4XZQB

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xzqB00
5B33C 2AROA 1TZYC 5B1LD 4H9SA 5AV8C 3LZ1B 1M19B 1M1AA 5AV5D 1P3FA 1ZLAA 3W96D 4YM6A 3LELC 5B2JC 5AVCA 3LZ0D 3AV1C 1JFIB 1KX5A 5B24B 3MNND 4X23B 5DNNA 2HUEC 2BYKA 1F66A 4H9RA 5B1MB 5DNMA 3AZID 3AZFD 3W97D 5B2IC 3X1VA 2CV5A 5JA4A 5CPJD 3X1TA 1P3BC 3X1SB 1P34B 3MGRD 5AY8C 3AN2B 1P3AB 5GT3A 1P3OC 4WU8D 3V9RB 4JJND 2F8NH 3MVDD 5AV6D 3O62A 4LD9A 2AROC 4XZQB 1ID3A 5AVBB 5AV9D 1M1AC 1P3FC 4J8VD 4H9QB 3A6NC 3AFAB 5AVCC 3REKD 1KX5C 4E45A 1P3KB 2CV5B 3WKJD 4KGCD 4QLCD 1B67A 5CPIB 5DNNC 4KUDA 1WWIA 1F66C 2NQBA 5B31A 3X1VC 4J8WB 2CV5C 3KSYA 3KXBA 3X1TC 5CP6B 3B6GB 4NFTA 3AZHB 5E5AB 1N1JA 3RELA 3MGPA 3WAAD 1HQ3A 3TU4D 3O62C 4LD9C 3AZMD 1ID3C 2FJ7A 3AZKD 4NE6A 1P3MD 4ZUXD 3W99A 4J8UA 5BO0A 3REJD 3WA9D 3NQJA 1P3LB 3AZNB 3WTPE 3WTPA 4AWLB 1KX3D 5B33D 4Z66B 5GXQA 4KUDC 3UT9A 4Z2MG 4KHAA 1TZYD 2NQBC 1AOIA 1BFMA 4Z5TB 3B6FD 3AV2B 3REHA 1P3GD 2PYOA 4NE3A 3REIB 3MGPC 3RELC 5B40A 2JSSA 5B24A 3VH6W 3MGSA 2FJ7C 3X1UB 4J8XA 3AZLD 5BNXB 1P3BD 3W99C 4J8UC 1S32D 3LJAA 3KUYD 3MGQA 1P3LD 3X1SA 5B1LB 3AZEC 4R8PB 4UUZB 2HIOA 3WTPC 5AV5B 5F99A 4G92B 3AN2A 5GXQC 3W96B 3UT9C 4H9NB 3LZ0B 5GSUA 3LELA 4WV4B 4H9PB 3C1CA 1AOIC 1EQZA 3AV1A 1P3FD 1ZLAD 3MNNB 3AZJA 4XUJA 4YM6D 3VH6T 5AVCD 1KX5D 2RVQC 3AZFB 3REHC 3W97B 2PYOC 4YS3A 3KWQA 5B2IA 5B40C 5CPJB 5DNND 1Q9CA 5B24C 3MGSC 4HGAB 5DNMD 2L5AA 5B0YA 3MGRB 4X23C 5B31G 5CPIA 3X1VD 1P3IB 4M6BA 3AZGA 3X1TD 4G91C 4WU8B 4JJNB 3MVDB 3LJAC 5AV6B 3B0DB 5GT3D 3X1SC 5AV9B 2HIOC 4R8PD 5F99C 3AN2C 4J8VB 3O62D 4LD9D 3VH5A 1ID3D 5GSUC 3A6NA 3REKB 1EQZC 4CAYB 3VH5T 3C1CC 4KGCB 3AZJC 3WKJB 4Z2MH 4XUJC 4QLCB 5G49B 5FUGB 3AFAC 4YS3C 1H3OA 3AZNA 1P3PA 3KWQC 3UTAA 4KUDD 5C3IB 2NQBD 5CHLB 5B0YC 5B31D 1M18A 5CPIC 4Z66A 3NQUB 3AZGC 3KXBD 1P3ID 5CPKD 3AYWB 3WAAB 4J8WC 3TU4B 1BH8A 3AZMB 3AZKB 1P3MB 4ZUXB 3RELD 1U35B 1HQ3D 3REJB 3WA9B 2FJ7D 4CSRA 2F8NA 3W99D 4H9OB 5KDMA 1KX3B 5B33B 2IO5C 5BNVB 1TZYB 3WTPD 3C1BA 3AZNC 1P3PC 3UTAC 5GXQD 3UT9D 3B6FB 2YFVB 1M18C 1AOID 2CWEA 4Z66C 1HTAA 1P3GB 3LZ0A 2HUEB 2NZDA 3UTBA 3AYWD 4WZSB 2RVQD 3REHD 3AZLB 2PYOD 5JRGA 5B40D 1P3BB 5B32A 3AZIA 3AZFA 1U35D 1S32B 3R45B 5GT0A 4WNNB 4J8XD 3KUYB 1P3OB 1BH9B 5B0ZA 4E44A 3X1UC 3AZEA 4EO5C 3LJAD 3W98A 5BS7C 2AROB 3MGQD 4WU9A 1KX4A 2HIOD 5AV6A 1M1AB 1P3FB 5AV8D 5F99D 3C1BC 1ZLAB 4YM6B 2F8NK 5AVCB 5GSUD 3LELD 5B2JD 4ZBJC 3C1CD 1KX5B 3LZ1A 1M19A 3AV1D 3AZJD 3LZ0C 1JFIA 5DNNB 2BYKB 3UTBC 4H9RB 1F66B 2NZDC 5DNMB 3X1VB 4YS3D 5G49A 4X23A 1F1EA 5JA4B 5JRGC 5B2ID 3KWQD 3X1TB 5B32C 3AZFC 3AZIC 5B1MA 5GT0C 5B0YD 5CPJC 5GT3B 3AZGD 5AY8D 4HGAC 5B0ZC 1P3OD 3MGRC 1P34A 3O62B 3W98C 4LD9B 4WU8C 1ID3B 1P3AA 4WU9C 1KX4C 3WAAA 2AROD 3V9RA 5AV6C 1M1AD 3VH6A 4XZQA 5AVBA 3A6ND 3LZ1C 4J8VC 1M19C 3WA9A 4H9QA 3AFAA 4KUDB 2BYMB 1P3KA 2NQBB 1F66D 5B31B 1KU5A 1P3PD 1R4VA 3KXBB 3UTAD 2CV5D 5CPKB 5B1MC 1M18D 4J8WA 1N1JB 2LY8A 5CP6A 3RELB 3MGPB 1P34C 3B6GA 1HQ3B 3AZHA 1WWSA 5E5AA 1P3GA 1P3AC 2FJ7B 3WAAC 3TU4C 3W99B 4J8UB 3B0BA 4XZQC 3NQJB 5AVBC 3WA9C 2YFWB 2F8ND 3WTPB 3KUYA 1P3LA 5GXQB 3UT9B 4KHAB 