5AV5C

Human nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av5C00
3REHA 3KUYD 5B33D 5B32G 3MGQA 3KXBB 2NQBA 3B6FB 2HIOC 5AV6A 1B67A 4KUDC 1P34A 1BH8A 4CAYB 3VH6T 5CP6A 3B0DC 4CSRA 5BO0B 1AOIA 5B1LD 4QLCB 3WA9B 3MNNA 3X1UA 4KGCC 1TZYB 4J8VA 1KX3D 5E5AC 5AVCA 3AZMC 3AZLD 3LZ1A 5AY8B 4H9OB 4Z2MG 2IO5C 2YFWB 2BYMA 5GT3C 4NFTA 4YS3B 4WU9D 3AZKB 4J8XC 4X23C 3UTAD 2PYOB 3C1CB 3TU4D 3AFAC 5B2IC 3AZEB 5GXQC 1N1JA 2RVQD 3W97A 3AZGA 1KX5B 3REIC 2F8NK 3REHD 3UTBC 3MVDB 3AZHB 3MGQD 3LZ0D 1P3BB 5BNVA 1KX4D 2F8NA 5JRGA 5DNMB 3KXBC 2NQBD 5AV6D 5B31D 3X1TB 3B6FC 5G49B 1P34D 4UUZA 4YM6A 5B31G 4J8WA 5CPKB 4G92B 1AOID 1HQ3A 4Z2MH 3MNND 4QLCC 3WA9C 5B40A 3X1UD 3R45A 1BFMA 4J8VD 1TZYC 3UT9B 5AVCD 3X1SA 3AN2B 1P3LA 1ZLAA 5AVBA 3W98A 1EQZA 1S32A 3LZ1D 1ID3D 2FJ7B 1P3FA 5AY8C 2YFVB 1P3IA 4KHAA 4H9QA 5CPJB 5B24A 4YS3C 3REKA 3AZKC 2PYOC 5AV5B 4XUJA 3LELA 3C1CC 5AV9B 2CV5B 3AZEC 3W97D 2BYKA 3AZGD 1P3GB 4LD9A 3AV1B 1KX5C 5F99D 3O62A 1M1AD 3MVDC 1S32B 2F8ND 3AZHC 4HGAB 5JRGD 1P3BC 5B1LA 5DNMC 2LY8A 2F8NG 3X1TC 5DNND 3RELB 5B32B 4KHAB 5GSUA 4R8PA 4H9SC 4J8WD 3KUYB 5B33B 5CPKC 4G92C 3B0CT 1HQ3D 3X1VA 5BNXA 1F66D 5B40D 2NZDA 3MGPA 4E45A 4H9NB 3UT9C 3X1SD 1P3LD 1ZLAD 5AVBD 3AN2C 5B1LB 1EQZD 3W98D 3AZNA 4WU9A 1P3FD 2FJ7C 3REJA 4WZSB 1P3OD 5CPIA 5B1MA 5GT0A 3NQUB 1KX3B 3AZJA 5BT1C 4H9RA 5CPJC 5B24D 3AZLB 2F8NH 3REKD 3LZ0A 1KX4A 4XUJD 3LELD 5AV5C 4JJNA 5B31A 5AV9C 2CV5C 4LD9D 5B0YA 1P3GC 1P3KA 3AV1C 3O62D 5B0ZA 3WKJA 1U35A 1TAFB 3UTAB 4HGAC 4Z5TC 4DRAA 1JFIA 4J8UA 3TU4B 3AV2C 3B6GA 5B2JA 5GSUD 4R8PD 3RELC 5B32C 3REHB 1P3PA 3KWQA 5CHLB 3MGQB 3LZ0B 3KUYC 5B33C 3X1VD 1M18A 2NQBB 2NZDD 5AV6B 3MGSA 1ID3A 5B31B 3MGPD 1P34B 1BH8B 3W99A 5CP6B 3NQJA 4CSRB 1AOIB 1M19A 4G91B 3AZND 5B1LC 3MNNB 3REJD 3X1UB 5CPID 5B1MD 4J8VB 5GT0D 3C1BA 1P3AA 5AV8A 1H3OA 3A6NA 5AVCB 3AZJD 1KX3C 5F99A 1M1AA 3AZLC 3LZ1B 1ID3B 3WAAA 4JJND 3AZFA 3WTPA 3NQJB 2BYMB 5DNNA 5B0YD 1P3KD 3W96A 5JA4A 5B0ZD 3WKJD 5BS7C 1U35D 1P3MA 4J8UD 4WNNA 3UTAC 4DRBA 3TU4C 1F66A 3B6GD 5B2JD 4EO5B 1N1JB 3AYWA 3W97B 3AZGB 2RVQC 4XZQA 2JSSA 3AZIA 3B0CW 1P3PD 3V9RA 1B6WA 3KWQD 3REHC 1M18D 5BNVB 4WU8A 2F8NB 5JRGB 3MGQC 3MGSD 4Z66A 2NQBC 5AV6C 3LJAA 1P3OA 5DNNB 3MGRA 3W99D 4UUZB 4ZUXA 2AROA 1P34C 4YM6B 5CP6C 4J8WB 1M19D 1AOIC 4G91C 1HQ3B 1F66B 3MNNC 5B40B 3R45B 2HIOA 3X1UC 4KUDA 3C1BD 1P3AD 5AV8D 4J8VC 3A6ND 5AVCC 3X1SB 1P3LB 1ZLAB 1Q9CA 5AVBB 3W98B 1EQZB 5DNMD 3WAAD 1P3FB 3LZ1C 3KSYA 3AZFD 3WTPD 1P3OB 1R4VA 4KGCA 3VH6W 1P3IB 4H9QB 5E5AA 1BH9A 4H9PA 3W96D 3AZMA 5B24B 1P3MD 3REKB 4XUJB 3LELB 4WV4B 3AYWD 4EO5C 2BYKB 4XZQD 3W97C 4LD9B 5GT3A 3AZGC 3AZID 3O62B 4WU8D 4J8XA 4X23A 5JRGC 4Z66D 3AFAA 3LJAD 5B2IA 3MGRD 4ZUXD 5GXQA 2AROD 5GSUB 4R8PB 4H9PB 4YM6C 1ULYA 3REIA 5CPJD 4J8WC 3UTBA 3X1VB 5BNXB 1HQ3C 3KXBA 2NZDB 2HIOD 5B40C 3B6FA 3MGPB 4KUDD 2IO5B 4CAYA 5BO0A 3X1SC 3VH5A 1P3LC 4Z5TD 3AZNB 1ZLAC 5AVBC 3W98C 1EQZC 4WU9B 3AV2D 1S32C 3REJB 4QLCA 3WA9A 1P3FC 4KGCD 5CPIB 5B1MB 5GT0B 1P3IC 1TZYA 5E5AD 4E44A 3AZJB 4H9RB 3AZMD 3VH5T 5B24C 1KX4B 3REKC 4JJNB 4XUJC 3LELC 5AY8A 4H9OA 5GT3D 5B0YB 1P3KB 4LD9C 2YFWA 5B0ZB 3WKJB 3O62C 1U35B 4J8XD 4X23D 1JFIB 4YS3A 3AZKA 2PYOA 4J8UB 5FUGA 3AFAD 3C1CA 3B6GB 4M6BA 5B2JB 5B2ID 5GXQD 5C3IB 3AZEA 4ZBJB 5GSUC 4R8PC 3REID 1KX5A 1P3PB 3UTBD 1KU5A 3KWQB 1M18B 3MVDA 3AZHA 1P3BA 3X1VC 3KXBD 5DNMA 3MGSB 2NZDC 3B6FD 3X1TA 3MGPC 5G49A 3W99B 2CWEA 4H9SA 1WWSA 1M19B 5CPKA 2HUEB 3AZNC 5FUGB 4QLCD 4WU9C 3WA9D 3REJC 5CPIC 5B1MC 3C1BB 1F1EA 1TZYD 5AV8B 1P3AB 5GT0C 1H3OB 3A6NB 3UT9A 3AZJC 5F99B 4NE3A 1M1AB 3AN2A 3WAAB 3LZ0C 1KX4C 2FJ7A 4JJNC 3WTPB 3AZFB 5AY8D 5B31C 2YFVA 5CP6D 5B0YC 1P3KC 5JA4B 3W96B 5B0ZC 3WKJC 5CPJA 1P3MB 1U35C 4YS3D 3AZKD 2PYOD 4WNNB 4J8UC 3C1CD 5AV5A 3B6GC 3AYWB 5B2JC 3AZED 5C3IC 5AV9A 4XZQB 2CV5A 4ZBJC 3AZIB 1P3GA 4NE6A 4NE5A 1KX5D 3AV1A 3V9RB 1P3PC 3MVDD 4WU8B 3KWQC 3AZHD 1M18C 1P3BD 4Z5TA 4Z66B 3AV2A 1ID3C 3MGSC 3LJAB 3X1TD 3MGRB 4AWLB 4ZUXB 2AROB 3W99C 5B32A 3RELA 5CPKD 1M19C 3KUYA 5B33A 2HUEC 2HIOB 2L5AA 4KUDB 3C1BC 1P3AC 5AV8C 4H9NA 3B0DB 3A6NC 3UT9D 3VH5W 1HTAA 5F99C 3AN2D 4Z5TB 1M1AC 1A7WA 3AV2B 2FJ7D 3WAAC 3AZFC 3WTPC 4KGCB 4YM6D 5DNNC 5E5AB 1BH9B 1WWIA 3NQUA 5BT1D 3W96C 5KDMA 3AZMB 1KX3A 3AZLA 3B0BA 1P3MC 5AV5D 1F66C 5AV9D 3AYWC 2CV5D 3WTPE 5GT3B 4XZQC 1P3GD 3AV1D 3AZIC 5BS7A 4WU8C 4J8XB 4X23B 1S32D 1TAFA 3UTAA 4Z66C 3AFAB 3TU4A 5B2IB 5GXQB 3LJAC 1P3OC 1P3ID 3MGRC 4AWLC 4ZUXC 5B32D 3RELD 2AROC 3VH6A 5KDMB 3REIB 3UTBB
