5AV5C

Human nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av5C00
4QLCB 1S32C 1AOIB 2F8NK 3KWQB 4J8VD 1BFMA 3AYWC 1P3OC 3UTBA 3WTPE 1ID3C 3W99A 3REKA 5GT0A 3LELA 4E44A 5B33C 5CPIB 3WTPB 2CV5C 2HUEB 2YFVB 1HQ3C 3AZHD 4H9NA 5CP6B 1KX3A 3AN2A 1P3GD 3NQJB 4KUDA 3AZHC 4XZQC 5AVBA 3LZ0C 3X1TA 2CV5B 4WU8B 5CPKA 1U35A 3UT9A 5GXQB 3AN2D 1P3GA 3AZEC 5DNMC 5B2JB 4YS3D 3AZIB 5CPKD 1U35D 4UUZB 2YFWB 3X1TD 4WU9C 4EO5B 3X1UC 3WAAA 5AV8B 4G91C 3W98D 5B40D 1P3OD 4J8UA 3KWQA 3WA9B 4J8UB 5B2JC 4J8XD 4JJNA 3LZ1C 3RELA 5B2IA 3LJAB 4Z5TC 3WAAC 4KGCB 5B32B 5B24B 5AV9D 1P3LA 3W97D 4G92B 5GT0D 3AYWA 3W99B 4H9QB 4J8WA 3X1SC 1TAFA 2L5AA 5CP6C 1P3ID 5AV8A 3MGRD 4E45A 4Z5TB 3O62A 1EQZC 5C3IB 5DNND 3AZJD 5DNMD 5GT3C 3AFAC 1P3IA 1P3BB 5GSUA 4XUJA 3AZHA 3AYWB 2AROC 3AZID 5AVBC 3LZ0A 4X23D 3TU4B 5B40C 3AZEA 1P3PC 4Z66C 3X1VB 2CV5D 5B1LC 3X1UA 1P3PA 1ID3A 3NQUB 5AV6B 5B1LD 1BH9A 5BNXB 5F99D 4M6BA 3AZED 5AY8A 3AZNB 2PYOD 3KXBA 5AV5C 3LELD 3MVDB 5B1MC 2RVQD 3MGQD 1ZLAC 1P3PD 3WKJD 5B2ID 3UT9D 1KX4C 4R8PD 3KWQD 3WKJC 3WA9C 1AOID 5CP6A 4KUDD 3NQUA 3VH6W 5AV8C 1F66D 1P3BA 4NFTA 5F99C 4WNNA 4NE3A 5GT0B 3AYWD 4KGCA 3AZLA 5B31C 3TU4A 1F66A 5E5AB 3REJC 3KUYA 3B6FB 2NZDD 5AV9C 1P34A 1S32B 1S32A 4ZBJC 1TAFB 5CHLB 3REHB 4H9SA 3AZLC 5B40A 1ID3B 3MGRB 3REJA 3AZMB 1WWIA 3AZMA 1P34D 3AZFC 3AZGB 1TZYD 3MGQC 4NE6A 4YS3B 3VH5W 5CPKC 1U35C 5GT3D 5AY8B 5BNVA 2FJ7A 1Q9CA 2AROB 5CPJA 2F8NG 4UUZA 3LJAC 5JA4B 3REIC 1KX3B 1M19B 4J8XB 3B6GC 1F1EA 5BT1D 1P3KA 1AOIA 3MGPD 1P3FC 3W99C 2BYMA 1P3MB 3A6NC 3KXBB 4WU9B 5AVCC 5GXQA 3MVDD 3WKJA 5GT0C 4ZUXA 1BH9B 4XUJB 4J8WD 3A6NA 5BO0A 4H9QA 4J8WB 3WTPC 5B31D 4H9NB 3MVDA 4KGCC 2F8NH 4R8PB 3AZGD 3MGRA 5FUGB 1KX5A 4Z5TA 4QLCD 3MNNC 3KUYC 5AVBB 3AN2C 5G49B 4AWLC 1M18A 5BS7C 3NQJA 5B0YC 5CPID 3UT9C 3B6FD 2NQBD 3AZIA 5AV6C 3UTAD 4HGAB 3AZKB 1HQ3D 4AWLB 3REHA 2NQBC 4H9OA 5FUGA 3C1BB 1KX5B 4H9OB 3C1BA 3B6FA 5KDMB 3C1CA 3X1VD 1P34B 2BYMB 1P3MA 4DRAA 1P3BC 3REKC 5GSUC 3REIA 3LJAA 4LD9B 4J8XA 2PYOC 5B32A 3VH5T 4HGAC 3C1CC 3MGSA 3W96B 5CPJB 5B2IB 2BYKA 4KGCD 5GXQC 5CPJD 4LD9C 3LELB 5DNNB 4J8WC 3AV2A 2F8NB 5E5AA 3WA9D 3MGSC 3UTBD 1P3OB 3O62C 1EQZA 1P3KD 2LY8A 5B0ZA 1P3AC 5B0ZB 3AFAD 3W98A 3REIB 5AVCD 3MVDC 1P3GC 3AV2C 2JSSA 1M1AC 3WA9A 3AZNA 3MNNA 3B6GD 5BT1C 5AV9B 3AV1C 5B24C 3MGPC 3VH6A 3WKJB 4XUJD 1M18C 3X1SD 3AV1D 3UTAA 5B2JA 5B1LA 1M18D 5BO0B 4QLCC 3LZ1A 4ZUXD 1P3KC 1R4VA 3VH5A 1P34C 5B33B 1BH8B 5BNXA 5B2JD 3MNNB 2RVQC 2AROD 3AZGA 5AY8D 4CSRB 5GT3B 2IO5C 3KXBC 2FJ7D 3X1UD 4Z2MH 3MGSB 1P3FB 3RELD 3W97B 1KX5C 1P3MD 5B33A 3AFAA 4YM6C 4R8PA 3LJAD 1M19D 4CAYB 1ULYA 4WV4B 4CAYA 4Z2MG 4XZQD 1KX4D 4Z66D 3AV1B 2IO5B 1AOIC 3AV2D 3W98B 1KX3C 2NZDB 5JRGD 5CPJC 3W96D 5AV5B 4J8VB 3AZLD 5JRGC 4G91B 3O62D 5AV5D 5B0YB 1P3MC 5B0ZD 3AFAB 5DNNC 1F66B 1P3KB 1TZYA 4KUDB 4G92C 3C1CD 3X1VA 5AVCA 4WZSB 3B0DC 4J8VC 5B32C 4WNNB 2CWEA 3MGRC 1A7WA 4X23A 3AZKC 2NZDA 1P3GB 5E5AD 3AZFA 4WU8C 3R45B 3WTPA 5GSUB 2CV5A 3A6ND 2YFWA 3AZKA 3AZJA 1HQ3A 1M19C 3AZIC 5AV6D 3AN2B 5AVBD 1H3OB 5C3IC 1P3AA 5F99A 1P3FA 2YFVA 2HUEC 4DRBA 1KX5D 3LZ1B 4JJNB 4YM6B 4XZQA 4NE5A 5G49A 4YM6D 3UT9B 3AZJC 4JJND 5B32G 5B31A 1P3PB 5AV6A 3AZHB 1N1JB 2HIOC 3UTBB 5AV9A 1P3LD 2NQBA 4CSRA 5GT3A 4H9SC 4YS3A 5JA4A 3AZEB 3MGPB 5F99B 2HIOA 2AROA 3B0DB 4H9RA 4J8XC 1EQZB 1WWSA 2PYOA 3B6GB 1KU5A 5E5AC 3B0BA 4WU9A 5B0YA 5BS7A 1B6WA 4Z5TD 5B31B 3REID 1P3IB 4ZBJB 4J8UC 4H9PA 3O62B 2HIOD 3W96A 5B1MB 3A6NB 1P3LC 1ZLAB 3C1BD 3W99D 3REHC 3AZLB 2NZDC 3X1SA 5JRGB 1JFIB 5B0ZC 3C1BC 1P3BD 3AZMD 5DNMA 5DNMB 4R8PC 3UTAC 1HTAA 1M1AA 1KX3D 4QLCA 1M19A 3W97C 3REJB 3RELB 4KHAA 1P3AD 4LD9A 3MGSD 3UTBC 1HQ3B 5B2IC 3UTAB 3AZKD 3B0CT 1N1JA 5B32D 4WU8D 4H9RB 3LELC 5GXQD 3W98C 4Z66B 3X1VC 4XZQB 4YS3C 5B40B 4JJNC 3TU4C 1KX4B 3REKD 5B33D 4J8UD 4WU9D 4X23C 5KDMA 3AV1A 3V9RB 3X1TB 4WU8A 5CPKB 1U35B 4KUDC 3REKB 3X1UB 1M18B 1P3FD 3WTPD 5CPIC 1P3LB 5B24A 5BNVB 2FJ7B 3B0CW 3MGPA 3B6FC 3W96C 2BYKB 3MNND 5CPIA 1EQZD 1H3OA 1P3AB 5AVCB 3KXBD 2FJ7C 5CP6D 1P3OA 1M1AB 1TZYC 3AZGC 1ID3D 4ZUXB 3KUYD 3AZFB 3REHD 3R45A 5B31G 3RELC 3X1SB 5JRGA 1JFIA 1S32D 5B1LB 5AY8C 4Z66A 3AZJB 4ZUXC 1TZYB 3LZ1D 2F8NA 3C1CB 3AZNC 3X1TC 3V9RA 3WAAD 3REJD 4YM6A 3TU4D 3AZMC 4X23B 4KHAB 3WAAB 1KX4A 1BH8A 5AV5A 2F8ND 5GSUD 4H9PB 3LZ0B 5B1MA 5B24D 1ZLAA 2NQBB 1B67A 1P3IC 3LZ0D 4XUJC 3MGQB 3VH6T 3MGQA 5DNNA 3AV2B 3KWQC 4J8VA 3KUYB 3AZFD 2HIOB 5B1MD 3AZND 1ZLAD 3KSYA 1M1AD 2PYOB 5AV8D 3W97A 1F66C 3B6GA 4LD9D 5B0YD 4EO5C
