5AV5C

Human nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av5C00
2YFVB 4WV4B 5JRGA 3AYWC 3W98B 5CP6D 2F8NG 3REKA 3B6GC 4AWLC 4J8XC 5B24A 5AV5A 3AZIA 4X23D 4J8VB 5AVBD 4CAYA 5GSUC 3REHB 5CPJC 3AZFC 5DNMD 4J8UB 1JFIB 3AV2C 1S32C 5B0ZD 5B40A 3AV1B 3B6FA 1WWSA 1M1AD 3AZMA 3TU4D 2F8NK 1ID3A 4YS3C 1B67A 5B1LA 1P3OA 1Q9CA 5B40C 1P3AD 3KXBB 5GXQA 4XUJC 3WA9B 1P3BA 4G91C 1KX4B 5C3IC 4DRBA 5B1MA 5B24C 3AZHB 3LZ0D 4H9RB 2F8NB 2PYOC 3X1UD 3WKJB 4H9OA 1ZLAD 3RELA 3REJB 3AFAB 5B2JC 3C1CB 3REHC 3A6ND 3C1CD 4J8VD 5B2IC 4JJND 3AYWB 2YFWA 2AROC 4ZBJB 3MGPC 3X1UB 4J8WA 3UTBD 1AOIC 4LD9D 5JRGB 1P3KA 1P3GD 3LJAD 5GT3B 1TAFB 5B31G 1KX3B 5B24B 5AVCA 3AV2D 5GT3D 2PYOB 2LY8A 3AV2B 4XZQD 4QLCD 3MGSB 4H9NA 5AVCC 4YS3D 4ZUXA 4NE6A 3NQJB 3LZ1C 5B40B 4E44A 3B6FB 5AVBB 3AV1C 2FJ7B 4KUDD 3X1UC 1H3OA 1ZLAC 3REKC 3WA9A 5BNVA 3REIA 4WU9D 3REJD 3AZKA 1KX4C 5B2JB 1BH8B 5G49A 4H9OB 4WNNB 3X1VC 1P34B 4UUZA 1HQ3B 3B6GD 5E5AB 1EQZB 5AV9B 3MGSD 1WWIA 3LELA 5JA4B 5AV8D 3AZGC 3X1SB 3W96B 2JSSA 5BNXB 3AN2D 4QLCC 3AZLB 1M18C 4H9PB 2BYMB 4YM6B 5C3IB 3AZHC 3B0CW 3AZEB 2NZDA 3KUYB 3C1BB 4KGCC 5AV5B 3MGQB 5B2IA 4DRAA 2L5AA 2HUEC 4CAYB 4Z66B 1AOIB 2AROB 3MGPB 3UT9D 1H3OB 5B31C 3MVDB 4H9QA 4QLCA 3AV1A 5B32A 4H9SC 3MGQD 4YM6C 1KX3C 4J8VC 5B1LB 1P3OB 3AZND 1BH8A 3KXBA 1U35D 3UTAA 4KGCA 1P34A 5B1MB 3AZJA 4H9RA 1R4VA 1EQZC 4KUDA 1M19D 3WA9D 5E5AC 3W97D 3LJAB 4WU9A 4HGAC 3NQUB 3X1TD 5BT1D 4X23B 1BH9B 3WTPB 1F66D 3LELC 3AZID 2YFWB 5F99B 3MGRA 3MNND 4EO5B 4AWLB 3RELC 4KHAA 5AV5C 3KUYA 4Z66D 1P3FA 1P3MA 4Z5TC 2FJ7D 2NZDC 5B2IB 3AZMD 2PYOA 1F1EA 1KX4D 4J8UC 5BO0B 3WAAC 3AZNC 1M18A 3W96C 3X1SC 3MVDA 4QLCB 5BS7C 5AV9D 3AZHA 2NQBC 3O62D 5B0ZA 4J8WC 5E5AD 3AZLD 3WKJA 3TU4A 1M19B 2NQBA 3B0DC 1P3AA 3C1CA 4J8XA 3X1VA 3LZ1B 5B2JA 5G49B 2IO5C 2HIOC 3WAAA 1BFMA 4WU9B 3AZKD 4G92C 1KX5B 5CPID 2HIOA 3WTPA 1U35A 5GT3A 1TAFA 5F99A 1ID3C 2F8ND 1P3PA 4NFTA 5DNND 4H9NB 4ZUXD 3C1CC 2BYMA 3B0BA 1HQ3C 5B1MC 1P3KD 3X1SD 3AZEA 3W96D 4LD9C 1KX3D 3C1BA 5CHLB 5AVBA 3LJAC 4G92B 3AZLC 1M18B 4X23C 5GT3C 5AVBC 3WTPC 5CPKA 1M19C 5AV6D 2AROA 5CPJD 3MGPA 3KWQD 1P3LD 1P3PC 3AZKC 1KX4A 3X1TC 1P3BD 1P3IA 4R8PD 1F66C 3AZIC 5CPIB 3B6FD 3AZJB 5JA4A 1TZYD 4NE3A 3RELD 4WU9C 3KXBD 5B31B 4H9PA 3AZGB 3A6NA 5B1MD 4Z2MH 5CPKC 3AZMC 3NQUA 3X1VD 4XUJA 4J8UD 1TZYB 4JJNC 5GT0A 2CV5A 4WU8C 3KUYC 3AZGD 4Z5TA 4WZSB 3V9RB 5KDMA 2F8NH 3W98D 2HUEB 3KWQC 1P3LC 1P3PD 2RVQC 4H9QB 1P3GA 5AY8B 5BO0A 4R8PC 2FJ7A 3VH5T 1S32B 1KX5D 4KGCD 5AY8D 4KGCB 5FUGA 4YS3B 5B33A 5B1LC 4CSRB 1P3OC 5CPIC 3AZJC 3AFAD 4LD9A 1F66B 3REKD 3TU4B 5CPKD 3LJAA 1ID3D 4UUZB 5CPJA 3LZ1A 5E5AA 4YM6D 1BH9A 4ZUXC 3MVDC 3UTBB 5B0YD 2YFVA 4JJNB 3W97A 1EQZD 1U35B 5F99C 1ULYA 3AN2A 3AZFD 3MGSC 5B32C 5AV8C 3B0CT 1S32D 3WTPD 5GXQD 4J8VA 3B6GA 1P3MC 1P3FC 4WU8B 3MGRD 4HGAB 4E45A 3REHA 1KX5C 3LELD 5AY8C 5B40D 1P3AC 4XUJD 3KWQB 1P3LB 1ZLAB 5AV5D 3W99A 1ID3B 3AZED 4M6BA 3LZ0B 5BS7A 5DNMB 1M19A 2NQBB 2NZDD 2CV5C 4YS3A 2CWEA 3X1VB 1P34C 3MVDD 3WAAD 1M1AB 1N1JB 5AV8B 5B2ID 4LD9B 3WAAB 5B0YC 5AV6A 3AZNB 3AYWD 5AV9C 5CP6C 2NQBD 2HIOB 1P3GC 4XZQA 3UTBA 5JRGD 5B32D 1P3ID 3X1UA 5GSUB 4J8WB 2BYKB 3KUYD 4R8PB 5B31A 1P3PB 5GSUD 1KU5A 3VH6T 3A6NB 3MGRB 3LZ1D 3C1BD 1M1AC 4WU8A 3MGSA 4G91B 4Z2MG 4KUDC 5B0YA 4NE5A 3VH5A 3NQJA 1B6WA 5B24D 5B1LD 3LZ0C 1P3OD 5CPKB 3AFAC 2PYOD 1P34D 1A7WA 4H9SA 3LZ0A 5B32G 4Z5TD 5B2JD 5DNMA 5DNNB 3A6NC 1M1AA 5JRGC 3O62A 5CPIA 4WNNA 1P3IC 5AV6B 5B33B 1AOID 4CSRA 4J8XB 3REID 3O62C 4J8WD 5F99D 1M18D 5CP6B 3REJA 5AV9A 3AZHD 3LELB 5CPJB 4XZQC 1P3BC 5GT0D 5AVCD 3MGRC 3AZLA 3WKJD 1TZYA 3MNNB 2HIOD 2CV5B 4JJNA 3AZIB 3UTAC 1TZYC 3W97B 3KXBC 4Z5TB 2NZDB 3AV1D 3AN2B 3V9RA 5KDMB 5B0YB 5AVCB 4J8UA 1JFIA 5B31D 3AV2A 1P3GB 3AZFA 5AY8A 3AZMB 1HQ3D 1S32A 1P3KC 1U35C 5GXQB 3R45B 1P3BB 3W99C 5DNNA 1ZLAA 5B32B 3B0DB 3X1TA 1F66A 3UTAB 3W97C 3O62B 5BNVB 3REIB 2RVQD 3UT9B 5B0ZC 3AN2C 1P3IB 4KUDB 5AV6C 3TU4C 1N1JA 5AV8A 5CP6A 3AZNA 3MNNC 3C1BC 2IO5B 4X23A 1P3KB 4XZQB 3MNNA 3AZGA 1AOIA 1KX3A 3B6FC 4Z66C 2BYKA 4R8PA 3B6GB 4XUJB 5BNXA 3REHD 4KHAB 3W98A 3REKB 5GT0B 3UT9C 5B33C 1P3MB 3VH6A 2AROD 4ZUXB 3MGPD 1P3FB 3UTBC 3W99D 3MGQC 3KWQA 1P3LA 3AZFB 3KSYA 3W99B 3WTPE 4J8XD 3MGQA 4WU8D 3R45A 1HTAA 5GXQC 4ZBJC 4Z66A 1P3FD 1P3MD 3REIC 3AZKB 3VH6W 3X1TB 3WA9C 3VH5W 5B0ZB 5DNMC 3W98C 3UT9A 5FUGB 5BT1C 1P3AB 5GT0C 1HQ3A 2F8NA 3WKJC 4EO5C 3AZEC 3RELB 3AFAA 1EQZA 5GSUA 3UTAD 2CV5D 1KX5A 3W96A 3X1SA 3REJC 3AZJD 5DNNC 3AYWA 4YM6A 5B33D 2FJ7C