chains in the Genus database with same CATH superfamily
3REHA 3KUYD 5B33D 5B32G 3MGQA 3KXBB 2NQBA 3B6FB 2HIOC 5AV6A 1B67A 4KUDC 1P34A 1BH8A 4CAYB 1T3UA 3VH6T 5CP6A 3B0DC 4CSRA 3H0MC 5BO0B 1AOIA 5B1LD 4QLCB 3WA9B 3MNNA 3X1UA 4KGCC 1TZYB 4J8VA 1KX3D 5E5AC 5AVCA 3AZMC 3AZLD 3LZ1A 5AY8B 4H9OB 4Z2MG 2IO5C 2YFWB 2BYMA 5GT3C 4NFTA 2DF4C 2DQNC 4YS3B 4WU9D 3AZKB 4J8XC 4X23C 2G5HC 3UTAD 2PYOB 3C1CB 3TU4D 3AFAC 5B2IC 3AZEB 5GXQC 1N1JA 2RVQD 3W97A 3AZGA 1KX5B 2XD5A 3REIC 2F8NK 2Y2IA 3REHD 2ZY3A 3UTBC 3MVDB 3AZHB 3MGQD 3LZ0D 1P3BB 5BNVA 1KX4D 2F8NA 5JRGA 5DNMB 3A1KA 3KXBC 2NQBD 5AV6D 5B31D 3X1TB 3B6FC 5G49B 1P34D 4UUZA 4YM6A 5B31G 4J8WA 2VQRA 4G92B 5CPKB 1AOID 1HQ3A 4Z2MH 3MNND 4QLCC 3WA9C 2RIQA 5B40A 3X1UD 3R45A 1BFMA 4J8VD 1TZYC 3UT9B 5AVCD 3EPHA 3X1SA 3AN2B 1P3LA 1ZLAA 5AVBA 3W98A 1EQZA 1S32A 3LZ1D 1ID3D 2FJ7B 1P3FA 5AY8C 2Y2MA 2YFVB 1P3IA 4KHAA 4H9QA 4WJ3C 5CPJB 3EPJA 5B24A 4YS3C 3REKA 3AZKC 2F2AC 2PYOC 5AV5B 4XUJA 3LELA 3C1CC 5AV9B 2CV5B 3AZEC 3W97D 2BYKA 3AZGD 2ZY4A 1P3GB 4LD9A 3AV1B 1KX5C 5F99D 3O62A 1M1AD 2G5IC 3MVDC 1S32B 3AZHC 4HGAB 5JRGD 1P3BC 2F8ND 5B1LA 5DNMC 2Y2OA 2LY8A 2F8NG 3X1TC 5DNND 3RELB 5B32B 4KHAB 5GSUA 4R8PA 4UPKA 4DQYB 4H9SC 4J8WD 3KUYB 5B33B 5CPKC 4G92C 3B0CT 1HQ3D 3X1VA 5BNXA 1F66D 5B40D 2NZDA 2ZY5A 2XD1A 3MGPA 4E45A 4H9NB 3UT9C 3X1SD 1P3LD 1ZLAD 5AVBD 3AN2C 5B1LB 1EQZD 3W98D 3AZNA 4WU9A 1P3FD 2FJ7C 3REJA 4WZSB 1P3OD 5CPIA 5B1MA 5GT0A 3NQUB 3F6TA 1KX3B 3AZJA 5BT1C 4H9RA 5CPJC 5B24D 3AZLB 2F8NH 3REKD 3LZ0A 1KX4A 4XUJD 3LELD 5AV5C 4JJNA 5B31A 5AV9C 2CV5C 4LD9D 5B0YA 1P3GC 1P3KA 3AV1C 3O62D 5B0ZA 3WKJA 1U35A 1TAFB 3UTAB 4HGAC 4Z5TC 4DRAA 1JFIA 4J8UA 3TU4B 3AV2C 3B6GA 5B2JA 5GSUD 4R8PD 3RELC 5B32C 3REHB 1P3PA 3KWQA 5CHLB 3MGQB 3LZ0B 3KUYC 5B33C 3X1VD 1M18A 2NQBB 2NZDD 5AV6B 3MGSA 1ID3A 5B31B 3MGPD 1P34B 1BH8B 3W99A 5CP6B 3NQJA 4CSRB 3H0LC 2Y2JA 1AOIB 1M19A 4G91B 3AZND 5B1LC 3MNNB 3REJD 3X1UB 5CPID 5B1MD 4J8VB 5GT0D 3C1BA 1P3AA 5AV8A 1H3OA 3A6NA 5AVCB 3AZJD 1KX3C 5F99A 1M1AA 3AZLC 2ZY2A 3LZ1B 1ID3B 3WAAA 4JJND 3AZFA 3WTPA 3NQJB 2BYMB 5DNNA 5B0YD 1P3KD 3W96A 5JA4A 5B0ZD 3WKJD 5BS7C 2Y2LA 1U35D 1P3MA 4J8UD 4WNNA 3UTAC 4DRBA 3TU4C 1F66A 2BG1A 3B6GD 5B2JD 2W8SA 4EO5B 1N1JB 3AYWA 3W97B 3AZGB 2RVQC 4XZQA 2JSSA 3AZIA 3B0CW 1P3PD 2Y2QA 3V9RA 1B6WA 3KWQD 3REHC 1M18D 5BNVB 4WU8A 2F8NB 5JRGB 3MGQC 3AL0C 3A1IA 3MGSD 4Z66A 2NQBC 5AV6C 3LJAA 1P3OA 5DNNB 2Y2PA 3MGRA 3W99D 4UUZB 4ZUXA 2AROA 1P34C 4YM6B 5CP6C 4J8WB 1M19D 1AOIC 4G91C 1HQ3B 1F66B 3MNNC 5B40B 3R45B 2HIOA 3X1UC 4KUDA 3C1BD 2Y2GA 1P3AD 5AV8D 4J8VC 3KFUG 3A6ND 5AVCC 3X1SB 1P3LB 1ZLAB 1Q9CA 5AVBB 3W98B 1EQZB 5DNMD 3WAAD 1P3FB 3LZ1C 3KSYA 3AZFD 3WTPD 1P3OB 1R4VA 4KGCA 3VH6W 1P3IB 4H9QB 5E5AA 1BH9A 4H9PA 3W96D 3AZMA 5B24B 1P3MD 3REKB 4XUJB 3LELB 4WV4B 3AYWD 4EO5C 2BYKB 4XZQD 3W97C 4LD9B 5GT3A 3AZGC 3AZID 3O62B 4WU8D 4J8XA 4X23A 5JRGC 4Z66D 3AFAA 3LJAD 5B2IA 3MGRD 4ZUXD 5GXQA 2AROD 5GSUB 4R8PB 4H9PB 4YM6C 1ULYA 3REIA 5CPJD 4J8WC 3UTBA 3X1VB 5BNXB 1HQ3C 3KXBA 2Y2NA 3H0RC 2NZDB 2HIOD 5B40C 3B6FA 3MGPB 4KUDD 2IO5B 4CAYA 5BO0A 3X1SC 3VH5A 1P3LC 4Z5TD 3AZNB 1ZLAC 5AVBC 3W98C 1EQZC 4WU9B 3AV2D 1S32C 3REJB 4QLCA 3WA9A 1P3FC 4KGCD 5CPIB 5B1MB 5GT0B 1P3IC 1TZYA 5E5AD 4E44A 3AZJB 4H9RB 3AZMD 3VH5T 3EPLA 5B24C 1KX4B 3FDDA 3REKC 4JJNB 4XUJC 3LELC 5AY8A 2J8PA 4H9OA 5GT3D 5B0YB 1P3KB 4LD9C 2YFWA 5B0ZB 3WKJB 3O62C 1U35B 3EG5B 4J8XD 4X23D 1JFIB 4YS3A 3AZKA 2PYOA 4J8UB 1W2EA 3IP4C 5FUGA 3AFAD 3C1CA 3B6GB 4M6BA 5B2JB 5B2ID 5GXQD 5C3IB 3AZEA 4ZBJB 5GSUC 4R8PC 3REID 1KX5A 1P3PB 3UTBD 1KU5A 3KWQB 1M18B 3MVDA 3AZHA 1P3BA 3X1VC 3KXBD 5DNMA 3MGSB 2NZDC 3B6FD 3X1TA 3MGPC 5G49A 3W99B 2CWEA 4H9SA 1WWSA 1M19B 5CPKA 2HUEB 3AZNC 5FUGB 4QLCD 4WU9C 3WA9D 3REJC 2JE5A 5CPIC 5B1MC 3C1BB 1F1EA 1TZYD 5AV8B 1P3AB 5GT0C 1H3OB 3A6NB 3P5JB 3UT9A 3AZJC 5F99B 4NE3A 1M1AB 3AN2A 3WAAB 3LZ0C 1KX4C 2FJ7A 4JJNC 3WTPB 3AZFB 5AY8D 5B31C 2YFVA 2Y2KA 5CP6D 5B0YC 1P3KC 5JA4B 3W96B 5B0ZC 3WKJC 5CPJA 1P3MB 1U35C 4YS3D 3AZKD 2PYOD 4WNNB 4J8UC 3C1CD 5AV5A 3B6GC 3AYWB 5B2JC 3AZED 5C3IC 5AV9A 4XZQB 2CV5A 4ZBJC 3AZIB 1P3GA 4NE6A 4NE5A 1KX5D 3AV1A 3V9RB 1P3PC 3MVDD 4WU8B 3KWQC 3AZHD 1M18C 1P3BD 4Z5TA 4Z66B 3AV2A 1ID3C 3MGSC 3LJAB 3X1TD 3MGRB 4AWLB 4ZUXB 2AROB 3W99C 5B32A 3RELA 2FFFB 5CPKD 1M19C 3KUYA 5B33A 2HUEC 2HIOB 2L5AA 4KUDB 1PZRA 3C1BC 1P3AC 2Y2HA 4H9NA 3B0DB 5AV8C 3A6NC 3UT9D 3VH5W 1HTAA 5F99C 3AN2D 2UWXA 4Z5TB 1M1AC 1Z2CB 1A7WA 2JCHA 3AV2B 2FJ7D 3WAAC 3AZFC 3WTPC 3EPKA 4KGCB 4YM6D 5DNNC 5E5AB 1BH9B 1WWIA 3NQUA 5BT1D 3W96C 5KDMA 3AZMB 1KX3A 3AZLA 3B0BA 1P3MC 5AV5D 2ZM5A 1F66C 5AV9D 3AYWC 2CV5D 3WTPE 5GT3B 4XZQC 1P3GD 3AV1D 3AZIC 5BS7A 4WU8C 4J8XB 4X23B 1S32D 1TAFA 3UTAA 4Z66C 3AFAB 3TU4A 5B2IB 5GXQB 3LJAC 1P3OC 1P3ID 3MGRC 4AWLC 4ZUXC 5B32D 3RELD 2AROC 3VH6A 5KDMB 3REIB 3UTBB