chains in the Genus database with same CATH superfamily
4QLCB 1S32C 1AOIB 2F8NK 3KWQB 3EPLA 3H0RC 4J8VD 1BFMA 3AYWC 1P3OC 2G5IC 3UTBA 3WTPE 1ID3C 3W99A 3REKA 5GT0A 3LELA 4E44A 5B33C 5CPIB 3WTPB 2CV5C 2HUEB 2YFVB 3EG5B 1HQ3C 3AZHD 4H9NA 5CP6B 1KX3A 3AN2A 1P3GD 3NQJB 4KUDA 3AZHC 4XZQC 5AVBA 3LZ0C 3X1TA 2CV5B 4WU8B 5CPKA 1U35A 3UT9A 5GXQB 2FFFB 3AN2D 1P3GA 3AZEC 5DNMC 5B2JB 4YS3D 3AZIB 5CPKD 1U35D 4UUZB 2YFWB 3H0MC 3X1TD 4WU9C 4EO5B 3X1UC 3WAAA 5AV8B 4G91C 3W98D 5B40D 1P3OD 4J8UA 3KWQA 3WA9B 4J8UB 5B2JC 4J8XD 4JJNA 3LZ1C 3RELA 5B2IA 3LJAB 4Z5TC 3WAAC 4KGCB 5B32B 5B24B 5AV9D 1P3LA 3W97D 3P5JB 4G92B 5GT0D 3AYWA 3W99B 4H9QB 4J8WA 3X1SC 1TAFA 2L5AA 5CP6C 3EPHA 1P3ID 5AV8A 3MGRD 4E45A 4Z5TB 3O62A 1EQZC 5C3IB 5DNND 3AZJD 5DNMD 5GT3C 3AFAC 1P3IA 1P3BB 5GSUA 4XUJA 3AZHA 2Y2KA 3AYWB 2AROC 3AZID 5AVBC 3LZ0A 4X23D 3TU4B 5B40C 3AZEA 1P3PC 4Z66C 3X1VB 2CV5D 2DQNC 5B1LC 3EPJA 3X1UA 1P3PA 1ID3A 3NQUB 5AV6B 2VQRA 5B1LD 1BH9A 5BNXB 5F99D 4M6BA 2F2AC 3AZED 5AY8A 3AZNB 2PYOD 3KXBA 5AV5C 3LELD 3MVDB 5B1MC 2RVQD 3MGQD 1ZLAC 1P3PD 3WKJD 5B2ID 3UT9D 1KX4C 4R8PD 3KWQD 3WKJC 3WA9C 1AOID 5CP6A 4KUDD 2JE5A 3NQUA 3VH6W 5AV8C 1F66D 1P3BA 4NFTA 5F99C 4WNNA 4NE3A 5GT0B 3AYWD 4KGCA 3AZLA 5B31C 3TU4A 1F66A 5E5AB 3REJC 3KUYA 3B6FB 2NZDD 5AV9C 1P34A 1S32B 1S32A 4ZBJC 1TAFB 5CHLB 3REHB 4H9SA 3AZLC 5B40A 1ID3B 3MGRB 3REJA 3AZMB 2ZY3A 1WWIA 3AZMA 1P34D 3AZFC 3AZGB 1TZYD 3MGQC 4NE6A 4YS3B 3VH5W 5CPKC 1U35C 5GT3D 5AY8B 5BNVA 1W2EA 2FJ7A 1Q9CA 2AROB 5CPJA 2F8NG 4UUZA 3LJAC 5JA4B 3REIC 1KX3B 1M19B 4J8XB 3B6GC 2Y2JA 1F1EA 5BT1D 1P3KA 1AOIA 3MGPD 1P3FC 3W99C 2BYMA 1P3MB 3A6NC 3KXBB 4WU9B 3FDDA 5AVCC 5GXQA 3MVDD 3WKJA 5GT0C 4ZUXA 1BH9B 4XUJB 4J8WD 3A6NA 5BO0A 4H9QA 4J8WB 3WTPC 5B31D 4H9NB 3MVDA 4KGCC 2F8NH 4R8PB 3AZGD 3MGRA 2ZY2A 5FUGB 4Z5TA 1KX5A 4QLCD 3MNNC 3KUYC 5AVBB 3AN2C 5G49B 4AWLC 1M18A 5BS7C 3NQJA 5B0YC 5CPID 2Y2NA 3UT9C 3B6FD 2NQBD 3AZIA 5AV6C 2RIQA 3UTAD 4HGAB 3AZKB 1HQ3D 4AWLB 3REHA 2NQBC 4H9OA 5FUGA 3C1BB 1KX5B 4H9OB 3C1BA 3B6FA 5KDMB 3C1CA 3X1VD 1P34B 2BYMB 1P3MA 4DRAA 1P3BC 3REKC 5GSUC 3REIA 3LJAA 4LD9B 4J8XA 2PYOC 5B32A 3VH5T 2Y2PA 4HGAC 3C1CC 3MGSA 3W96B 5CPJB 5B2IB 2BYKA 4KGCD 5GXQC 1Z2CB 5CPJD 4LD9C 3LELB 5DNNB 4J8WC 3AV2A 2F8NB 5E5AA 3WA9D 3MGSC 3UTBD 1P3OB 3O62C 1EQZA 1P3KD 2LY8A 5B0ZA 1P3AC 5B0ZB 2Y2IA 3AFAD 2BG1A 3H0LC 3W98A 3REIB 5AVCD 3MVDC 1P3GC 3AV2C 2JSSA 1M1AC 3WA9A 2XD5A 3AZNA 3MNNA 3B6GD 5BT1C 5AV9B 3AV1C 5B24C 2UWXA 3MGPC 3VH6A 2Y2OA 3WKJB 4XUJD 1M18C 3X1SD 3AV1D 3UTAA 5B2JA 2ZY4A 5B1LA 1M18D 5BO0B 4QLCC 3LZ1A 4ZUXD 1P3KC 1R4VA 3VH5A 1P34C 5B33B 1BH8B 5BNXA 5B2JD 2Y2GA 3MNNB 2RVQC 2AROD 3AZGA 5AY8D 4CSRB 5GT3B 2IO5C 3KXBC 2FJ7D 3X1UD 4Z2MH 3MGSB 1P3FB 3RELD 2XD1A 3W97B 1KX5C 1P3MD 5B33A 3AFAA 4YM6C 4R8PA 3LJAD 1M19D 4CAYB 1ULYA 4WV4B 4CAYA 4Z2MG 4XZQD 1KX4D 4Z66D 3AV1B 3IP4C 2IO5B 1AOIC 3AV2D 3W98B 1KX3C 2NZDB 5JRGD 5CPJC 3W96D 5AV5B 4J8VB 3AZLD 3F6TA 5JRGC 4G91B 3O62D 5AV5D 5B0YB 1P3MC 5B0ZD 3AFAB 5DNNC 1F66B 1P3KB 1TZYA 4KUDB 4G92C 3C1CD 3X1VA 5AVCA 4WZSB 3B0DC 4J8VC 5B32C 2W8SA 4WNNB 2CWEA 3MGRC 1A7WA 4X23A 3AZKC 2NZDA 1P3GB 5E5AD 3AZFA 4WU8C 3R45B 3WTPA 5GSUB 2CV5A 3A6ND 2YFWA 3A1KA 3AZKA 4DQYB 3AZJA 1HQ3A 1M19C 3AZIC 5AV6D 3AN2B 5AVBD 1H3OB 5C3IC 1P3AA 5F99A 1P3FA 2YFVA 2HUEC 4DRBA 1KX5D 2Y2LA 3LZ1B 4JJNB 4YM6B 4XZQA 4NE5A 5G49A 4YM6D 3UT9B 3AZJC 4JJND 5B32G 5B31A 1P3PB 5AV6A 2J8PA 3AZHB 1N1JB 2HIOC 3UTBB 5AV9A 1P3LD 2NQBA 4CSRA 5GT3A 4H9SC 4YS3A 5JA4A 3KFUG 3AZEB 3MGPB 5F99B 2HIOA 2AROA 3B0DB 4H9RA 4J8XC 1EQZB 1WWSA 2PYOA 3B6GB 1PZRA 1KU5A 5E5AC 3B0BA 4WU9A 5B0YA 5BS7A 1B6WA 4Z5TD 2DF4C 5B31B 3REID 1P3IB 4ZBJB 3EPKA 4J8UC 4H9PA 3O62B 2HIOD 2ZY5A 3W96A 5B1MB 3A6NB 1P3LC 1ZLAB 3C1BD 3W99D 3REHC 3AZLB 2NZDC 2Y2QA 3X1SA 5JRGB 1JFIB 5B0ZC 3C1BC 1P3BD 3AZMD 3AL0C 5DNMA 2Y2MA 5DNMB 4R8PC 3UTAC 1HTAA 1M1AA 1KX3D 4QLCA 1M19A 3W97C 3REJB 2ZM5A 2Y2HA 3RELB 4KHAA 1P3AD 4LD9A 3MGSD 3UTBC 1HQ3B 5B2IC 3UTAB 3AZKD 3B0CT 1N1JA 5B32D 4WU8D 4H9RB 3LELC 5GXQD 3W98C 4Z66B 3X1VC 4XZQB 4YS3C 5B40B 4JJNC 3TU4C 1KX4B 3REKD 5B33D 4J8UD 4WU9D 2JCHA 4WJ3C 4X23C 5KDMA 3AV1A 3V9RB 4UPKA 3X1TB 4WU8A 1T3UA 5CPKB 1U35B 4KUDC 3REKB 3X1UB 1M18B 1P3FD 3WTPD 5CPIC 1P3LB 5B24A 3A1IA 5BNVB 2FJ7B 3B0CW 3MGPA 3B6FC 3W96C 2BYKB 3MNND 5CPIA 1EQZD 1H3OA 1P3AB 5AVCB 3KXBD 2FJ7C 5CP6D 1P3OA 1M1AB 1TZYC 3AZGC 1ID3D 4ZUXB 3KUYD 3AZFB 2G5HC 3REHD 3R45A 5B31G 3RELC 3X1SB 5JRGA 1JFIA 1S32D 5B1LB 5AY8C 4Z66A 3AZJB 4ZUXC 1TZYB 3LZ1D 2F8NA 3C1CB 3AZNC 3X1TC 3V9RA 3WAAD 3REJD 4YM6A 3TU4D 3AZMC 4X23B 4KHAB 3WAAB 1KX4A 1BH8A 5AV5A 2F8ND 5GSUD 4H9PB 3LZ0B 5B1MA 5B24D 1ZLAA 2NQBB 1B67A 1P3IC 3LZ0D 4XUJC 3MGQB 3VH6T 3MGQA 5DNNA 3AV2B 3KWQC 4J8VA 3KUYB 3AZFD 2HIOB 5B1MD 3AZND 1ZLAD 3KSYA 1M1AD 2PYOB 5AV8D 3W97A 1F66C 3B6GA 4LD9D 5B0YD 4EO5C