1P3KC 1AOIB 3C1BD 1B6WA 3REHB 3B6FC 2PYOB 4Z5TA 5CP6C 3B6GC 5B40B 3AZHC 5E5AC 3MGPD 3MGSB 3UTBD 3AV2A 1P3GC 2NZDD 4J8XB 1A7WA 3REIA 4G91B 5JRGD 5B32D 3AZLC 3X1UA 5GT0D 3LJAB 4J8UD 3MGQB 5BNXA 5BS7A 1S32C 5B0ZD 2HIOB 3AZED 5AV8B 5F99B 3KUYC 1P3LC 3W98D 4WU9D 5B1LA 1KX4D 5GSUB 4R8PA 4UUZA 5B2JB 3LELB 3C1CB 1EQZB 4AWLC 5AV5A 3AV1B 3AZJB 4XUJB 3W96A 4H9SC 4H9NA 1ZLAC 4H9PA 3LZ1D 1M19D 4YM6C 3MNNA 4Z5TC 4YS3B 3KWQB 5B2IB 5BT1C 3AV2C 5B0YB 1TAFB 5B24D 3MGSD 3W97A 3REIC 3AZGB 4X23D 5AY8B 2BYMA 5CPJA 5DNMC 5B1MD 3MGRA 1P3IA 4WU8A 5CPKA 3X1SD 4JJNA 1P34D 3MVDA 5GT3C 3AN2D 1P3AD 5B1LC 5AV9A 4R8PC 3A6NB 5AV5C 4DRBA 1EQZD 4G92C 4J8VA 3W96C 4XZQD 4XUJD 5AVBD 3REKA 2IO5B 4CAYA 3MNNC 4KGCA 3WKJA 4QLCA 1H3OB 3AFAD 1P3PB 3UTAB 2YFWA 5FUGA 1P3KD 1M18B 3W97C 4DRAA 5CPID 5B31C 3KXBC 1P3IC 1BH8B 4J8WD 3NQUA 5CPKC 3B0CW 4NE5A 5CP6D 3B6GD 4JJNC 3AYWA 3MVDC 3TU4A 3AZHD 1ULYA 3B0DC 5E5AD 3AZMA 4CSRB 5AV9C 3AZKA 1HQ3C 1P3MA 4ZUXA 1U35A 2F8NB 3REJA 5KDMB 4EO5B 2F8NG 3REKC 4KGCC 3WKJC 4QLCC 4H9OA 3C1BB 1KX3A 5B33A 3AZND 5BNVA 1TZYA 5AV8A 4ZBJB 3B0CT 4Z66D 5C3IC 5B2JA 3B6FA 2YFVA 2NZDB 3UTBB 4Z5TD 3AYWC 5JRGB 5B32B 3AZIB 5BT1D 3VH5W 3AZMC 3AV2D 5GT0B 5B32G 5BO0B 3AZKC 3AZLA 1P3MC 4ZUXC 3REID 1U35C 1P3BA 5B0ZB 1TAFA 4J8XC 3REJC 3R45A 3AZEB 1S32A 3X1UD 4WNNA 3W98B 5AY8A 1P3OA 1BH9A 4WU9B 1KX4B 1KX3C 3MGQC
chains in the Genus database with same CATH superfamily
5B33C 2AROA 3IP4C 1TZYC 5B1LD 4H9SA 5AV8C 3LZ1B 1M19B 1M1AA 5AV5D 1P3FA 1ZLAA 3W96D 4YM6A 3LELC 5B2JC 2Y2KA 5AVCA 3LZ0D 3AV1C 1JFIB 1KX5A 5B24B 3MNND 4X23B 5DNNA 2HUEC 2BYKA 4UPKA 4H9RA 1F66A 5B1MB 5DNMA 3AZID 3AZFD 3W97D 5B2IC 3X1VA 2CV5A 5JA4A 5CPJD 3X1TA 1P3BC 3X1SB 1P34B 3MGRD 5AY8C 3AN2B 1P3AB 5GT3A 1P3OC 4WU8D 3AL0C 3V9RB 4JJND 2F8NH 3MVDD 5AV6D 3O62A 4LD9A 2AROC 4XZQB 1ID3A 2XD1A 5AVBB 5AV9D 1M1AC 1P3FC 4J8VD 4H9QB 3A6NC 3AFAB 5AVCC 3REKD 1KX5C 4E45A 1P3KB 2CV5B 3WKJD 4KGCD 4QLCD 1B67A 5CPIB 5DNNC 4KUDA 1WWIA 3A1KA 2G5IC 1F66C 2NQBA 5B31A 3X1VC 4J8WB 2CV5C 3KSYA 3KXBA 3X1TC 5CP6B 3B6GB 4NFTA 3AZHB 5E5AB 1N1JA 3RELA 3MGPA 3WAAD 1HQ3A 3TU4D 3O62C 4LD9C 3AZMD 1ID3C 2FJ7A 3AZKD 4NE6A 1P3MD 4ZUXD 3W99A 4J8UA 5BO0A 3REJD 3WA9D 3NQJA 1P3LB 3A1IA 3AZNB 3WTPE 2ZY4A 3WTPA 4AWLB 1KX3D 5B33D 4Z66B 5GXQA 4KUDC 3EPHA 3UT9A 4Z2MG 4KHAA 1TZYD 2NQBC 1AOIA 1BFMA 3FDDA 4Z5TB 3B6FD 3AV2B 3REHA 1P3GD 2PYOA 4NE3A 3REIB 3MGPC 3RELC 5B40A 2JSSA 5B24A 3VH6W 3MGSA 2FJ7C 3X1UB 4J8XA 3AZLD 5BNXB 1P3BD 3W99C 4J8UC 1S32D 3LJAA 3KUYD 3MGQA 1P3LD 3X1SA 5B1LB 3AZEC 4R8PB 4UUZB 2HIOA 3WTPC 5AV5B 5F99A 4G92B 3AN2A 5GXQC 3W96B 3UT9C 4H9NB 3LZ0B 5GSUA 3LELA 4WV4B 4H9PB 3C1CA 1AOIC 3H0LC 1EQZA 3AV1A 1P3FD 1ZLAD 3MNNB 3AZJA 4XUJA 4YM6D 2ZY2A 3VH6T 5AVCD 1KX5D 2RVQC 3AZFB 3REHC 3W97B 2PYOC 4YS3A 3KWQA 5B2IA 5B40C 5CPJB 5DNND 1Q9CA 3H0MC 5B24C 3MGSC 4HGAB 5DNMD 2L5AA 5B0YA 3MGRB 4X23C 5B31G 5CPIA 3X1VD 1P3IB 4M6BA 3AZGA 3X1TD 4G91C 4WU8B 4JJNB 3MVDB 3LJAC 5AV6B 3B0DB 5GT3D 3X1SC 5AV9B 2HIOC 4R8PD 5F99C 3AN2C 4J8VB 3O62D 4LD9D 3VH5A 1ID3D 2FFFB 5GSUC 3A6NA 3REKB 1EQZC 4CAYB 3VH5T 3C1CC 4KGCB 3AZJC 