chains in the Genus database with same CATH topology
3REHA 3KUYD 5B33D 5B32G 3MGQA 3KXBB 2NQBA 3B6FB 2HIOC 5AV6A 1B67A 4KUDC 1P34A 1BH8A 4CAYB 1T3UA 3VH6T 5CP6A 3B0DC 4CSRA 3H0MC 5BO0B 1AOIA 5B1LD 4QLCB 3WA9B 3MNNA 3X1UA 4KGCC 1TZYB 4J8VA 1KX3D 5E5AC 5AVCA 3AZMC 3AZLD 3LZ1A 5AY8B 4H9OB 4Z2MG 2IO5C 2YFWB 2BYMA 5GT3C 4NFTA 2DF4C 2DQNC 4YS3B 4WU9D 3AZKB 4J8XC 4X23C 2G5HC 3UTAD 2PYOB 3C1CB 3TU4D 3AFAC 5B2IC 3AZEB 5GXQC 1N1JA 2RVQD 3W97A 3AZGA 1KX5B 2XD5A 3REIC 2F8NK 2Y2IA 3REHD 2ZY3A 3UTBC 3MVDB 3AZHB 3MGQD 3LZ0D 1P3BB 5BNVA 1KX4D 2F8NA 5JRGA 5DNMB 3A1KA 3KXBC 2NQBD 5AV6D 5B31D 3X1TB 3B6FC 5G49B 1P34D 4UUZA 4YM6A 5B31G 4J8WA 2VQRA 4G92B 5CPKB 1AOID 1HQ3A 4Z2MH 3MNND 4QLCC 3WA9C 2RIQA 5B40A 3X1UD 3R45A 1BFMA 4J8VD 1TZYC 3UT9B 5AVCD 3EPHA 3X1SA 3AN2B 1P3LA 1ZLAA 5AVBA 3W98A 1EQZA 1S32A 3LZ1D 1ID3D 2FJ7B 1P3FA 5AY8C 2Y2MA 2YFVB 1P3IA 4KHAA 4H9QA 4WJ3C 5CPJB 3EPJA 5B24A 4YS3C 3REKA 3AZKC 2F2AC 2PYOC 5AV5B 4XUJA 3LELA 3C1CC 5AV9B 2CV5B 3AZEC 3W97D 2BYKA 3AZGD 2ZY4A 1P3GB 4LD9A 3AV1B 1KX5C 5F99D 3O62A 1M1AD 2G5IC 3MVDC 1S32B 3AZHC 4HGAB 5JRGD 1P3BC 2F8ND 5B1LA 5DNMC 2Y2OA 2LY8A 2F8NG 3X1TC 5DNND 3RELB 5B32B 4KHAB 5GSUA 4R8PA 4UPKA 4DQYB 4H9SC 4J8WD 3KUYB 5B33B 5CPKC 4G92C 3B0CT 1HQ3D 3X1VA 5BNXA 1F66D 5B40D 2NZDA 2ZY5A 2XD1A 3MGPA 4E45A 4H9NB 3UT9C 3X1SD 1P3LD 1ZLAD 5AVBD 3AN2C 5B1LB 1EQZD 3W98D 3AZNA 4WU9A 1P3FD 2FJ7C 3REJA 4WZSB 1P3OD 5CPIA 5B1MA 5GT0A 3NQUB 3F6TA 1KX3B 3AZJA 5BT1C 4H9RA 5CPJC 5B24D 3AZLB 2F8NH 3REKD 3LZ0A 1KX4A 4XUJD 3LELD 5AV5C 4JJNA 5B31A 5AV9C 2CV5C 4LD9D 5B0YA 1P3GC 1P3KA 3AV1C 3O62D 5B0ZA 3WKJA 1U35A 1TAFB 3UTAB 4HGAC 4Z5TC 4DRAA 1JFIA 4J8UA 3TU4B 3AV2C 3B6GA 5B2JA 5GSUD 4R8PD 3RELC 5B32C 3REHB 1P3PA 3KWQA 5CHLB 3MGQB 3LZ0B 3KUYC 5B33C 3X1VD 1M18A 2NQBB 2NZDD 5AV6B 3MGSA 1ID3A 5B31B 3MGPD 1P34B 1BH8B 3W99A 5CP6B 3NQJA 4CSRB 3H0LC 2Y2JA 1AOIB 1M19A 4G91B 3AZND 5B1LC 3MNNB 3REJD 3X1UB 5CPID 5B1MD 4J8VB 5GT0D 3C1BA 1P3AA 5AV8A 1H3OA 3A6NA 5AVCB 3AZJD 1KX3C 5F99A 1M1AA 3AZLC 2ZY2A 3LZ1B 1ID3B 3WAAA 4JJND 3AZFA 3WTPA 3NQJB 2BYMB 5DNNA 5B0YD 1P3KD 3W96A 5JA4A 5B0ZD 3WKJD 5BS7C 2Y2LA 1U35D 1P3MA 4J8UD 4WNNA 3UTAC 4DRBA 3TU4C 1F66A 2BG1A 3B6GD 5B2JD 2W8SA 4EO5B 1N1JB 3AYWA 3W97B 3AZGB 2RVQC 4XZQA 2JSSA 3AZIA 3B0CW 1P3PD 2Y2QA 3V9RA 1B6WA 3KWQD 3REHC 1M18D 5BNVB 4WU8A 2F8NB 5JRGB 3MGQC 3AL0C 3A1IA 3MGSD 4Z66A 2NQBC 5AV6C 3LJAA 1P3OA 5DNNB 2Y2PA 3MGRA 3W99D 4UUZB 4ZUXA 2AROA 1P34C 4YM6B 5CP6C 4J8WB 1M19D 1AOIC 4G91C 1HQ3B 1F66B 3MNNC 5B40B 3R45B 2HIOA 3X1UC 4KUDA 3C1BD 2Y2GA 1P3AD 5AV8D 4J8VC 3KFUG 3A6ND 5AVCC 3X1SB 1P3LB 1ZLAB 1Q9CA 5AVBB 3W98B 1EQZB 5DNMD 3WAAD 1P3FB 3LZ1C 3KSYA 3AZFD 3WTPD 1P3OB 1R4VA 4KGCA 3VH6W 1P3IB 4H9QB 5E5AA 1BH9A 4H9PA 3W96D 3AZMA 5B24B 1P3MD 3REKB 4XUJB 3LELB 4WV4B 3AYWD 4EO5C 2BYKB 4XZQD 3W97C 4LD9B 5GT3A 3AZGC 3AZID 3O62B 4WU8D 4J8XA 4X23A 5JRGC 4Z66D 3AFAA 3LJAD 5B2IA 3MGRD 4ZUXD 5GXQA 2AROD 5GSUB 4R8PB 4H9PB 4YM6C 1ULYA 3REIA 5CPJD 4J8WC 3UTBA 3X1VB 5BNXB 1HQ3C 3KXBA 2Y2NA 3H0RC 2NZDB 2HIOD 5B40C 3B6FA 3MGPB 4KUDD 2IO5B 4CAYA 5BO0A 3X1SC 3VH5A 1P3LC 4Z5TD 3AZNB 1ZLAC 5AVBC 3W98C 1EQZC 4WU9B 3AV2D 1S32C 3REJB 4QLCA 3WA9A 1P3FC 4KGCD 5CPIB 5B1MB 5GT0B 1P3IC 1TZYA 5E5AD 4E44A 3AZJB 4H9RB 3AZMD 3VH5T 3EPLA 5B24C 1KX4B 3FDDA 3REKC 4JJNB 4XUJC 3LELC 5AY8A 2J8PA 4H9OA 5GT3D 5B0YB 1P3KB 4LD9C 2YFWA 5B0ZB 3WKJB 3O62C 1U35B 3EG5B 4J8XD 4X23D 1JFIB 4YS3A 3AZKA 2PYOA 4J8UB 1W2EA 3IP4C 5FUGA 3AFAD 3C1CA 3B6GB 4M6BA 5B2JB 5B2ID 5GXQD 5C3IB 3AZEA 4ZBJB 5GSUC 4R8PC 3REID 1KX5A 1P3PB 3UTBD 1KU5A 3KWQB 1M18B 3MVDA 3AZHA 1P3BA 3X1VC 3KXBD 5DNMA 3MGSB 2NZDC 3B6FD 3X1TA 3MGPC 5G49A 3W99B 2CWEA 4H9SA 1WWSA 1M19B 5CPKA 2HUEB 3AZNC 5FUGB 4QLCD 4WU9C 3WA9D 3REJC 2JE5A 5CPIC 5B1MC 3C1BB 1F1EA 1TZYD 5AV8B 1P3AB 5GT0C 1H3OB 3A6NB 3P5JB 3UT9A 3AZJC 5F99B 4NE3A 1M1AB 3AN2A 3WAAB 3LZ0C 1KX4C 2FJ7A 4JJNC 3WTPB 3AZFB 5AY8D 