chains in the Genus database with same CATH topology
4QLCB 1S32C 1AOIB 2F8NK 3KWQB 3EPLA 3H0RC 4J8VD 1BFMA 3AYWC 1P3OC 2G5IC 3UTBA 3WTPE 1ID3C 3W99A 3REKA 5GT0A 3LELA 4E44A 5B33C 5CPIB 3WTPB 2CV5C 2HUEB 2YFVB 3EG5B 1HQ3C 3AZHD 4H9NA 5CP6B 1KX3A 3AN2A 1P3GD 3NQJB 4KUDA 3AZHC 4XZQC 5AVBA 3LZ0C 3X1TA 2CV5B 4WU8B 5CPKA 1U35A 3UT9A 5GXQB 2FFFB 3AN2D 1P3GA 3AZEC 5DNMC 5B2JB 4YS3D 3AZIB 5CPKD 1U35D 4UUZB 2YFWB 3H0MC 3X1TD 4WU9C 4EO5B 3X1UC 3WAAA 5AV8B 4G91C 3W98D 5B40D 1P3OD 4J8UA 3KWQA 3WA9B 4J8UB 5B2JC 4J8XD 4JJNA 3LZ1C 3RELA 5B2IA 3LJAB 4Z5TC 3WAAC 4KGCB 5B32B 5B24B 5AV9D 1P3LA 3W97D 3P5JB 4G92B 5GT0D 3AYWA 3W99B 4H9QB 4J8WA 3X1SC 1TAFA 2L5AA 5CP6C 3EPHA 1P3ID 5AV8A 3MGRD 4E45A 4Z5TB 3O62A 1EQZC 5C3IB 5DNND 3AZJD 5DNMD 5GT3C 3AFAC 1P3IA 1P3BB 5GSUA 4XUJA 3AZHA 2Y2KA 3AYWB 2AROC 3AZID 5AVBC 3LZ0A 4X23D 3TU4B 5B40C 3AZEA 1P3PC 4Z66C 3X1VB 2CV5D 2DQNC 5B1LC 3EPJA 3X1UA 1P3PA 1ID3A 3NQUB 5AV6B 2VQRA 5B1LD 1BH9A 5BNXB 5F99D 4M6BA 2F2AC 3AZED 5AY8A 3AZNB 2PYOD 3KXBA 5AV5C 3LELD 3MVDB 5B1MC 2RVQD 3MGQD 1ZLAC 1P3PD 3WKJD 5B2ID 3UT9D 1KX4C 4R8PD 3KWQD 3WKJC 3WA9C 1AOID 5CP6A 4KUDD 2JE5A 3NQUA 3VH6W 5AV8C 1F66D 1P3BA 4NFTA 5F99C 4WNNA 4NE3A 5GT0B 3AYWD 4KGCA 3AZLA 5B31C 3TU4A 1F66A 5E5AB 3REJC 3KUYA 3B6FB 2NZDD 5AV9C 1P34A 1S32B 1S32A 4ZBJC 1TAFB 5CHLB 3REHB 4H9SA 3AZLC 5B40A 1ID3B 3MGRB 3REJA 3AZMB 2ZY3A 1WWIA 3AZMA 1P34D 3AZFC 3AZGB 1TZYD 3MGQC 4NE6A 4YS3B 3VH5W 5CPKC 1U35C 5GT3D 5AY8B 5BNVA 1W2EA 2FJ7A 1Q9CA 2AROB 5CPJA 2F8NG 4UUZA 3LJAC 5JA4B 3REIC 1KX3B 1M19B 4J8XB 3B6GC 2Y2JA 1F1EA 5BT1D 1P3KA 1AOIA 3MGPD 1P3FC 3W99C 2BYMA 1P3MB 3A6NC 3KXBB 4WU9B 3FDDA 5AVCC 5GXQA 3MVDD 3WKJA 5GT0C 4ZUXA 1BH9B 4XUJB 4J8WD 3A6NA 5BO0A 4H9QA 4J8WB 3WTPC 5B31D 4H9NB 3MVDA 4KGCC 2F8NH 4R8PB 3AZGD 3MGRA 2ZY2A 5FUGB 4Z5TA 1KX5A 4QLCD 3MNNC 3KUYC 5AVBB 3AN2C 5G49B 4AWLC 1M18A 5BS7C 3NQJA 5B0YC 5CPID 2Y2NA 3UT9C 3B6FD 2NQBD 3AZIA 5AV6C 2RIQA 3UTAD 4HGAB 3AZKB 1HQ3D 4AWLB 3REHA 2NQBC 4H9OA 5FUGA 3C1BB 1KX5B 4H9OB 3C1BA 3B6FA 5KDMB 3C1CA 3X1VD 1P34B 2BYMB 1P3MA 4DRAA 1P3BC 3REKC 5GSUC 3REIA 3LJAA 4LD9B 4J8XA 2PYOC 5B32A 3VH5T 2Y2PA 4HGAC 3C1CC 3MGSA 3W96B 5CPJB 5B2IB 2BYKA 4KGCD 5GXQC 1Z2CB 5CPJD 4LD9C 3LELB 5DNNB 4J8WC 3AV2A 2F8NB 5E5AA 3WA9D 3MGSC 3UTBD 1P3OB 3O62C 1EQZA 1P3KD 2LY8A 5B0ZA 1P3AC 5B0ZB 2Y2IA 3AFAD 2BG1A 3H0LC 3W98A 3REIB 5AVCD 3MVDC 1P3GC 3AV2C 2JSSA 1M1AC 3WA9A 2XD5A 3AZNA 3MNNA 3B6GD 5BT1C 5AV9B 3AV1C 5B24C 2UWXA 3MGPC 3VH6A 2Y2OA 3WKJB 4XUJD 1M18C 3X1SD 3AV1D 3UTAA 5B2JA 2ZY4A 5B1LA 1M18D 5BO0B 4QLCC 3LZ1A 4ZUXD 1P3KC 1R4VA 3VH5A 1P34C 5B33B 1BH8B 5BNXA 5B2JD 2Y2GA 3MNNB 2RVQC 2AROD 3AZGA 5AY8D 4CSRB 5GT3B 2IO5C 3KXBC 2FJ7D 3X1UD 4Z2MH 3MGSB 1P3FB 3RELD 2XD1A 3W97B 1KX5C 1P3MD 5B33A 3AFAA 4YM6C 4R8PA 3LJAD 1M19D 4CAYB 1ULYA 4WV4B 4CAYA 4Z2MG 4XZQD 1KX4D 4Z66D 3AV1B 3IP4C 2IO5B 1AOIC 3AV2D 3W98B 1KX3C 2NZDB 5JRGD 5CPJC 3W96D 5AV5B 4J8VB 3AZLD 3F6TA 5JRGC 4G91B 3O62D 5AV5D 5B0YB 1P3MC 5B0ZD 3AFAB 5DNNC 1F66B 1P3KB 1TZYA 4KUDB 4G92C 3C1CD 3X1VA 5AVCA 4WZSB 3B0DC 4J8VC 5B32C 2W8SA 4WNNB 2CWEA 3MGRC 1A7WA 4X23A 3AZKC 2NZDA 1P3GB 5E5AD 3AZFA 4WU8C 3R45B 3WTPA 5GSUB 2CV5A 3A6ND 2YFWA 3A1KA 3AZKA 4DQYB 3AZJA 1HQ3A 1M19C 3AZIC 5AV6D 3AN2B 5AVBD 1H3OB 5C3IC 1P3AA 5F99A 1P3FA 2YFVA 2HUEC 4DRBA 1KX5D 2Y2LA 3LZ1B 4JJNB 4YM6B 4XZQA 4NE5A 5G49A 4YM6D 3UT9B 3AZJC 4JJND 5B32G 5B31A 1P3PB 5AV6A 2J8PA 3AZHB 1N1JB 2HIOC 3UTBB 5AV9A 1P3LD 2NQBA 4CSRA 5GT3A 4H9SC 4YS3A 5JA4A 3KFUG 3AZEB 3MGPB 5F99B 2HIOA 2AROA 3B0DB 4H9RA 4J8XC 1EQZB 1WWSA 2PYOA 3B6GB 1PZRA 1KU5A 5E5AC 3B0BA 4WU9A 5B0YA 5BS7A 1B6WA 4Z5TD 2DF4C 5B31B 3REID 1P3IB 4ZBJB 3EPKA 4J8UC 4H9PA 3O62B 2HIOD 2ZY5A 3W96A 5B1MB 3A6NB 1P3LC 1ZLAB 3C1BD 3W99D 3REHC 3AZLB 2NZDC 2Y2QA 3X1SA 5JRGB 1JFIB 5B0ZC 3C1BC 1P3BD 3AZMD 3AL0C 5DNMA 2Y2MA 5DNMB 4R8PC 3UTAC 1HTAA 1M1AA 1KX3D 4QLCA 1M19A 3W97C 3REJB 2ZM5A 2Y2HA 