chains in the Genus database with same CATH superfamily
2YFVB 4WV4B 5JRGA 3AYWC 3W98B 5CP6D 2F8NG 3REKA 3B6GC 4AWLC 4J8XC 5B24A 5AV5A 3AZIA 4X23D 4J8VB 5AVBD 4CAYA 5GSUC 3REHB 5CPJC 3AZFC 5DNMD 4J8UB 1JFIB 3AV2C 1S32C 5B0ZD 5B40A 3AV1B 3B6FA 1WWSA 1M1AD 3AZMA 3TU4D 2F8NK 1ID3A 4YS3C 1B67A 5B1LA 1P3OA 1Q9CA 5B40C 1P3AD 2XD1A 5GXQA 3KXBB 4XUJC 3WA9B 1P3BA 4G91C 1KX4B 5C3IC 4DRBA 5B1MA 5B24C 3AZHB 4H9RB 3LZ0D 2F8NB 2PYOC 3X1UD 3WKJB 4H9OA 1ZLAD 3RELA 2Y2MA 3REJB 3AFAB 5B2JC 1W2EA 3C1CB 3REHC 2Y2HA 3A6ND 3C1CD 4J8VD 5B2IC 4JJND 3AYWB 2YFWA 2AROC 4ZBJB 3MGPC 3X1UB 4J8WA 3UTBD 1AOIC 4LD9D 5JRGB 2Y2LA 1P3KA 1P3GD 3LJAD 5GT3B 1TAFB 5B31G 1KX3B 5B24B 5AVCA 3AV2D 5GT3D 2PYOB 2LY8A 3AV2B 4XZQD 4QLCD 3MGSB 4H9NA 5AVCC 4YS3D 2W8SA 4ZUXA 4NE6A 3NQJB 3LZ1C 5B40B 4E44A 3B6FB 5AVBB 3AV1C 2FJ7B 4KUDD 3X1UC 1H3OA 1ZLAC 3REKC 3WA9A 5BNVA 3REIA 4WU9D 2JE5A 3REJD 3AZKA 1KX4C 5B2JB 1BH8B 5G49A 4H9OB 4WNNB 3X1VC 1P34B 4UUZA 1HQ3B 3B6GD 5E5AB 1EQZB 5AV9B 3MGSD 1WWIA 3LELA 5JA4B 5AV8D 3AZGC 3X1SB 3W96B 2JSSA 5BNXB 3AN2D 4QLCC 3AZLB 1M18C 4H9PB 2BYMB 4YM6B 5C3IB 3AZHC 2VQRA 3B0CW 2Y2IA 3AZEB 3F6TA 2NZDA 3KUYB 3C1BB 4KGCC 5AV5B 3MGQB 5B2IA 4DRAA 2L5AA 2HUEC 4CAYB 2FFFB 4Z66B 4WJ3C 3EPLA 2XD5A 1AOIB 2AROB 3MGPB 3UT9D 1H3OB 5B31C 3MVDB 4H9QA 4QLCA 3AV1A 5B32A 4H9SC 3MGQD 4YM6C 1KX3C 4J8VC 5B1LB 1P3OB 3AZND 1BH8A 3KXBA 1U35D 3UTAA 4KGCA 1P34A 5B1MB 3AZJA 4H9RA 1R4VA 1EQZC 4KUDA 1M19D 3WA9D 5E5AC 3EPJA 3W97D 3LJAB 4WU9A 4HGAC 3NQUB 3X1TD 5BT1D 4X23B 1BH9B 3WTPB 1F66D 3LELC 3AZID 2YFWB 5F99B 3MGRA 4EO5B 2Y2GA 3MNND 4AWLB 3RELC 4KHAA 5AV5C 3KUYA 4Z66D 1P3FA 1P3MA 4Z5TC 2FJ7D 2NZDC 5B2IB 3AZMD 2PYOA 1F1EA 1KX4D 4J8UC 5BO0B 3WAAC 2G5IC 3AZNC 1M18A 3W96C 3X1SC 3MVDA 4QLCB 5BS7C 5AV9D 3AZHA 2NQBC 3FDDA 5B0ZA 3O62D 4J8WC 5E5AD 3AZLD 3WKJA 3TU4A 2Y2KA 1Z2CB 1M19B 3B0DC 2NQBA 1P3AA 3C1CA 4J8XA 3X1VA 3LZ1B 5B2JA 5G49B 2IO5C 2HIOC 3WAAA 1BFMA 4WU9B 3AZKD 4G92C 1KX5B 5CPID 2HIOA 3WTPA 1U35A 5GT3A 1TAFA 5F99A 1ID3C 2F8ND 1P3PA 4NFTA 2Y2PA 5DNND 4H9NB 4ZUXD 3C1CC 2BYMA 3B0BA 1HQ3C 2BG1A 5B1MC 1P3KD 3X1SD 3AZEA 3W96D 4LD9C 1KX3D 3C1BA 5CHLB 5AVBA 3LJAC 4G92B 3AZLC 1M18B 4X23C 5GT3C 5AVBC 3WTPC 5CPKA 3EPHA 1M19C 5AV6D 1T3UA 2AROA 5CPJD 3MGPA 2JCHA 3KWQD 1P3LD 2J8PA 1P3PC 3AZKC 1KX4A 3X1TC 1P3BD 2F2AC 1P3IA 4R8PD 1F66C 3AZIC 5CPIB 3B6FD 3AZJB 5JA4A 1TZYD 4NE3A 3RELD 4WU9C 3KXBD 5B31B 3KFUG 4H9PA 3AZGB 3A6NA 5B1MD 4Z2MH 5CPKC 3AZMC 3NQUA 3X1VD 4XUJA 4J8UD 1TZYB 4JJNC 5GT0A 2CV5A 4WU8C 3KUYC 3AZGD 4Z5TA 4WZSB 3V9RB 5KDMA 2F8NH 3W98D 2HUEB 3KWQC 1P3LC 1P3PD 2RVQC 4H9QB 3H0LC 1P3GA 5AY8B 5BO0A 4R8PC 2DF4C 2FJ7A 3VH5T 1S32B 1KX5D 4KGCD 5AY8D 4KGCB 5FUGA 4YS3B 5B33A 5B1LC 4CSRB 1P3OC 5CPIC 3AZJC 3AFAD 4LD9A 1F66B 3REKD 3TU4B 5CPKD 3LJAA 1ID3D 4UUZB 5CPJA 3LZ1A 5E5AA 4YM6D 1BH9A 4ZUXC 3MVDC 3UTBB 5B0YD 2YFVA 4JJNB 2ZY5A 3W97A 1EQZD 2Y2QA 1U35B 5F99C 1ULYA 3AN2A 3AZFD 3MGSC 5B32C 5AV8C 3B0CT 1S32D 3WTPD 5GXQD 4J8VA 3B6GA 1P3MC 1P3FC 4WU8B 3MGRD 4HGAB 4E45A 3REHA 1KX5C 3LELD 5AY8C 5B40D 1P3AC 4XUJD 1PZRA 3KWQB 1P3LB 1ZLAB 2RIQA 5AV5D 3W99A 1ID3B 3AZED 4M6BA 3LZ0B 5BS7A 5DNMB 1M19A 2NQBB 2NZDD 2CV5C 4YS3A 2CWEA 3X1VB 1P34C 3MVDD 3WAAD 1M1AB 1N1JB 5AV8B 5B2ID 4LD9B 3WAAB 5B0YC 5AV6A 3AZNB 3AYWD 5AV9C 5CP6C 3IP4C 2NQBD 2HIOB 1P3GC 4XZQA 3UTBA 5JRGD 5B32D 1P3ID 3X1UA 5GSUB 4J8WB 2BYKB 3KUYD 4R8PB 4UPKA 2UWXA 5B31A 1P3PB 5GSUD 1KU5A 3VH6T 3A6NB 3H0MC 3MGRB 3LZ1D 3C1BD 1M1AC 4WU8A 3MGSA 4G91B 4Z2MG 4KUDC 5B0YA 4NE5A 3VH5A 3NQJA 1B6WA 5B24D 5B1LD 3LZ0C 1P3OD 2ZM5A 5CPKB 3AFAC 2PYOD 1P34D 1A7WA 4H9SA 3LZ0A 5B32G 4Z5TD 5B2JD 5DNMA 5DNNB 2Y2JA 3A6NC 1M1AA 5JRGC 3O62A 5CPIA 3EG5B 4WNNA 1P3IC 5AV6B 5B33B 1AOID 4CSRA 4J8XB 3REID 3O62C 4J8WD 5F99D 1M18D 5CP6B 3REJA 4DQYB 5AV9A 3AZHD 3LELB 5CPJB 4XZQC 1P3BC 5GT0D 5AVCD 3MGRC 3AZLA 3WKJD 1TZYA 3MNNB 2HIOD 2CV5B 4JJNA 3AZIB 3UTAC 1TZYC 3W97B 3KXBC 4Z5TB 2NZDB 3AV1D 3AN2B 3V9RA 5KDMB 5B0YB 5AVCB 4J8UA 1JFIA 5B31D 3AV2A 1P3GB 3AZFA 5AY8A 3AZMB 1HQ3D 1S32A 1P3KC 1U35C 5GXQB 3R45B 1P3BB 3W99C 5DNNA 1ZLAA 5B32B 3B0DB 3X1TA 1F66A 3UTAB 3W97C 3O62B 5BNVB 3REIB 2RVQD 3UT9B 5B0ZC 3AN2C 1P3IB 4KUDB 5AV6C 2DQNC 3TU4C 1N1JA 5AV8A 5CP6A 3AZNA 3MNNC 3C1BC 2IO5B 4X23A 1P3KB 2Y2NA 2ZY4A 4XZQB 3MNNA 3AZGA 1AOIA 1KX3A 3B6FC 4Z66C 2BYKA 4R8PA 3B6GB 4XUJB 5BNXA 3REHD 4KHAB 3W98A 3REKB 3A1KA 5GT0B 3UT9C 5B33C 3A1IA 1P3MB 3VH6A 2AROD 4ZUXB 3MGPD 1P3FB 3UTBC 3W99D 3MGQC 3KWQA 1P3LA 3AZFB 3H0RC 3KSYA 3W99B 3WTPE 4J8XD 3MGQA 4WU8D 3R45A 1HTAA 5GXQC 4ZBJC 4Z66A 2ZY3A 1P3FD 1P3MD 3REIC 3AZKB 3VH6W 3X1TB 3WA9C 3VH5W 5B0ZB 5DNMC 3W98C 3P5JB 3UT9A 3AL0C 5FUGB 5BT1C 2ZY2A 1P3AB 5GT0C 1HQ3A 2F8NA 3WKJC 2G5HC 4EO5C 3AZEC 3RELB 2Y2OA 3AFAA 1EQZA 3EPKA 5GSUA 3UTAD 2CV5D 1KX5A 3W96A 3X1SA 3REJC 3AZJD 5DNNC 3AYWA 4YM6A 5B33D 2FJ7C
