5AV5C

Human nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av5C00
3NQJB 3O62A 1AOIA 4QLCD 3V9RA 3X1UC 1P3PC 1S32C 3C1BB 3REKB 1P3BD 5E5AB 5B40A 5CP6C 4H9RA 3AV1C 1M19B 2CV5A 1ID3B 2HUEB 3C1BA 3AZFB 3X1TA 2PYOC 3AFAB 5F99C 5AY8C 3MNND 3UTAC 3AN2B 3REHD 4G91C 3AYWA 5AVCD 1ID3A 5BNVB 4KGCD 1P3GC 1ZLAD 5B31G 4AWLC 1P3KD 4NE6A 5B0YB 5B33D 3WAAD 3WA9A 3UT9C 1Q9CA 3A6NA 5CPJC 1KX5D 3WTPB 5DNMD 1HQ3A 3R45B 5BNVA 2F8NG 3MGQD 4LD9D 3AZEB 5GXQC 3WTPA 3RELC 1BH9A 5B2JC 3LZ1D 3AZKC 3AZGC 5AV8D 1M18B 1H3OA 4YM6D 1U35B 1P3OD 1F66B 2NZDC 3AZNB 3W97B 3AZEA 4J8UD 1P34C 2IO5B 3X1VB 5CPID 4H9QB 1M18A 1U35A 3AZHC 1ZLAA 1KX3C 3WAAA 3AZNA 3VH6W 5GT3D 3W96B 3MGPD 4NE5A 3W98C 1TZYC 4Z5TC 3LJAB 3MGSA 3X1VA 3WKJD 4H9QA 3KWQC 4XZQB 5B32D 3LELB 3AZMC 2YFVB 5AVBB 3X1SC 3W96A 3X1UD 3B6GB 1P3PD 1KX4A 1S32D 3LJAA 5BS7C 2FJ7C 3LELA 4XZQA 3MVDC 4ZUXB 2YFVA 5CP6D 4WU8C 3AV1D 2CWEA 3B6GA 5CPKB 5JRGB 3TU4A 2PYOD 5F99D 4WU9B 5AY8D 2HIOA 4ZUXA 4CSRA 3UTAD 3AZJB 5CPKA 5JRGA 3KXBC 1P3GD 1M19C 5AV9C 5B1LA 4H9PA 3REJB 3UT9D 3AFAC 1M1AB 5CPJD 5GT0B 3AV2B 3B6FA 3AZJA 5DNNB 3MGRB 3AN2C 2LY8A 3B0BA 3REJA 5GXQD 5B0YC 3UTBA 5GT0A 1M1AA 3RELD 5B2JD 3AZKD 2AROB 3AV2A 3AZGD 1A7WA 4JJNC 2NZDD 1P3MB 4XUJB 5AY8A 4R8PB 1P34D 5AV6A 3WTPE 5AV5C 1KX3D 1P3MA 4XUJA 4CAYB 3UT9A 5B31A 1WWIA 5GSUC 3W97C 3W98D 1TZYD 4Z5TD 5G49B 4J8XC 1P3FC 3W99B 3KWQD 3VH5T 3O62B 3AZMD 2F8NA 1B67A 3X1SD 1AOIB 4CAYA 3C1CA 3KUYD 3MGPC 4Z2MH 5B32G 4H9OA 2FJ7D 3W99A 4KUDC 5B40B 3MVDD 4M6BA 4H9RB 1P3IB 3B0CT 5B2IA 5B0ZA 4WU8D 2CV5B 3VH5A 4X23B 1P34A 4Z66C 3AZLC 3X1TB 4H9SA 4YS3B 1P3AC 3AZHA 4HGAB 5E5AD 1P3IA 3AYWB 4X23A 3KXBD 1M19D 5AV9D 4YS3A 5C3IB 3KWQA 1EQZA 3WA9B 3A6NB 3AFAD 1HQ3B 4WU9C 3AN2D 5BNXB 1P3BB 3REIC 5B0YD 1BH9B 2NQBC 4QLCA 4WU8A 1H3OB 4ZBJB 4JJND 5BNXA 4J8VC 1P3BA 1BFMA 3AZIC 1P3LC 2AROC 4KGCB 2JSSA 5AV5D 1ZLAB 3WAAB 5B33B 3MNNA 1KX5B 5GSUD 5DNMB 3W97D 3MGSB 3REHA 3LZ0C 5AVCA 4J8XD 1P3FD 4KGCA 1P3KA 5B33A 3MGQB 4NE3A 1KX5A 5DNMA 5B24C 1KX4B 1P3OB 4KUDD 4JJNA 3MGQA 3O62C 3KUYC 4LD9A 5B1MC 3LZ1A 4Z66D 3AZLD 4H9NB 5AV8A 3TU4B 5CPIB 4YM6A 1P3OA 5AV5A 2HIOB 1P3AD 4J8WC 4UUZA 4CSRB 1F1EA 4J8UA 4H9NA 2CV5C 5B1LB 4H9PB 5CPIA 3C1BC 3REKC 5B32B 1P3FA 2RVQC 3X1TC 5E5AC 5GT3A 4WU9D 3B6FB 4HGAC 3X1UB 3VH6T 3MGPA 1P3PB 1ID3C 3WKJA 2HUEC 1N1JA 5B32A 3AZFC 3REID 3UTBB 1JFIB 5CP6B 3WA9C 5C3IC 2NQBD 1BH8B 3A6NC 4DRAA 3AV1B 3X1UA 1HQ3C 1P3PA 4Z66A 1S32A 2PYOB 4J8VD 5F99B 5AY8B 1P3AA 1JFIA 3AZID 5CP6A 5AV6B 3UTAB 1BH8A 3AV1A 1P3LD 4G91B 3WTPC 2AROD 1P3GB 5BO0A 4AWLB 2PYOA 4ZBJC 5F99A 3UT9B 5B31B 3UTAA 3AZEC 4R8PD 4EO5B 3LZ0D 1P3GA 3VH5W 1M18C 1U35C 2F8NB 1F66C 3C1CB 5GXQB 3AZNC 5CPJA 5B24D 3AZKB 4H9OB 3AZGB 2IO5C 3X1VC 3MGSC 1ULYA 5JA4A 5B2IB 5B0ZB 3O62D 3B0CW 5FUGA 5B1MD 5GXQA 1P34B 3RELA 5B2JA 3AZKA 3W96C 3AZGA 1P3LA 1KX4C 3LJAC 3AZHB 2NZDA 4J8WD 3LELC 4XZQC 1KX3B 5AVBC 2F8NK 2CV5D 3B6GC 3W98B 3LZ0A 3C1BD 3KWQB 3REKD 1EQZB 3TU4C 2RVQD 3X1TD 1KX3A 2HIOC 4ZUXC 2L5AA 5KDMA 5B24A 3B0DB 3W98A 1TZYA 4Z5TA 1ID3D 5CPKC 5JRGC 3AZFD 3AZMA 3X1SA 3WA9D 5BT1C 4QLCB 3A6ND 4WU8B 3KUYA 2F8NH 5B1MA 4G92B 1HQ3D 3B6FC 4E45A 3AZJC 5BS7A 4WZSB 4Z2MG 2FJ7A 2BYKB 3MVDA 3REJC 4J8WA 3NQJA 3UTBC 1M1AC 5GT0C 3WTPD 5CHLB 3AV2C 3KXBB 5DNNC 3MGRC 5AV9B 2BYKA 3REKA 3MNNB 1KU5A 5E5AA 3AZED 3REHB 5AVCB 5AV6C 3KXBA 1M19A 1P3KB 5AV9A 1M18D 1U35D 1F66D 1P3MC 3AZFA 4XUJC 3AFAA 3AZND 4R8PC 5B31C 3AN2A 3MGSD 3X1VD 4EO5C 4JJNB 4LD9B 5B0YA 3LZ1B 3C1CC 5AV8B 3W96D 4YM6B 1KX4D 3LJAD 5AV5B 3R45A 3W99C 4UUZB 3LELD 4XZQD 5AVBD 4J8UB 1AOIC 5GSUB 5B2IC 5B0ZC 3B6GD 4J8XB 1P3FB 3TU4D 4H9SC 5B40C 5GT3B 2HIOD 4ZUXD 1F66A 3MGPB 3W97A 5GSUA 1P3IC 3WKJB 4X23C 5CPKD 1N1JB 5JRGD 4J8XA 4KUDB 5B1LD 4YS3C 1EQZC 5BT1D 4Z66B 1R4VA 3AYWC 3AZLB 3AZJD 1S32B 3B6FD 3B0DC 4KUDA 1P3AB 4E44A 3REJD 3UTBD 5AVBA 1M1AD 5GT0D 2BYMB 4QLCC 3AV2D 3AZLA 5BO0B 4G92C 5DNND 3MGRD 3VH6A 3NQUB 4NFTA 1P3BC 5AV6D 4WNNB 2BYMA 4WV4B 3NQUA 3REIB 1P3MD 4XUJD 5CPJB 2NQBB 2YFWB 4WU9A 3MNNC 5B31D 4WNNA 3REHC 5AVCC 5JA4B 4KGCC 1ZLAC 4J8VB 3WAAC 3REIA 5FUGB 5B33C 3AZIB 1P3KC 2F8ND 3RELB 5B2JB 2NQBA 2YFWA 3C1CD 1P3LB 1KX5C 5DNMC 2NZDB 1WWSA 3W99D 5DNNA 3MGRA 4J8VA 1B6WA 3AZIA 3MGQC 1AOID 4LD9C 5B2ID 5B0ZD 3LZ0B 3LZ1C 2AROA 5AV8C 4YM6C 1P3OC 5B40D 3KSYA 3AZHD 4KHAB 5KDMB 5B24B 1TAFB 1P3ID 1TZYB 4Z5TB 4J8UC 4R8PA 4X23D 5CPIC 3AZMB 3X1SB 4YS3D 1EQZD 3KUYB 4KHAA 5B1MB 5GT3C 1TAFA 3V9RB 3AYWD 2FJ7B 1HTAA 3WKJC 3MVDB 5B1LC 4DRBA 5G49A 4J8WB 5B32C