3RELB 4KHAA 1P3AD 4LD9A 3MGSD 3UTBC 1HQ3B 5B2IC 3UTAB 3AZKD 3B0CT 1N1JA 5B32D 4WU8D 4H9RB 3LELC 5GXQD 3W98C 4Z66B 3X1VC 4XZQB 4YS3C 5B40B 4JJNC 3TU4C 1KX4B 3REKD 5B33D 4J8UD 4WU9D 2JCHA 4WJ3C 4X23C 5KDMA 3AV1A 3V9RB 4UPKA 3X1TB 4WU8A 1T3UA 5CPKB 1U35B 4KUDC 3REKB 3X1UB 1M18B 1P3FD 3WTPD 5CPIC 1P3LB 5B24A 3A1IA 5BNVB 2FJ7B 3B0CW 3MGPA 3B6FC 3W96C 2BYKB 3MNND 5CPIA 1EQZD 1H3OA 1P3AB 5AVCB 3KXBD 2FJ7C 5CP6D 1P3OA 1M1AB 1TZYC 3AZGC 1ID3D 4ZUXB 3KUYD 3AZFB 2G5HC 3REHD 3R45A 5B31G 3RELC 3X1SB 5JRGA 1JFIA 1S32D 5B1LB 5AY8C 4Z66A 3AZJB 4ZUXC 1TZYB 3LZ1D 2F8NA 3C1CB 3AZNC 3X1TC 3V9RA 3WAAD 3REJD 4YM6A 3TU4D 3AZMC 4X23B 4KHAB 3WAAB 1KX4A 1BH8A 5AV5A 2F8ND 5GSUD 4H9PB 3LZ0B 5B1MA 5B24D 1ZLAA 2NQBB 1B67A 1P3IC 3LZ0D 4XUJC 3MGQB 3VH6T 3MGQA 5DNNA 3AV2B 3KWQC 4J8VA 3KUYB 3AZFD 2HIOB 5B1MD 3AZND 1ZLAD 3KSYA 1M1AD 2PYOB 5AV8D 3W97A 1F66C 3B6GA 4LD9D 5B0YD 4EO5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QLC B;  1S32 C;  1AOI B;  2F8N K;  3KWQ B;  4J8V D;  1BFM A;  3AYW C;  1P3O C;  3UTB A;  3WTP E;  1ID3 C;  3W99 A;  3REK A;  5GT0 A;  3LEL A;  4E44 A;  5B33 C;  5CPI B;  3WTP B;  2CV5 C;  2HUE B;  2YFV B;  1HQ3 C;  3AZH D;  4H9N A;  5CP6 B;  1KX3 A;  3AN2 A;  1P3G D;  3NQJ B;  4KUD A;  3AZH C;  4XZQ C;  5AVB A;  3LZ0 C;  3X1T A;  2CV5 B;  4WU8 B;  5CPK A;  1U35 A;  3UT9 A;  5GXQ B;  3AN2 D;  1P3G A;  3AZE C;  5DNM C;  5B2J B;  4YS3 D;  3AZI B;  5CPK D;  1U35 D;  4UUZ B;  2YFW B;  3X1T D;  4WU9 C;  4EO5 B;  3X1U C;  3WAA A;  5AV8 B;  4G91 C;  3W98 D;  5B40 D;  1P3O D;  4J8U A;  3KWQ A;  3WA9 B;  4J8U B;  5B2J C;  4J8X D;  4JJN A;  3LZ1 C;  3REL A;  5B2I A;  3LJA B;  4Z5T C;  3WAA C;  4KGC B;  5B32 B;  5B24 B;  5AV9 D;  1P3L A;  3W97 D;  4G92 B;  5GT0 D;  3AYW A;  3W99 B;  4H9Q B;  4J8W A;  3X1S C;  1TAF A;  2L5A A;  5CP6 C;  1P3I D;  5AV8 A;  3MGR D;  4E45 A;  4Z5T B;  3O62 A;  1EQZ C;  5C3I B;  5DNN D;  3AZJ D;  5DNM D;  5GT3 C;  3AFA C;  1P3I A;  1P3B B;  5GSU A;  4XUJ A;  3AZH A;  3AYW B;  2ARO C;  3AZI D;  5AVB C;  3LZ0 A;  4X23 D;  3TU4 B;  5B40 C;  3AZE A;  1P3P C;  4Z66 C;  3X1V B;  2CV5 D;  5B1L C;  3X1U A;  1P3P A;  1ID3 A;  3NQU B;  5AV6 B;  5B1L D;  1BH9 A;  5BNX B;  5F99 D;  4M6B A;  3AZE D;  5AY8 A;  3AZN B;  2PYO D;  3KXB A;  5AV5 C;  3LEL D;  3MVD B;  5B1M C;  2RVQ D;  3MGQ D;  1ZLA C;  1P3P D;  3WKJ D;  5B2I D;  3UT9 D;  1KX4 C;  4R8P D;  3KWQ D;  3WKJ C;  3WA9 C;  1AOI D;  5CP6 A;  4KUD D;  3NQU A;  3VH6 W;  5AV8 C;  1F66 D;  1P3B A;  4NFT A;  5F99 C;  4WNN A;  4NE3 A;  5GT0 B;  3AYW D;  4KGC A;  3AZL A;  5B31 C;  3TU4 A;  1F66 A;  5E5A B;  3REJ C;  3KUY A;  3B6F B;  2NZD D;  5AV9 C;  1P34 A;  1S32 B;  1S32 A;  4ZBJ C;  1TAF B;  5CHL B;  3REH B;  4H9S A;  3AZL C;  5B40 A;  1ID3 B;  3MGR B;  3REJ A;  3AZM B;  1WWI A;  3AZM A;  1P34 D;  3AZF C;  3AZG B;  1TZY D;  3MGQ C;  4NE6 A;  4YS3 B;  3VH5 W;  5CPK C;  1U35 C;  5GT3 D;  5AY8 B;  5BNV A;  2FJ7 A;  1Q9C A;  2ARO B;  5CPJ A;  2F8N G;  4UUZ A;  3LJA C;  5JA4 B;  3REI C;  1KX3 B;  1M19 B;  4J8X B;  3B6G C;  1F1E A;  5BT1 D;  1P3K A;  1AOI A;  3MGP D;  1P3F C;  3W99 C;  2BYM A;  1P3M B;  3A6N C;  3KXB B;  4WU9 B;  5AVC C;  5GXQ A;  3MVD D;  3WKJ A;  5GT0 C;  4ZUX A;  1BH9 B;  4XUJ B;  4J8W D;  3A6N A;  5BO0 A;  4H9Q A;  4J8W B;  3WTP C;  5B31 D;  4H9N B;  3MVD A;  4KGC C;  2F8N H;  4R8P B;  3AZG D;  3MGR A;  5FUG B;  1KX5 A;  4Z5T A;  4QLC D;  3MNN C;  3KUY C;  5AVB B;  3AN2 C;  5G49 B;  4AWL C;  1M18 A;  5BS7 C;  3NQJ A;  5B0Y C;  5CPI D;  3UT9 C;  3B6F D;  2NQB D;  3AZI A;  5AV6 C;  3UTA D;  4HGA B;  3AZK B;  1HQ3 D;  4AWL B;  3REH A;  2NQB C;  4H9O A;  5FUG A;  3C1B B;  1KX5 B;  4H9O B;  3C1B A;  3B6F A;  5KDM B;  3C1C A;  3X1V D;  1P34 B;  2BYM B;  1P3M A;  4DRA A;  1P3B C;  3REK C;  5GSU C;  3REI A;  3LJA A;  4LD9 B;  4J8X A;  2PYO C;  5B32 A;  3VH5 T;  4HGA C;  3C1C C;  3MGS A;  3W96 B;  5CPJ B;  5B2I B;  2BYK A;  4KGC D;  5GXQ C;  5CPJ D;  4LD9 C;  3LEL B;  5DNN B;  4J8W C;  3AV2 A;  2F8N B;  5E5A A;  3WA9 D;  3MGS C;  3UTB D;  1P3O B;  3O62 C;  1EQZ A;  1P3K D;  2LY8 A;  5B0Z A;  1P3A C;  5B0Z B;  3AFA D;  3W98 A;  3REI B;  5AVC D;  3MVD C;  1P3G C;  3AV2 C;  2JSS A;  1M1A C;  3WA9 A;  3AZN A;  3MNN A;  3B6G D;  5BT1 C;  5AV9 B;  3AV1 C;  5B24 C;  3MGP C;  3VH6 A;  3WKJ B;  4XUJ D;  1M18 C;  3X1S D;  3AV1 D;  3UTA A;  5B2J A;  