chains in the Genus database with same CATH topology
2YFVB 4WV4B 5JRGA 3AYWC 3W98B 5CP6D 2F8NG 3REKA 3B6GC 4AWLC 4J8XC 5B24A 5AV5A 3AZIA 4X23D 4J8VB 5AVBD 4CAYA 5GSUC 3REHB 5CPJC 3AZFC 5DNMD 4J8UB 1JFIB 3AV2C 1S32C 5B0ZD 5B40A 3AV1B 3B6FA 1WWSA 1M1AD 3AZMA 3TU4D 2F8NK 1ID3A 4YS3C 1B67A 5B1LA 1P3OA 1Q9CA 5B40C 1P3AD 2XD1A 5GXQA 3KXBB 4XUJC 3WA9B 1P3BA 4G91C 1KX4B 5C3IC 4DRBA 5B1MA 5B24C 3AZHB 4H9RB 3LZ0D 2F8NB 2PYOC 3X1UD 3WKJB 4H9OA 1ZLAD 3RELA 2Y2MA 3REJB 3AFAB 5B2JC 1W2EA 3C1CB 3REHC 2Y2HA 3A6ND 3C1CD 4J8VD 5B2IC 4JJND 3AYWB 2YFWA 2AROC 4ZBJB 3MGPC 3X1UB 4J8WA 3UTBD 1AOIC 4LD9D 5JRGB 2Y2LA 1P3KA 1P3GD 3LJAD 5GT3B 1TAFB 5B31G 1KX3B 5B24B 5AVCA 3AV2D 5GT3D 2PYOB 2LY8A 3AV2B 4XZQD 4QLCD 3MGSB 4H9NA 5AVCC 4YS3D 2W8SA 4ZUXA 4NE6A 3NQJB 3LZ1C 5B40B 4E44A 3B6FB 5AVBB 3AV1C 2FJ7B 4KUDD 3X1UC 1H3OA 1ZLAC 3REKC 3WA9A 5BNVA 3REIA 4WU9D 2JE5A 3REJD 3AZKA 1KX4C 5B2JB 1BH8B 5G49A 4H9OB 4WNNB 3X1VC 1P34B 4UUZA 1HQ3B 3B6GD 5E5AB 1EQZB 5AV9B 3MGSD 1WWIA 3LELA 5JA4B 5AV8D 3AZGC 3X1SB 3W96B 2JSSA 5BNXB 3AN2D 4QLCC 3AZLB 1M18C 4H9PB 2BYMB 4YM6B 5C3IB 3AZHC 2VQRA 3B0CW 2Y2IA 3AZEB 3F6TA 2NZDA 3KUYB 3C1BB 4KGCC 5AV5B 3MGQB 5B2IA 4DRAA 2L5AA 2HUEC 4CAYB 2FFFB 4Z66B 4WJ3C 3EPLA 2XD5A 1AOIB 2AROB 3MGPB 3UT9D 1H3OB 5B31C 3MVDB 4H9QA 4QLCA 3AV1A 5B32A 4H9SC 3MGQD 4YM6C 1KX3C 4J8VC 5B1LB 1P3OB 3AZND 1BH8A 3KXBA 1U35D 3UTAA 4KGCA 1P34A 5B1MB 3AZJA 4H9RA 1R4VA 1EQZC 4KUDA 1M19D 3WA9D 5E5AC 3EPJA 3W97D 3LJAB 4WU9A 4HGAC 3NQUB 3X1TD 5BT1D 4X23B 1BH9B 3WTPB 1F66D 3LELC 3AZID 2YFWB 5F99B 3MGRA 4EO5B 2Y2GA 3MNND 4AWLB 3RELC 4KHAA 5AV5C 3KUYA 4Z66D 1P3FA 1P3MA 4Z5TC 2FJ7D 2NZDC 5B2IB 3AZMD 2PYOA 1F1EA 1KX4D 4J8UC 5BO0B 3WAAC 2G5IC 3AZNC 1M18A 3W96C 3X1SC 3MVDA 4QLCB 5BS7C 5AV9D 3AZHA 2NQBC 3FDDA 5B0ZA 3O62D 4J8WC 5E5AD 3AZLD 3WKJA 3TU4A 2Y2KA 1Z2CB 1M19B 3B0DC 2NQBA 1P3AA 3C1CA 4J8XA 3X1VA 3LZ1B 5B2JA 5G49B 2IO5C 2HIOC 3WAAA 1BFMA 4WU9B 3AZKD 4G92C 1KX5B 5CPID 2HIOA 3WTPA 1U35A 5GT3A 1TAFA 5F99A 1ID3C 2F8ND 1P3PA 4NFTA 2Y2PA 5DNND 4H9NB 4ZUXD 3C1CC 2BYMA 3B0BA 1HQ3C 2BG1A 5B1MC 1P3KD 3X1SD 3AZEA 3W96D 4LD9C 1KX3D 3C1BA 5CHLB 5AVBA 3LJAC 4G92B 3AZLC 1M18B 4X23C 5GT3C 5AVBC 3WTPC 5CPKA 3EPHA 1M19C 5AV6D 1T3UA 2AROA 5CPJD 3MGPA 2JCHA 3KWQD 1P3LD 2J8PA 1P3PC 3AZKC 1KX4A 3X1TC 1P3BD 2F2AC 1P3IA 4R8PD 1F66C 3AZIC 5CPIB 3B6FD 3AZJB 5JA4A 1TZYD 4NE3A 3RELD 4WU9C 3KXBD 5B31B 3KFUG 4H9PA 3AZGB 3A6NA 5B1MD 4Z2MH 5CPKC 3AZMC 3NQUA 3X1VD 4XUJA 4J8UD 1TZYB 4JJNC 5GT0A 2CV5A 4WU8C 3KUYC 3AZGD 4Z5TA 4WZSB 3V9RB 5KDMA 2F8NH 3W98D 2HUEB 3KWQC 1P3LC 1P3PD 2RVQC 4H9QB 3H0LC 1P3GA 5AY8B 5BO0A 4R8PC 2DF4C 2FJ7A 3VH5T 1S32B 1KX5D 4KGCD 5AY8D 4KGCB 5FUGA 4YS3B 5B33A 5B1LC 4CSRB 1P3OC 5CPIC 3AZJC 3AFAD 4LD9A 1F66B 3REKD 3TU4B 5CPKD 3LJAA 1ID3D 4UUZB 5CPJA 3LZ1A 5E5AA 4YM6D 1BH9A 4ZUXC 3MVDC 3UTBB 5B0YD 2YFVA 4JJNB 2ZY5A 3W97A 1EQZD 2Y2QA 1U35B 5F99C 1ULYA 3AN2A 3AZFD 3MGSC 5B32C 5AV8C 3B0CT 1S32D 3WTPD 5GXQD 4J8VA 3B6GA 1P3MC 1P3FC 4WU8B 3MGRD 4HGAB 4E45A 3REHA 1KX5C 3LELD 5AY8C 5B40D 1P3AC 4XUJD 1PZRA 3KWQB 1P3LB 1ZLAB 2RIQA 5AV5D 3W99A 1ID3B 3AZED 4M6BA 3LZ0B 5BS7A 5DNMB 1M19A 2NQBB 2NZDD 2CV5C 4YS3A 2CWEA 3X1VB 1P34C 3MVDD 3WAAD 1M1AB 1N1JB 5AV8B 5B2ID 4LD9B 3WAAB 5B0YC 5AV6A 3AZNB 3AYWD 5AV9C 5CP6C 3IP4C 2NQBD 2HIOB 1P3GC 4XZQA 3UTBA 5JRGD 5B32D 1P3ID 3X1UA 5GSUB 4J8WB 2BYKB 3KUYD 4R8PB 4UPKA 2UWXA 5B31A 1P3PB 5GSUD 1KU5A 3VH6T 3A6NB 3H0MC 3MGRB 3LZ1D 3C1BD 1M1AC 4WU8A 3MGSA 4G91B 4Z2MG 4KUDC 5B0YA 4NE5A 3VH5A 3NQJA 1B6WA 5B24D 5B1LD 3LZ0C 1P3OD 2ZM5A 5CPKB 3AFAC 2PYOD 1P34D 1A7WA 4H9SA 3LZ0A 5B32G 4Z5TD 5B2JD 5DNMA 5DNNB 2Y2JA 3A6NC 1M1AA 5JRGC 3O62A 5CPIA 3EG5B 4WNNA 1P3IC 5AV6B 5B33B 1AOID 4CSRA 4J8XB 3REID 3O62C 4J8WD 5F99D 1M18D 5CP6B 3REJA 4DQYB 5AV9A 3AZHD 3LELB 5CPJB 4XZQC 1P3BC 5GT0D 5AVCD 3MGRC 3AZLA 3WKJD 1TZYA 3MNNB 2HIOD 2CV5B 4JJNA 3AZIB 3UTAC 1TZYC 3W97B 3KXBC 4Z5TB 