3WKJB 4Z2MH 4XUJC 4QLCB 5G49B 5FUGB 2Y2NA 2DQNC 3AFAC 4YS3C 1H3OA 3AZNA 1P3PA 3KWQC 3UTAA 4KUDD 2Y2IA 5C3IB 2NQBD 5CHLB 5B0YC 5B31D 1M18A 5CPIC 4Z66A 3NQUB 3AZGC 3KXBD 1P3ID 5CPKD 3AYWB 3WAAB 4J8WC 3TU4B 1BH8A 3AZMB 3AZKB 2Y2JA 1P3MB 4ZUXB 3EPLA 3RELD 1U35B 1HQ3D 3H0RC 1T3UA 3REJB 3WA9B 2FJ7D 4CSRA 2F8NA 3W99D 4H9OB 5KDMA 1KX3B 5B33B 4WJ3C 2IO5C 5BNVB 1TZYB 3WTPD 3C1BA 3AZNC 1P3PC 3UTAC 5GXQD 3UT9D 3B6FB 2YFVB 1M18C 1AOID 2CWEA 4Z66C 1HTAA 1P3GB 3LZ0A 2HUEB 2NZDA 3UTBA 3AYWD 4WZSB 2RVQD 3REHD 3AZLB 2PYOD 5JRGA 5B40D 1P3BB 5B32A 3AZIA 3AZFA 1U35D 1S32B 3R45B 5GT0A 4WNNB 4J8XD 3KUYB 1P3OB 1BH9B 5B0ZA 4E44A 3X1UC 3AZEA 4EO5C 3LJAD 3W98A 5BS7C 2AROB 3MGQD 4WU9A 1PZRA 1KX4A 2HIOD 5AV6A 1M1AB 1P3FB 5AV8D 5F99D 3C1BC 1ZLAB 4YM6B 2F8NK 5AVCB 5GSUD 3LELD 5B2JD 4ZBJC 3C1CD 1KX5B 3LZ1A 1M19A 3AV1D 1W2EA 3AZJD 3LZ0C 1JFIA 2Y2LA 5DNNB 2BYKB 3UTBC 4H9RB 1F66B 2NZDC 5DNMB 3X1VB 4YS3D 5G49A 4X23A 1F1EA 5JA4B 5JRGC 5B2ID 3KWQD 3X1TB 5B32C 3AZFC 3AZIC 2JE5A 5B1MA 5GT0C 5B0YD 5CPJC 2XD5A 1Z2CB 5GT3B 3AZGD 5AY8D 4HGAC 5B0ZC 1P3OD 3MGRC 2G5HC 1P34A 3O62B 3W98C 4LD9B 4WU8C 1ID3B 1P3AA 4WU9C 1KX4C 3WAAA 2AROD 3V9RA 5AV6C 1M1AD 3VH6A 4XZQA 5AVBA 3A6ND 3LZ1C 4J8VC 1M19C 3WA9A 4H9QA 2Y2PA 3AFAA 4KUDB 2ZY3A 2BYMB 1P3KA 2NQBB 4DQYB 1F66D 5B31B 1KU5A 1P3PD 1R4VA 3KXBB 3UTAD 2CV5D 5CPKB 5B1MC 1M18D 4J8WA 1N1JB 2LY8A 5CP6A 3RELB 3MGPB 1P34C 3B6GA 1HQ3B 3AZHA 1WWSA 5E5AA 1P3GA 1P3AC 2FJ7B 3WAAC 3TU4C 3W99B 4J8UB 3B0BA 4XZQC 3NQJB 5AVBC 3WA9C 2YFWB 2F8ND 3WTPB 3KUYA 1P3LA 5GXQB 3UT9B 4KHAB 1P3KC 2DF4C 1AOIB 3C1BD 1B6WA 3REHB 3B6FC 2PYOB 4Z5TA 5CP6C 3B6GC 2BG1A 5B40B 3AZHC 5E5AC 3MGPD 3MGSB 3UTBD 3AV2A 1P3GC 2NZDD 4J8XB 1A7WA 3REIA 4G91B 5JRGD 5B32D 3AZLC 3X1UA 5GT0D 3LJAB 4J8UD 3MGQB 5BNXA 5BS7A 1S32C 5B0ZD 2HIOB 3AZED 5AV8B 5F99B 3KUYC 1P3LC 3KFUG 3W98D 4WU9D 5B1LA 1KX4D 5GSUB 4R8PA 4UUZA 5B2JB 3LELB 3C1CB 1EQZB 4AWLC 5AV5A 3AV1B 3AZJB 4XUJB 3W96A 4H9SC 4H9NA 1ZLAC 4H9PA 2J8PA 3LZ1D 1M19D 4YM6C 3MNNA 4Z5TC 2Y2HA 4YS3B 2Y2GA 5B2IB 3KWQB 5BT1C 3AV2C 5B0YB 1TAFB 5B24D 3MGSD 3W97A 3REIC 3AZGB 4X23D 5AY8B 2BYMA 2JCHA 5DNMC 5CPJA 5B1MD 3MGRA 1P3IA 4WU8A 5CPKA 3EG5B 3X1SD 4JJNA 1P34D 3MVDA 5GT3C 3AN2D 1P3AD 5B1LC 5AV9A 4R8PC 3A6NB 5AV5C 4DRBA 1EQZD 4G92C 4J8VA 2F2AC 3W96C 4XZQD 4XUJD 5AVBD 3REKA 2IO5B 4CAYA 3F6TA 3MNNC 4KGCA 3WKJA 4QLCA 1H3OB 2ZY5A 3AFAD 1P3PB 3UTAB 2YFWA 5FUGA 1P3KD 1M18B 3W97C 4DRAA 5CPID 5B31C 3KXBC 1P3IC 1BH8B 4J8WD 3NQUA 5CPKC 3B0CW 4NE5A 5CP6D 3B6GD 4JJNC 3AYWA 3MVDC 3TU4A 3AZHD 1ULYA 3B0DC 5E5AD 3AZMA 4CSRB 5AV9C 3AZKA 1HQ3C 1P3MA 4ZUXA 1U35A 2Y2OA 2F8NB 3REJA 5KDMB 4EO5B 2F8NG 3REKC 4KGCC 3WKJC 4QLCC 3P5JB 4H9OA 3C1BB 1KX3A 2ZM5A 5B33A 2Y2MA 3AZND 5BNVA 1TZYA 5AV8A 4ZBJB 3B0CT 2W8SA 4Z66D 5C3IC 5B2JA 3B6FA 2YFVA 2NZDB 3UTBB 3EPKA 3EPJA 2RIQA 4Z5TD 3AYWC 5JRGB 5B32B 3AZIB 5BT1D 3VH5W 3AZMC 3AV2D 2UWXA 5GT0B 5B32G 5BO0B 3AZKC 3AZLA 1P3MC 4ZUXC 3REID 1U35C 1P3BA 5B0ZB 2Y2QA 1TAFA 4J8XC 3REJC 3R45A 3AZEB 1S32A 3X1UD 4WNNA 2VQRA 3W98B 5AY8A 1P3OA 1BH9A 4WU9B 1KX4B 1KX3C 3MGQC
chains in the Genus database with same CATH topology