5B1L A;  1M18 D;  5BO0 B;  4QLC C;  3LZ1 A;  4ZUX D;  1P3K C;  1R4V A;  3VH5 A;  1P34 C;  5B33 B;  1BH8 B;  5BNX A;  5B2J D;  3MNN B;  2RVQ C;  2ARO D;  3AZG A;  5AY8 D;  4CSR B;  5GT3 B;  2IO5 C;  3KXB C;  2FJ7 D;  3X1U D;  4Z2M H;  3MGS B;  1P3F B;  3REL D;  3W97 B;  1KX5 C;  1P3M D;  5B33 A;  3AFA A;  4YM6 C;  4R8P A;  3LJA D;  1M19 D;  4CAY B;  1ULY A;  4WV4 B;  4CAY A;  4Z2M G;  4XZQ D;  1KX4 D;  4Z66 D;  3AV1 B;  2IO5 B;  1AOI C;  3AV2 D;  3W98 B;  1KX3 C;  2NZD B;  5JRG D;  5CPJ C;  3W96 D;  5AV5 B;  4J8V B;  3AZL D;  5JRG C;  4G91 B;  3O62 D;  5AV5 D;  5B0Y B;  1P3M C;  5B0Z D;  3AFA B;  5DNN C;  1F66 B;  1P3K B;  1TZY A;  4KUD B;  4G92 C;  3C1C D;  3X1V A;  5AVC A;  4WZS B;  3B0D C;  4J8V C;  5B32 C;  4WNN B;  2CWE A;  3MGR C;  1A7W A;  4X23 A;  3AZK C;  2NZD A;  1P3G B;  5E5A D;  3AZF A;  4WU8 C;  3R45 B;  3WTP A;  5GSU B;  2CV5 A;  3A6N D;  2YFW A;  3AZK A;  3AZJ A;  1HQ3 A;  1M19 C;  3AZI C;  5AV6 D;  3AN2 B;  5AVB D;  1H3O B;  5C3I C;  1P3A A;  5F99 A;  1P3F A;  2YFV A;  2HUE C;  4DRB A;  1KX5 D;  3LZ1 B;  4JJN B;  4YM6 B;  4XZQ A;  4NE5 A;  5G49 A;  4YM6 D;  3UT9 B;  3AZJ C;  4JJN D;  5B32 G;  5B31 A;  1P3P B;  5AV6 A;  3AZH B;  1N1J B;  2HIO C;  3UTB B;  5AV9 A;  1P3L D;  2NQB A;  4CSR A;  5GT3 A;  4H9S C;  4YS3 A;  5JA4 A;  3AZE B;  3MGP B;  5F99 B;  2HIO A;  2ARO A;  3B0D B;  4H9R A;  4J8X C;  1EQZ B;  1WWS A;  2PYO A;  3B6G B;  1KU5 A;  5E5A C;  3B0B A;  4WU9 A;  5B0Y A;  5BS7 A;  1B6W A;  4Z5T D;  5B31 B;  3REI D;  1P3I B;  4ZBJ B;  4J8U C;  4H9P A;  3O62 B;  2HIO D;  3W96 A;  5B1M B;  3A6N B;  1P3L C;  1ZLA B;  3C1B D;  3W99 D;  3REH C;  3AZL B;  2NZD C;  3X1S A;  5JRG B;  1JFI B;  5B0Z C;  3C1B C;  1P3B D;  3AZM D;  5DNM A;  5DNM B;  4R8P C;  3UTA C;  1HTA A;  1M1A A;  1KX3 D;  4QLC A;  1M19 A;  3W97 C;  3REJ B;  3REL B;  4KHA A;  1P3A D;  4LD9 A;  3MGS D;  3UTB C;  1HQ3 B;  5B2I C;  3UTA B;  3AZK D;  3B0C T;  1N1J A;  5B32 D;  4WU8 D;  4H9R B;  3LEL C;  5GXQ D;  3W98 C;  4Z66 B;  3X1V C;  4XZQ B;  4YS3 C;  5B40 B;  4JJN C;  3TU4 C;  1KX4 B;  3REK D;  5B33 D;  4J8U D;  4WU9 D;  4X23 C;  5KDM A;  3AV1 A;  3V9R B;  3X1T B;  4WU8 A;  5CPK B;  1U35 B;  4KUD C;  3REK B;  3X1U B;  1M18 B;  1P3F D;  3WTP D;  5CPI C;  1P3L B;  5B24 A;  5BNV B;  2FJ7 B;  3B0C W;  3MGP A;  3B6F C;  3W96 C;  2BYK B;  3MNN D;  5CPI A;  1EQZ D;  1H3O A;  1P3A B;  5AVC B;  3KXB D;  2FJ7 C;  5CP6 D;  1P3O A;  1M1A B;  1TZY C;  3AZG C;  1ID3 D;  4ZUX B;  3KUY D;  3AZF B;  3REH D;  3R45 A;  5B31 G;  3REL C;  3X1S B;  5JRG A;  1JFI A;  1S32 D;  5B1L B;  5AY8 C;  4Z66 A;  3AZJ B;  4ZUX C;  1TZY B;  3LZ1 D;  2F8N A;  3C1C B;  3AZN C;  3X1T C;  3V9R A;  3WAA D;  3REJ D;  4YM6 A;  3TU4 D;  3AZM C;  4X23 B;  4KHA B;  3WAA B;  1KX4 A;  1BH8 A;  5AV5 A;  2F8N D;  5GSU D;  4H9P B;  3LZ0 B;  5B1M A;  5B24 D;  1ZLA A;  2NQB B;  1B67 A;  1P3I C;  3LZ0 D;  4XUJ C;  3MGQ B;  3VH6 T;  3MGQ A;  5DNN A;  3AV2 B;  3KWQ C;  4J8V A;  3KUY B;  3AZF D;  2HIO B;  5B1M D;  3AZN D;  1ZLA D;  3KSY A;  1M1A D;  2PYO B;  5AV8 D;  3W97 A;  1F66 C;  3B6G A;  4LD9 D;  5B0Y D;  4EO5 C; 
#chains in the Genus database with same CATH topology
 4QLC B;  1S32 C;  1AOI B;  2F8N K;  3KWQ B;  3EPL A;  3H0R C;  4J8V D;  1BFM A;  3AYW C;  1P3O C;  2G5I C;  3UTB A;  3WTP E;  1ID3 C;  3W99 A;  3REK A;  5GT0 A;  3LEL A;  4E44 A;  5B33 C;  5CPI B;  3WTP B;  2CV5 C;  2HUE B;  2YFV B;  3EG5 B;  1HQ3 C;  3AZH D;  4H9N A;  5CP6 B;  1KX3 A;  3AN2 A;  1P3G D;  3NQJ B;  4KUD A;  3AZH C;  4XZQ C;  5AVB A;  3LZ0 C;  3X1T A;  2CV5 B;  4WU8 B;  5CPK A;  1U35 A;  3UT9 A;  5GXQ B;  2FFF B;  3AN2 D;  1P3G A;  3AZE C;  5DNM C;  5B2J B;  4YS3 D;  3AZI B;  5CPK D;  1U35 D;  4UUZ B;  2YFW B;  3H0M C;  3X1T D;  4WU9 C;  4EO5 B;  3X1U C;  3WAA A;  5AV8 B;  4G91 C;  3W98 D;  5B40 D;  1P3O D;  4J8U A;  3KWQ A;  3WA9 B;  4J8U B;  5B2J C;  4J8X D;  4JJN A;  3LZ1 C;  3REL A;  5B2I A;  3LJA B;  4Z5T C;  3WAA C;  4KGC B;  5B32 B;  5B24 B;  5AV9 D;  1P3L A;  3W97 D;  3P5J B;  4G92 B;  5GT0 D;  3AYW A;  3W99 B;  4H9Q B;  4J8W A;  3X1S C;  1TAF A;  2L5A A;  5CP6 C;  3EPH A;  1P3I D;  5AV8 A;  3MGR D;  4E45 A;  4Z5T B;  3O62 A;  1EQZ C;  5C3I B;  5DNN D;  3AZJ D;  5DNM D;  5GT3 C;  3AFA C;  1P3I A;  1P3B B;  5GSU A;  4XUJ A;  3AZH A;  2Y2K A;  3AYW B;  2ARO C;  3AZI D;  5AVB