2NZDB 3AV1D 3AN2B 3V9RA 5KDMB 5B0YB 5AVCB 4J8UA 1JFIA 5B31D 3AV2A 1P3GB 3AZFA 5AY8A 3AZMB 1HQ3D 1S32A 1P3KC 1U35C 5GXQB 3R45B 1P3BB 3W99C 5DNNA 1ZLAA 5B32B 3B0DB 3X1TA 1F66A 3UTAB 3W97C 3O62B 5BNVB 3REIB 2RVQD 3UT9B 5B0ZC 3AN2C 1P3IB 4KUDB 5AV6C 2DQNC 3TU4C 1N1JA 5AV8A 5CP6A 3AZNA 3MNNC 3C1BC 2IO5B 4X23A 1P3KB 2Y2NA 2ZY4A 4XZQB 3MNNA 3AZGA 1AOIA 1KX3A 3B6FC 4Z66C 2BYKA 4R8PA 3B6GB 4XUJB 5BNXA 3REHD 4KHAB 3W98A 3REKB 3A1KA 5GT0B 3UT9C 5B33C 3A1IA 1P3MB 3VH6A 2AROD 4ZUXB 3MGPD 1P3FB 3UTBC 3W99D 3MGQC 3KWQA 1P3LA 3AZFB 3H0RC 3KSYA 3W99B 3WTPE 4J8XD 3MGQA 4WU8D 3R45A 1HTAA 5GXQC 4ZBJC 4Z66A 2ZY3A 1P3FD 1P3MD 3REIC 3AZKB 3VH6W 3X1TB 3WA9C 3VH5W 5B0ZB 5DNMC 3W98C 3P5JB 3UT9A 3AL0C 5FUGB 5BT1C 2ZY2A 1P3AB 5GT0C 1HQ3A 2F8NA 3WKJC 2G5HC 4EO5C 3AZEC 3RELB 2Y2OA 3AFAA 1EQZA 3EPKA 5GSUA 3UTAD 2CV5D 1KX5A 3W96A 3X1SA 3REJC 3AZJD 5DNNC 3AYWA 4YM6A 5B33D 2FJ7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFV B;  4WV4 B;  5JRG A;  3AYW C;  3W98 B;  5CP6 D;  2F8N G;  3REK A;  3B6G C;  4AWL C;  4J8X C;  5B24 A;  5AV5 A;  3AZI A;  4X23 D;  4J8V B;  5AVB D;  4CAY A;  5GSU C;  3REH B;  5CPJ C;  3AZF C;  5DNM D;  4J8U B;  1JFI B;  3AV2 C;  1S32 C;  5B0Z D;  5B40 A;  3AV1 B;  3B6F A;  1WWS A;  1M1A D;  3AZM A;  3TU4 D;  2F8N K;  1ID3 A;  4YS3 C;  1B67 A;  5B1L A;  1P3O A;  1Q9C A;  5B40 C;  1P3A D;  3KXB B;  5GXQ A;  4XUJ C;  3WA9 B;  1P3B A;  4G91 C;  1KX4 B;  5C3I C;  4DRB A;  5B1M A;  5B24 C;  3AZH B;  3LZ0 D;  4H9R B;  2F8N B;  2PYO C;  3X1U D;  3WKJ B;  4H9O A;  1ZLA D;  3REL A;  3REJ B;  3AFA B;  5B2J C;  3C1C B;  3REH C;  3A6N D;  3C1C D;  4J8V D;  5B2I C;  4JJN D;  3AYW B;  2YFW A;  2ARO C;  4ZBJ B;  3MGP C;  3X1U B;  4J8W A;  3UTB D;  1AOI C;  4LD9 D;  5JRG B;  1P3K A;  1P3G D;  3LJA D;  5GT3 B;  1TAF B;  5B31 G;  1KX3 B;  5B24 B;  5AVC A;  3AV2 D;  5GT3 D;  2PYO B;  2LY8 A;  3AV2 B;  4XZQ D;  4QLC D;  3MGS B;  4H9N A;  5AVC C;  4YS3 D;  4ZUX A;  4NE6 A;  3NQJ B;  3LZ1 C;  5B40 B;  4E44 A;  3B6F B;  5AVB B;  3AV1 C;  2FJ7 B;  4KUD D;  3X1U C;  1H3O A;  1ZLA C;  3REK C;  3WA9 A;  5BNV A;  3REI A;  4WU9 D;  3REJ D;  3AZK A;  1KX4 C;  5B2J B;  1BH8 B;  5G49 A;  4H9O B;  4WNN B;  3X1V C;  1P34 B;  4UUZ A;  1HQ3 B;  3B6G D;  5E5A B;  1EQZ B;  5AV9 B;  3MGS D;  1WWI A;  3LEL A;  5JA4 B;  5AV8 D;  3AZG C;  3X1S B;  3W96 B;  2JSS A;  5BNX B;  3AN2 D;  4QLC C;  3AZL B;  1M18 C;  4H9P B;  2BYM B;  4YM6 B;  5C3I B;  3AZH C;  3B0C W;  3AZE B;  2NZD A;  3KUY B;  3C1B B;  4KGC C;  5AV5 B;  3MGQ B;  5B2I A;  4DRA A;  2L5A A;  2HUE C;  4CAY B;  4Z66 B;  1AOI B;  2ARO B;  3MGP B;  3UT9 D;  1H3O B;  5B31 C;  3MVD B;  4H9Q A;  4QLC A;  3AV1 A;  5B32 A;  4H9S C;  3MGQ D;  4YM6 C;  1KX3 C;  4J8V C;  5B1L B;  1P3O B;  3AZN D;  1BH8 A;  3KXB A;  1U35 D;  3UTA A;  4KGC A;  1P34 A;  5B1M B;  3AZJ A;  4H9R A;  1R4V A;  1EQZ C;  4KUD A;  1M19 D;  3WA9 D;  5E5A C;  3W97 D;  3LJA B;  4WU9 A;  4HGA C;  3NQU B;  3X1T D;  5BT1 D;  4X23 B;  1BH9 B;  3WTP B;  1F66 D;  3LEL C;  3AZI D;  2YFW B;  5F99 B;  3MGR A;  3MNN D;  4EO5 B;  4AWL B;  3REL C;  4KHA A;  5AV5 C;  3KUY A;  4Z66 D;  1P3F A;  1P3M A;  4Z5T C;  2FJ7 D;  2NZD C;  5B2I B;  3AZM D;  2PYO A;  1F1E A;  1KX4 D;  4J8U C;  5BO0 B;  3WAA C;  3AZN C;  1M18 A;  3W96 C;  3X1S C;  3MVD A;  4QLC B;  5BS7 C;  5AV9 D;  3AZH A;  2NQB C;  3O62 D;  5B0Z A;  4J8W C;  5E5A D;  3AZL D;  3WKJ A;  3TU4 A;  1M19 B;  2NQB A;  3B0D C;  1P3A A;  3C1C A;  4J8X A;  3X1V A;  3LZ1 B;  5B2J A;  5G49 B;  2IO5 C;  2HIO C;  3WAA A;  1BFM A;  4WU9 B;  3AZK D;  4G92 C;  1KX5 B;  5CPI D;  2HIO A;  3WTP A;  1U35 A;  5GT3 A;  1TAF A;  5F99 A;  1ID3 C;  2F8N D;  1P3P A;  4NFT A;  5DNN D;  4H9N B;  4ZUX D;  3C1C C;  2BYM A;  3B0B A;  1HQ3 C;  5B1M C;  1P3K D;  3X1S D;  3AZE A;  3W96 D;  4LD9 C;  1KX3 D;  3C1B A;  5CHL B;  5AVB A;  3LJA C;  4G92 B;  3AZL C;  1M18 B;  4X23 C;  5GT3 C;  5AVB C;  3WTP C;  5CPK A;  1M19 C;  5AV6 D;  2ARO A;  5CPJ D;  3MGP A;  3KWQ D;  1P3L D;  1P3P C;  3AZK C;  1KX4 A;  3X1T C;  1P3B D;  1P3I A;  4R8P D;  1F66 C;  3AZI C;  5CPI B;  3B6F D;  3AZJ B;  5JA4 A;  1TZY D;  4NE3 A;  3REL D;  4WU9 C;  3KXB D;  5B31 B;  4H9P A;  3AZG B;  3A6N A;  5B1M D;  4Z2M H;  5CPK C;  3AZM C;  3NQU A;  3X1V D;  4XUJ A;  4J8U D;  1TZY B;  4JJN C;  5GT0 A;  2CV5 A;  4WU8 C;  3KUY C;  3AZG D;  4Z5T A;  