chains in the Genus database with same CATH superfamily
3NQJB 3O62A 1AOIA 4QLCD 3V9RA 3X1UC 2RIQA 1P3PC 1S32C 3C1BB 3REKB 1P3BD 5E5AB 5B40A 5CP6C 3A1KA 4H9RA 3AV1C 1M19B 2CV5A 1ID3B 2HUEB 3C1BA 2W8SA 3AZFB 3X1TA 2PYOC 3AFAB 5F99C 5AY8C 3MNND 3A1IA 3UTAC 3AN2B 3REHD 4G91C 3AYWA 5AVCD 1ID3A 5BNVB 4KGCD 1P3GC 1ZLAD 5B31G 4AWLC 1P3KD 4NE6A 5B0YB 5B33D 3WAAD 3WA9A 3UT9C 1Q9CA 3A6NA 5CPJC 1KX5D 3WTPB 5DNMD 1HQ3A 3R45B 2Y2OA 5BNVA 2F8NG 3MGQD 4LD9D 3AZEB 5GXQC 3WTPA 3RELC 1BH9A 5B2JC 2UWXA 3LZ1D 3AZKC 3AZGC 5AV8D 1M18B 1H3OA 4YM6D 1U35B 1P3OD 1F66B 2NZDC 3AZNB 3W97B 4DQYB 3AZEA 4J8UD 2ZY4A 1P34C 2IO5B 2F2AC 3X1VB 5CPID 4H9QB 1M18A 1U35A 3AZHC 1ZLAA 3F6TA 1KX3C 3WAAA 3AZNA 3VH6W 5GT3D 1Z2CB 3W96B 3MGPD 4NE5A 3W98C 1TZYC 4Z5TC 3LJAB 3MGSA 3X1VA 3WKJD 4H9QA 3KWQC 4XZQB 5B32D 2G5HC 3LELB 3AZMC 2YFVB 5AVBB 3X1SC 3W96A 3X1UD 3B6GB 3H0LC 1P3PD 1KX4A 1S32D 3LJAA 5BS7C 2FJ7C 3LELA 4XZQA 3MVDC 4ZUXB 2YFVA 5CP6D 4WU8C 3AV1D 2CWEA 3B6GA 5CPKB 5JRGB 3TU4A 2PYOD 5F99D 4WU9B 5AY8D 2HIOA 4ZUXA 4CSRA 3UTAD 3AZJB 2ZY3A 5CPKA 5JRGA 3KXBC 1P3GD 1M19C 5AV9C 5B1LA 4H9PA 3REJB 3UT9D 3AFAC 1M1AB 5CPJD 5GT0B 3AV2B 3B6FA 3AZJA 1W2EA 5DNNB 3MGRB 3AN2C 2LY8A 3B0BA 3REJA 5GXQD 5B0YC 3UTBA 5GT0A 1M1AA 3RELD 5B2JD 3AZKD 2AROB 3AV2A 3AZGD 3EG5B 2XD5A 1A7WA 4JJNC 2NZDD 1P3MB 4XUJB 2JE5A 5AY8A 4R8PB 2Y2JA 1P34D 2Y2MA 5AV6A 2BG1A 4WJ3C 3WTPE 5AV5C 1KX3D 1P3MA 4XUJA 4CAYB 3UT9A 5B31A 1WWIA 5GSUC 3W97C 3W98D 1TZYD 4Z5TD 5G49B 4J8XC 3EPKA 1P3FC 3W99B 3KWQD 3VH5T 3O62B 3AZMD 2F8NA 1B67A 3X1SD 1AOIB 4CAYA 3C1CA 3KUYD 3MGPC 4Z2MH 5B32G 4H9OA 2FJ7D 3W99A 4KUDC 5B40B 3MVDD 4M6BA 4H9RB 2FFFB 1P3IB 3B0CT 5B2IA 5B0ZA 4WU8D 2CV5B 3VH5A 4X23B 1P34A 4Z66C 3AZLC 3X1TB 4H9SA 4YS3B 1P3AC 3AZHA 4HGAB 2ZM5A 5E5AD 1P3IA 3AYWB 4X23A 3KXBD 1M19D 5AV9D 4YS3A 5C3IB 3KWQA 1EQZA 3WA9B 3A6NB 3KFUG 3AFAD 1HQ3B 4WU9C 2G5IC 3AN2D 5BNXB 1P3BB 3REIC 5B0YD 1BH9B 2NQBC 4QLCA 4WU8A 1H3OB 4ZBJB 4JJND 5BNXA 4J8VC 1P3BA 1BFMA 2XD1A 3AZIC 1P3LC 2AROC 4KGCB 2JSSA 5AV5D 1ZLAB 3WAAB 5B33B 3MNNA 1KX5B 5GSUD 5DNMB 3W97D 3MGSB 3REHA 3LZ0C 5AVCA 4J8XD 1P3FD 4KGCA 1P3KA 5B33A 3MGQB 4NE3A 1KX5A 5DNMA 5B24C 1KX4B 1P3OB 4KUDD 4JJNA 3MGQA 3O62C 3KUYC 4LD9A 5B1MC 2Y2IA 3LZ1A 4Z66D 3AZLD 4H9NB 5AV8A 3TU4B 5CPIB 4YM6A 1P3OA 5AV5A 2HIOB 1P3AD 4J8WC 4UUZA 4CSRB 3H0RC 1F1EA 4J8UA 2J8PA 3H0MC 4H9NA 2CV5C 5B1LB 4H9PB 3IP4C 5CPIA 3C1BC 3REKC 5B32B 1P3FA 2RVQC 3X1TC 5E5AC 5GT3A 4WU9D 3B6FB 4HGAC 3X1UB 3VH6T 3MGPA 1P3PB 1ID3C 3WKJA 2HUEC 1N1JA 5B32A 3EPJA 3AZFC 3REID 3UTBB 1JFIB 5CP6B 3WA9C 5C3IC 2NQBD 1BH8B 3A6NC 4DRAA 3AV1B 2DQNC 1HQ3C 3X1UA 1P3PA 4Z66A 1S32A 2PYOB 4J8VD 5F99B 5AY8B 1P3AA 1JFIA 3AZID 5CP6A 5AV6B 3UTAB 1BH8A 3AV1A 1P3LD 4G91B 3WTPC 2AROD 1P3GB 5BO0A 4AWLB 2PYOA 2Y2PA 4ZBJC 5F99A 3UT9B 5B31B 3UTAA 3AZEC 3FDDA 4R8PD 4EO5B 3LZ0D 2VQRA 1P3GA 3VH5W 1M18C 1U35C 2F8NB 1F66C 2Y2QA 3C1CB 5GXQB 3AZNC 5CPJA 5B24D 3AZKB 3AL0C 4H9OB 3AZGB 2IO5C 3X1VC 3MGSC 1ULYA 2Y2LA 5JA4A 5B2IB 5B0ZB 3O62D 3B0CW 5FUGA 5B1MD 5GXQA 1P34B 3RELA 5B2JA 3AZKA 3W96C 3AZGA 1P3LA 1KX4C 3LJAC 3AZHB 2NZDA 4J8WD 3LELC 4XZQC 1KX3B 5AVBC 2DF4C 2F8NK 2CV5D 3B6GC 3W98B 3LZ0A 3C1BD 3KWQB 3REKD 1EQZB 3TU4C 2RVQD 3X1TD 1KX3A 2HIOC 4ZUXC 2L5AA 2Y2KA 5KDMA 3B0DB 5B24A 3W98A 1TZYA 4Z5TA 1ID3D 5CPKC 5JRGC 2ZY2A 3AZFD 3AZMA 3X1SA 3WA9D 5BT1C 4QLCB 3A6ND 4WU8B 3KUYA 2F8NH 5B1MA 4G92B 1HQ3D 3B6FC 4E45A 3AZJC 5BS7A 4WZSB 4Z2MG 2FJ7A 2BYKB 3MVDA 3REJC 4J8WA 3NQJA 3UTBC 1M1AC 5GT0C 3WTPD 5CHLB 3AV2C 3KXBB 5DNNC 3MGRC 5AV9B 2BYKA 3REKA 3MNNB 1KU5A 5E5AA 3P5JB 3REHB 3AZED 5AVCB 5AV6C 3KXBA 1M19A 1P3KB 5AV9A 1M18D 1U35D 1T3UA 1F66D 1P3MC 3AZFA 4XUJC 3AFAA 3AZND 4R8PC 5B31C 3AN2A 3MGSD 3X1VD 4EO5C 4JJNB 2ZY5A 4LD9B 5B0YA 3LZ1B 3C1CC 5AV8B 3W96D 4YM6B 1KX4D 3LJAD 5AV5B 1PZRA 3R45A 3W99C 4UUZB 3LELD 4XZQD 5AVBD 4J8UB 1AOIC 5GSUB 5B2IC 5B0ZC 3B6GD 4J8XB 3EPHA 1P3FB 3TU4D 4H9SC 3EPLA 2Y2NA 5B40C 5GT3B 2HIOD 4ZUXD 1F66A 3MGPB 3W97A 5GSUA 1P3IC 3WKJB 4X23C 5CPKD 1N1JB 5JRGD 4J8XA 4KUDB 5B1LD 4YS3C 1EQZC 5BT1D 4Z66B 1R4VA 3AYWC 3AZLB 3AZJD 1S32B 3B6FD 3B0DC 4KUDA 1P3AB 4E44A 3REJD 3UTBD 5AVBA 1M1AD 5GT0D 4UPKA 2BYMB 4QLCC 3AV2D 3AZLA 5BO0B 4G92C 5DNND 3MGRD 3VH6A 3NQUB 4NFTA 1P3BC 5AV6D 4WNNB 2BYMA 4WV4B 3NQUA 3REIB 2JCHA 1P3MD 4XUJD 5CPJB 2NQBB 2YFWB 4WU9A 3MNNC 5B31D 4WNNA 3REHC 5AVCC 5JA4B 4KGCC 1ZLAC 4J8VB 3WAAC 3REIA 5FUGB 5B33C 3AZIB 1P3KC 2F8ND 3RELB 5B2JB 2NQBA 2YFWA 3C1CD 1P3LB 1KX5C 5DNMC 2Y2GA 2NZDB 1WWSA 3W99D 5DNNA 3MGRA 4J8VA 1B6WA 3AZIA 3MGQC 1AOID 4LD9C 5B2ID 5B0ZD 3LZ0B 3LZ1C 2AROA 5AV8C 4YM6C 1P3OC 2Y2HA 5B40D 3KSYA 3AZHD 4KHAB 5KDMB 5B24B 1TAFB 1P3ID 1TZYB 4Z5TB 4J8UC 4R8PA 4X23D 5CPIC 3AZMB 3X1SB 4YS3D 1EQZD 3KUYB 4KHAA 5B1MB 5GT3C 1TAFA 3V9RB 3AYWD 2FJ7B 1HTAA 3WKJC 3MVDB 5B1LC 4DRBA 5G49A 4J8WB 5B32C