5B31C 2YFVA 2Y2KA 5CP6D 5B0YC 1P3KC 5JA4B 3W96B 5B0ZC 3WKJC 5CPJA 1P3MB 1U35C 4YS3D 3AZKD 2PYOD 4WNNB 4J8UC 3C1CD 5AV5A 3B6GC 3AYWB 5B2JC 3AZED 5C3IC 5AV9A 4XZQB 2CV5A 4ZBJC 3AZIB 1P3GA 4NE6A 4NE5A 1KX5D 3AV1A 3V9RB 1P3PC 3MVDD 4WU8B 3KWQC 3AZHD 1M18C 1P3BD 4Z5TA 4Z66B 3AV2A 1ID3C 3MGSC 3LJAB 3X1TD 3MGRB 4AWLB 4ZUXB 2AROB 3W99C 5B32A 3RELA 2FFFB 5CPKD 1M19C 3KUYA 5B33A 2HUEC 2HIOB 2L5AA 4KUDB 1PZRA 3C1BC 1P3AC 2Y2HA 4H9NA 3B0DB 5AV8C 3A6NC 3UT9D 3VH5W 1HTAA 5F99C 3AN2D 2UWXA 4Z5TB 1M1AC 1Z2CB 1A7WA 2JCHA 3AV2B 2FJ7D 3WAAC 3AZFC 3WTPC 3EPKA 4KGCB 4YM6D 5DNNC 5E5AB 1BH9B 1WWIA 3NQUA 5BT1D 3W96C 5KDMA 3AZMB 1KX3A 3AZLA 3B0BA 1P3MC 5AV5D 2ZM5A 1F66C 5AV9D 3AYWC 2CV5D 3WTPE 5GT3B 4XZQC 1P3GD 3AV1D 3AZIC 5BS7A 4WU8C 4J8XB 4X23B 1S32D 1TAFA 3UTAA 4Z66C 3AFAB 3TU4A 5B2IB 5GXQB 3LJAC 1P3OC 1P3ID 3MGRC 4AWLC 4ZUXC 5B32D 3RELD 2AROC 3VH6A 5KDMB 3REIB 3UTBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REH A;  3KUY D;  5B33 D;  5B32 G;  3MGQ A;  3KXB B;  2NQB A;  3B6F B;  2HIO C;  5AV6 A;  1B67 A;  4KUD C;  1P34 A;  1BH8 A;  4CAY B;  3VH6 T;  5CP6 A;  3B0D C;  4CSR A;  5BO0 B;  1AOI A;  5B1L D;  4QLC B;  3WA9 B;  3MNN A;  3X1U A;  4KGC C;  1TZY B;  4J8V A;  1KX3 D;  5E5A C;  5AVC A;  3AZM C;  3AZL D;  3LZ1 A;  5AY8 B;  4H9O B;  4Z2M G;  2IO5 C;  2YFW B;  2BYM A;  5GT3 C;  4NFT A;  4YS3 B;  4WU9 D;  3AZK B;  4J8X C;  4X23 C;  3UTA D;  2PYO B;  3C1C B;  3TU4 D;  3AFA C;  5B2I C;  3AZE B;  5GXQ C;  1N1J A;  2RVQ D;  3W97 A;  3AZG A;  1KX5 B;  3REI C;  2F8N K;  3REH D;  3UTB C;  3MVD B;  3AZH B;  3MGQ D;  3LZ0 D;  1P3B B;  5BNV A;  1KX4 D;  2F8N A;  5JRG A;  5DNM B;  3KXB C;  2NQB D;  5AV6 D;  5B31 D;  3X1T B;  3B6F C;  5G49 B;  1P34 D;  4UUZ A;  4YM6 A;  5B31 G;  4J8W A;  5CPK B;  4G92 B;  1AOI D;  1HQ3 A;  4Z2M H;  3MNN D;  4QLC C;  3WA9 C;  5B40 A;  3X1U D;  3R45 A;  1BFM A;  4J8V D;  1TZY C;  3UT9 B;  5AVC D;  3X1S A;  3AN2 B;  1P3L A;  1ZLA A;  5AVB A;  3W98 A;  1EQZ A;  1S32 A;  3LZ1 D;  1ID3 D;  2FJ7 B;  1P3F A;  5AY8 C;  2YFV B;  1P3I A;  4KHA A;  4H9Q A;  5CPJ B;  5B24 A;  4YS3 C;  3REK A;  3AZK C;  2PYO C;  5AV5 B;  4XUJ A;  3LEL A;  3C1C C;  5AV9 B;  2CV5 B;  3AZE C;  3W97 D;  2BYK A;  3AZG D;  1P3G B;  4LD9 A;  3AV1 B;  1KX5 C;  5F99 D;  3O62 A;  1M1A D;  3MVD C;  1S32 B;  2F8N D;  3AZH C;  4HGA B;  5JRG D;  1P3B C;  5B1L A;  5DNM C;  2LY8 A;  2F8N G;  3X1T C;  5DNN D;  3REL B;  5B32 B;  4KHA B;  5GSU A;  4R8P A;  4H9S C;  4J8W D;  3KUY B;  5B33 B;  5CPK C;  4G92 C;  3B0C T;  1HQ3 D;  3X1V A;  5BNX A;  1F66 D;  5B40 D;  2NZD A;  3MGP A;  4E45 A;  4H9N B;  3UT9 C;  3X1S D;  1P3L D;  1ZLA D;  5AVB D;  3AN2 C;  5B1L B;  1EQZ D;  3W98 D;  3AZN A;  4WU9 A;  1P3F D;  2FJ7 C;  3REJ A;  4WZS B;  1P3O D;  5CPI A;  5B1M A;  5GT0 A;  3NQU B;  1KX3 B;  3AZJ A;  5BT1 C;  4H9R A;  5CPJ C;  5B24 D;  3AZL B;  2F8N H;  3REK D;  3LZ0 A;  1KX4 A;  4XUJ D;  3LEL D;  5AV5 C;  4JJN A;  5B31 A;  5AV9 C;  2CV5 C;  4LD9 D;  5B0Y A;  1P3G C;  1P3K A;  3AV1 C;  3O62 D;  5B0Z A;  3WKJ A;  1U35 A;  1TAF B;  3UTA B;  4HGA C;  4Z5T C;  4DRA A;  1JFI A;  4J8U A;  3TU4 B;  3AV2 C;  3B6G A;  5B2J A;  5GSU D;  4R8P D;  3REL C;  5B32 C;  3REH B;  1P3P A;  3KWQ A;  5CHL B;  3MGQ B;  3LZ0 B;  3KUY C;  5B33 C;  3X1V D;  1M18 A;  2NQB B;  2NZD D;  5AV6 B;  3MGS A;  1ID3 A;  5B31 B;  3MGP D;  1P34 B;  1BH8 B;  3W99 A;  5CP6 B;  3NQJ A;  4CSR B;  1AOI B;  1M19 A;  4G91 B;  3AZN D;  5B1L C;  3MNN B;  3REJ D;  3X1U B;  5CPI D;  5B1M D;  4J8V B;  5GT0 D;  3C1B A;  1P3A A;  5AV8 A;  1H3O A;  3A6N A;  5AVC B;  3AZJ D;  1KX3 C;  5F99 A;  1M1A A;  3AZL C;  3LZ1 B;  1ID3 B;  3WAA A;  4JJN D;  3AZF A;  3WTP A;  3NQJ B;  2BYM B;  5DNN A;  5B0Y D;  1P3K D;  3W96 A;  5JA4 A;  5B0Z D;  3WKJ D;  5BS7 C;  1U35 D;  1P3M A;  4J8U D;  4WNN A;  3UTA C;  4DRB A;  3TU4 C;  1F66 A;  3B6G D;  5B2J D;  4EO5 B;  1N1J B;  3AYW A;  3W97 B;  3AZG B;  2RVQ C;  4XZQ A;  2JSS A;  3AZI A;  3B0C W;  1P3P D;  3V9R A;  1B6W A;  3KWQ D;  3REH C;  1M18 D;  5BNV B;  4WU8 A;  2F8N B;  5JRG B;  3MGQ C;  3MGS D;  4Z66 A;  2NQB C;  5AV6 C;  3LJA A;  1P3O A;  5DNN B;  3MGR A;  3W99 D;  4UUZ B;  4ZUX A;  2ARO A;  1P34 C;  4YM6 B;  5CP6 C;  4J8W B;  1M19 D;  1AOI C;  4G91 C;  1HQ3 B;  1F66 B;  3MNN C;  5B40 B;  3R45 B;  2HIO A;  3X1U C;  4KUD A;  3C1B D;  1P3A D;  5AV8 D;  