4WZS B;  3V9R B;  5KDM A;  2F8N H;  3W98 D;  2HUE B;  3KWQ C;  1P3L C;  1P3P D;  2RVQ C;  4H9Q B;  1P3G A;  5AY8 B;  5BO0 A;  4R8P C;  2FJ7 A;  3VH5 T;  1S32 B;  1KX5 D;  4KGC D;  5AY8 D;  4KGC B;  5FUG A;  4YS3 B;  5B33 A;  5B1L C;  4CSR B;  1P3O C;  5CPI C;  3AZJ C;  3AFA D;  4LD9 A;  1F66 B;  3REK D;  3TU4 B;  5CPK D;  3LJA A;  1ID3 D;  4UUZ B;  5CPJ A;  3LZ1 A;  5E5A A;  4YM6 D;  1BH9 A;  4ZUX C;  3MVD C;  3UTB B;  5B0Y D;  2YFV A;  4JJN B;  3W97 A;  1EQZ D;  1U35 B;  5F99 C;  1ULY A;  3AN2 A;  3AZF D;  3MGS C;  5B32 C;  5AV8 C;  3B0C T;  1S32 D;  3WTP D;  5GXQ D;  4J8V A;  3B6G A;  1P3M C;  1P3F C;  4WU8 B;  3MGR D;  4HGA B;  4E45 A;  3REH A;  1KX5 C;  3LEL D;  5AY8 C;  5B40 D;  1P3A C;  4XUJ D;  3KWQ B;  1P3L B;  1ZLA B;  5AV5 D;  3W99 A;  1ID3 B;  3AZE D;  4M6B A;  3LZ0 B;  5BS7 A;  5DNM B;  1M19 A;  2NQB B;  2NZD D;  2CV5 C;  4YS3 A;  2CWE A;  3X1V B;  1P34 C;  3MVD D;  3WAA D;  1M1A B;  1N1J B;  5AV8 B;  5B2I D;  4LD9 B;  3WAA B;  5B0Y C;  5AV6 A;  3AZN B;  3AYW D;  5AV9 C;  5CP6 C;  2NQB D;  2HIO B;  1P3G C;  4XZQ A;  3UTB A;  5JRG D;  5B32 D;  1P3I D;  3X1U A;  5GSU B;  4J8W B;  2BYK B;  3KUY D;  4R8P B;  5B31 A;  1P3P B;  5GSU D;  1KU5 A;  3VH6 T;  3A6N B;  3MGR B;  3LZ1 D;  3C1B D;  1M1A C;  4WU8 A;  3MGS A;  4G91 B;  4Z2M G;  4KUD C;  5B0Y A;  4NE5 A;  3VH5 A;  3NQJ A;  1B6W A;  5B24 D;  5B1L D;  3LZ0 C;  1P3O D;  5CPK B;  3AFA C;  2PYO D;  1P34 D;  1A7W A;  4H9S A;  3LZ0 A;  5B32 G;  4Z5T D;  5B2J D;  5DNM A;  5DNN B;  3A6N C;  1M1A A;  5JRG C;  3O62 A;  5CPI A;  4WNN A;  1P3I C;  5AV6 B;  5B33 B;  1AOI D;  4CSR A;  4J8X B;  3REI D;  3O62 C;  4J8W D;  5F99 D;  1M18 D;  5CP6 B;  3REJ A;  5AV9 A;  3AZH D;  3LEL B;  5CPJ B;  4XZQ C;  1P3B C;  5GT0 D;  5AVC D;  3MGR C;  3AZL A;  3WKJ D;  1TZY A;  3MNN B;  2HIO D;  2CV5 B;  4JJN A;  3AZI B;  3UTA C;  1TZY C;  3W97 B;  3KXB C;  4Z5T B;  2NZD B;  3AV1 D;  3AN2 B;  3V9R A;  5KDM B;  5B0Y B;  5AVC B;  4J8U A;  1JFI A;  5B31 D;  3AV2 A;  1P3G B;  3AZF A;  5AY8 A;  3AZM B;  1HQ3 D;  1S32 A;  1P3K C;  1U35 C;  5GXQ B;  3R45 B;  1P3B B;  3W99 C;  5DNN A;  1ZLA A;  5B32 B;  3B0D B;  3X1T A;  1F66 A;  3UTA B;  3W97 C;  3O62 B;  5BNV B;  3REI B;  2RVQ D;  3UT9 B;  5B0Z C;  3AN2 C;  1P3I B;  4KUD B;  5AV6 C;  3TU4 C;  1N1J A;  5AV8 A;  5CP6 A;  3AZN A;  3MNN C;  3C1B C;  2IO5 B;  4X23 A;  1P3K B;  4XZQ B;  3MNN A;  3AZG A;  1AOI A;  1KX3 A;  3B6F C;  4Z66 C;  2BYK A;  4R8P A;  3B6G B;  4XUJ B;  5BNX A;  3REH D;  4KHA B;  3W98 A;  3REK B;  5GT0 B;  3UT9 C;  5B33 C;  1P3M B;  3VH6 A;  2ARO D;  4ZUX B;  3MGP D;  1P3F B;  3UTB C;  3W99 D;  3MGQ C;  3KWQ A;  1P3L A;  3AZF B;  3KSY A;  3W99 B;  3WTP E;  4J8X D;  3MGQ A;  4WU8 D;  3R45 A;  1HTA A;  5GXQ C;  4ZBJ C;  4Z66 A;  1P3F D;  1P3M D;  3REI C;  3AZK B;  3VH6 W;  3X1T B;  3WA9 C;  3VH5 W;  5B0Z B;  5DNM C;  3W98 C;  3UT9 A;  5FUG B;  5BT1 C;  1P3A B;  5GT0 C;  1HQ3 A;  2F8N A;  3WKJ C;  4EO5 C;  3AZE C;  3REL B;  3AFA A;  1EQZ A;  5GSU A;  3UTA D;  2CV5 D;  1KX5 A;  3W96 A;  3X1S A;  3REJ C;  3AZJ D;  5DNN C;  3AYW A;  4YM6 A;  5B33 D;  2FJ7 C; 
#chains in the Genus database with same CATH topology
 2YFV B;  4WV4 B;  5JRG A;  3AYW C;  3W98 B;  5CP6 D;  2F8N G;  3REK A;  3B6G C;  4AWL C;  4J8X C;  5B24 A;  5AV5 A;  3AZI A;  4X23 D;  4J8V B;  5AVB D;  4CAY A;  5GSU C;  3REH B;  5CPJ C;  3AZF C;  5DNM D;  4J8U B;  1JFI B;  3AV2 C;  1S32 C;  5B0Z D;  5B40 A;  3AV1 B;  3B6F A;  1WWS A;  1M1A D;  3AZM A;  3TU4 D;  2F8N K;  1ID3 A;  4YS3 C;  1B67 A;  5B1L A;  1P3O A;  1Q9C A;  5B40 C;  1P3A D;  2XD1 A;  5GXQ A;  3KXB B;  4XUJ C;  3WA9 B;  1P3B A;  4G91 C;  1KX4 B;  5C3I C;  4DRB A;  5B1M A;  5B24 C;  3AZH B;  4H9R B;  3LZ0 D;  2F8N B;  2PYO C;  3X1U D;  3WKJ B;  4H9O A;  1ZLA D;  3REL A;  2Y2M A;  3REJ B;  3AFA B;  5B2J C;  1W2E A;  3C1C B;  3REH C;  2Y2H A;  3A6N D;  3C1C D;  4J8V D;  5B2I C;  4JJN D;  3AYW B;  2YFW A;  2ARO C;  4ZBJ B;  3MGP C;  3X1U B;  4J8W A;  3UTB D;  1AOI C;  4LD9 D;  5JRG B;  2Y2L A;  1P3K A;  1P3G D;  3LJA D;  5GT3 B;  1TAF B;  5B31 G;  1KX3 B;  5B24 B;  5AVC A;  3AV2 D;  5GT3 D;  2PYO B;  2LY8 A;  3AV2 B;  4XZQ D;  4QLC D;  3MGS B;  4H9N A;  5AVC C;  4YS3 D;  2W8S A;  4ZUX A;  4NE6 A;  3NQJ B;  3LZ1 C;  5B40 B;  4E44 A;  3B6F B;  5AVB B;  3AV1 C;  2FJ7 B;  4KUD D;  3X1U