chains in the Genus database with same CATH topology
3NQJB 3O62A 1AOIA 4QLCD 3V9RA 3X1UC 2RIQA 1P3PC 1S32C 3C1BB 3REKB 1P3BD 5E5AB 5B40A 5CP6C 3A1KA 4H9RA 3AV1C 1M19B 2CV5A 1ID3B 2HUEB 3C1BA 2W8SA 3AZFB 3X1TA 2PYOC 3AFAB 5F99C 5AY8C 3MNND 3A1IA 3UTAC 3AN2B 3REHD 4G91C 3AYWA 5AVCD 1ID3A 5BNVB 4KGCD 1P3GC 1ZLAD 5B31G 4AWLC 1P3KD 4NE6A 5B0YB 5B33D 3WAAD 3WA9A 3UT9C 1Q9CA 3A6NA 5CPJC 1KX5D 3WTPB 5DNMD 1HQ3A 3R45B 2Y2OA 5BNVA 2F8NG 3MGQD 4LD9D 3AZEB 5GXQC 3WTPA 3RELC 1BH9A 5B2JC 2UWXA 3LZ1D 3AZKC 3AZGC 5AV8D 1M18B 1H3OA 4YM6D 1U35B 1P3OD 1F66B 2NZDC 3AZNB 3W97B 4DQYB 3AZEA 4J8UD 2ZY4A 1P34C 2IO5B 2F2AC 3X1VB 5CPID 4H9QB 1M18A 1U35A 3AZHC 1ZLAA 3F6TA 1KX3C 3WAAA 3AZNA 3VH6W 5GT3D 1Z2CB 3W96B 3MGPD 4NE5A 3W98C 1TZYC 4Z5TC 3LJAB 3MGSA 3X1VA 3WKJD 4H9QA 3KWQC 4XZQB 5B32D 2G5HC 3LELB 3AZMC 2YFVB 5AVBB 3X1SC 3W96A 3X1UD 3B6GB 3H0LC 1P3PD 1KX4A 1S32D 3LJAA 5BS7C 2FJ7C 3LELA 4XZQA 3MVDC 4ZUXB 2YFVA 5CP6D 4WU8C 3AV1D 2CWEA 3B6GA 5CPKB 5JRGB 3TU4A 2PYOD 5F99D 4WU9B 5AY8D 2HIOA 4ZUXA 4CSRA 3UTAD 3AZJB 2ZY3A 5CPKA 5JRGA 3KXBC 1P3GD 1M19C 5AV9C 5B1LA 4H9PA 3REJB 3UT9D 3AFAC 1M1AB 5CPJD 5GT0B 3AV2B 3B6FA 3AZJA 1W2EA 5DNNB 3MGRB 3AN2C 2LY8A 3B0BA 3REJA 5GXQD 5B0YC 3UTBA 5GT0A 1M1AA 3RELD 5B2JD 3AZKD 2AROB 3AV2A 3AZGD 3EG5B 2XD5A 1A7WA 4JJNC 2NZDD 1P3MB 4XUJB 2JE5A 5AY8A 4R8PB 2Y2JA 1P34D 2Y2MA 5AV6A 2BG1A 4WJ3C 3WTPE 5AV5C 1KX3D 1P3MA 4XUJA 4CAYB 3UT9A 5B31A 1WWIA 5GSUC 3W97C 3W98D 1TZYD 4Z5TD 5G49B 4J8XC 3EPKA 1P3FC 3W99B 3KWQD 3VH5T 3O62B 3AZMD 2F8NA 1B67A 3X1SD 1AOIB 4CAYA 3C1CA 3KUYD 3MGPC 4Z2MH 5B32G 4H9OA 2FJ7D 3W99A 4KUDC 5B40B 3MVDD 4M6BA 4H9RB 2FFFB 1P3IB 3B0CT 5B2IA 5B0ZA 4WU8D 2CV5B 3VH5A 4X23B 1P34A 4Z66C 3AZLC 3X1TB 4H9SA 4YS3B 1P3AC 3AZHA 4HGAB 2ZM5A 5E5AD 1P3IA 3AYWB 4X23A 3KXBD 1M19D 5AV9D 4YS3A 5C3IB 3KWQA 1EQZA 3WA9B 3A6NB 3KFUG 3AFAD 1HQ3B 4WU9C 2G5IC 3AN2D 5BNXB 1P3BB 3REIC 5B0YD 1BH9B 2NQBC 4QLCA 4WU8A 1H3OB 4ZBJB 4JJND 5BNXA 4J8VC 1P3BA 1BFMA 2XD1A 3AZIC 1P3LC 2AROC 4KGCB 2JSSA 5AV5D 1ZLAB 3WAAB 5B33B 3MNNA 1KX5B 5GSUD 5DNMB 3W97D 3MGSB 3REHA 3LZ0C 5AVCA 4J8XD 1P3FD 4KGCA 1P3KA 5B33A 3MGQB 4NE3A 1KX5A 5DNMA 5B24C 1KX4B 1P3OB 4KUDD 4JJNA 3MGQA 3O62C 3KUYC 4LD9A 5B1MC 2Y2IA 3LZ1A 4Z66D 3AZLD 4H9NB 5AV8A 3TU4B 5CPIB 4YM6A 1P3OA 5AV5A 2HIOB 1P3AD 4J8WC 4UUZA 4CSRB 3H0RC 1F1EA 4J8UA 2J8PA 3H0MC 4H9NA 2CV5C 5B1LB 4H9PB 3IP4C 5CPIA 3C1BC 3REKC 5B32B 1P3FA 2RVQC 3X1TC 5E5AC 5GT3A 4WU9D 3B6FB 4HGAC 3X1UB 3VH6T 3MGPA 1P3PB 1ID3C 3WKJA 2HUEC 1N1JA 5B32A 3EPJA 3AZFC 3REID 3UTBB 1JFIB 5CP6B 3WA9C 5C3IC 2NQBD 1BH8B 3A6NC 4DRAA 3AV1B 2DQNC 1HQ3C 3X1UA 1P3PA 4Z66A 1S32A 2PYOB 4J8VD 5F99B 5AY8B 1P3AA 1JFIA 3AZID 5CP6A 5AV6B 3UTAB 1BH8A 3AV1A 1P3LD 4G91B 3WTPC 2AROD 1P3GB 5BO0A 4AWLB 2PYOA 2Y2PA 4ZBJC 5F99A 3UT9B 5B31B 3UTAA 3AZEC 3FDDA 4R8PD 4EO5B 3LZ0D 2VQRA 1P3GA 3VH5W 1M18C 1U35C 2F8NB 1F66C 2Y2QA 3C1CB 5GXQB 3AZNC 5CPJA 5B24D 3AZKB 3AL0C 4H9OB 3AZGB 2IO5C 3X1VC 3MGSC 1ULYA 2Y2LA 5JA4A 5B2IB 5B0ZB 3O62D 3B0CW 5FUGA 5B1MD 5GXQA 1P34B 3RELA 5B2JA 3AZKA 3W96C 3AZGA 1P3LA 1KX4C 3LJAC 3AZHB 2NZDA 4J8WD 3LELC 4XZQC 1KX3B 5AVBC 2DF4C 2F8NK 2CV5D 3B6GC 3W98B 3LZ0A 3C1BD 3KWQB 3REKD 1EQZB 3TU4C 2RVQD 3X1TD 1KX3A 2HIOC 4ZUXC 2L5AA 2Y2KA 5KDMA 3B0DB 5B24A 3W98A 1TZYA 4Z5TA 1ID3D 5CPKC 5JRGC 2ZY2A 3AZFD 3AZMA 3X1SA 3WA9D 5BT1C 4QLCB 3A6ND 4WU8B 3KUYA 2F8NH 5B1MA 4G92B 1HQ3D 3B6FC 4E45A 3AZJC 5BS7A 4WZSB 4Z2MG 2FJ7A 2BYKB 3MVDA 3REJC 4J8WA 3NQJA 3UTBC 1M1AC 5GT0C 3WTPD 5CHLB 3AV2C 3KXBB 5DNNC 3MGRC 5AV9B 2BYKA 3REKA 3MNNB 1KU5A 5E5AA 3P5JB 3REHB 3AZED 5AVCB 5AV6C 3KXBA 1M19A 1P3KB 5AV9A 1M18D 1U35D 1T3UA 1F66D 1P3MC 3AZFA 4XUJC 3AFAA 3AZND 4R8PC 5B31C 3AN2A 3MGSD 3X1VD 4EO5C 4JJNB 2ZY5A 4LD9B 5B0YA 3LZ1B 3C1CC 5AV8B 3W96D 4YM6B 1KX4D 3LJAD 5AV5B 1PZRA 3R45A 3W99C 4UUZB 3LELD 4XZQD 5AVBD 4J8UB 1AOIC 5GSUB 5B2IC 5B0ZC 3B6GD 4J8XB 3EPHA 1P3FB 3TU4D 4H9SC 