4J8V C;  3A6N D;  5AVC C;  3X1S B;  1P3L B;  1ZLA B;  1Q9C A;  5AVB B;  3W98 B;  1EQZ B;  5DNM D;  3WAA D;  1P3F B;  3LZ1 C;  3KSY A;  3AZF D;  3WTP D;  1P3O B;  1R4V A;  4KGC A;  3VH6 W;  1P3I B;  4H9Q B;  5E5A A;  1BH9 A;  4H9P A;  3W96 D;  3AZM A;  5B24 B;  1P3M D;  3REK B;  4XUJ B;  3LEL B;  4WV4 B;  3AYW D;  4EO5 C;  2BYK B;  4XZQ D;  3W97 C;  4LD9 B;  5GT3 A;  3AZG C;  3AZI D;  3O62 B;  4WU8 D;  4J8X A;  4X23 A;  5JRG C;  4Z66 D;  3AFA A;  3LJA D;  5B2I A;  3MGR D;  4ZUX D;  5GXQ A;  2ARO D;  5GSU B;  4R8P B;  4H9P B;  4YM6 C;  1ULY A;  3REI A;  5CPJ D;  4J8W C;  3UTB A;  3X1V B;  5BNX B;  1HQ3 C;  3KXB A;  2NZD B;  2HIO D;  5B40 C;  3B6F A;  3MGP B;  4KUD D;  2IO5 B;  4CAY A;  5BO0 A;  3X1S C;  3VH5 A;  1P3L C;  4Z5T D;  3AZN B;  1ZLA C;  5AVB C;  3W98 C;  1EQZ C;  4WU9 B;  3AV2 D;  1S32 C;  3REJ B;  4QLC A;  3WA9 A;  1P3F C;  4KGC D;  5CPI B;  5B1M B;  5GT0 B;  1P3I C;  1TZY A;  5E5A D;  4E44 A;  3AZJ B;  4H9R B;  3AZM D;  3VH5 T;  5B24 C;  1KX4 B;  3REK C;  4JJN B;  4XUJ C;  3LEL C;  5AY8 A;  4H9O A;  5GT3 D;  5B0Y B;  1P3K B;  4LD9 C;  2YFW A;  5B0Z B;  3WKJ B;  3O62 C;  1U35 B;  4J8X D;  4X23 D;  1JFI B;  4YS3 A;  3AZK A;  2PYO A;  4J8U B;  5FUG A;  3AFA D;  3C1C A;  3B6G B;  4M6B A;  5B2J B;  5B2I D;  5GXQ D;  5C3I B;  3AZE A;  4ZBJ B;  5GSU C;  4R8P C;  3REI D;  1KX5 A;  1P3P B;  3UTB D;  1KU5 A;  3KWQ B;  1M18 B;  3MVD A;  3AZH A;  1P3B A;  3X1V C;  3KXB D;  5DNM A;  3MGS B;  2NZD C;  3B6F D;  3X1T A;  3MGP C;  5G49 A;  3W99 B;  2CWE A;  4H9S A;  1WWS A;  1M19 B;  5CPK A;  2HUE B;  3AZN C;  5FUG B;  4QLC D;  4WU9 C;  3WA9 D;  3REJ C;  5CPI C;  5B1M C;  3C1B B;  1F1E A;  1TZY D;  5AV8 B;  1P3A B;  5GT0 C;  1H3O B;  3A6N B;  3UT9 A;  3AZJ C;  5F99 B;  4NE3 A;  1M1A B;  3AN2 A;  3WAA B;  3LZ0 C;  1KX4 C;  2FJ7 A;  4JJN C;  3WTP B;  3AZF B;  5AY8 D;  5B31 C;  2YFV A;  5CP6 D;  5B0Y C;  1P3K C;  5JA4 B;  3W96 B;  5B0Z C;  3WKJ C;  5CPJ A;  1P3M B;  1U35 C;  4YS3 D;  3AZK D;  2PYO D;  4WNN B;  4J8U C;  3C1C D;  5AV5 A;  3B6G C;  3AYW B;  5B2J C;  3AZE D;  5C3I C;  5AV9 A;  4XZQ B;  2CV5 A;  4ZBJ C;  3AZI B;  1P3G A;  4NE6 A;  4NE5 A;  1KX5 D;  3AV1 A;  3V9R B;  1P3P C;  3MVD D;  4WU8 B;  3KWQ C;  3AZH D;  1M18 C;  1P3B D;  4Z5T A;  4Z66 B;  3AV2 A;  1ID3 C;  3MGS C;  3LJA B;  3X1T D;  3MGR B;  4AWL B;  4ZUX B;  2ARO B;  3W99 C;  5B32 A;  3REL A;  5CPK D;  1M19 C;  3KUY A;  5B33 A;  2HUE C;  2HIO B;  2L5A A;  4KUD B;  3C1B C;  1P3A C;  5AV8 C;  4H9N A;  3B0D B;  3A6N C;  3UT9 D;  3VH5 W;  1HTA A;  5F99 C;  3AN2 D;  4Z5T B;  1M1A C;  1A7W A;  3AV2 B;  2FJ7 D;  3WAA C;  3AZF C;  3WTP C;  4KGC B;  4YM6 D;  5DNN C;  5E5A B;  1BH9 B;  1WWI A;  3NQU A;  5BT1 D;  3W96 C;  5KDM A;  3AZM B;  1KX3 A;  3AZL A;  3B0B A;  1P3M C;  5AV5 D;  1F66 C;  5AV9 D;  3AYW C;  2CV5 D;  3WTP E;  5GT3 B;  4XZQ C;  1P3G D;  3AV1 D;  3AZI C;  5BS7 A;  4WU8 C;  4J8X B;  4X23 B;  1S32 D;  1TAF A;  3UTA A;  4Z66 C;  3AFA B;  3TU4 A;  5B2I B;  5GXQ B;  3LJA C;  1P3O C;  1P3I D;  3MGR C;  4AWL C;  4ZUX C;  5B32 D;  3REL D;  2ARO C;  3VH6 A;  5KDM B;  3REI B;  3UTB B; 
#chains in the Genus database with same CATH topology
 3REH A;  3KUY D;  5B33 D;  5B32 G;  3MGQ A;  3KXB B;  2NQB A;  3B6F B;  2HIO C;  5AV6 A;  1B67 A;  4KUD C;  1P34 A;  1BH8 A;  4CAY B;  1T3U A;  3VH6 T;  5CP6 A;  3B0D C;  4CSR A;  3H0M C;  5BO0 B;  1AOI A;  5B1L D;  4QLC B;  3WA9 B;  3MNN A;  3X1U A;  4KGC C;  1TZY B;  4J8V A;  1KX3 D;  5E5A C;  5AVC A;  3AZM C;  3AZL D;  3LZ1 A;  5AY8 B;  4H9O B;  4Z2M G;  2IO5 C;  2YFW B;  2BYM A;  5GT3 C;  4NFT A;  2DF4 C;  2DQN C;  4YS3 B;  4WU9 D;  3AZK B;  4J8X C;  4X23 C;  2G5H C;  3UTA D;  2PYO B;  3C1C B;  3TU4 D;  3AFA C;  5B2I C;  3AZE B;  5GXQ C;  1N1J A;  2RVQ D;  3W97 A;  3AZG A;  1KX5 B;  2XD5 A;  3REI C;  2F8N K;  2Y2I A;  3REH D;  2ZY3 A;  3UTB C;  3MVD B;  3AZH B;  3MGQ D;  3LZ0 D;  1P3B B;  5BNV A;  1KX4 D;  2F8N A;  5JRG A;  5DNM B;  3A1K A;  3KXB C;  2NQB D;  5AV6 D;  5B31 D;  3X1T B;  3B6F C;  5G49 B;  1P34 D;  4UUZ A;  4YM6 A;  5B31 G;  4J8W A;  2VQR A;  4G92 B;  5CPK B;  1AOI D;  1HQ3 A;  4Z2M H;  3MNN D;  4QLC C;  3WA9 C;  2RIQ A;  5B40 A;  3X1U D;  3R45 A;  1BFM A;  4J8V D;  1TZY C;  3UT9 B;  5AVC D;  3EPH A;  3X1S A;  3AN2 B;  1P3L A;  1ZLA A;  5AVB A;  3W98 A;  1EQZ A;  1S32 A;  3LZ1 