C;  3LZ0 A;  4X23 D;  3TU4 B;  5B40 C;  3AZE A;  1P3P C;  4Z66 C;  3X1V B;  2CV5 D;  2DQN C;  5B1L C;  3EPJ A;  3X1U A;  1P3P A;  1ID3 A;  3NQU B;  5AV6 B;  2VQR A;  5B1L D;  1BH9 A;  5BNX B;  5F99 D;  4M6B A;  2F2A C;  3AZE D;  5AY8 A;  3AZN B;  2PYO D;  3KXB A;  5AV5 C;  3LEL D;  3MVD B;  5B1M C;  2RVQ D;  3MGQ D;  1ZLA C;  1P3P D;  3WKJ D;  5B2I D;  3UT9 D;  1KX4 C;  4R8P D;  3KWQ D;  3WKJ C;  3WA9 C;  1AOI D;  5CP6 A;  4KUD D;  2JE5 A;  3NQU A;  3VH6 W;  5AV8 C;  1F66 D;  1P3B A;  4NFT A;  5F99 C;  4WNN A;  4NE3 A;  5GT0 B;  3AYW D;  4KGC A;  3AZL A;  5B31 C;  3TU4 A;  1F66 A;  5E5A B;  3REJ C;  3KUY A;  3B6F B;  2NZD D;  5AV9 C;  1P34 A;  1S32 B;  1S32 A;  4ZBJ C;  1TAF B;  5CHL B;  3REH B;  4H9S A;  3AZL C;  5B40 A;  1ID3 B;  3MGR B;  3REJ A;  3AZM B;  2ZY3 A;  1WWI A;  3AZM A;  1P34 D;  3AZF C;  3AZG B;  1TZY D;  3MGQ C;  4NE6 A;  4YS3 B;  3VH5 W;  5CPK C;  1U35 C;  5GT3 D;  5AY8 B;  5BNV A;  1W2E A;  2FJ7 A;  1Q9C A;  2ARO B;  5CPJ A;  2F8N G;  4UUZ A;  3LJA C;  5JA4 B;  3REI C;  1KX3 B;  1M19 B;  4J8X B;  3B6G C;  2Y2J A;  1F1E A;  5BT1 D;  1P3K A;  1AOI A;  3MGP D;  1P3F C;  3W99 C;  2BYM A;  1P3M B;  3A6N C;  3KXB B;  4WU9 B;  3FDD A;  5AVC C;  5GXQ A;  3MVD D;  3WKJ A;  5GT0 C;  4ZUX A;  1BH9 B;  4XUJ B;  4J8W D;  3A6N A;  5BO0 A;  4H9Q A;  4J8W B;  3WTP C;  5B31 D;  4H9N B;  3MVD A;  4KGC C;  2F8N H;  4R8P B;  3AZG D;  3MGR A;  2ZY2 A;  5FUG B;  4Z5T A;  1KX5 A;  4QLC D;  3MNN C;  3KUY C;  5AVB B;  3AN2 C;  5G49 B;  4AWL C;  1M18 A;  5BS7 C;  3NQJ A;  5B0Y C;  5CPI D;  2Y2N A;  3UT9 C;  3B6F D;  2NQB D;  3AZI A;  5AV6 C;  2RIQ A;  3UTA D;  4HGA B;  3AZK B;  1HQ3 D;  4AWL B;  3REH A;  2NQB C;  4H9O A;  5FUG A;  3C1B B;  1KX5 B;  4H9O B;  3C1B A;  3B6F A;  5KDM B;  3C1C A;  3X1V D;  1P34 B;  2BYM B;  1P3M A;  4DRA A;  1P3B C;  3REK C;  5GSU C;  3REI A;  3LJA A;  4LD9 B;  4J8X A;  2PYO C;  5B32 A;  3VH5 T;  2Y2P A;  4HGA C;  3C1C C;  3MGS A;  3W96 B;  5CPJ B;  5B2I B;  2BYK A;  4KGC D;  5GXQ C;  1Z2C B;  5CPJ D;  4LD9 C;  3LEL B;  5DNN B;  4J8W C;  3AV2 A;  2F8N B;  5E5A A;  3WA9 D;  3MGS C;  3UTB D;  1P3O B;  3O62 C;  1EQZ A;  1P3K D;  2LY8 A;  5B0Z A;  1P3A C;  5B0Z B;  2Y2I A;  3AFA D;  2BG1 A;  3H0L C;  3W98 A;  3REI B;  5AVC D;  3MVD C;  1P3G C;  3AV2 C;  2JSS A;  1M1A C;  3WA9 A;  2XD5 A;  3AZN A;  3MNN A;  3B6G D;  5BT1 C;  5AV9 B;  3AV1 C;  5B24 C;  2UWX A;  3MGP C;  3VH6 A;  2Y2O A;  3WKJ B;  4XUJ D;  1M18 C;  3X1S D;  3AV1 D;  3UTA A;  5B2J A;  2ZY4 A;  5B1L A;  1M18 D;  5BO0 B;  4QLC C;  3LZ1 A;  4ZUX D;  1P3K C;  1R4V A;  3VH5 A;  1P34 C;  5B33 B;  1BH8 B;  5BNX A;  5B2J D;  2Y2G A;  3MNN B;  2RVQ C;  2ARO D;  3AZG A;  5AY8 D;  4CSR B;  5GT3 B;  2IO5 C;  3KXB C;  2FJ7 D;  3X1U D;  4Z2M H;  3MGS B;  1P3F B;  3REL D;  2XD1 A;  3W97 B;  1KX5 C;  1P3M D;  5B33 A;  3AFA A;  4YM6 C;  4R8P A;  3LJA D;  1M19 D;  4CAY B;  1ULY A;  4WV4 B;  4CAY A;  4Z2M G;  4XZQ D;  1KX4 D;  4Z66 D;  3AV1 B;  3IP4 C;  2IO5 B;  1AOI C;  3AV2 D;  3W98 B;  1KX3 C;  2NZD B;  5JRG D;  5CPJ C;  3W96 D;  5AV5 B;  4J8V B;  3AZL D;  3F6T A;  5JRG C;  4G91 B;  3O62 D;  5AV5 D;  5B0Y B;  1P3M C;  5B0Z D;  3AFA B;  5DNN C;  1F66 B;  1P3K B;  1TZY A;  4KUD B;  4G92 C;  3C1C D;  3X1V A;  5AVC A;  4WZS B;  3B0D C;  4J8V C;  5B32 C;  2W8S A;  4WNN B;  2CWE A;  3MGR C;  1A7W A;  4X23 A;  3AZK C;  2NZD A;  1P3G B;  5E5A D;  3AZF A;  4WU8 C;  3R45 B;  3WTP A;  5GSU B;  2CV5 A;  3A6N D;  2YFW A;  3A1K A;  3AZK A;  4DQY B;  3AZJ A;  1HQ3 A;  1M19 C;  3AZI C;  5AV6 D;  3AN2 B;  5AVB D;  1H3O B;  5C3I C;  1P3A A;  5F99 A;  1P3F A;  2YFV A;  2HUE C;  4DRB A;  1KX5 D;  2Y2L A;  3LZ1 B;  4JJN B;  4YM6 B;  4XZQ A;  4NE5 A;  5G49 A;  4YM6 D;  3UT9 B;  3AZJ C;  4JJN D;  5B32 G;  5B31 A;  1P3P B;  5AV6 A;  2J8P A;  3AZH B;  1N1J B;  2HIO C;  3UTB B;  5AV9 A;  1P3L D;  2NQB A;  4CSR A;  5GT3 A;  4H9S C;  4YS3 A;  5JA4 A;  3KFU G;  3AZE B;  3MGP B;  5F99 B;  2HIO A;  2ARO A;  3B0D B;  4H9R A;  4J8X C;  1EQZ B;  1WWS A;  2PYO A;  3B6G B;  1PZR A;  1KU5 A;  5E5A C;  3B0B A;  4WU9 A;  5B0Y A;  5BS7 A;  1B6W A;  4Z5T D;  2DF4 C;  5B31 B;  3REI D;  1P3I B;  4ZBJ B;  3EPK A;  4J8U C;  4H9P A;  3O62 B;  2HIO D;  2ZY5 A;  3W96 A;  5B1M B;  3A6N B;  1P3L C;  1ZLA B;  3C1B D;  3W99 D;  3REH C;  3AZL B;  2NZD C;  2Y2Q A;  3X1S A;  