3EPLA 2Y2NA 5B40C 5GT3B 2HIOD 4ZUXD 1F66A 3MGPB 3W97A 5GSUA 1P3IC 3WKJB 4X23C 5CPKD 1N1JB 5JRGD 4J8XA 4KUDB 5B1LD 4YS3C 1EQZC 5BT1D 4Z66B 1R4VA 3AYWC 3AZLB 3AZJD 1S32B 3B6FD 3B0DC 4KUDA 1P3AB 4E44A 3REJD 3UTBD 5AVBA 1M1AD 5GT0D 4UPKA 2BYMB 4QLCC 3AV2D 3AZLA 5BO0B 4G92C 5DNND 3MGRD 3VH6A 3NQUB 4NFTA 1P3BC 5AV6D 4WNNB 2BYMA 4WV4B 3NQUA 3REIB 2JCHA 1P3MD 4XUJD 5CPJB 2NQBB 2YFWB 4WU9A 3MNNC 5B31D 4WNNA 3REHC 5AVCC 5JA4B 4KGCC 1ZLAC 4J8VB 3WAAC 3REIA 5FUGB 5B33C 3AZIB 1P3KC 2F8ND 3RELB 5B2JB 2NQBA 2YFWA 3C1CD 1P3LB 1KX5C 5DNMC 2Y2GA 2NZDB 1WWSA 3W99D 5DNNA 3MGRA 4J8VA 1B6WA 3AZIA 3MGQC 1AOID 4LD9C 5B2ID 5B0ZD 3LZ0B 3LZ1C 2AROA 5AV8C 4YM6C 1P3OC 2Y2HA 5B40D 3KSYA 3AZHD 4KHAB 5KDMB 5B24B 1TAFB 1P3ID 1TZYB 4Z5TB 4J8UC 4R8PA 4X23D 5CPIC 3AZMB 3X1SB 4YS3D 1EQZD 3KUYB 4KHAA 5B1MB 5GT3C 1TAFA 3V9RB 3AYWD 2FJ7B 1HTAA 3WKJC 3MVDB 5B1LC 4DRBA 5G49A 4J8WB 5B32C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQJ B;  3O62 A;  1AOI A;  4QLC D;  3V9R A;  3X1U C;  1P3P C;  1S32 C;  3C1B B;  3REK B;  1P3B D;  5E5A B;  5B40 A;  5CP6 C;  4H9R A;  3AV1 C;  1M19 B;  2CV5 A;  1ID3 B;  2HUE B;  3C1B A;  3AZF B;  3X1T A;  2PYO C;  3AFA B;  5F99 C;  5AY8 C;  3MNN D;  3UTA C;  3AN2 B;  3REH D;  4G91 C;  3AYW A;  5AVC D;  1ID3 A;  5BNV B;  4KGC D;  1P3G C;  1ZLA D;  5B31 G;  4AWL C;  1P3K D;  4NE6 A;  5B0Y B;  5B33 D;  3WAA D;  3WA9 A;  3UT9 C;  1Q9C A;  3A6N A;  5CPJ C;  1KX5 D;  3WTP B;  5DNM D;  1HQ3 A;  3R45 B;  5BNV A;  2F8N G;  3MGQ D;  4LD9 D;  3AZE B;  5GXQ C;  3WTP A;  3REL C;  1BH9 A;  5B2J C;  3LZ1 D;  3AZK C;  3AZG C;  5AV8 D;  1M18 B;  1H3O A;  4YM6 D;  1U35 B;  1P3O D;  1F66 B;  2NZD C;  3AZN B;  3W97 B;  3AZE A;  4J8U D;  1P34 C;  2IO5 B;  3X1V B;  5CPI D;  4H9Q B;  1M18 A;  1U35 A;  3AZH C;  1ZLA A;  1KX3 C;  3WAA A;  3AZN A;  3VH6 W;  5GT3 D;  3W96 B;  3MGP D;  4NE5 A;  3W98 C;  1TZY C;  4Z5T C;  3LJA B;  3MGS A;  3X1V A;  3WKJ D;  4H9Q A;  3KWQ C;  4XZQ B;  5B32 D;  3LEL B;  3AZM C;  2YFV B;  5AVB B;  3X1S C;  3W96 A;  3X1U D;  3B6G B;  1P3P D;  1KX4 A;  1S32 D;  3LJA A;  5BS7 C;  2FJ7 C;  3LEL A;  4XZQ A;  3MVD C;  4ZUX B;  2YFV A;  5CP6 D;  4WU8 C;  3AV1 D;  2CWE A;  3B6G A;  5CPK B;  5JRG B;  3TU4 A;  2PYO D;  5F99 D;  4WU9 B;  5AY8 D;  2HIO A;  4ZUX A;  4CSR A;  3UTA D;  3AZJ B;  5CPK A;  5JRG A;  3KXB C;  1P3G D;  1M19 C;  5AV9 C;  5B1L A;  4H9P A;  3REJ B;  3UT9 D;  3AFA C;  1M1A B;  5CPJ D;  5GT0 B;  3AV2 B;  3B6F A;  3AZJ A;  5DNN B;  3MGR B;  3AN2 C;  2LY8 A;  3B0B A;  3REJ A;  5GXQ D;  5B0Y C;  3UTB A;  5GT0 A;  1M1A A;  3REL D;  5B2J D;  3AZK D;  2ARO B;  3AV2 A;  3AZG D;  1A7W A;  4JJN C;  2NZD D;  1P3M B;  4XUJ B;  5AY8 A;  4R8P B;  1P34 D;  5AV6 A;  3WTP E;  5AV5 C;  1KX3 D;  1P3M A;  4XUJ A;  4CAY B;  3UT9 A;  5B31 A;  1WWI A;  5GSU C;  3W97 C;  3W98 D;  1TZY D;  4Z5T D;  5G49 B;  4J8X C;  1P3F C;  3W99 B;  3KWQ D;  3VH5 T;  3O62 B;  3AZM D;  2F8N A;  1B67 A;  3X1S D;  1AOI B;  4CAY A;  3C1C A;  3KUY D;  3MGP C;  4Z2M H;  5B32 G;  4H9O A;  2FJ7 D;  3W99 A;  4KUD C;  5B40 B;  3MVD D;  4M6B A;  4H9R B;  1P3I B;  3B0C T;  5B2I A;  5B0Z A;  4WU8 D;  2CV5 B;  3VH5 A;  4X23 B;  1P34 A;  4Z66 C;  3AZL C;  3X1T B;  4H9S A;  4YS3 B;  1P3A C;  3AZH A;  4HGA B;  5E5A D;  1P3I A;  3AYW B;  4X23 A;  3KXB D;  1M19 D;  5AV9 D;  4YS3 A;  5C3I B;  3KWQ A;  1EQZ A;  3WA9 B;  3A6N B;  3AFA D;  1HQ3 B;  4WU9 C;  3AN2 D;  5BNX B;  1P3B B;  3REI C;  5B0Y D;  1BH9 B;  2NQB C;  4QLC A;  4WU8 A;  1H3O B;  4ZBJ B;  4JJN D;  5BNX A;  4J8V C;  1P3B A;  1BFM A;  3AZI C;  1P3L C;  2ARO C;  4KGC B;  2JSS A;  5AV5 D;  1ZLA B;  3WAA B;  5B33 B;  3MNN A;  1KX5 B;  5GSU D;  5DNM B;  3W97 D;  3MGS B;  3REH A;  3LZ0 C;  5AVC A;  4J8X D;  1P3F D;  4KGC A;  1P3K A;  5B33 A;  3MGQ B;  4NE3 A;  1KX5 A;  5DNM A;  5B24 C;  1KX4 B;  1P3O B;  4KUD D;  4JJN A;  3MGQ A;  3O62 C;  3KUY C;  4LD9 A;  5B1M C;  3LZ1 A;  4Z66 D;  3AZL D;  4H9N B;  5AV8 A;  3TU4 B;  5CPI B;  4YM6 A;  1P3O A;  5AV5 A;  2HIO B;  1P3A D;  4J8W C;  4UUZ A;  4CSR B;  1F1E A;  4J8U A;  4H9N A;  2CV5 C;  5B1L B;  4H9P B;  5CPI A;  3C1B C;  3REK C;  5B32 B;  1P3F A;  2RVQ C;  3X1T C;  5E5A C;  5GT3 A;  4WU9 D;  3B6F B;  4HGA C;  3X1U B;  3VH6 T;  3MGP A;  1P3P B;  1ID3 C;  3WKJ A;  2HUE C;  1N1J A;  5B32 A;  3AZF C;  3REI D;  3UTB B;  1JFI B;  5CP6 B;  3WA9 C;  