5B33C 2AROA 3IP4C 1TZYC 5B1LD 4H9SA 5AV8C 3LZ1B 1M19B 1M1AA 5AV5D 1P3FA 1ZLAA 3W96D 4YM6A 3LELC 5B2JC 2Y2KA 5AVCA 3LZ0D 3AV1C 1JFIB 1KX5A 5B24B 3MNND 4X23B 5DNNA 2HUEC 2BYKA 4UPKA 4H9RA 1F66A 5B1MB 5DNMA 3AZID 3AZFD 3W97D 5B2IC 3X1VA 2CV5A 5JA4A 5CPJD 3X1TA 1P3BC 3X1SB 1P34B 3MGRD 5AY8C 3AN2B 1P3AB 5GT3A 1P3OC 4WU8D 3AL0C 3V9RB 4JJND 2F8NH 3MVDD 5AV6D 3O62A 4LD9A 2AROC 4XZQB 1ID3A 2XD1A 5AVBB 5AV9D 1M1AC 1P3FC 4J8VD 4H9QB 3A6NC 3AFAB 5AVCC 3REKD 1KX5C 4E45A 1P3KB 2CV5B 3WKJD 4KGCD 4QLCD 1B67A 5CPIB 5DNNC 4KUDA 1WWIA 3A1KA 2G5IC 1F66C 2NQBA 5B31A 3X1VC 4J8WB 2CV5C 3KSYA 3KXBA 3X1TC 5CP6B 3B6GB 4NFTA 3AZHB 5E5AB 1N1JA 3RELA 3MGPA 3WAAD 1HQ3A 3TU4D 3O62C 4LD9C 3AZMD 1ID3C 2FJ7A 3AZKD 4NE6A 1P3MD 4ZUXD 3W99A 4J8UA 5BO0A 3REJD 3WA9D 3NQJA 1P3LB 3A1IA 3AZNB 3WTPE 2ZY4A 3WTPA 4AWLB 1KX3D 5B33D 4Z66B 5GXQA 4KUDC 3EPHA 3UT9A 4Z2MG 4KHAA 1TZYD 2NQBC 1AOIA 1BFMA 3FDDA 4Z5TB 3B6FD 3AV2B 3REHA 1P3GD 2PYOA 4NE3A 3REIB 3MGPC 3RELC 5B40A 2JSSA 5B24A 3VH6W 3MGSA 2FJ7C 3X1UB 4J8XA 3AZLD 5BNXB 1P3BD 3W99C 4J8UC 1S32D 3LJAA 3KUYD 3MGQA 1P3LD 3X1SA 5B1LB 3AZEC 4R8PB 4UUZB 2HIOA 3WTPC 5AV5B 5F99A 4G92B 3AN2A 5GXQC 3W96B 3UT9C 4H9NB 3LZ0B 5GSUA 3LELA 4WV4B 4H9PB 3C1CA 1AOIC 3H0LC 1EQZA 3AV1A 1P3FD 1ZLAD 3MNNB 3AZJA 4XUJA 4YM6D 2ZY2A 3VH6T 5AVCD 1KX5D 2RVQC 3AZFB 3REHC 3W97B 2PYOC 4YS3A 3KWQA 5B2IA 5B40C 5CPJB 5DNND 1Q9CA 3H0MC 5B24C 3MGSC 4HGAB 5DNMD 2L5AA 5B0YA 3MGRB 4X23C 5B31G 5CPIA 3X1VD 1P3IB 4M6BA 3AZGA 3X1TD 4G91C 4WU8B 4JJNB 3MVDB 3LJAC 5AV6B 3B0DB 5GT3D 3X1SC 5AV9B 2HIOC 4R8PD 5F99C 3AN2C 4J8VB 3O62D 4LD9D 3VH5A 1ID3D 2FFFB 5GSUC 3A6NA 3REKB 1EQZC 4CAYB 3VH5T 3C1CC 4KGCB 3AZJC 3WKJB 4Z2MH 4XUJC 4QLCB 5G49B 5FUGB 2Y2NA 2DQNC 3AFAC 4YS3C 1H3OA 3AZNA 1P3PA 3KWQC 3UTAA 4KUDD 2Y2IA 5C3IB 2NQBD 5CHLB 5B0YC 5B31D 1M18A 5CPIC 4Z66A 3NQUB 3AZGC 3KXBD 1P3ID 5CPKD 3AYWB 3WAAB 4J8WC 3TU4B 1BH8A 3AZMB 3AZKB 2Y2JA 1P3MB 4ZUXB 3EPLA 3RELD 1U35B 1HQ3D 3H0RC 1T3UA 3REJB 3WA9B 2FJ7D 4CSRA 2F8NA 3W99D 4H9OB 5KDMA 1KX3B 5B33B 4WJ3C 2IO5C 5BNVB 1TZYB 3WTPD 3C1BA 3AZNC 1P3PC 3UTAC 5GXQD 3UT9D 3B6FB 2YFVB 1M18C 1AOID 2CWEA 4Z66C 1HTAA 1P3GB 3LZ0A 2HUEB 2NZDA 3UTBA 3AYWD 4WZSB 2RVQD 3REHD 3AZLB 2PYOD 5JRGA 5B40D 1P3BB 5B32A 3AZIA 3AZFA 1U35D 1S32B 3R45B 5GT0A 4WNNB 4J8XD 3KUYB 1P3OB 1BH9B 5B0ZA 4E44A 3X1UC 3AZEA 4EO5C 3LJAD 3W98A 5BS7C 2AROB 3MGQD 4WU9A 1PZRA 1KX4A 2HIOD 5AV6A 1M1AB 1P3FB 5AV8D 5F99D 3C1BC 1ZLAB 4YM6B 2F8NK 5AVCB 5GSUD 3LELD 5B2JD 4ZBJC 3C1CD 1KX5B 3LZ1A 1M19A 3AV1D 1W2EA 3AZJD 3LZ0C 1JFIA 2Y2LA 5DNNB 2BYKB 3UTBC 4H9RB 1F66B 2NZDC 5DNMB 3X1VB 4YS3D 5G49A 4X23A 1F1EA 5JA4B 5JRGC 5B2ID 3KWQD 3X1TB 5B32C 3AZFC 3AZIC 2JE5A 5B1MA 5GT0C 5B0YD 5CPJC 2XD5A 1Z2CB 5GT3B 3AZGD 5AY8D 4HGAC 5B0ZC 1P3OD 3MGRC 2G5HC 1P34A 3O62B 3W98C 4LD9B 4WU8C 1ID3B 1P3AA 4WU9C 1KX4C 3WAAA 2AROD 3V9RA 5AV6C 1M1AD 3VH6A 4XZQA 5AVBA 3A6ND 3LZ1C 4J8VC 1M19C 3WA9A 4H9QA 2Y2PA 3AFAA 4KUDB 2ZY3A 2BYMB 1P3KA 2NQBB 4DQYB 1F66D 5B31B 1KU5A 1P3PD 1R4VA 3KXBB 3UTAD 2CV5D 5CPKB 5B1MC 1M18D 4J8WA 1N1JB 2LY8A 5CP6A 3RELB 3MGPB 1P34C 3B6GA 