C;  1H3O A;  1ZLA C;  3REK C;  3WA9 A;  5BNV A;  3REI A;  4WU9 D;  2JE5 A;  3REJ D;  3AZK A;  1KX4 C;  5B2J B;  1BH8 B;  5G49 A;  4H9O B;  4WNN B;  3X1V C;  1P34 B;  4UUZ A;  1HQ3 B;  3B6G D;  5E5A B;  1EQZ B;  5AV9 B;  3MGS D;  1WWI A;  3LEL A;  5JA4 B;  5AV8 D;  3AZG C;  3X1S B;  3W96 B;  2JSS A;  5BNX B;  3AN2 D;  4QLC C;  3AZL B;  1M18 C;  4H9P B;  2BYM B;  4YM6 B;  5C3I B;  3AZH C;  2VQR A;  3B0C W;  2Y2I A;  3AZE B;  3F6T A;  2NZD A;  3KUY B;  3C1B B;  4KGC C;  5AV5 B;  3MGQ B;  5B2I A;  4DRA A;  2L5A A;  2HUE C;  4CAY B;  2FFF B;  4Z66 B;  4WJ3 C;  3EPL A;  2XD5 A;  1AOI B;  2ARO B;  3MGP B;  3UT9 D;  1H3O B;  5B31 C;  3MVD B;  4H9Q A;  4QLC A;  3AV1 A;  5B32 A;  4H9S C;  3MGQ D;  4YM6 C;  1KX3 C;  4J8V C;  5B1L B;  1P3O B;  3AZN D;  1BH8 A;  3KXB A;  1U35 D;  3UTA A;  4KGC A;  1P34 A;  5B1M B;  3AZJ A;  4H9R A;  1R4V A;  1EQZ C;  4KUD A;  1M19 D;  3WA9 D;  5E5A C;  3EPJ A;  3W97 D;  3LJA B;  4WU9 A;  4HGA C;  3NQU B;  3X1T D;  5BT1 D;  4X23 B;  1BH9 B;  3WTP B;  1F66 D;  3LEL C;  3AZI D;  2YFW B;  5F99 B;  3MGR A;  4EO5 B;  2Y2G A;  3MNN D;  4AWL B;  3REL C;  4KHA A;  5AV5 C;  3KUY A;  4Z66 D;  1P3F A;  1P3M A;  4Z5T C;  2FJ7 D;  2NZD C;  5B2I B;  3AZM D;  2PYO A;  1F1E A;  1KX4 D;  4J8U C;  5BO0 B;  3WAA C;  2G5I C;  3AZN C;  1M18 A;  3W96 C;  3X1S C;  3MVD A;  4QLC B;  5BS7 C;  5AV9 D;  3AZH A;  2NQB C;  3FDD A;  5B0Z A;  3O62 D;  4J8W C;  5E5A D;  3AZL D;  3WKJ A;  3TU4 A;  2Y2K A;  1Z2C B;  1M19 B;  3B0D C;  2NQB A;  1P3A A;  3C1C A;  4J8X A;  3X1V A;  3LZ1 B;  5B2J A;  5G49 B;  2IO5 C;  2HIO C;  3WAA A;  1BFM A;  4WU9 B;  3AZK D;  4G92 C;  1KX5 B;  5CPI D;  2HIO A;  3WTP A;  1U35 A;  5GT3 A;  1TAF A;  5F99 A;  1ID3 C;  2F8N D;  1P3P A;  4NFT A;  2Y2P A;  5DNN D;  4H9N B;  4ZUX D;  3C1C C;  2BYM A;  3B0B A;  1HQ3 C;  2BG1 A;  5B1M C;  1P3K D;  3X1S D;  3AZE A;  3W96 D;  4LD9 C;  1KX3 D;  3C1B A;  5CHL B;  5AVB A;  3LJA C;  4G92 B;  3AZL C;  1M18 B;  4X23 C;  5GT3 C;  5AVB C;  3WTP C;  5CPK A;  3EPH A;  1M19 C;  5AV6 D;  1T3U A;  2ARO A;  5CPJ D;  3MGP A;  2JCH A;  3KWQ D;  1P3L D;  2J8P A;  1P3P C;  3AZK C;  1KX4 A;  3X1T C;  1P3B D;  2F2A C;  1P3I A;  4R8P D;  1F66 C;  3AZI C;  5CPI B;  3B6F D;  3AZJ B;  5JA4 A;  1TZY D;  4NE3 A;  3REL D;  4WU9 C;  3KXB D;  5B31 B;  3KFU G;  4H9P A;  3AZG B;  3A6N A;  5B1M D;  4Z2M H;  5CPK C;  3AZM C;  3NQU A;  3X1V D;  4XUJ A;  4J8U D;  1TZY B;  4JJN C;  5GT0 A;  2CV5 A;  4WU8 C;  3KUY C;  3AZG D;  4Z5T A;  4WZS B;  3V9R B;  5KDM A;  2F8N H;  3W98 D;  2HUE B;  3KWQ C;  1P3L C;  1P3P D;  2RVQ C;  4H9Q B;  3H0L C;  1P3G A;  5AY8 B;  5BO0 A;  4R8P C;  2DF4 C;  2FJ7 A;  3VH5 T;  1S32 B;  1KX5 D;  4KGC D;  5AY8 D;  4KGC B;  5FUG A;  4YS3 B;  5B33 A;  5B1L C;  4CSR B;  1P3O C;  5CPI C;  3AZJ C;  3AFA D;  4LD9 A;  1F66 B;  3REK D;  3TU4 B;  5CPK D;  3LJA A;  1ID3 D;  4UUZ B;  5CPJ A;  3LZ1 A;  5E5A A;  4YM6 D;  1BH9 A;  4ZUX C;  3MVD C;  3UTB B;  5B0Y D;  2YFV A;  4JJN B;  2ZY5 A;  3W97 A;  1EQZ D;  2Y2Q A;  1U35 B;  5F99 C;  1ULY A;  3AN2 A;  3AZF D;  3MGS C;  5B32 C;  5AV8 C;  3B0C T;  1S32 D;  3WTP D;  5GXQ D;  4J8V A;  3B6G A;  1P3M C;  1P3F C;  4WU8 B;  3MGR D;  4HGA B;  4E45 A;  3REH A;  1KX5 C;  3LEL D;  5AY8 C;  5B40 D;  1P3A C;  4XUJ D;  1PZR A;  3KWQ B;  1P3L B;  1ZLA B;  2RIQ A;  5AV5 D;  3W99 A;  1ID3 B;  3AZE D;  4M6B A;  3LZ0 B;  5BS7 A;  5DNM B;  1M19 A;  2NQB B;  2NZD D;  2CV5 C;  4YS3 A;  2CWE A;  3X1V B;  1P34 C;  3MVD D;  3WAA D;  1M1A B;  1N1J B;  5AV8 B;  5B2I D;  4LD9 B;  3WAA B;  5B0Y C;  5AV6 A;  3AZN B;  3AYW D;  5AV9 C;  5CP6 C;  3IP4 C;  2NQB D;  2HIO B;  1P3G C;  4XZQ A;  3UTB A;  5JRG D;  5B32 D;  1P3I D;  3X1U A;  5GSU B;  4J8W B;  2BYK B;  3KUY D;  4R8P B;  4UPK A;  2UWX A;  5B31 A;  1P3P B;  5GSU D;  1KU5 A;  3VH6 T;  3A6N B;  3H0M C;  3MGR B;  3LZ1 D;  3C1B D;  1M1A C;  4WU8 A;  3MGS A;  4G91 B;  4Z2M G;  4KUD C;  5B0Y A;  4NE5 A;  3VH5 A;  3NQJ A;  1B6W A;  5B24 D;  5B1L D;  3LZ0 C;  1P3O D;  2ZM5 A;  5CPK B;  3AFA C;  2PYO D;  1P34 D;  1A7W A;  4H9S A;  3LZ0 A;  5B32 G;  4Z5T D;  5B2J D;  5DNM A;  5DNN B;  2Y2J A;  3A6N C;  1M1A A;  5JRG C;  3O62 A;  5CPI A;  3EG5 B;  4WNN A;  1P3I C;  5AV6 B;  5B33 B;  1AOI D;  4CSR A;  4J8X B;  3REI D;  3O62 C;  4J8W D;  5F99 D;  1M18 D;  5CP6 B;  3REJ A;  4DQY B;  5AV9 A;  