5C3I C;  2NQB D;  1BH8 B;  3A6N C;  4DRA A;  3AV1 B;  3X1U A;  1HQ3 C;  1P3P A;  4Z66 A;  1S32 A;  2PYO B;  4J8V D;  5F99 B;  5AY8 B;  1P3A A;  1JFI A;  3AZI D;  5CP6 A;  5AV6 B;  3UTA B;  1BH8 A;  3AV1 A;  1P3L D;  4G91 B;  3WTP C;  2ARO D;  1P3G B;  5BO0 A;  4AWL B;  2PYO A;  4ZBJ C;  5F99 A;  3UT9 B;  5B31 B;  3UTA A;  3AZE C;  4R8P D;  4EO5 B;  3LZ0 D;  1P3G A;  3VH5 W;  1M18 C;  1U35 C;  2F8N B;  1F66 C;  3C1C B;  5GXQ B;  3AZN C;  5CPJ A;  5B24 D;  3AZK B;  4H9O B;  3AZG B;  2IO5 C;  3X1V C;  3MGS C;  1ULY A;  5JA4 A;  5B2I B;  5B0Z B;  3O62 D;  3B0C W;  5FUG A;  5B1M D;  5GXQ A;  1P34 B;  3REL A;  5B2J A;  3AZK A;  3W96 C;  3AZG A;  1P3L A;  1KX4 C;  3LJA C;  3AZH B;  2NZD A;  4J8W D;  3LEL C;  4XZQ C;  1KX3 B;  5AVB C;  2F8N K;  2CV5 D;  3B6G C;  3W98 B;  3LZ0 A;  3C1B D;  3KWQ B;  3REK D;  1EQZ B;  3TU4 C;  2RVQ D;  3X1T D;  1KX3 A;  2HIO C;  4ZUX C;  2L5A A;  5KDM A;  5B24 A;  3B0D B;  3W98 A;  1TZY A;  4Z5T A;  1ID3 D;  5CPK C;  5JRG C;  3AZF D;  3AZM A;  3X1S A;  3WA9 D;  5BT1 C;  4QLC B;  3A6N D;  4WU8 B;  3KUY A;  2F8N H;  5B1M A;  4G92 B;  1HQ3 D;  3B6F C;  4E45 A;  3AZJ C;  5BS7 A;  4WZS B;  4Z2M G;  2FJ7 A;  2BYK B;  3MVD A;  3REJ C;  4J8W A;  3NQJ A;  3UTB C;  1M1A C;  5GT0 C;  3WTP D;  5CHL B;  3AV2 C;  3KXB B;  5DNN C;  3MGR C;  5AV9 B;  2BYK A;  3REK A;  3MNN B;  1KU5 A;  5E5A A;  3AZE D;  3REH B;  5AVC B;  5AV6 C;  3KXB A;  1M19 A;  1P3K B;  5AV9 A;  1M18 D;  1U35 D;  1F66 D;  1P3M C;  3AZF A;  4XUJ C;  3AFA A;  3AZN D;  4R8P C;  5B31 C;  3AN2 A;  3MGS D;  3X1V D;  4EO5 C;  4JJN B;  4LD9 B;  5B0Y A;  3LZ1 B;  3C1C C;  5AV8 B;  3W96 D;  4YM6 B;  1KX4 D;  3LJA D;  5AV5 B;  3R45 A;  3W99 C;  4UUZ B;  3LEL D;  4XZQ D;  5AVB D;  4J8U B;  1AOI C;  5GSU B;  5B2I C;  5B0Z C;  3B6G D;  4J8X B;  1P3F B;  3TU4 D;  4H9S C;  5B40 C;  5GT3 B;  2HIO D;  4ZUX D;  1F66 A;  3MGP B;  3W97 A;  5GSU A;  1P3I C;  3WKJ B;  4X23 C;  5CPK D;  1N1J B;  5JRG D;  4J8X A;  4KUD B;  5B1L D;  4YS3 C;  1EQZ C;  5BT1 D;  4Z66 B;  1R4V A;  3AYW C;  3AZL B;  3AZJ D;  1S32 B;  3B6F D;  3B0D C;  4KUD A;  1P3A B;  4E44 A;  3REJ D;  3UTB D;  5AVB A;  1M1A D;  5GT0 D;  2BYM B;  4QLC C;  3AV2 D;  3AZL A;  5BO0 B;  4G92 C;  5DNN D;  3MGR D;  3VH6 A;  3NQU B;  4NFT A;  1P3B C;  5AV6 D;  4WNN B;  2BYM A;  4WV4 B;  3NQU A;  3REI B;  1P3M D;  4XUJ D;  5CPJ B;  2NQB B;  2YFW B;  4WU9 A;  3MNN C;  5B31 D;  4WNN A;  3REH C;  5AVC C;  5JA4 B;  4KGC C;  1ZLA C;  4J8V B;  3WAA C;  3REI A;  5FUG B;  5B33 C;  3AZI B;  1P3K C;  2F8N D;  3REL B;  5B2J B;  2NQB A;  2YFW A;  3C1C D;  1P3L B;  1KX5 C;  5DNM C;  2NZD B;  1WWS A;  3W99 D;  5DNN A;  3MGR A;  4J8V A;  1B6W A;  3AZI A;  3MGQ C;  1AOI D;  4LD9 C;  5B2I D;  5B0Z D;  3LZ0 B;  3LZ1 C;  2ARO A;  5AV8 C;  4YM6 C;  1P3O C;  5B40 D;  3KSY A;  3AZH D;  4KHA B;  5KDM B;  5B24 B;  1TAF B;  1P3I D;  1TZY B;  4Z5T B;  4J8U C;  4R8P A;  4X23 D;  5CPI C;  3AZM B;  3X1S B;  4YS3 D;  1EQZ D;  3KUY B;  4KHA A;  5B1M B;  5GT3 C;  1TAF A;  3V9R B;  3AYW D;  2FJ7 B;  1HTA A;  3WKJ C;  3MVD B;  5B1L C;  4DRB A;  5G49 A;  4J8W B;  5B32 C; 
#chains in the Genus database with same CATH topology
 3NQJ B;  3O62 A;  1AOI A;  4QLC D;  3V9R A;  3X1U C;  2RIQ A;  1P3P C;  1S32 C;  3C1B B;  3REK B;  1P3B D;  5E5A B;  5B40 A;  5CP6 C;  3A1K A;  4H9R A;  3AV1 C;  1M19 B;  2CV5 A;  1ID3 B;  2HUE B;  3C1B A;  2W8S A;  3AZF B;  3X1T A;  2PYO C;  3AFA B;  5F99 C;  5AY8 C;  3MNN D;  3A1I A;  3UTA C;  3AN2 B;  3REH D;  4G91 C;  3AYW A;  5AVC D;  1ID3 A;  5BNV B;  4KGC D;  1P3G C;  1ZLA D;  5B31 G;  4AWL C;  1P3K D;  4NE6 A;  5B0Y B;  5B33 D;  3WAA D;  3WA9 A;  3UT9 C;  1Q9C A;  3A6N A;  5CPJ C;  1KX5 D;  3WTP B;  5DNM D;  1HQ3 A;  3R45 B;  2Y2O A;  5BNV A;  2F8N G;  3MGQ D;  4LD9 D;  3AZE B;  5GXQ C;  3WTP A;  3REL C;  1BH9 A;  5B2J C;  2UWX A;  3LZ1 D;  3AZK C;  3AZG C;  5AV8 D;  1M18 B;  1H3O A;  4YM6 D;  1U35 B;  1P3O D;  1F66 B;  2NZD C;  3AZN B;  3W97 B;  4DQY B;  3AZE A;  4J8U D;  2ZY4 A;  1P34 C;  2IO5 B;  2F2A C;  3X1V B;  5CPI D;  4H9Q B;  1M18 A;  1U35 A;  3AZH C;  1ZLA A;  3F6T A;  1KX3 C;  3WAA A;  3AZN A;  3VH6 W;  5GT3 D;  1Z2C B;  3W96 B;  3MGP D;  4NE5 A;  3W98 C;  1TZY C;  4Z5T C;  3LJA B;  3MGS A;  3X1V A;  3WKJ D;  4H9Q A;  3KWQ C;  4XZQ B;  5B32 D;  2G5H C;  3LEL B;  3AZM C;  2YFV