5JRG B;  1JFI B;  5B0Z C;  3C1B C;  1P3B D;  3AZM D;  3AL0 C;  5DNM A;  2Y2M A;  5DNM B;  4R8P C;  3UTA C;  1HTA A;  1M1A A;  1KX3 D;  4QLC A;  1M19 A;  3W97 C;  3REJ B;  2ZM5 A;  2Y2H A;  3REL B;  4KHA A;  1P3A D;  4LD9 A;  3MGS D;  3UTB C;  1HQ3 B;  5B2I C;  3UTA B;  3AZK D;  3B0C T;  1N1J A;  5B32 D;  4WU8 D;  4H9R B;  3LEL C;  5GXQ D;  3W98 C;  4Z66 B;  3X1V C;  4XZQ B;  4YS3 C;  5B40 B;  4JJN C;  3TU4 C;  1KX4 B;  3REK D;  5B33 D;  4J8U D;  4WU9 D;  2JCH A;  4WJ3 C;  4X23 C;  5KDM A;  3AV1 A;  3V9R B;  4UPK A;  3X1T B;  4WU8 A;  1T3U A;  5CPK B;  1U35 B;  4KUD C;  3REK B;  3X1U B;  1M18 B;  1P3F D;  3WTP D;  5CPI C;  1P3L B;  5B24 A;  3A1I A;  5BNV B;  2FJ7 B;  3B0C W;  3MGP A;  3B6F C;  3W96 C;  2BYK B;  3MNN D;  5CPI A;  1EQZ D;  1H3O A;  1P3A B;  5AVC B;  3KXB D;  2FJ7 C;  5CP6 D;  1P3O A;  1M1A B;  1TZY C;  3AZG C;  1ID3 D;  4ZUX B;  3KUY D;  3AZF B;  2G5H C;  3REH D;  3R45 A;  5B31 G;  3REL C;  3X1S B;  5JRG A;  1JFI A;  1S32 D;  5B1L B;  5AY8 C;  4Z66 A;  3AZJ B;  4ZUX C;  1TZY B;  3LZ1 D;  2F8N A;  3C1C B;  3AZN C;  3X1T C;  3V9R A;  3WAA D;  3REJ D;  4YM6 A;  3TU4 D;  3AZM C;  4X23 B;  4KHA B;  3WAA B;  1KX4 A;  1BH8 A;  5AV5 A;  2F8N D;  5GSU D;  4H9P B;  3LZ0 B;  5B1M A;  5B24 D;  1ZLA A;  2NQB B;  1B67 A;  1P3I C;  3LZ0 D;  4XUJ C;  3MGQ B;  3VH6 T;  3MGQ A;  5DNN A;  3AV2 B;  3KWQ C;  4J8V A;  3KUY B;  3AZF D;  2HIO B;  5B1M D;  3AZN D;  1ZLA D;  3KSY A;  1M1A D;  2PYO B;  5AV8 D;  3W97 A;  1F66 C;  3B6G A;  4LD9 D;  5B0Y D;  4EO5 C; 
#chains in the Genus database with same CATH homology
 4QLC B;  1S32 C;  1AOI B;  2F8N K;  3KWQ B;  3EPL A;  3H0R C;  4J8V D;  1BFM A;  3AYW C;  1P3O C;  2G5I C;  3UTB A;  3WTP E;  1ID3 C;  3W99 A;  3REK A;  5GT0 A;  3LEL A;  4E44 A;  5B33 C;  5CPI B;  3WTP B;  2CV5 C;  2HUE B;  2YFV B;  3EG5 B;  1HQ3 C;  3AZH D;  4H9N A;  5CP6 B;  1KX3 A;  3AN2 A;  1P3G D;  3NQJ B;  4KUD A;  3AZH C;  4XZQ C;  5AVB A;  3LZ0 C;  3X1T A;  2CV5 B;  4WU8 B;  5CPK A;  1U35 A;  3UT9 A;  5GXQ B;  2FFF B;  3AN2 D;  1P3G A;  3AZE C;  5DNM C;  5B2J B;  4YS3 D;  3AZI B;  5CPK D;  1U35 D;  4UUZ B;  2YFW B;  3H0M C;  3X1T D;  4WU9 C;  4EO5 B;  3X1U C;  3WAA A;  5AV8 B;  4G91 C;  3W98 D;  5B40 D;  1P3O D;  4J8U A;  3KWQ A;  3WA9 B;  4J8U B;  5B2J C;  4J8X D;  4JJN A;  3LZ1 C;  3REL A;  5B2I A;  3LJA B;  4Z5T C;  3WAA C;  4KGC B;  5B32 B;  5B24 B;  5AV9 D;  1P3L A;  3W97 D;  3P5J B;  4G92 B;  5GT0 D;  3AYW A;  3W99 B;  4H9Q B;  4J8W A;  3X1S C;  1TAF A;  2L5A A;  5CP6 C;  3EPH A;  1P3I D;  5AV8 A;  3MGR D;  4E45 A;  4Z5T B;  3O62 A;  1EQZ C;  5C3I B;  5DNN D;  3AZJ D;  5DNM D;  5GT3 C;  3AFA C;  1P3I A;  1P3B B;  5GSU A;  4XUJ A;  3AZH A;  2Y2K A;  3AYW B;  2ARO C;  3AZI D;  5AVB C;  3LZ0 A;  4X23 D;  3TU4 B;  5B40 C;  3AZE A;  1P3P C;  4Z66 C;  3X1V B;  2CV5 D;  2DQN C;  5B1L C;  3EPJ A;  3X1U A;  1P3P A;  1ID3 A;  3NQU B;  5AV6 B;  2VQR A;  5B1L D;  1BH9 A;  5BNX B;  5F99 D;  4M6B A;  2F2A C;  3AZE D;  5AY8 A;  3AZN B;  2PYO D;  3KXB A;  5AV5 C;  3LEL D;  3MVD B;  5B1M C;  2RVQ D;  3MGQ D;  1ZLA C;  1P3P D;  3WKJ D;  5B2I D;  3UT9 D;  1KX4 C;  4R8P D;  3KWQ D;  3WKJ C;  3WA9 C;  1AOI D;  5CP6 A;  4KUD D;  2JE5 A;  3NQU A;  3VH6 W;  5AV8 C;  1F66 D;  1P3B A;  4NFT A;  5F99 C;  4WNN A;  4NE3 A;  5GT0 B;  3AYW D;  4KGC A;  3AZL A;  5B31 C;  3TU4 A;  1F66 A;  5E5A B;  3REJ C;  3KUY A;  3B6F B;  2NZD D;  5AV9 C;  1P34 A;  1S32 B;  1S32 A;  4ZBJ C;  1TAF B;  5CHL B;  3REH B;  4H9S A;  3AZL C;  5B40 A;  1ID3 B;  3MGR B;  3REJ A;  3AZM B;  2ZY3 A;  1WWI A;  3AZM A;  1P34 D;  3AZF C;  3AZG B;  1TZY D;  3MGQ C;  4NE6 A;  4YS3 B;  3VH5 W;  5CPK C;  1U35 C;  5GT3 D;  5AY8 B;  5BNV A;  1W2E A;  2FJ7 A;  1Q9C A;  2ARO B;  5CPJ A;  2F8N G;  4UUZ A;  3LJA C;  5JA4 B;  3REI C;  1KX3 B;  1M19 B;  4J8X B;  3B6G C;  2Y2J A;  1F1E A;  5BT1 D;  1P3K A;  1AOI A;  3MGP D;  1P3F C;  3W99 C;  2BYM A;  1P3M B;  3A6N C;  3KXB B;  4WU9 B;  3FDD A;  5AVC C;  5GXQ A;  3MVD D;  3WKJ A;  5GT0 C;  4ZUX A;  1BH9 B;  4XUJ B;  4J8W D;  3A6N A;  5BO0 A;  4H9Q A;  4J8W B;  3WTP C;  5B31 D;  4H9N B;  3MVD A;  4KGC C;  2F8N H;  4R8P B;  3AZG D;  3MGR A;  2ZY2 A;  5FUG B;  4Z5T A;  1KX5 A;  4QLC D;  3MNN C;  3KUY C;  5AVB B;  3AN2 C;  5G49 B;  4AWL C;  1M18 A;  5BS7 C;  3NQJ A;  5B0Y C;  5CPI D;  2Y2N A;  3UT9 C;  