3AZH D;  3LEL B;  5CPJ B;  4XZQ C;  1P3B C;  5GT0 D;  5AVC D;  3MGR C;  3AZL A;  3WKJ D;  1TZY A;  3MNN B;  2HIO D;  2CV5 B;  4JJN A;  3AZI B;  3UTA C;  1TZY C;  3W97 B;  3KXB C;  4Z5T B;  2NZD B;  3AV1 D;  3AN2 B;  3V9R A;  5KDM B;  5B0Y B;  5AVC B;  4J8U A;  1JFI A;  5B31 D;  3AV2 A;  1P3G B;  3AZF A;  5AY8 A;  3AZM B;  1HQ3 D;  1S32 A;  1P3K C;  1U35 C;  5GXQ B;  3R45 B;  1P3B B;  3W99 C;  5DNN A;  1ZLA A;  5B32 B;  3B0D B;  3X1T A;  1F66 A;  3UTA B;  3W97 C;  3O62 B;  5BNV B;  3REI B;  2RVQ D;  3UT9 B;  5B0Z C;  3AN2 C;  1P3I B;  4KUD B;  5AV6 C;  2DQN C;  3TU4 C;  1N1J A;  5AV8 A;  5CP6 A;  3AZN A;  3MNN C;  3C1B C;  2IO5 B;  4X23 A;  1P3K B;  2Y2N A;  2ZY4 A;  4XZQ B;  3MNN A;  3AZG A;  1AOI A;  1KX3 A;  3B6F C;  4Z66 C;  2BYK A;  4R8P A;  3B6G B;  4XUJ B;  5BNX A;  3REH D;  4KHA B;  3W98 A;  3REK B;  3A1K A;  5GT0 B;  3UT9 C;  5B33 C;  3A1I A;  1P3M B;  3VH6 A;  2ARO D;  4ZUX B;  3MGP D;  1P3F B;  3UTB C;  3W99 D;  3MGQ C;  3KWQ A;  1P3L A;  3AZF B;  3H0R C;  3KSY A;  3W99 B;  3WTP E;  4J8X D;  3MGQ A;  4WU8 D;  3R45 A;  1HTA A;  5GXQ C;  4ZBJ C;  4Z66 A;  2ZY3 A;  1P3F D;  1P3M D;  3REI C;  3AZK B;  3VH6 W;  3X1T B;  3WA9 C;  3VH5 W;  5B0Z B;  5DNM C;  3W98 C;  3P5J B;  3UT9 A;  3AL0 C;  5FUG B;  5BT1 C;  2ZY2 A;  1P3A B;  5GT0 C;  1HQ3 A;  2F8N A;  3WKJ C;  2G5H C;  4EO5 C;  3AZE C;  3REL B;  2Y2O A;  3AFA A;  1EQZ A;  3EPK A;  5GSU A;  3UTA D;  2CV5 D;  1KX5 A;  3W96 A;  3X1S A;  3REJ C;  3AZJ D;  5DNN C;  3AYW A;  4YM6 A;  5B33 D;  2FJ7 C; 
#chains in the Genus database with same CATH homology
 2YFV B;  4WV4 B;  5JRG A;  3AYW C;  3W98 B;  5CP6 D;  2F8N G;  3REK A;  3B6G C;  4AWL C;  4J8X C;  5B24 A;  5AV5 A;  3AZI A;  4X23 D;  4J8V B;  5AVB D;  4CAY A;  5GSU C;  3REH B;  5CPJ C;  3AZF C;  5DNM D;  4J8U B;  1JFI B;  3AV2 C;  1S32 C;  5B0Z D;  5B40 A;  3AV1 B;  3B6F A;  1WWS A;  1M1A D;  3AZM A;  3TU4 D;  2F8N K;  1ID3 A;  4YS3 C;  1B67 A;  5B1L A;  1P3O A;  1Q9C A;  5B40 C;  1P3A D;  2XD1 A;  5GXQ A;  3KXB B;  4XUJ C;  3WA9 B;  1P3B A;  4G91 C;  1KX4 B;  5C3I C;  4DRB A;  5B1M A;  5B24 C;  3AZH B;  4H9R B;  3LZ0 D;  2F8N B;  2PYO C;  3X1U D;  3WKJ B;  4H9O A;  1ZLA D;  3REL A;  2Y2M A;  3REJ B;  3AFA B;  5B2J C;  1W2E A;  3C1C B;  3REH C;  2Y2H A;  3A6N D;  3C1C D;  4J8V D;  5B2I C;  4JJN D;  3AYW B;  2YFW A;  2ARO C;  4ZBJ B;  3MGP C;  3X1U B;  4J8W A;  3UTB D;  1AOI C;  4LD9 D;  5JRG B;  2Y2L A;  1P3K A;  1P3G D;  3LJA D;  5GT3 B;  1TAF B;  5B31 G;  1KX3 B;  5B24 B;  5AVC A;  3AV2 D;  5GT3 D;  2PYO B;  2LY8 A;  3AV2 B;  4XZQ D;  4QLC D;  3MGS B;  4H9N A;  5AVC C;  4YS3 D;  2W8S A;  4ZUX A;  4NE6 A;  3NQJ B;  3LZ1 C;  5B40 B;  4E44 A;  3B6F B;  5AVB B;  3AV1 C;  2FJ7 B;  4KUD D;  3X1U C;  1H3O A;  1ZLA C;  3REK C;  3WA9 A;  5BNV A;  3REI A;  4WU9 D;  2JE5 A;  3REJ D;  3AZK A;  1KX4 C;  5B2J B;  1BH8 B;  5G49 A;  4H9O B;  4WNN B;  3X1V C;  1P34 B;  4UUZ A;  1HQ3 B;  3B6G D;  5E5A B;  1EQZ B;  5AV9 B;  3MGS D;  1WWI A;  3LEL A;  5JA4 B;  5AV8 D;  3AZG C;  3X1S B;  3W96 B;  2JSS A;  5BNX B;  3AN2 D;  4QLC C;  3AZL B;  1M18 C;  4H9P B;  2BYM B;  4YM6 B;  5C3I B;  3AZH C;  2VQR A;  3B0C W;  2Y2I A;  3AZE B;  3F6T A;  2NZD A;  3KUY B;  3C1B B;  4KGC C;  5AV5 B;  3MGQ B;  5B2I A;  4DRA A;  2L5A A;  2HUE C;  4CAY B;  2FFF B;  4Z66 B;  4WJ3 C;  3EPL A;  2XD5 A;  1AOI B;  2ARO B;  3MGP B;  3UT9 D;  1H3O B;  5B31 C;  3MVD B;  4H9Q A;  4QLC A;  3AV1 A;  5B32 A;  4H9S C;  3MGQ D;  4YM6 C;  1KX3 C;  4J8V C;  5B1L B;  1P3O B;  3AZN D;  1BH8 A;  3KXB A;  1U35 D;  3UTA A;  4KGC A;  1P34 A;  5B1M B;  3AZJ A;  4H9R A;  1R4V A;  1EQZ C;  4KUD A;  1M19 D;  3WA9 D;  5E5A C;  3EPJ A;  3W97 D;  3LJA B;  4WU9 A;  4HGA C;  3NQU B;  3X1T D;  5BT1 D;  4X23 B;  1BH9 B;  3WTP B;  1F66 D;  3LEL C;  3AZI D;  2YFW B;  5F99 B;  3MGR A;  4EO5 B;  2Y2G A;  3MNN D;  4AWL B;  3REL C;  4KHA A;  5AV5 C;  3KUY A;  4Z66 D;  1P3F A;  1P3M A;  4Z5T C;  2FJ7 D;  2NZD C;  5B2I B;  3AZM D;  2PYO A;  1F1E A;  1KX4 D;  4J8U C;  5BO0 B;  3WAA C;  2G5I C;  3AZN C;  1M18 A;  3W96 C;  3X1S C;  3MVD A;  4QLC B;  5BS7 C;  5AV9 D;  3AZH A;  2NQB C;  3FDD A;  5B0Z A;  3O62 D;  4J8W C;  5E5A D;  3AZL D;  3WKJ A;  3TU4 A;  2Y2K A;  1Z2C B;  1M19 B;  3B0D C;  2NQB A;  1P3A A;  3C1C A;  4J8X A;  3X1V A;  3LZ1 B;  5B2J A;  5G49 B;  2IO5 C;  