1HQ3B 3AZHA 1WWSA 5E5AA 1P3GA 1P3AC 2FJ7B 3WAAC 3TU4C 3W99B 4J8UB 3B0BA 4XZQC 3NQJB 5AVBC 3WA9C 2YFWB 2F8ND 3WTPB 3KUYA 1P3LA 5GXQB 3UT9B 4KHAB 1P3KC 2DF4C 1AOIB 3C1BD 1B6WA 3REHB 3B6FC 2PYOB 4Z5TA 5CP6C 3B6GC 2BG1A 5B40B 3AZHC 5E5AC 3MGPD 3MGSB 3UTBD 3AV2A 1P3GC 2NZDD 4J8XB 1A7WA 3REIA 4G91B 5JRGD 5B32D 3AZLC 3X1UA 5GT0D 3LJAB 4J8UD 3MGQB 5BNXA 5BS7A 1S32C 5B0ZD 2HIOB 3AZED 5AV8B 5F99B 3KUYC 1P3LC 3KFUG 3W98D 4WU9D 5B1LA 1KX4D 5GSUB 4R8PA 4UUZA 5B2JB 3LELB 3C1CB 1EQZB 4AWLC 5AV5A 3AV1B 3AZJB 4XUJB 3W96A 4H9SC 4H9NA 1ZLAC 4H9PA 2J8PA 3LZ1D 1M19D 4YM6C 3MNNA 4Z5TC 2Y2HA 4YS3B 2Y2GA 5B2IB 3KWQB 5BT1C 3AV2C 5B0YB 1TAFB 5B24D 3MGSD 3W97A 3REIC 3AZGB 4X23D 5AY8B 2BYMA 2JCHA 5DNMC 5CPJA 5B1MD 3MGRA 1P3IA 4WU8A 5CPKA 3EG5B 3X1SD 4JJNA 1P34D 3MVDA 5GT3C 3AN2D 1P3AD 5B1LC 5AV9A 4R8PC 3A6NB 5AV5C 4DRBA 1EQZD 4G92C 4J8VA 2F2AC 3W96C 4XZQD 4XUJD 5AVBD 3REKA 2IO5B 4CAYA 3F6TA 3MNNC 4KGCA 3WKJA 4QLCA 1H3OB 2ZY5A 3AFAD 1P3PB 3UTAB 2YFWA 5FUGA 1P3KD 1M18B 3W97C 4DRAA 5CPID 5B31C 3KXBC 1P3IC 1BH8B 4J8WD 3NQUA 5CPKC 3B0CW 4NE5A 5CP6D 3B6GD 4JJNC 3AYWA 3MVDC 3TU4A 3AZHD 1ULYA 3B0DC 5E5AD 3AZMA 4CSRB 5AV9C 3AZKA 1HQ3C 1P3MA 4ZUXA 1U35A 2Y2OA 2F8NB 3REJA 5KDMB 4EO5B 2F8NG 3REKC 4KGCC 3WKJC 4QLCC 3P5JB 4H9OA 3C1BB 1KX3A 2ZM5A 5B33A 2Y2MA 3AZND 5BNVA 1TZYA 5AV8A 4ZBJB 3B0CT 2W8SA 4Z66D 5C3IC 5B2JA 3B6FA 2YFVA 2NZDB 3UTBB 3EPKA 3EPJA 2RIQA 4Z5TD 3AYWC 5JRGB 5B32B 3AZIB 5BT1D 3VH5W 3AZMC 3AV2D 2UWXA 5GT0B 5B32G 5BO0B 3AZKC 3AZLA 1P3MC 4ZUXC 3REID 1U35C 1P3BA 5B0ZB 2Y2QA 1TAFA 4J8XC 3REJC 3R45A 3AZEB 1S32A 3X1UD 4WNNA 2VQRA 3W98B 5AY8A 1P3OA 1BH9A 4WU9B 1KX4B 1KX3C 3MGQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B33 C;  2ARO A;  1TZY C;  5B1L D;  4H9S A;  5AV8 C;  3LZ1 B;  1M19 B;  1M1A A;  5AV5 D;  1P3F A;  1ZLA A;  3W96 D;  4YM6 A;  3LEL C;  5B2J C;  5AVC A;  3LZ0 D;  3AV1 C;  1JFI B;  1KX5 A;  5B24 B;  3MNN D;  4X23 B;  5DNN A;  2HUE C;  2BYK A;  1F66 A;  4H9R A;  5B1M B;  5DNM A;  3AZI D;  3AZF D;  3W97 D;  5B2I C;  3X1V A;  2CV5 A;  5JA4 A;  5CPJ D;  3X1T A;  1P3B C;  3X1S B;  1P34 B;  3MGR D;  5AY8 C;  3AN2 B;  1P3A B;  5GT3 A;  1P3O C;  4WU8 D;  3V9R B;  4JJN D;  2F8N H;  3MVD D;  5AV6 D;  3O62 A;  4LD9 A;  2ARO C;  4XZQ B;  1ID3 A;  5AVB B;  5AV9 D;  1M1A C;  1P3F C;  4J8V D;  4H9Q B;  3A6N C;  3AFA B;  5AVC C;  3REK D;  1KX5 C;  4E45 A;  1P3K B;  2CV5 B;  3WKJ D;  4KGC D;  4QLC D;  1B67 A;  5CPI B;  5DNN C;  4KUD A;  1WWI A;  1F66 C;  2NQB A;  5B31 A;  3X1V C;  4J8W B;  2CV5 C;  3KSY A;  3KXB A;  3X1T C;  5CP6 B;  3B6G B;  4NFT A;  3AZH B;  5E5A B;  1N1J A;  3REL A;  3MGP A;  3WAA D;  1HQ3 A;  3TU4 D;  3O62 C;  4LD9 C;  3AZM D;  1ID3 C;  2FJ7 A;  3AZK D;  4NE6 A;  1P3M D;  4ZUX D;  3W99 A;  4J8U A;  5BO0 A;  3REJ D;  3WA9 D;  3NQJ A;  1P3L B;  3AZN B;  3WTP E;  3WTP A;  4AWL B;  1KX3 D;  5B33 D;  4Z66 B;  5GXQ A;  4KUD C;  3UT9 A;  4Z2M G;  4KHA A;  1TZY D;  2NQB C;  1AOI A;  1BFM A;  4Z5T B;  3B6F D;  3AV2 B;  3REH A;  1P3G D;  2PYO A;  4NE3 A;  3REI B;  3MGP C;  3REL C;  5B40 A;  2JSS A;  5B24 