B;  5AVB B;  3X1S C;  3W96 A;  3X1U D;  3B6G B;  3H0L C;  1P3P D;  1KX4 A;  1S32 D;  3LJA A;  5BS7 C;  2FJ7 C;  3LEL A;  4XZQ A;  3MVD C;  4ZUX B;  2YFV A;  5CP6 D;  4WU8 C;  3AV1 D;  2CWE A;  3B6G A;  5CPK B;  5JRG B;  3TU4 A;  2PYO D;  5F99 D;  4WU9 B;  5AY8 D;  2HIO A;  4ZUX A;  4CSR A;  3UTA D;  3AZJ B;  2ZY3 A;  5CPK A;  5JRG A;  3KXB C;  1P3G D;  1M19 C;  5AV9 C;  5B1L A;  4H9P A;  3REJ B;  3UT9 D;  3AFA C;  1M1A B;  5CPJ D;  5GT0 B;  3AV2 B;  3B6F A;  3AZJ A;  1W2E A;  5DNN B;  3MGR B;  3AN2 C;  2LY8 A;  3B0B A;  3REJ A;  5GXQ D;  5B0Y C;  3UTB A;  5GT0 A;  1M1A A;  3REL D;  5B2J D;  3AZK D;  2ARO B;  3AV2 A;  3AZG D;  3EG5 B;  2XD5 A;  1A7W A;  4JJN C;  2NZD D;  1P3M B;  4XUJ B;  2JE5 A;  5AY8 A;  4R8P B;  2Y2J A;  1P34 D;  2Y2M A;  5AV6 A;  2BG1 A;  4WJ3 C;  3WTP E;  5AV5 C;  1KX3 D;  1P3M A;  4XUJ A;  4CAY B;  3UT9 A;  5B31 A;  1WWI A;  5GSU C;  3W97 C;  3W98 D;  1TZY D;  4Z5T D;  5G49 B;  4J8X C;  3EPK A;  1P3F C;  3W99 B;  3KWQ D;  3VH5 T;  3O62 B;  3AZM D;  2F8N A;  1B67 A;  3X1S D;  1AOI B;  4CAY A;  3C1C A;  3KUY D;  3MGP C;  4Z2M H;  5B32 G;  4H9O A;  2FJ7 D;  3W99 A;  4KUD C;  5B40 B;  3MVD D;  4M6B A;  4H9R B;  2FFF B;  1P3I B;  3B0C T;  5B2I A;  5B0Z A;  4WU8 D;  2CV5 B;  3VH5 A;  4X23 B;  1P34 A;  4Z66 C;  3AZL C;  3X1T B;  4H9S A;  4YS3 B;  1P3A C;  3AZH A;  4HGA B;  2ZM5 A;  5E5A D;  1P3I A;  3AYW B;  4X23 A;  3KXB D;  1M19 D;  5AV9 D;  4YS3 A;  5C3I B;  3KWQ A;  1EQZ A;  3WA9 B;  3A6N B;  3KFU G;  3AFA D;  1HQ3 B;  4WU9 C;  2G5I C;  3AN2 D;  5BNX B;  1P3B B;  3REI C;  5B0Y D;  1BH9 B;  2NQB C;  4QLC A;  4WU8 A;  1H3O B;  4ZBJ B;  4JJN D;  5BNX A;  4J8V C;  1P3B A;  1BFM A;  2XD1 A;  3AZI C;  1P3L C;  2ARO C;  4KGC B;  2JSS A;  5AV5 D;  1ZLA B;  3WAA B;  5B33 B;  3MNN A;  1KX5 B;  5GSU D;  5DNM B;  3W97 D;  3MGS B;  3REH A;  3LZ0 C;  5AVC A;  4J8X D;  1P3F D;  4KGC A;  1P3K A;  5B33 A;  3MGQ B;  4NE3 A;  1KX5 A;  5DNM A;  5B24 C;  1KX4 B;  1P3O B;  4KUD D;  4JJN A;  3MGQ A;  3O62 C;  3KUY C;  4LD9 A;  5B1M C;  2Y2I A;  3LZ1 A;  4Z66 D;  3AZL D;  4H9N B;  5AV8 A;  3TU4 B;  5CPI B;  4YM6 A;  1P3O A;  5AV5 A;  2HIO B;  1P3A D;  4J8W C;  4UUZ A;  4CSR B;  3H0R C;  1F1E A;  4J8U A;  2J8P A;  3H0M C;  4H9N A;  2CV5 C;  5B1L B;  4H9P B;  3IP4 C;  5CPI A;  3C1B C;  3REK C;  5B32 B;  1P3F A;  2RVQ C;  3X1T C;  5E5A C;  5GT3 A;  4WU9 D;  3B6F B;  4HGA C;  3X1U B;  3VH6 T;  3MGP A;  1P3P B;  1ID3 C;  3WKJ A;  2HUE C;  1N1J A;  5B32 A;  3EPJ A;  3AZF C;  3REI D;  3UTB B;  1JFI B;  5CP6 B;  3WA9 C;  5C3I C;  2NQB D;  1BH8 B;  3A6N C;  4DRA A;  3AV1 B;  2DQN C;  1HQ3 C;  3X1U A;  1P3P A;  4Z66 A;  1S32 A;  2PYO B;  4J8V D;  5F99 B;  5AY8 B;  1P3A A;  1JFI A;  3AZI D;  5CP6 A;  5AV6 B;  3UTA B;  1BH8 A;  3AV1 A;  1P3L D;  4G91 B;  3WTP C;  2ARO D;  1P3G B;  5BO0 A;  4AWL B;  2PYO A;  2Y2P A;  4ZBJ C;  5F99 A;  3UT9 B;  5B31 B;  3UTA A;  3AZE C;  3FDD A;  4R8P D;  4EO5 B;  3LZ0 D;  2VQR A;  1P3G A;  3VH5 W;  1M18 C;  1U35 C;  2F8N B;  1F66 C;  2Y2Q A;  3C1C B;  5GXQ B;  3AZN C;  5CPJ A;  5B24 D;  3AZK B;  3AL0 C;  4H9O B;  3AZG B;  2IO5 C;  3X1V C;  3MGS C;  1ULY A;  2Y2L A;  5JA4 A;  5B2I B;  5B0Z B;  3O62 D;  3B0C W;  5FUG A;  5B1M D;  5GXQ A;  1P34 B;  3REL A;  5B2J A;  3AZK A;  3W96 C;  3AZG A;  1P3L A;  1KX4 C;  3LJA C;  3AZH B;  2NZD A;  4J8W D;  3LEL C;  4XZQ C;  1KX3 B;  5AVB C;  2DF4 C;  2F8N K;  2CV5 D;  3B6G C;  3W98 B;  3LZ0 A;  3C1B D;  3KWQ B;  3REK D;  1EQZ B;  3TU4 C;  2RVQ D;  3X1T D;  1KX3 A;  2HIO C;  4ZUX C;  2L5A A;  2Y2K A;  5KDM A;  3B0D B;  5B24 A;  3W98 A;  1TZY A;  4Z5T A;  1ID3 D;  5CPK C;  5JRG C;  2ZY2 A;  3AZF D;  3AZM A;  3X1S A;  3WA9 D;  5BT1 C;  4QLC B;  3A6N D;  4WU8 B;  3KUY A;  2F8N H;  5B1M A;  4G92 B;  1HQ3 D;  3B6F C;  4E45 A;  3AZJ C;  5BS7 A;  4WZS B;  4Z2M G;  2FJ7 A;  2BYK B;  3MVD A;  3REJ C;  4J8W A;  3NQJ A;  3UTB C;  1M1A C;  5GT0 C;  3WTP D;  5CHL B;  3AV2 C;  3KXB B;  5DNN C;  3MGR C;  5AV9 B;  2BYK A;  3REK A;  3MNN B;  1KU5 A;  5E5A A;  3P5J B;  3REH B;  3AZE D;  5AVC B;  5AV6 C;  3KXB A;  1M19 A;  1P3K B;  5AV9 A;  1M18 D;  1U35 D;  1T3U A;  1F66 D;  1P3M C;  3AZF A;  4XUJ C;  3AFA A;  3AZN D;  4R8P C;  5B31 C;  3AN2 A;  3MGS D;  3X1V D;  4EO5 C;  4JJN B;  2ZY5 A;  4LD9 B;  5B0Y A;  3LZ1 B;  3C1C C;  5AV8 B;  3W96 D;  4YM6 B;  1KX4 