D;  1ID3 D;  2FJ7 B;  1P3F A;  5AY8 C;  2Y2M A;  2YFV B;  1P3I A;  4KHA A;  4H9Q A;  4WJ3 C;  5CPJ B;  3EPJ A;  5B24 A;  4YS3 C;  3REK A;  3AZK C;  2F2A C;  2PYO C;  5AV5 B;  4XUJ A;  3LEL A;  3C1C C;  5AV9 B;  2CV5 B;  3AZE C;  3W97 D;  2BYK A;  3AZG D;  2ZY4 A;  1P3G B;  4LD9 A;  3AV1 B;  1KX5 C;  5F99 D;  3O62 A;  1M1A D;  2G5I C;  3MVD C;  1S32 B;  3AZH C;  4HGA B;  5JRG D;  1P3B C;  2F8N D;  5B1L A;  5DNM C;  2Y2O A;  2LY8 A;  2F8N G;  3X1T C;  5DNN D;  3REL B;  5B32 B;  4KHA B;  5GSU A;  4R8P A;  4UPK A;  4DQY B;  4H9S C;  4J8W D;  3KUY B;  5B33 B;  5CPK C;  4G92 C;  3B0C T;  1HQ3 D;  3X1V A;  5BNX A;  1F66 D;  5B40 D;  2NZD A;  2ZY5 A;  2XD1 A;  3MGP A;  4E45 A;  4H9N B;  3UT9 C;  3X1S D;  1P3L D;  1ZLA D;  5AVB D;  3AN2 C;  5B1L B;  1EQZ D;  3W98 D;  3AZN A;  4WU9 A;  1P3F D;  2FJ7 C;  3REJ A;  4WZS B;  1P3O D;  5CPI A;  5B1M A;  5GT0 A;  3NQU B;  3F6T A;  1KX3 B;  3AZJ A;  5BT1 C;  4H9R A;  5CPJ C;  5B24 D;  3AZL B;  2F8N H;  3REK D;  3LZ0 A;  1KX4 A;  4XUJ D;  3LEL D;  5AV5 C;  4JJN A;  5B31 A;  5AV9 C;  2CV5 C;  4LD9 D;  5B0Y A;  1P3G C;  1P3K A;  3AV1 C;  3O62 D;  5B0Z A;  3WKJ A;  1U35 A;  1TAF B;  3UTA B;  4HGA C;  4Z5T C;  4DRA A;  1JFI A;  4J8U A;  3TU4 B;  3AV2 C;  3B6G A;  5B2J A;  5GSU D;  4R8P D;  3REL C;  5B32 C;  3REH B;  1P3P A;  3KWQ A;  5CHL B;  3MGQ B;  3LZ0 B;  3KUY C;  5B33 C;  3X1V D;  1M18 A;  2NQB B;  2NZD D;  5AV6 B;  3MGS A;  1ID3 A;  5B31 B;  3MGP D;  1P34 B;  1BH8 B;  3W99 A;  5CP6 B;  3NQJ A;  4CSR B;  3H0L C;  2Y2J A;  1AOI B;  1M19 A;  4G91 B;  3AZN D;  5B1L C;  3MNN B;  3REJ D;  3X1U B;  5CPI D;  5B1M D;  4J8V B;  5GT0 D;  3C1B A;  1P3A A;  5AV8 A;  1H3O A;  3A6N A;  5AVC B;  3AZJ D;  1KX3 C;  5F99 A;  1M1A A;  3AZL C;  2ZY2 A;  3LZ1 B;  1ID3 B;  3WAA A;  4JJN D;  3AZF A;  3WTP A;  3NQJ B;  2BYM B;  5DNN A;  5B0Y D;  1P3K D;  3W96 A;  5JA4 A;  5B0Z D;  3WKJ D;  5BS7 C;  2Y2L A;  1U35 D;  1P3M A;  4J8U D;  4WNN A;  3UTA C;  4DRB A;  3TU4 C;  1F66 A;  2BG1 A;  3B6G D;  5B2J D;  2W8S A;  4EO5 B;  1N1J B;  3AYW A;  3W97 B;  3AZG B;  2RVQ C;  4XZQ A;  2JSS A;  3AZI A;  3B0C W;  1P3P D;  2Y2Q A;  3V9R A;  1B6W A;  3KWQ D;  3REH C;  1M18 D;  5BNV B;  4WU8 A;  2F8N B;  5JRG B;  3MGQ C;  3AL0 C;  3A1I A;  3MGS D;  4Z66 A;  2NQB C;  5AV6 C;  3LJA A;  1P3O A;  5DNN B;  2Y2P A;  3MGR A;  3W99 D;  4UUZ B;  4ZUX A;  2ARO A;  1P34 C;  4YM6 B;  5CP6 C;  4J8W B;  1M19 D;  1AOI C;  4G91 C;  1HQ3 B;  1F66 B;  3MNN C;  5B40 B;  3R45 B;  2HIO A;  3X1U C;  4KUD A;  3C1B D;  2Y2G A;  1P3A D;  5AV8 D;  4J8V C;  3KFU G;  3A6N D;  5AVC C;  3X1S B;  1P3L B;  1ZLA B;  1Q9C A;  5AVB B;  3W98 B;  1EQZ B;  5DNM D;  3WAA D;  1P3F B;  3LZ1 C;  3KSY A;  3AZF D;  3WTP D;  1P3O B;  1R4V A;  4KGC A;  3VH6 W;  1P3I B;  4H9Q B;  5E5A A;  1BH9 A;  4H9P A;  3W96 D;  3AZM A;  5B24 B;  1P3M D;  3REK B;  4XUJ B;  3LEL B;  4WV4 B;  3AYW D;  4EO5 C;  2BYK B;  4XZQ D;  3W97 C;  4LD9 B;  5GT3 A;  3AZG C;  3AZI D;  3O62 B;  4WU8 D;  4J8X A;  4X23 A;  5JRG C;  4Z66 D;  3AFA A;  3LJA D;  5B2I A;  3MGR D;  4ZUX D;  5GXQ A;  2ARO D;  5GSU B;  4R8P B;  4H9P B;  4YM6 C;  1ULY A;  3REI A;  5CPJ D;  4J8W C;  3UTB A;  3X1V B;  5BNX B;  1HQ3 C;  3KXB A;  2Y2N A;  3H0R C;  2NZD B;  2HIO D;  5B40 C;  3B6F A;  3MGP B;  4KUD D;  2IO5 B;  4CAY A;  5BO0 A;  3X1S C;  3VH5 A;  1P3L C;  4Z5T D;  3AZN B;  1ZLA C;  5AVB C;  3W98 C;  1EQZ C;  4WU9 B;  3AV2 D;  1S32 C;  3REJ B;  4QLC A;  3WA9 A;  1P3F C;  4KGC D;  5CPI B;  5B1M B;  5GT0 B;  1P3I C;  1TZY A;  5E5A D;  4E44 A;  3AZJ B;  4H9R B;  3AZM D;  3VH5 T;  3EPL A;  5B24 C;  1KX4 B;  3FDD A;  3REK C;  4JJN B;  4XUJ C;  3LEL C;  5AY8 A;  2J8P A;  4H9O A;  5GT3 D;  5B0Y B;  1P3K B;  4LD9 C;  2YFW A;  5B0Z B;  3WKJ B;  3O62 C;  1U35 B;  3EG5 B;  4J8X D;  4X23 D;  1JFI B;  4YS3 A;  3AZK A;  2PYO A;  4J8U B;  1W2E A;  3IP4 C;  5FUG A;  3AFA D;  3C1C A;  3B6G B;  4M6B A;  5B2J B;  5B2I D;  5GXQ D;  5C3I B;  3AZE A;  4ZBJ B;  5GSU C;  4R8P C;  3REI D;  1KX5 A;  1P3P B;  3UTB D;  1KU5 A;  3KWQ B;  1M18 B;  3MVD A;  3AZH A;  1P3B A;  3X1V C;  3KXB D;  5DNM A;  3MGS B;  2NZD C;  3B6F D;  3X1T A;  3MGP C;  5G49 A;  3W99 B;  2CWE A;  4H9S A;  1WWS A;  1M19 B;  5CPK A;  2HUE B;  3AZN C;  5FUG B;  4QLC D;  4WU9 C;  3WA9 D;  3REJ C;  2JE5 A;  5CPI C;  5B1M C;  3C1B B;  1F1E A;  