2HIO C;  3WAA A;  1BFM A;  4WU9 B;  3AZK D;  4G92 C;  1KX5 B;  5CPI D;  2HIO A;  3WTP A;  1U35 A;  5GT3 A;  1TAF A;  5F99 A;  1ID3 C;  2F8N D;  1P3P A;  4NFT A;  2Y2P A;  5DNN D;  4H9N B;  4ZUX D;  3C1C C;  2BYM A;  3B0B A;  1HQ3 C;  2BG1 A;  5B1M C;  1P3K D;  3X1S D;  3AZE A;  3W96 D;  4LD9 C;  1KX3 D;  3C1B A;  5CHL B;  5AVB A;  3LJA C;  4G92 B;  3AZL C;  1M18 B;  4X23 C;  5GT3 C;  5AVB C;  3WTP C;  5CPK A;  3EPH A;  1M19 C;  5AV6 D;  1T3U A;  2ARO A;  5CPJ D;  3MGP A;  2JCH A;  3KWQ D;  1P3L D;  2J8P A;  1P3P C;  3AZK C;  1KX4 A;  3X1T C;  1P3B D;  2F2A C;  1P3I A;  4R8P D;  1F66 C;  3AZI C;  5CPI B;  3B6F D;  3AZJ B;  5JA4 A;  1TZY D;  4NE3 A;  3REL D;  4WU9 C;  3KXB D;  5B31 B;  3KFU G;  4H9P A;  3AZG B;  3A6N A;  5B1M D;  4Z2M H;  5CPK C;  3AZM C;  3NQU A;  3X1V D;  4XUJ A;  4J8U D;  1TZY B;  4JJN C;  5GT0 A;  2CV5 A;  4WU8 C;  3KUY C;  3AZG D;  4Z5T A;  4WZS B;  3V9R B;  5KDM A;  2F8N H;  3W98 D;  2HUE B;  3KWQ C;  1P3L C;  1P3P D;  2RVQ C;  4H9Q B;  3H0L C;  1P3G A;  5AY8 B;  5BO0 A;  4R8P C;  2DF4 C;  2FJ7 A;  3VH5 T;  1S32 B;  1KX5 D;  4KGC D;  5AY8 D;  4KGC B;  5FUG A;  4YS3 B;  5B33 A;  5B1L C;  4CSR B;  1P3O C;  5CPI C;  3AZJ C;  3AFA D;  4LD9 A;  1F66 B;  3REK D;  3TU4 B;  5CPK D;  3LJA A;  1ID3 D;  4UUZ B;  5CPJ A;  3LZ1 A;  5E5A A;  4YM6 D;  1BH9 A;  4ZUX C;  3MVD C;  3UTB B;  5B0Y D;  2YFV A;  4JJN B;  2ZY5 A;  3W97 A;  1EQZ D;  2Y2Q A;  1U35 B;  5F99 C;  1ULY A;  3AN2 A;  3AZF D;  3MGS C;  5B32 C;  5AV8 C;  3B0C T;  1S32 D;  3WTP D;  5GXQ D;  4J8V A;  3B6G A;  1P3M C;  1P3F C;  4WU8 B;  3MGR D;  4HGA B;  4E45 A;  3REH A;  1KX5 C;  3LEL D;  5AY8 C;  5B40 D;  1P3A C;  4XUJ D;  1PZR A;  3KWQ B;  1P3L B;  1ZLA B;  2RIQ A;  5AV5 D;  3W99 A;  1ID3 B;  3AZE D;  4M6B A;  3LZ0 B;  5BS7 A;  5DNM B;  1M19 A;  2NQB B;  2NZD D;  2CV5 C;  4YS3 A;  2CWE A;  3X1V B;  1P34 C;  3MVD D;  3WAA D;  1M1A B;  1N1J B;  5AV8 B;  5B2I D;  4LD9 B;  3WAA B;  5B0Y C;  5AV6 A;  3AZN B;  3AYW D;  5AV9 C;  5CP6 C;  3IP4 C;  2NQB D;  2HIO B;  1P3G C;  4XZQ A;  3UTB A;  5JRG D;  5B32 D;  1P3I D;  3X1U A;  5GSU B;  4J8W B;  2BYK B;  3KUY D;  4R8P B;  4UPK A;  2UWX A;  5B31 A;  1P3P B;  5GSU D;  1KU5 A;  3VH6 T;  3A6N B;  3H0M C;  3MGR B;  3LZ1 D;  3C1B D;  1M1A C;  4WU8 A;  3MGS A;  4G91 B;  4Z2M G;  4KUD C;  5B0Y A;  4NE5 A;  3VH5 A;  3NQJ A;  1B6W A;  5B24 D;  5B1L D;  3LZ0 C;  1P3O D;  2ZM5 A;  5CPK B;  3AFA C;  2PYO D;  1P34 D;  1A7W A;  4H9S A;  3LZ0 A;  5B32 G;  4Z5T D;  5B2J D;  5DNM A;  5DNN B;  2Y2J A;  3A6N C;  1M1A A;  5JRG C;  3O62 A;  5CPI A;  3EG5 B;  4WNN A;  1P3I C;  5AV6 B;  5B33 B;  1AOI D;  4CSR A;  4J8X B;  3REI D;  3O62 C;  4J8W D;  5F99 D;  1M18 D;  5CP6 B;  3REJ A;  4DQY B;  5AV9 A;  3AZH D;  3LEL B;  5CPJ B;  4XZQ C;  1P3B C;  5GT0 D;  5AVC D;  3MGR C;  3AZL A;  3WKJ D;  1TZY A;  3MNN B;  2HIO D;  2CV5 B;  4JJN A;  3AZI B;  3UTA C;  1TZY C;  3W97 B;  3KXB C;  4Z5T B;  2NZD B;  3AV1 D;  3AN2 B;  3V9R A;  5KDM B;  5B0Y B;  5AVC B;  4J8U A;  1JFI A;  5B31 D;  3AV2 A;  1P3G B;  3AZF A;  5AY8 A;  3AZM B;  1HQ3 D;  1S32 A;  1P3K C;  1U35 C;  5GXQ B;  3R45 B;  1P3B B;  3W99 C;  5DNN A;  1ZLA A;  5B32 B;  3B0D B;  3X1T A;  1F66 A;  3UTA B;  3W97 C;  3O62 B;  5BNV B;  3REI B;  2RVQ D;  3UT9 B;  5B0Z C;  3AN2 C;  1P3I B;  4KUD B;  5AV6 C;  2DQN C;  3TU4 C;  1N1J A;  5AV8 A;  5CP6 A;  3AZN A;  3MNN C;  3C1B C;  2IO5 B;  4X23 A;  1P3K B;  2Y2N A;  2ZY4 A;  4XZQ B;  3MNN A;  3AZG A;  1AOI A;  1KX3 A;  3B6F C;  4Z66 C;  2BYK A;  4R8P A;  3B6G B;  4XUJ B;  5BNX A;  3REH D;  4KHA B;  3W98 A;  3REK B;  3A1K A;  5GT0 B;  3UT9 C;  5B33 C;  3A1I A;  1P3M B;  3VH6 A;  2ARO D;  4ZUX B;  3MGP D;  1P3F B;  3UTB C;  3W99 D;  3MGQ C;  3KWQ A;  1P3L A;  3AZF B;  3H0R C;  3KSY A;  3W99 B;  3WTP E;  4J8X D;  3MGQ A;  4WU8 D;  3R45 A;  1HTA A;  5GXQ C;  4ZBJ C;  4Z66 A;  2ZY3 A;  1P3F D;  1P3M D;  3REI C;  3AZK B;  3VH6 W;  3X1T B;  3WA9 C;  3VH5 W;  5B0Z B;  5DNM C;  3W98 C;  3P5J B;  3UT9 A;  3AL0 C;  5FUG B;  5BT1 C;  2ZY2 A;  1P3A B;  5GT0 C;  1HQ3 A;  2F8N A;  3WKJ C;  2G5H C;  4EO5 C;  3AZE C;  3REL B;  2Y2O A;  3AFA A;  1EQZ A;  3EPK A;  5GSU A;  3UTA D;  2CV5 D;  1KX5 A;  3W96 A;  3X1S A;  3REJ C;  3AZJ D;  5DNN C;  3AYW A;  4YM6 A;  5B33 D;  2FJ7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...