D;  3LJA D;  5AV5 B;  1PZR A;  3R45 A;  3W99 C;  4UUZ B;  3LEL D;  4XZQ D;  5AVB D;  4J8U B;  1AOI C;  5GSU B;  5B2I C;  5B0Z C;  3B6G D;  4J8X B;  3EPH A;  1P3F B;  3TU4 D;  4H9S C;  3EPL A;  2Y2N A;  5B40 C;  5GT3 B;  2HIO D;  4ZUX D;  1F66 A;  3MGP B;  3W97 A;  5GSU A;  1P3I C;  3WKJ B;  4X23 C;  5CPK D;  1N1J B;  5JRG D;  4J8X A;  4KUD B;  5B1L D;  4YS3 C;  1EQZ C;  5BT1 D;  4Z66 B;  1R4V A;  3AYW C;  3AZL B;  3AZJ D;  1S32 B;  3B6F D;  3B0D C;  4KUD A;  1P3A B;  4E44 A;  3REJ D;  3UTB D;  5AVB A;  1M1A D;  5GT0 D;  4UPK A;  2BYM B;  4QLC C;  3AV2 D;  3AZL A;  5BO0 B;  4G92 C;  5DNN D;  3MGR D;  3VH6 A;  3NQU B;  4NFT A;  1P3B C;  5AV6 D;  4WNN B;  2BYM A;  4WV4 B;  3NQU A;  3REI B;  2JCH A;  1P3M D;  4XUJ D;  5CPJ B;  2NQB B;  2YFW B;  4WU9 A;  3MNN C;  5B31 D;  4WNN A;  3REH C;  5AVC C;  5JA4 B;  4KGC C;  1ZLA C;  4J8V B;  3WAA C;  3REI A;  5FUG B;  5B33 C;  3AZI B;  1P3K C;  2F8N D;  3REL B;  5B2J B;  2NQB A;  2YFW A;  3C1C D;  1P3L B;  1KX5 C;  5DNM C;  2Y2G A;  2NZD B;  1WWS A;  3W99 D;  5DNN A;  3MGR A;  4J8V A;  1B6W A;  3AZI A;  3MGQ C;  1AOI D;  4LD9 C;  5B2I D;  5B0Z D;  3LZ0 B;  3LZ1 C;  2ARO A;  5AV8 C;  4YM6 C;  1P3O C;  2Y2H A;  5B40 D;  3KSY A;  3AZH D;  4KHA B;  5KDM B;  5B24 B;  1TAF B;  1P3I D;  1TZY B;  4Z5T B;  4J8U C;  4R8P A;  4X23 D;  5CPI C;  3AZM B;  3X1S B;  4YS3 D;  1EQZ D;  3KUY B;  4KHA A;  5B1M B;  5GT3 C;  1TAF A;  3V9R B;  3AYW D;  2FJ7 B;  1HTA A;  3WKJ C;  3MVD B;  5B1L C;  4DRB A;  5G49 A;  4J8W B;  5B32 C; 
#chains in the Genus database with same CATH homology
 3NQJ B;  3O62 A;  1AOI A;  4QLC D;  3V9R A;  3X1U C;  2RIQ A;  1P3P C;  1S32 C;  3C1B B;  3REK B;  1P3B D;  5E5A B;  5B40 A;  5CP6 C;  3A1K A;  4H9R A;  3AV1 C;  1M19 B;  2CV5 A;  1ID3 B;  2HUE B;  3C1B A;  2W8S A;  3AZF B;  3X1T A;  2PYO C;  3AFA B;  5F99 C;  5AY8 C;  3MNN D;  3A1I A;  3UTA C;  3AN2 B;  3REH D;  4G91 C;  3AYW A;  5AVC D;  1ID3 A;  5BNV B;  4KGC D;  1P3G C;  1ZLA D;  5B31 G;  4AWL C;  1P3K D;  4NE6 A;  5B0Y B;  5B33 D;  3WAA D;  3WA9 A;  3UT9 C;  1Q9C A;  3A6N A;  5CPJ C;  1KX5 D;  3WTP B;  5DNM D;  1HQ3 A;  3R45 B;  2Y2O A;  5BNV A;  2F8N G;  3MGQ D;  4LD9 D;  3AZE B;  5GXQ C;  3WTP A;  3REL C;  1BH9 A;  5B2J C;  2UWX A;  3LZ1 D;  3AZK C;  3AZG C;  5AV8 D;  1M18 B;  1H3O A;  4YM6 D;  1U35 B;  1P3O D;  1F66 B;  2NZD C;  3AZN B;  3W97 B;  4DQY B;  3AZE A;  4J8U D;  2ZY4 A;  1P34 C;  2IO5 B;  2F2A C;  3X1V B;  5CPI D;  4H9Q B;  1M18 A;  1U35 A;  3AZH C;  1ZLA A;  3F6T A;  1KX3 C;  3WAA A;  3AZN A;  3VH6 W;  5GT3 D;  1Z2C B;  3W96 B;  3MGP D;  4NE5 A;  3W98 C;  1TZY C;  4Z5T C;  3LJA B;  3MGS A;  3X1V A;  3WKJ D;  4H9Q A;  3KWQ C;  4XZQ B;  5B32 D;  2G5H C;  3LEL B;  3AZM C;  2YFV B;  5AVB B;  3X1S C;  3W96 A;  3X1U D;  3B6G B;  3H0L C;  1P3P D;  1KX4 A;  1S32 D;  3LJA A;  5BS7 C;  2FJ7 C;  3LEL A;  4XZQ A;  3MVD C;  4ZUX B;  2YFV A;  5CP6 D;  4WU8 C;  3AV1 D;  2CWE A;  3B6G A;  5CPK B;  5JRG B;  3TU4 A;  2PYO D;  5F99 D;  4WU9 B;  5AY8 D;  2HIO A;  4ZUX A;  4CSR A;  3UTA D;  3AZJ B;  2ZY3 A;  5CPK A;  5JRG A;  3KXB C;  1P3G D;  1M19 C;  5AV9 C;  5B1L A;  4H9P A;  3REJ B;  3UT9 D;  3AFA C;  1M1A B;  5CPJ D;  5GT0 B;  3AV2 B;  3B6F A;  3AZJ A;  1W2E A;  5DNN B;  3MGR B;  3AN2 C;  2LY8 A;  3B0B A;  3REJ A;  5GXQ D;  5B0Y C;  3UTB A;  5GT0 A;  1M1A A;  3REL D;  5B2J D;  3AZK D;  2ARO B;  3AV2 A;  3AZG D;  3EG5 B;  2XD5 A;  1A7W A;  4JJN C;  2NZD D;  1P3M B;  4XUJ B;  2JE5 A;  5AY8 A;  4R8P B;  2Y2J A;  1P34 D;  2Y2M A;  5AV6 A;  2BG1 A;  4WJ3 C;  3WTP E;  5AV5 C;  1KX3 D;  1P3M A;  4XUJ A;  4CAY B;  3UT9 A;  5B31 A;  1WWI A;  5GSU C;  3W97 C;  3W98 D;  1TZY D;  4Z5T D;  5G49 B;  4J8X C;  3EPK A;  1P3F C;  3W99 B;  3KWQ D;  3VH5 T;  3O62 B;  3AZM D;  2F8N A;  1B67 A;  3X1S D;  1AOI B;  4CAY A;  3C1C A;  3KUY D;  3MGP C;  4Z2M H;  5B32 G;  4H9O A;  2FJ7 D;  3W99 A;  4KUD C;  5B40 B;  3MVD D;  4M6B A;  4H9R B;  2FFF B;  1P3I B;  3B0C T;  5B2I A;  5B0Z A;  4WU8 D;  2CV5 B;  3VH5 A;  4X23 B;  1P34 A;  4Z66 C;  3AZL C;  3X1T B;  4H9S A;  4YS3 B;  1P3A C;  3AZH A;  4HGA B;  2ZM5 A;  5E5A D;  1P3I A;  3AYW B;  4X23 A;  3KXB D;  1M19 D;  5AV9 D;  4YS3 A;  5C3I B;  3KWQ A;  1EQZ A;  3WA9 B;  3A6N B;  3KFU G;  3AFA D;  1HQ3 B;  4WU9 C;  2G5I C;  3AN2 D;  5BNX B;  1P3B B;  3REI C;  5B0Y D;  