A;  3VH6 W;  3MGS A;  2FJ7 C;  3X1U B;  4J8X A;  3AZL D;  5BNX B;  1P3B D;  3W99 C;  4J8U C;  1S32 D;  3LJA A;  3KUY D;  3MGQ A;  1P3L D;  3X1S A;  5B1L B;  3AZE C;  4R8P B;  4UUZ B;  2HIO A;  3WTP C;  5AV5 B;  5F99 A;  4G92 B;  3AN2 A;  5GXQ C;  3W96 B;  3UT9 C;  4H9N B;  3LZ0 B;  5GSU A;  3LEL A;  4WV4 B;  4H9P B;  3C1C A;  1AOI C;  1EQZ A;  3AV1 A;  1P3F D;  1ZLA D;  3MNN B;  3AZJ A;  4XUJ A;  4YM6 D;  3VH6 T;  5AVC D;  1KX5 D;  2RVQ C;  3AZF B;  3REH C;  3W97 B;  2PYO C;  4YS3 A;  3KWQ A;  5B2I A;  5B40 C;  5CPJ B;  5DNN D;  1Q9C A;  5B24 C;  3MGS C;  4HGA B;  5DNM D;  2L5A A;  5B0Y A;  3MGR B;  4X23 C;  5B31 G;  5CPI A;  3X1V D;  1P3I B;  4M6B A;  3AZG A;  3X1T D;  4G91 C;  4WU8 B;  4JJN B;  3MVD B;  3LJA C;  5AV6 B;  3B0D B;  5GT3 D;  3X1S C;  5AV9 B;  2HIO C;  4R8P D;  5F99 C;  3AN2 C;  4J8V B;  3O62 D;  4LD9 D;  3VH5 A;  1ID3 D;  5GSU C;  3A6N A;  3REK B;  1EQZ C;  4CAY B;  3VH5 T;  3C1C C;  4KGC B;  3AZJ C;  3WKJ B;  4Z2M H;  4XUJ C;  4QLC B;  5G49 B;  5FUG B;  3AFA C;  4YS3 C;  1H3O A;  3AZN A;  1P3P A;  3KWQ C;  3UTA A;  4KUD D;  5C3I B;  2NQB D;  5CHL B;  5B0Y C;  5B31 D;  1M18 A;  5CPI C;  4Z66 A;  3NQU B;  3AZG C;  3KXB D;  1P3I D;  5CPK D;  3AYW B;  3WAA B;  4J8W C;  3TU4 B;  1BH8 A;  3AZM B;  3AZK B;  1P3M B;  4ZUX B;  3REL D;  1U35 B;  1HQ3 D;  3REJ B;  3WA9 B;  2FJ7 D;  4CSR A;  2F8N A;  3W99 D;  4H9O B;  5KDM A;  1KX3 B;  5B33 B;  2IO5 C;  5BNV B;  1TZY B;  3WTP D;  3C1B A;  3AZN C;  1P3P C;  3UTA C;  5GXQ D;  3UT9 D;  3B6F B;  2YFV B;  1M18 C;  1AOI D;  2CWE A;  4Z66 C;  1HTA A;  1P3G B;  3LZ0 A;  2HUE B;  2NZD A;  3UTB A;  3AYW D;  4WZS B;  2RVQ D;  3REH D;  3AZL B;  2PYO D;  5JRG A;  5B40 D;  1P3B B;  5B32 A;  3AZI A;  3AZF A;  1U35 D;  1S32 B;  3R45 B;  5GT0 A;  4WNN B;  4J8X D;  3KUY B;  1P3O B;  1BH9 B;  5B0Z A;  4E44 A;  3X1U C;  3AZE A;  4EO5 C;  3LJA D;  3W98 A;  5BS7 C;  2ARO B;  3MGQ D;  4WU9 A;  1KX4 A;  2HIO D;  5AV6 A;  1M1A B;  1P3F B;  5AV8 D;  5F99 D;  3C1B C;  1ZLA B;  4YM6 B;  2F8N K;  5AVC B;  5GSU D;  3LEL D;  5B2J D;  4ZBJ C;  3C1C D;  1KX5 B;  3LZ1 A;  1M19 A;  3AV1 D;  3AZJ D;  3LZ0 C;  1JFI A;  5DNN B;  2BYK B;  3UTB C;  4H9R B;  1F66 B;  2NZD C;  5DNM B;  3X1V B;  4YS3 D;  5G49 A;  4X23 A;  1F1E A;  5JA4 B;  5JRG C;  5B2I D;  3KWQ D;  3X1T B;  5B32 C;  3AZF C;  3AZI C;  5B1M A;  5GT0 C;  5B0Y D;  5CPJ C;  5GT3 B;  3AZG D;  5AY8 D;  4HGA C;  5B0Z C;  1P3O D;  3MGR C;  1P34 A;  3O62 B;  3W98 C;  4LD9 B;  4WU8 C;  1ID3 B;  1P3A A;  4WU9 C;  1KX4 C;  3WAA A;  2ARO D;  3V9R A;  5AV6 C;  1M1A D;  3VH6 A;  4XZQ A;  5AVB A;  3A6N D;  3LZ1 C;  4J8V C;  1M19 C;  3WA9 A;  4H9Q A;  3AFA A;  4KUD B;  2BYM B;  1P3K A;  2NQB B;  1F66 D;  5B31 B;  1KU5 A;  1P3P D;  1R4V A;  3KXB B;  3UTA D;  2CV5 D;  5CPK B;  5B1M C;  1M18 D;  4J8W A;  1N1J B;  2LY8 A;  5CP6 A;  3REL B;  3MGP B;  1P34 C;  3B6G A;  1HQ3 B;  3AZH A;  1WWS A;  5E5A A;  1P3G A;  1P3A C;  2FJ7 B;  3WAA C;  3TU4 C;  3W99 B;  4J8U B;  3B0B A;  4XZQ C;  3NQJ B;  5AVB C;  3WA9 C;  2YFW B;  2F8N D;  3WTP