ZUX D;  1AOI C;  1P3F D;  5F99 D;  5B1L A;  2F8N D;  3KXB A;  4J8X A;  1EQZ B;  4ZBJ C;  3TU4 B;  4JJN B;  1AOI A;  1P3G C;  3MGS D;  1P3G A;  3R45 B;  4WNN B;  1P34 D;  3C1C B;  2CV5 B;  4J8V D;  3X1V B;  5CPJ C;  3MGP B;  5B1L D;  2JCH A;  3KXB D;  2HIO B;  4J8X D;  4KHA A;  1BH9 A;  3X1U B;  1P3I B;  1P3M C;  3LZ1 B;  2Y2P A;  1P3G D;  5B31 C;  4KUD A;  2FFF B;  3NQJ B;  5B31 A;  3X1T D;  3EPK A;  4M6B A;  3B6G B;  5FUG A;  3A1I A;  3LEL B;  2NQB C;  3W97 C;  5JRG C;  4Z66 D;  3REJ C;  5B32 B;  1ZLA C;  3B6F B;  2DF4 C;  3WKJ D;  2NQB A;  3W97 A;  5JRG A;  3REJ A;  1P3L C;  5B33 C;  1ZLA A;  4X23 D;  3UTA C;  3MGR D;  4KUD D;  5C3I B;  1P3L A;  5B33 A;  1M1A B;  3UTA A;  4QLC B;  2BYK A;  1KX4 D;  3H0M C;  5B24 C;  4G92 C;  1M19 C;  2Y2M A;  3WTP C;  2BYM B;  3AV1 B;  5B24 A;  1M18 C;  5DNN B;  1M19 A;  5CP6 B;  3F6T A;  3WA9 C;  3WTP A;  3REK C;  5CPI B;  3VH5 A;  1M18 A;  5AY8 B;  3WA9 A;  3A6N C;  3REK A;  4YM6 B;  1WWI A;  1Q9C A;  3REJ D;  3AN2 B;  2PYO B;  3REH D;  3A6N A;  1P3O B;  3W99 B;  5AVB C;  2ZY5 A;  3UT9 A;  5GXQ B;  1F66 B;  5AVB A;  4ZUX B;  4H9O A;  1M19 D;  2CWE A;  3WTP D;  1M18 D;  3O62 B;  4AWL C;  3IP4 C;  2Y2I A;  3MGS B;  3REL C;  1S32 D;  3AZK C;  3B0C T;  1H3O B;  3LEL C;  3AZM D;  4J8V B;  5E5A B;  5B2I C;  4EO5 B;  3MGQ D;  3REI D;  2LY8 A;  3UT9 D;  3AZK A;  3A1K A;  3AZE D;  1U35 D;  1P3A D;  3W98 B;  5B1M D;  1KX5 C;  4DRA A;  5B2I A;  5B1L B;  1P3B D;  4J8X B;  1KX5 A;  3AFA D;  5GT3 C;  1AOI B;  1WWS A;  5DNM D;  4ZBJ B;  5GT3 A;  1P3G B;  3MNN C;  3AV1 C;  4Z5T C;  3C1B C;  3AZH C;  3H0L C;  5JA4 A;  3MNN A;  1TAF A;  4Z5T A;  3WAA A;  3C1B A;  4KGC C;  3UTB C;  4YM6 C;  3AZH A;  3AV2 D;  5BNX A;  3AZF C;  3AZG C;  4KGC A;  4CSR A;  4XUJ D;  5AV5 D;  1KX3 C;  3AZG A;  4KHA B;  1BH9 B;  3AZF A;  3W96 C;  5CPJ B;  1KX3 A;  3AYW D;  3W96 A;  3AZL C;  5B32 G;  4ZUX C;  1P3M B;  1P3F C;  5F99 C;  4E45 A;  3AZL A;  5GT0 C;  1P3F A;  3MNN D;  5F99 A;  5B31 B;  5B40 C;  3C1B D;  2F8N A;  3WAA D;  5GT0 A;  4YS3 D;  1R4V A;  4KGC D;  5B40 A;  5FUG B;  1P34 C;  3EPH A;  3KWQ D;  3KSY A;  1P34 A;  4WU8 A;  2NQB B;  1KU5 A;  3W97 B;  5JRG B;  3REJ B;  1ZLA B;  3KXB C;  4J8X C;  5AV6 D;  5AV9 D;  4XZQ D;  1P3P D;  1P3L B;  5B33 B;  3UTA B;  5GT0 D;  2BYK B;  1N1J A;  5B40 D;  4UPK A;  3X1S D;  4R8P D;  5BO0 A;  5B24 B;  4LD9 D;  4G92 B;  1M19 B;  4NE3 A;  3AZN C;  1P3K C;  3WTP B;  3X1T C;  1M18 B;  4WU8 D;  3WA9 B;  3AZN A;  1P3K A;  3REK B;  3X1T A;  1JFI A;  1ID3 D;  3A6N B;  2DQN C;  4Z66 C;  3LZ0 D;  3WKJ C;  3B0B A;  3V9R A;  5AVB B;  4Z66 A;  5AVC D;  4H9O B;  4X23 C;  3WKJ A;  3MGR C;  4KUD C;  4DQY