1BH9 B;  2NQB C;  4QLC A;  4WU8 A;  1H3O B;  4ZBJ B;  4JJN D;  5BNX A;  4J8V C;  1P3B A;  1BFM A;  2XD1 A;  3AZI C;  1P3L C;  2ARO C;  4KGC B;  2JSS A;  5AV5 D;  1ZLA B;  3WAA B;  5B33 B;  3MNN A;  1KX5 B;  5GSU D;  5DNM B;  3W97 D;  3MGS B;  3REH A;  3LZ0 C;  5AVC A;  4J8X D;  1P3F D;  4KGC A;  1P3K A;  5B33 A;  3MGQ B;  4NE3 A;  1KX5 A;  5DNM A;  5B24 C;  1KX4 B;  1P3O B;  4KUD D;  4JJN A;  3MGQ A;  3O62 C;  3KUY C;  4LD9 A;  5B1M C;  2Y2I A;  3LZ1 A;  4Z66 D;  3AZL D;  4H9N B;  5AV8 A;  3TU4 B;  5CPI B;  4YM6 A;  1P3O A;  5AV5 A;  2HIO B;  1P3A D;  4J8W C;  4UUZ A;  4CSR B;  3H0R C;  1F1E A;  4J8U A;  2J8P A;  3H0M C;  4H9N A;  2CV5 C;  5B1L B;  4H9P B;  3IP4 C;  5CPI A;  3C1B C;  3REK C;  5B32 B;  1P3F A;  2RVQ C;  3X1T C;  5E5A C;  5GT3 A;  4WU9 D;  3B6F B;  4HGA C;  3X1U B;  3VH6 T;  3MGP A;  1P3P B;  1ID3 C;  3WKJ A;  2HUE C;  1N1J A;  5B32 A;  3EPJ A;  3AZF C;  3REI D;  3UTB B;  1JFI B;  5CP6 B;  3WA9 C;  5C3I C;  2NQB D;  1BH8 B;  3A6N C;  4DRA A;  3AV1 B;  2DQN C;  1HQ3 C;  3X1U A;  1P3P A;  4Z66 A;  1S32 A;  2PYO B;  4J8V D;  5F99 B;  5AY8 B;  1P3A A;  1JFI A;  3AZI D;  5CP6 A;  5AV6 B;  3UTA B;  1BH8 A;  3AV1 A;  1P3L D;  4G91 B;  3WTP C;  2ARO D;  1P3G B;  5BO0 A;  4AWL B;  2PYO A;  2Y2P A;  4ZBJ C;  5F99 A;  3UT9 B;  5B31 B;  3UTA A;  3AZE C;  3FDD A;  4R8P D;  4EO5 B;  3LZ0 D;  2VQR A;  1P3G A;  3VH5 W;  1M18 C;  1U35 C;  2F8N B;  1F66 C;  2Y2Q A;  3C1C B;  5GXQ B;  3AZN C;  5CPJ A;  5B24 D;  3AZK B;  3AL0 C;  4H9O B;  3AZG B;  2IO5 C;  3X1V C;  3MGS C;  1ULY A;  2Y2L A;  5JA4 A;  5B2I B;  5B0Z B;  3O62 D;  3B0C W;  5FUG A;  5B1M D;  5GXQ A;  1P34 B;  3REL A;  5B2J A;  3AZK A;  3W96 C;  3AZG A;  1P3L A;  1KX4 C;  3LJA C;  3AZH B;  2NZD A;  4J8W D;  3LEL C;  4XZQ C;  1KX3 B;  5AVB C;  2DF4 C;  2F8N K;  2CV5 D;  3B6G C;  3W98 B;  3LZ0 A;  3C1B D;  3KWQ B;  3REK D;  1EQZ B;  3TU4 C;  2RVQ D;  3X1T D;  1KX3 A;  2HIO C;  4ZUX C;  2L5A A;  2Y2K A;  5KDM A;  3B0D B;  5B24 A;  3W98 A;  1TZY A;  4Z5T A;  1ID3 D;  5CPK C;  5JRG C;  2ZY2 A;  3AZF D;  3AZM A;  3X1S A;  3WA9 D;  5BT1 C;  4QLC B;  3A6N D;  4WU8 B;  3KUY A;  2F8N H;  5B1M A;  4G92 B;  1HQ3 D;  3B6F C;  4E45 A;  3AZJ C;  5BS7 A;  4WZS B;  4Z2M G;  2FJ7 A;  2BYK B;  3MVD A;  3REJ C;  4J8W A;  3NQJ A;  3UTB C;  1M1A C;  5GT0 C;  3WTP D;  5CHL B;  3AV2 C;  3KXB B;  5DNN C;  3MGR C;  5AV9 B;  2BYK A;  3REK A;  3MNN B;  1KU5 A;  5E5A A;  3P5J B;  3REH B;  3AZE D;  5AVC B;  5AV6 C;  3KXB A;  1M19 A;  1P3K B;  5AV9 A;  1M18 D;  1U35 D;  1T3U A;  1F66 D;  1P3M C;  3AZF A;  4XUJ C;  3AFA A;  3AZN D;  4R8P C;  5B31 C;  3AN2 A;  3MGS D;  3X1V D;  4EO5 C;  4JJN B;  2ZY5 A;  4LD9 B;  5B0Y A;  3LZ1 B;  3C1C C;  5AV8 B;  3W96 D;  4YM6 B;  1KX4 D;  3LJA D;  5AV5 B;  1PZR A;  3R45 A;  3W99 C;  4UUZ B;  3LEL D;  4XZQ D;  5AVB D;  4J8U B;  1AOI C;  5GSU B;  5B2I C;  5B0Z C;  3B6G D;  4J8X B;  3EPH A;  1P3F B;  3TU4 D;  4H9S C;  3EPL A;  2Y2N A;  5B40 C;  5GT3 B;  2HIO D;  4ZUX D;  1F66 A;  3MGP B;  3W97 A;  5GSU A;  1P3I C;  3WKJ B;  4X23 C;  5CPK D;  1N1J B;  5JRG D;  4J8X A;  4KUD B;  5B1L D;  4YS3 C;  1EQZ C;  5BT1 D;  4Z66 B;  1R4V A;  3AYW C;  3AZL B;  3AZJ D;  1S32 B;  3B6F D;  3B0D C;  4KUD A;  1P3A B;  4E44 A;  3REJ D;  3UTB D;  5AVB A;  1M1A D;  5GT0 D;  4UPK A;  2BYM B;  4QLC C;  3AV2 D;  3AZL A;  5BO0 B;  4G92 C;  5DNN D;  3MGR D;  3VH6 A;  3NQU B;  4NFT A;  1P3B C;  5AV6 D;  4WNN B;  2BYM A;  4WV4 B;  3NQU A;  3REI B;  2JCH A;  1P3M D;  4XUJ D;  5CPJ B;  2NQB B;  2YFW B;  4WU9 A;  3MNN C;  5B31 D;  4WNN A;  3REH C;  5AVC C;  5JA4 B;  4KGC C;  1ZLA C;  4J8V B;  3WAA C;  3REI A;  5FUG B;  5B33 C;  3AZI B;  1P3K C;  2F8N D;  3REL B;  5B2J B;  2NQB A;  2YFW A;  3C1C D;  1P3L B;  1KX5 C;  5DNM C;  2Y2G A;  2NZD B;  1WWS A;  3W99 D;  5DNN A;  3MGR A;  4J8V A;  1B6W A;  3AZI A;  3MGQ C;  1AOI D;  4LD9 C;  5B2I D;  5B0Z D;  3LZ0 B;  3LZ1 C;  2ARO A;  5AV8 C;  4YM6 C;  1P3O C;  2Y2H A;  5B40 D;  3KSY A;  3AZH D;  4KHA B;  5KDM B;  5B24 B;  1TAF B;  1P3I D;  1TZY B;  4Z5T B;  4J8U C;  4R8P A;  4X23 D;  5CPI C;  3AZM B;  3X1S B;  4YS3 D;  1EQZ D;  3KUY B;  4KHA A;  5B1M B;  5GT3 C;  1TAF A;  3V9R B;  3AYW D;  2FJ7 B;  1HTA A;  3WKJ C;  3MVD B;  5B1L C;  4DRB A;  5G49 A;  4J8W B;  5B32 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...