3B6F D;  2NQB D;  3AZI A;  5AV6 C;  2RIQ A;  3UTA D;  4HGA B;  3AZK B;  1HQ3 D;  4AWL B;  3REH A;  2NQB C;  4H9O A;  5FUG A;  3C1B B;  1KX5 B;  4H9O B;  3C1B A;  3B6F A;  5KDM B;  3C1C A;  3X1V D;  1P34 B;  2BYM B;  1P3M A;  4DRA A;  1P3B C;  3REK C;  5GSU C;  3REI A;  3LJA A;  4LD9 B;  4J8X A;  2PYO C;  5B32 A;  3VH5 T;  2Y2P A;  4HGA C;  3C1C C;  3MGS A;  3W96 B;  5CPJ B;  5B2I B;  2BYK A;  4KGC D;  5GXQ C;  1Z2C B;  5CPJ D;  4LD9 C;  3LEL B;  5DNN B;  4J8W C;  3AV2 A;  2F8N B;  5E5A A;  3WA9 D;  3MGS C;  3UTB D;  1P3O B;  3O62 C;  1EQZ A;  1P3K D;  2LY8 A;  5B0Z A;  1P3A C;  5B0Z B;  2Y2I A;  3AFA D;  2BG1 A;  3H0L C;  3W98 A;  3REI B;  5AVC D;  3MVD C;  1P3G C;  3AV2 C;  2JSS A;  1M1A C;  3WA9 A;  2XD5 A;  3AZN A;  3MNN A;  3B6G D;  5BT1 C;  5AV9 B;  3AV1 C;  5B24 C;  2UWX A;  3MGP C;  3VH6 A;  2Y2O A;  3WKJ B;  4XUJ D;  1M18 C;  3X1S D;  3AV1 D;  3UTA A;  5B2J A;  2ZY4 A;  5B1L A;  1M18 D;  5BO0 B;  4QLC C;  3LZ1 A;  4ZUX D;  1P3K C;  1R4V A;  3VH5 A;  1P34 C;  5B33 B;  1BH8 B;  5BNX A;  5B2J D;  2Y2G A;  3MNN B;  2RVQ C;  2ARO D;  3AZG A;  5AY8 D;  4CSR B;  5GT3 B;  2IO5 C;  3KXB C;  2FJ7 D;  3X1U D;  4Z2M H;  3MGS B;  1P3F B;  3REL D;  2XD1 A;  3W97 B;  1KX5 C;  1P3M D;  5B33 A;  3AFA A;  4YM6 C;  4R8P A;  3LJA D;  1M19 D;  4CAY B;  1ULY A;  4WV4 B;  4CAY A;  4Z2M G;  4XZQ D;  1KX4 D;  4Z66 D;  3AV1 B;  3IP4 C;  2IO5 B;  1AOI C;  3AV2 D;  3W98 B;  1KX3 C;  2NZD B;  5JRG D;  5CPJ C;  3W96 D;  5AV5 B;  4J8V B;  3AZL D;  3F6T A;  5JRG C;  4G91 B;  3O62 D;  5AV5 D;  5B0Y B;  1P3M C;  5B0Z D;  3AFA B;  5DNN C;  1F66 B;  1P3K B;  1TZY A;  4KUD B;  4G92 C;  3C1C D;  3X1V A;  5AVC A;  4WZS B;  3B0D C;  4J8V C;  5B32 C;  2W8S A;  4WNN B;  2CWE A;  3MGR C;  1A7W A;  4X23 A;  3AZK C;  2NZD A;  1P3G B;  5E5A D;  3AZF A;  4WU8 C;  3R45 B;  3WTP A;  5GSU B;  2CV5 A;  3A6N D;  2YFW A;  3A1K A;  3AZK A;  4DQY B;  3AZJ A;  1HQ3 A;  1M19 C;  3AZI C;  5AV6 D;  3AN2 B;  5AVB D;  1H3O B;  5C3I C;  1P3A A;  5F99 A;  1P3F A;  2YFV A;  2HUE C;  4DRB A;  1KX5 D;  2Y2L A;  3LZ1 B;  4JJN B;  4YM6 B;  4XZQ A;  4NE5 A;  5G49 A;  4YM6 D;  3UT9 B;  3AZJ C;  4JJN D;  5B32 G;  5B31 A;  1P3P B;  5AV6 A;  2J8P A;  3AZH B;  1N1J B;  2HIO C;  3UTB B;  5AV9 A;  1P3L D;  2NQB A;  4CSR A;  5GT3 A;  4H9S C;  4YS3 A;  5JA4 A;  3KFU G;  3AZE B;  3MGP B;  5F99 B;  2HIO A;  2ARO A;  3B0D B;  4H9R A;  4J8X C;  1EQZ B;  1WWS A;  2PYO A;  3B6G B;  1PZR A;  1KU5 A;  5E5A C;  3B0B A;  4WU9 A;  5B0Y A;  5BS7 A;  1B6W A;  4Z5T D;  2DF4 C;  5B31 B;  3REI D;  1P3I B;  4ZBJ B;  3EPK A;  4J8U C;  4H9P A;  3O62 B;  2HIO D;  2ZY5 A;  3W96 A;  5B1M B;  3A6N B;  1P3L C;  1ZLA B;  3C1B D;  3W99 D;  3REH C;  3AZL B;  2NZD C;  2Y2Q A;  3X1S A;  5JRG B;  1JFI B;  5B0Z C;  3C1B C;  1P3B D;  3AZM D;  3AL0 C;  5DNM A;  2Y2M A;  5DNM B;  4R8P C;  3UTA C;  1HTA A;  1M1A A;  1KX3 D;  4QLC A;  1M19 A;  3W97 C;  3REJ B;  2ZM5 A;  2Y2H A;  3REL B;  4KHA A;  1P3A D;  4LD9 A;  3MGS D;  3UTB C;  1HQ3 B;  5B2I C;  3UTA B;  3AZK D;  3B0C T;  1N1J A;  5B32 D;  4WU8 D;  4H9R B;  3LEL C;  5GXQ D;  3W98 C;  4Z66 B;  3X1V C;  4XZQ B;  4YS3 C;  5B40 B;  4JJN C;  3TU4 C;  1KX4 B;  3REK D;  5B33 D;  4J8U D;  4WU9 D;  2JCH A;  4WJ3 C;  4X23 C;  5KDM A;  3AV1 A;  3V9R B;  4UPK A;  3X1T B;  4WU8 A;  1T3U A;  5CPK B;  1U35 B;  4KUD C;  3REK B;  3X1U B;  1M18 B;  1P3F D;  3WTP D;  5CPI C;  1P3L B;  5B24 A;  3A1I A;  5BNV B;  2FJ7 B;  3B0C W;  3MGP A;  3B6F C;  3W96 C;  2BYK B;  3MNN D;  5CPI A;  1EQZ D;  1H3O A;  1P3A B;  5AVC B;  3KXB D;  2FJ7 C;  5CP6 D;  1P3O A;  1M1A B;  1TZY C;  3AZG C;  1ID3 D;  4ZUX B;  3KUY D;  3AZF B;  2G5H C;  3REH D;  3R45 A;  5B31 G;  3REL C;  3X1S B;  5JRG A;  1JFI A;  1S32 D;  5B1L B;  5AY8 C;  4Z66 A;  3AZJ B;  4ZUX C;  1TZY B;  3LZ1 D;  2F8N A;  3C1C B;  3AZN C;  3X1T C;  3V9R A;  3WAA D;  3REJ D;  4YM6 A;  3TU4 D;  3AZM C;  4X23 B;  4KHA B;  3WAA B;  1KX4 A;  1BH8 A;  5AV5 A;  2F8N D;  5GSU D;  4H9P B;  3LZ0 B;  5B1M A;  5B24 D;  1ZLA A;  2NQB B;  1B67 A;  1P3I C;  3LZ0 D;  4XUJ C;  3MGQ B;  3VH6 T;  3MGQ A;  5DNN A;  3AV2 B;  3KWQ C;  4J8V A;  3KUY B;  3AZF D;  2HIO B;  5B1M D;  3AZN D;  1ZLA D;  3KSY A;  1M1A D;  2PYO B;  5AV8 D;  3W97 A;  1F66 C;  3B6G A;  4LD9 D;  5B0Y D;  4EO5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...