B;  3KUY A;  1P3L A;  5GXQ B;  3UT9 B;  4KHA B;  1P3K C;  1AOI B;  3C1B D;  1B6W A;  3REH B;  3B6F C;  2PYO B;  4Z5T A;  5CP6 C;  3B6G C;  5B40 B;  3AZH C;  5E5A C;  3MGP D;  3MGS B;  3UTB D;  3AV2 A;  1P3G C;  2NZD D;  4J8X B;  1A7W A;  3REI A;  4G91 B;  5JRG D;  5B32 D;  3AZL C;  3X1U A;  5GT0 D;  3LJA B;  4J8U D;  3MGQ B;  5BNX A;  5BS7 A;  1S32 C;  5B0Z D;  2HIO B;  3AZE D;  5AV8 B;  5F99 B;  3KUY C;  1P3L C;  3W98 D;  4WU9 D;  5B1L A;  1KX4 D;  5GSU B;  4R8P A;  4UUZ A;  5B2J B;  3LEL B;  3C1C B;  1EQZ B;  4AWL C;  5AV5 A;  3AV1 B;  3AZJ B;  4XUJ B;  3W96 A;  4H9S C;  4H9N A;  1ZLA C;  4H9P A;  3LZ1 D;  1M19 D;  4YM6 C;  3MNN A;  4Z5T C;  4YS3 B;  3KWQ B;  5B2I B;  5BT1 C;  3AV2 C;  5B0Y B;  1TAF B;  5B24 D;  3MGS D;  3W97 A;  3REI C;  3AZG B;  4X23 D;  5AY8 B;  2BYM A;  5CPJ A;  5DNM C;  5B1M D;  3MGR A;  1P3I A;  4WU8 A;  5CPK A;  3X1S D;  4JJN A;  1P34 D;  3MVD A;  5GT3 C;  3AN2 D;  1P3A D;  5B1L C;  5AV9 A;  4R8P C;  3A6N B;  5AV5 C;  4DRB A;  1EQZ D;  4G92 C;  4J8V A;  3W96 C;  4XZQ D;  4XUJ D;  5AVB D;  3REK A;  2IO5 B;  4CAY A;  3MNN C;  4KGC A;  3WKJ A;  4QLC A;  1H3O B;  3AFA D;  1P3P B;  3UTA B;  2YFW A;  5FUG A;  1P3K D;  1M18 B;  3W97 C;  4DRA A;  5CPI D;  5B31 C;  3KXB C;  1P3I C;  1BH8 B;  4J8W D;  3NQU A;  5CPK C;  3B0C W;  4NE5 A;  5CP6 D;  3B6G D;  4JJN C;  3AYW A;  3MVD C;  3TU4 A;  3AZH D;  1ULY A;  3B0D C;  5E5A D;  3AZM A;  4CSR B;  5AV9 C;  3AZK A;  1HQ3 C;  1P3M A;  4ZUX A;  1U35 A;  2F8N B;  3REJ A;  5KDM B;  4EO5 B;  2F8N G;  3REK C;  4KGC C;  3WKJ C;  4QLC C;  4H9O A;  3C1B B;  1KX3 A;  5B33 A;  3AZN D;  5BNV A;  1TZY A;  5AV8 A;  4ZBJ B;  3B0C T;  4Z66 D;  5C3I C;  5B2J A;  3B6F A;  2YFV A;  2NZD B;  3UTB B;  4Z5T D;  3AYW C;  5JRG B;  5B32 B;  3AZI B;  5BT1 D;  3VH5 W;  3AZM C;  3AV2 D;  5GT0 B;  5B32 G;  5BO0 B;  3AZK C;  3AZL A;  1P3M C;  4ZUX C;  3REI D;  1U35 C;  1P3B A;  5B0Z B;  1TAF A;  4J8X C;  3REJ C;  3R45 A;  3AZE B;  1S32 A;  3X1U D;  4WNN A;  3W98 B;  5AY8 A;  1P3O A;  1BH9 A;  4WU9 B;  1KX4 B;  1KX3 C;  3MGQ C; 
#chains in the Genus database with same CATH topology
 5B33 C;  2ARO A;  3IP4 C;  1TZY C;  5B1L D;  4H9S A;  5AV8 C;  3LZ1 B;  1M19 B;  1M1A A;  5AV5 D;  1P3F A;  1ZLA A;  3W96 D;  4YM6 A;  3LEL C;  5B2J C;  2Y2K A;  5AVC A;  3LZ0 D;  3AV1 C;  1JFI B;  1KX5 A;  5B24 B;  3MNN D;  4X23 B;  5DNN A;  2HUE C;  2BYK A;  4UPK A;  4H9R A;  1F66 A;  5B1M B;  5DNM A;  3AZI D;  3AZF D;  3W97 D;  5B2I C;  3X1V A;  2CV5 A;  5JA4 A;  5CPJ D;  3X1T A;  1P3B C;  3X1S B;  1P34 B;  3MGR D;  5AY8 C;  3AN2 B;  1P3A B;  5GT3 A;  1P3O C;  4WU8 D;  3AL0 C;  3V9R B;  4JJN D;  2F8N H;  3MVD D;  5AV6 D;  3O62 A;  4LD9 A;  2ARO C;  4XZQ B;  1ID3 A;  2XD1 A;  5AVB B;  5AV9 D;  1M1A C;  1P3F C;  4J8V D;  4H9Q B;  3A6N C;  3AFA B;  5AVC C;  3REK D;  1KX5 C;  4E45 A;  1P3K B;  2CV5 B;  3WKJ D;  4KGC D;  4QLC D;  1B67 A;  5CPI B;  5DNN C;  4KUD A;  1WWI A;  3A1K A;  2G5I C;  1F66 C;  2NQB A;  5B31 A;  3X1V C;  4J8W B;  2CV5 C;  3KSY A;  3KXB A;  3X1T C;  5CP6 B;  3B6G