1TZY D;  5AV8 B;  1P3A B;  5GT0 C;  1H3O B;  3A6N B;  3P5J B;  3UT9 A;  3AZJ C;  5F99 B;  4NE3 A;  1M1A B;  3AN2 A;  3WAA B;  3LZ0 C;  1KX4 C;  2FJ7 A;  4JJN C;  3WTP B;  3AZF B;  5AY8 D;  5B31 C;  2YFV A;  2Y2K A;  5CP6 D;  5B0Y C;  1P3K C;  5JA4 B;  3W96 B;  5B0Z C;  3WKJ C;  5CPJ A;  1P3M B;  1U35 C;  4YS3 D;  3AZK D;  2PYO D;  4WNN B;  4J8U C;  3C1C D;  5AV5 A;  3B6G C;  3AYW B;  5B2J C;  3AZE D;  5C3I C;  5AV9 A;  4XZQ B;  2CV5 A;  4ZBJ C;  3AZI B;  1P3G A;  4NE6 A;  4NE5 A;  1KX5 D;  3AV1 A;  3V9R B;  1P3P C;  3MVD D;  4WU8 B;  3KWQ C;  3AZH D;  1M18 C;  1P3B D;  4Z5T A;  4Z66 B;  3AV2 A;  1ID3 C;  3MGS C;  3LJA B;  3X1T D;  3MGR B;  4AWL B;  4ZUX B;  2ARO B;  3W99 C;  5B32 A;  3REL A;  2FFF B;  5CPK D;  1M19 C;  3KUY A;  5B33 A;  2HUE C;  2HIO B;  2L5A A;  4KUD B;  1PZR A;  3C1B C;  1P3A C;  2Y2H A;  4H9N A;  3B0D B;  5AV8 C;  3A6N C;  3UT9 D;  3VH5 W;  1HTA A;  5F99 C;  3AN2 D;  2UWX A;  4Z5T B;  1M1A C;  1Z2C B;  1A7W A;  2JCH A;  3AV2 B;  2FJ7 D;  3WAA C;  3AZF C;  3WTP C;  3EPK A;  4KGC B;  4YM6 D;  5DNN C;  5E5A B;  1BH9 B;  1WWI A;  3NQU A;  5BT1 D;  3W96 C;  5KDM A;  3AZM B;  1KX3 A;  3AZL A;  3B0B A;  1P3M C;  5AV5 D;  2ZM5 A;  1F66 C;  5AV9 D;  3AYW C;  2CV5 D;  3WTP E;  5GT3 B;  4XZQ C;  1P3G D;  3AV1 D;  3AZI C;  5BS7 A;  4WU8 C;  4J8X B;  4X23 B;  1S32 D;  1TAF A;  3UTA A;  4Z66 C;  3AFA B;  3TU4 A;  5B2I B;  5GXQ B;  3LJA C;  1P3O C;  1P3I D;  3MGR C;  4AWL C;  4ZUX C;  5B32 D;  3REL D;  2ARO C;  3VH6 A;  5KDM B;  3REI B;  3UTB B; 
#chains in the Genus database with same CATH homology
 3REH A;  3KUY D;  5B33 D;  5B32 G;  3MGQ A;  3KXB B;  2NQB A;  3B6F B;  2HIO C;  5AV6 A;  1B67 A;  4KUD C;  1P34 A;  1BH8 A;  4CAY B;  1T3U A;  3VH6 T;  5CP6 A;  3B0D C;  4CSR A;  3H0M C;  5BO0 B;  1AOI A;  5B1L D;  4QLC B;  3WA9 B;  3MNN A;  3X1U A;  4KGC C;  1TZY B;  4J8V A;  1KX3 D;  5E5A C;  5AVC A;  3AZM C;  3AZL D;  3LZ1 A;  5AY8 B;  4H9O B;  4Z2M G;  2IO5 C;  2YFW B;  2BYM A;  5GT3 C;  4NFT A;  2DF4 C;  2DQN C;  4YS3 B;  4WU9 D;  3AZK B;  4J8X C;  4X23 C;  2G5H C;  3UTA D;  2PYO B;  3C1C B;  3TU4 D;  3AFA C;  5B2I C;  3AZE B;  5GXQ C;  1N1J A;  2RVQ D;  3W97 A;  3AZG A;  1KX5 B;  2XD5 A;  3REI C;  2F8N K;  2Y2I A;  3REH D;  2ZY3 A;  3UTB C;  3MVD B;  3AZH B;  3MGQ D;  3LZ0 D;  1P3B B;  5BNV A;  1KX4 D;  2F8N A;  5JRG A;  5DNM B;  3A1K A;  3KXB C;  2NQB D;  5AV6 D;  5B31 D;  3X1T B;  3B6F C;  5G49 B;  1P34 D;  4UUZ A;  4YM6 A;  5B31 G;  4J8W A;  2VQR A;  4G92 B;  5CPK B;  1AOI D;  1HQ3 A;  4Z2M H;  3MNN D;  4QLC C;  3WA9 C;  2RIQ A;  5B40 A;  3X1U D;  3R45 A;  1BFM A;  4J8V D;  1TZY C;  3UT9 B;  5AVC D;  3EPH A;  3X1S A;  3AN2 B;  1P3L A;  1ZLA A;  5AVB A;  3W98 A;  1EQZ A;  1S32 A;  3LZ1 D;  1ID3 D;  2FJ7 B;  1P3F A;  5AY8 C;  2Y2M A;  2YFV B;  1P3I A;  4KHA A;  4H9Q A;  4WJ3 C;  5CPJ B;  3EPJ A;  5B24 A;  4YS3 C;  3REK A;  3AZK C;  2F2A C;  2PYO C;  5AV5 B;  4XUJ A;  3LEL A;  3C1C C;  5AV9 B;  2CV5 B;  3AZE C;  3W97 D;  2BYK A;  3AZG D;  2ZY4 A;  1P3G B;  4LD9 A;  3AV1 B;  1KX5 C;  5F99 D;  3O62 A;  1M1A D;  2G5I C;  3MVD C;  1S32 B;  3AZH C;  4HGA B;  5JRG D;  1P3B C;  2F8N D;  5B1L A;  5DNM C;  2Y2O A;  2LY8 A;  2F8N G;  3X1T C;  5DNN D;  3REL B;  5B32 B;  4KHA B;  5GSU A;  4R8P A;  4UPK A;  4DQY B;  4H9S C;  4J8W D;  3KUY B;  5B33 B;  5CPK C;  4G92 C;  3B0C T;  1HQ3 D;  3X1V A;  5BNX A;  1F66 D;  5B40 D;  2NZD A;  2ZY5 A;  2XD1 A;  3MGP A;  4E45 A;  4H9N B;  3UT9 C;  3X1S D;  1P3L D;  1ZLA D;  5AVB D;  3AN2 C;  5B1L B;  1EQZ D;  3W98 D;  3AZN A;  4WU9 A;  1P3F D;  2FJ7 C;  3REJ A;  4WZS B;  1P3O D;  5CPI A;  5B1M A;  5GT0 A;  3NQU B;  3F6T A;  1KX3 B;  3AZJ A;  5BT1 C;  4H9R A;  5CPJ C;  5B24 D;  3AZL B;  2F8N H;  3REK D;  3LZ0 A;  1KX4 A;  4XUJ D;  3LEL D;  5AV5 C;  4JJN A;  5B31 A;  5AV9 C;  2CV5 C;  4LD9 D;  5B0Y A;  1P3G C;  1P3K A;  3AV1 C;  3O62 D;  5B0Z A;  3WKJ A;  1U35 A;  1TAF B;  3UTA B;  4HGA C;  4Z5T C;  4DRA A;  1JFI A;  4J8U A;  3TU4 B;  3AV2 C;  3B6G A;  5B2J A;  5GSU D;  4R8P D;  3REL C;  5B32 C;  3REH B;  1P3P A;  3KWQ A;  5CHL B;  3MGQ B;  3LZ0 B;  3KUY C;  5B33 C;  3X1V D;  1M18 A;  2NQB B;  2NZD D;  5AV6 B;  3MGS A;  1ID3 A;  5B31 B;  3MGP D;  1P34 B;  1BH8 B;  3W99 A;  5CP6 B;  3NQJ A;  4CSR B;  3H0L C;  2Y2J A;  1AOI B;  1M19 A;  4G91 B;  3AZN D;  5B1L C;  