B;  5BNV A;  5B2J D;  4X23 A;  3MGR A;  2UWX A;  4E44 A;  3AZN D;  1KX4 C;  1P3K D;  2NZD A;  4AWL B;  1KX4 A;  4J8W A;  3REL B;  2XD5 A;  2BG1 A;  3AZK B;  4H9P A;  3AZI D;  5B2I B;  3REH C;  1KX5 B;  2FJ7 D;  5GSU C;  5KDM A;  3REH A;  2NZD D;  5AV8 D;  5GT3 B;  3NQU A;  5GSU A;  3VH5 T;  3EPL A;  4CAY A;  2XD1 A;  4J8W D;  2Y2J A;  1B6W A;  5G49 A;  3EPJ A;  3LJA D;  5JA4 B;  3MNN B;  1TAF B;  2ARO D;  4Z5T B;  3C1B B;  3AZJ D;  4J8U A;  5B31 G;  3AZH B;  5BNX B;  4KGC B;  4CSR B;  1S32 C;  3AZM C;  3UTB B;  3AZF B;  3AZG B;  5B0Z A;  1A7W A;  1S32 A;  3AZE C;  3REI C;  3MGQ C;  3AZM A;  3UT9 C;  1U35 C;  2VQR A;  1P3A C;  5CPK C;  1KX3 B;  4HGA C;  5GSU D;  5B1M C;  3W96 B;  3AZE A;  1F1E A;  3MGQ A;  4UUZ A;  3REI A;  1U35 A;  1P3A A;  5CPK A;  5B1M A;  3AZL B;  1P3B C;  3AFA C;  5BS7 C;  1P3F B;  5DNM C;  5F99 B;  2F8N B;  4H9R A;  1P3B A;  3KUY C;  5GT0 B;  3AFA A;  5BS7 A;  3MVD D;  4J8U D;  5DNM A;  5B40 B;  4Z2M G;  3KUY A;  5B0Z D;  1P34 B;  2YFV A;  3AV2 C;  1HQ3 D;  3X1V A;  5CPK D;  4XUJ C;  5AV5 C;  3AV2 A;  2ZM5 A;  1EQZ D;  4XUJ A;  3TU4 D;  3KXB B;  5AV5 A;  4JJN D;  3AYW C;  2Y2N A;  1N1J B;  2G5I C;  3KUY D;  3AYW A;  3B0D C;  2CV5 D;  3WAA C;  4YS3 C;  3AZN B;  1P3K B;  3X1V D;  3X1T B;  2Y2Q A;  4YS3 A;  1PZR A;  3VH6 W;  2HIO D;  3KWQ C;  3X1U D;  1P3I D;  3KWQ A;  3V9R B;  3LZ1 D;  4Z66 B;  4WU9 A;  3WKJ B;  5AV6 C;  5AV9 C;  2G5H C;  5BNV B;  4XZQ C;  1P3P C;  4X23 B;  2RVQ D;  5AV6 A;  5AV9 A;  3MGR B;  4KUD B;  4XZQ A;  1P3P A;  3X1S C;  2JSS A;  4R8P C;  1ULY A;  1KX4 B;  4LD9 C;  3X1S A;  4WV4 B;  4R8P A;  3H0R C;  2J8P A;  4H9P B;  4NE5 A;  4WU8 C;  4LD9 A;  3B6F D;  5B32 D;  4WU9 D;  2ZY3 A;  1ID3 C;  3AN2 A;  4Z2M H;  3REH B;  5KDM B;  1ID3 A;  3LZ0 C;  2HUE C;  3NQU B;  5GSU B;  4H9Q A;  3LZ0 A;  5AVC C;  4CAY B;  5CHL B;  2L5A A;  5G49 B;  5DNN D;  5CP6 D;  5B2J C;  5AVC A;  4H9N A;  5CPI D;  5AY8 D;  4WZS B;  5B2J A;  5B0Y C;  2F8N G;  3AN2 D;  2PYO D;  5B0Y A;  3W99 D;  1P3O D;  1S32 B;  3AZM B;  2JE5 A;  2Y2H A;  3AZI C;  1TZY C;  3P5J B;  5GXQ D;  3REI B;  3MGQ B;  4UUZ B;  3UT9 B;  3AZE B;  1U35 B;  1P3A B;  5CPK B;  1F66 D;  2IO5 C;  4HGA B;  5B1M B;  3AZI A;  1TZY A;  2FJ7 C;  4H9R B;  1P3B B;  3O62 D;  3AFA B;  5AV8 C;  3WTP E;  2FJ7 A;  2NZD C;  5DNM B;  1T3U A;  1BH8 A;  3KUY B;  5AV8 A;  4J8W C;  5B0Y D;  2ZY2 A;  5E5A D;  3LJA C;  3AZJ C;  2ARO C;  2YFV B;  3W98 D;  3LJA A;  3AZJ A;  2ARO A;  5BT1 D;  1TZY D;  3FDD A;  3AV2 B;  4XUJ B;  5CPJ A;  5AV5 B;  1AOI D;  3AYW B;  1P3M A;  3VH5 W;  1Z2C B;  2YFW A;  3B0D B;  4J8U C;  2Y2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...