3MNN B;  3REJ D;  3X1U B;  5CPI D;  5B1M D;  4J8V B;  5GT0 D;  3C1B A;  1P3A A;  5AV8 A;  1H3O A;  3A6N A;  5AVC B;  3AZJ D;  1KX3 C;  5F99 A;  1M1A A;  3AZL C;  2ZY2 A;  3LZ1 B;  1ID3 B;  3WAA A;  4JJN D;  3AZF A;  3WTP A;  3NQJ B;  2BYM B;  5DNN A;  5B0Y D;  1P3K D;  3W96 A;  5JA4 A;  5B0Z D;  3WKJ D;  5BS7 C;  2Y2L A;  1U35 D;  1P3M A;  4J8U D;  4WNN A;  3UTA C;  4DRB A;  3TU4 C;  1F66 A;  2BG1 A;  3B6G D;  5B2J D;  2W8S A;  4EO5 B;  1N1J B;  3AYW A;  3W97 B;  3AZG B;  2RVQ C;  4XZQ A;  2JSS A;  3AZI A;  3B0C W;  1P3P D;  2Y2Q A;  3V9R A;  1B6W A;  3KWQ D;  3REH C;  1M18 D;  5BNV B;  4WU8 A;  2F8N B;  5JRG B;  3MGQ C;  3AL0 C;  3A1I A;  3MGS D;  4Z66 A;  2NQB C;  5AV6 C;  3LJA A;  1P3O A;  5DNN B;  2Y2P A;  3MGR A;  3W99 D;  4UUZ B;  4ZUX A;  2ARO A;  1P34 C;  4YM6 B;  5CP6 C;  4J8W B;  1M19 D;  1AOI C;  4G91 C;  1HQ3 B;  1F66 B;  3MNN C;  5B40 B;  3R45 B;  2HIO A;  3X1U C;  4KUD A;  3C1B D;  2Y2G A;  1P3A D;  5AV8 D;  4J8V C;  3KFU G;  3A6N D;  5AVC C;  3X1S B;  1P3L B;  1ZLA B;  1Q9C A;  5AVB B;  3W98 B;  1EQZ B;  5DNM D;  3WAA D;  1P3F B;  3LZ1 C;  3KSY A;  3AZF D;  3WTP D;  1P3O B;  1R4V A;  4KGC A;  3VH6 W;  1P3I B;  4H9Q B;  5E5A A;  1BH9 A;  4H9P A;  3W96 D;  3AZM A;  5B24 B;  1P3M D;  3REK B;  4XUJ B;  3LEL B;  4WV4 B;  3AYW D;  4EO5 C;  2BYK B;  4XZQ D;  3W97 C;  4LD9 B;  5GT3 A;  3AZG C;  3AZI D;  3O62 B;  4WU8 D;  4J8X A;  4X23 A;  5JRG C;  4Z66 D;  3AFA A;  3LJA D;  5B2I A;  3MGR D;  4ZUX D;  5GXQ A;  2ARO D;  5GSU B;  4R8P B;  4H9P B;  4YM6 C;  1ULY A;  3REI A;  5CPJ D;  4J8W C;  3UTB A;  3X1V B;  5BNX B;  1HQ3 C;  3KXB A;  2Y2N A;  3H0R C;  2NZD B;  2HIO D;  5B40 C;  3B6F A;  3MGP B;  4KUD D;  2IO5 B;  4CAY A;  5BO0 A;  3X1S C;  3VH5 A;  1P3L C;  4Z5T D;  3AZN B;  1ZLA C;  5AVB C;  3W98 C;  1EQZ C;  4WU9 B;  3AV2 D;  1S32 C;  3REJ B;  4QLC A;  3WA9 A;  1P3F C;  4KGC D;  5CPI B;  5B1M B;  5GT0 B;  1P3I C;  1TZY A;  5E5A D;  4E44 A;  3AZJ B;  4H9R B;  3AZM D;  3VH5 T;  3EPL A;  5B24 C;  1KX4 B;  3FDD A;  3REK C;  4JJN B;  4XUJ C;  3LEL C;  5AY8 A;  2J8P A;  4H9O A;  5GT3 D;  5B0Y B;  1P3K B;  4LD9 C;  2YFW A;  5B0Z B;  3WKJ B;  3O62 C;  1U35 B;  3EG5 B;  4J8X D;  4X23 D;  1JFI B;  4YS3 A;  3AZK A;  2PYO A;  4J8U B;  1W2E A;  3IP4 C;  5FUG A;  3AFA D;  3C1C A;  3B6G B;  4M6B A;  5B2J B;  5B2I D;  5GXQ D;  5C3I B;  3AZE A;  4ZBJ B;  5GSU C;  4R8P C;  3REI D;  1KX5 A;  1P3P B;  3UTB D;  1KU5 A;  3KWQ B;  1M18 B;  3MVD A;  3AZH A;  1P3B A;  3X1V C;  3KXB D;  5DNM A;  3MGS B;  2NZD C;  3B6F D;  3X1T A;  3MGP C;  5G49 A;  3W99 B;  2CWE A;  4H9S A;  1WWS A;  1M19 B;  5CPK A;  2HUE B;  3AZN C;  5FUG B;  4QLC D;  4WU9 C;  3WA9 D;  3REJ C;  2JE5 A;  5CPI C;  5B1M C;  3C1B B;  1F1E A;  1TZY D;  5AV8 B;  1P3A B;  5GT0 C;  1H3O B;  3A6N B;  3P5J B;  3UT9 A;  3AZJ C;  5F99 B;  4NE3 A;  1M1A B;  3AN2 A;  3WAA B;  3LZ0 C;  1KX4 C;  2FJ7 A;  4JJN C;  3WTP B;  3AZF B;  5AY8 D;  5B31 C;  2YFV A;  2Y2K A;  5CP6 D;  5B0Y C;  1P3K C;  5JA4 B;  3W96 B;  5B0Z C;  3WKJ C;  5CPJ A;  1P3M B;  1U35 C;  4YS3 D;  3AZK D;  2PYO D;  4WNN B;  4J8U C;  3C1C D;  5AV5 A;  3B6G C;  3AYW B;  5B2J C;  3AZE D;  5C3I C;  5AV9 A;  4XZQ B;  2CV5 A;  4ZBJ C;  3AZI B;  1P3G A;  4NE6 A;  4NE5 A;  1KX5 D;  3AV1 A;  3V9R B;  1P3P C;  3MVD D;  4WU8 B;  3KWQ C;  3AZH D;  1M18 C;  1P3B D;  4Z5T A;  4Z66 B;  3AV2 A;  1ID3 C;  3MGS C;  3LJA B;  3X1T D;  3MGR B;  4AWL B;  4ZUX B;  2ARO B;  3W99 C;  5B32 A;  3REL A;  2FFF B;  5CPK D;  1M19 C;  3KUY A;  5B33 A;  2HUE C;  2HIO B;  2L5A A;  4KUD B;  1PZR A;  3C1B C;  1P3A C;  2Y2H A;  4H9N A;  3B0D B;  5AV8 C;  3A6N C;  3UT9 D;  3VH5 W;  1HTA A;  5F99 C;  3AN2 D;  2UWX A;  4Z5T B;  1M1A C;  1Z2C B;  1A7W A;  2JCH A;  3AV2 B;  2FJ7 D;  3WAA C;  3AZF C;  3WTP C;  3EPK A;  4KGC B;  4YM6 D;  5DNN C;  5E5A B;  1BH9 B;  1WWI A;  3NQU A;  5BT1 D;  3W96 C;  5KDM A;  3AZM B;  1KX3 A;  3AZL A;  3B0B A;  1P3M C;  5AV5 D;  2ZM5 A;  1F66 C;  5AV9 D;  3AYW C;  2CV5 D;  3WTP E;  5GT3 B;  4XZQ C;  1P3G D;  3AV1 D;  3AZI C;  5BS7 A;  4WU8 C;  4J8X B;  4X23 B;  1S32 D;  1TAF A;  3UTA A;  4Z66 C;  3AFA B;  3TU4 A;  5B2I B;  5GXQ B;  3LJA C;  1P3O C;  1P3I D;  3MGR C;  4AWL C;  4ZUX C;  5B32 D;  3REL D;  2ARO C;  3VH6 A;  5KDM B;  3REI B;  3UTB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...