B;  4NFT A;  3AZH B;  5E5A B;  1N1J A;  3REL A;  3MGP A;  3WAA D;  1HQ3 A;  3TU4 D;  3O62 C;  4LD9 C;  3AZM D;  1ID3 C;  2FJ7 A;  3AZK D;  4NE6 A;  1P3M D;  4ZUX D;  3W99 A;  4J8U A;  5BO0 A;  3REJ D;  3WA9 D;  3NQJ A;  1P3L B;  3A1I A;  3AZN B;  3WTP E;  2ZY4 A;  3WTP A;  4AWL B;  1KX3 D;  5B33 D;  4Z66 B;  5GXQ A;  4KUD C;  3EPH A;  3UT9 A;  4Z2M G;  4KHA A;  1TZY D;  2NQB C;  1AOI A;  1BFM A;  3FDD A;  4Z5T B;  3B6F D;  3AV2 B;  3REH A;  1P3G D;  2PYO A;  4NE3 A;  3REI B;  3MGP C;  3REL C;  5B40 A;  2JSS A;  5B24 A;  3VH6 W;  3MGS A;  2FJ7 C;  3X1U B;  4J8X A;  3AZL D;  5BNX B;  1P3B D;  3W99 C;  4J8U C;  1S32 D;  3LJA A;  3KUY D;  3MGQ A;  1P3L D;  3X1S A;  5B1L B;  3AZE C;  4R8P B;  4UUZ B;  2HIO A;  3WTP C;  5AV5 B;  5F99 A;  4G92 B;  3AN2 A;  5GXQ C;  3W96 B;  3UT9 C;  4H9N B;  3LZ0 B;  5GSU A;  3LEL A;  4WV4 B;  4H9P B;  3C1C A;  1AOI C;  3H0L C;  1EQZ A;  3AV1 A;  1P3F D;  1ZLA D;  3MNN B;  3AZJ A;  4XUJ A;  4YM6 D;  2ZY2 A;  3VH6 T;  5AVC D;  1KX5 D;  2RVQ C;  3AZF B;  3REH C;  3W97 B;  2PYO C;  4YS3 A;  3KWQ A;  5B2I A;  5B40 C;  5CPJ B;  5DNN D;  1Q9C A;  3H0M C;  5B24 C;  3MGS C;  4HGA B;  5DNM D;  2L5A A;  5B0Y A;  3MGR B;  4X23 C;  5B31 G;  5CPI A;  3X1V D;  1P3I B;  4M6B A;  3AZG A;  3X1T D;  4G91 C;  4WU8 B;  4JJN B;  3MVD B;  3LJA C;  5AV6 B;  3B0D B;  5GT3 D;  3X1S C;  5AV9 B;  2HIO C;  4R8P D;  5F99 C;  3AN2 C;  4J8V B;  3O62 D;  4LD9 D;  3VH5 A;  1ID3 D;  2FFF B;  5GSU C;  3A6N A;  3REK B;  1EQZ C;  4CAY B;  3VH5 T;  3C1C C;  4KGC B;  3AZJ C;  3WKJ B;  4Z2M H;  4XUJ C;  4QLC B;  5G49 B;  5FUG B;  2Y2N A;  2DQN C;  3AFA C;  4YS3 C;  1H3O A;  3AZN A;  1P3P A;  3KWQ C;  3UTA A;  4KUD D;  2Y2I A;  5C3I B;  2NQB D;  5CHL B;  5B0Y C;  5B31 D;  1M18 A;  5CPI C;  4Z66 A;  3NQU B;  3AZG C;  3KXB D;  1P3I D;  5CPK D;  3AYW B;  3WAA B;  4J8W C;  3TU4 B;  1BH8 A;  3AZM B;  3AZK B;  2Y2J A;  1P3M B;  4ZUX B;  3EPL A;  3REL D;  1U35 B;  1HQ3 D;  3H0R C;  1T3U A;  3REJ B;  3WA9 B;  2FJ7 D;  4CSR A;  2F8N A;  3W99 D;  4H9O B;  5KDM A;  1KX3 B;  5B33 B;  4WJ3 C;  2IO5 C;  5BNV B;  1TZY B;  3WTP D;  3C1B A;  3AZN C;  1P3P C;  3UTA C;  5GXQ D;  3UT9 D;  3B6F B;  2YFV B;  1M18 C;  1AOI D;  2CWE A;  4Z66 C;  1HTA A;  1P3G B;  3LZ0 A;  2HUE B;  2NZD A;  3UTB A;  3AYW D;  4WZS B;  2RVQ D;  3REH D;  3AZL B;  2PYO D;  5JRG A;  5B40 D;  1P3B B;  5B32 A;  3AZI A;  3AZF A;  1U35 D;  1S32 B;  3R45 B;  5GT0 A;  4WNN B;  4J8X D;  3KUY B;  1P3O B;  1BH9 B;  5B0Z A;  4E44 A;  3X1U C;  3AZE A;  4EO5 C;  3LJA D;  3W98 A;  5BS7 C;  2ARO B;  3MGQ D;  4WU9 A;  1PZR A;  1KX4 A;  2HIO D;  5AV6 A;  1M1A B;  1P3F B;  5AV8 D;  5F99 D;  3C1B C;  1ZLA B;  4YM6 B;  2F8N K;  5AVC B;  5GSU D;  3LEL D;  5B2J D;  4ZBJ C;  3C1C D;  1KX5 B;  3LZ1 A;  1M19 A;  3AV1 D;  1W2E A;  3AZJ D;  3LZ0 C;  1JFI A;  2Y2L A;  5DNN B;  2BYK B;  3UTB C;  4H9R B;  1F66 B;  2NZD C;  5DNM B;  3X1V B;  4YS3 D;  5G49 A;  4X23 A;  1F1E A;  5JA4 B;  5JRG C;  5B2I D;  3KWQ D;  3X1T B;  5B32 C;  3AZF C;  3AZI C;  2JE5 A;  5B1M A;  5GT0 C;  5B0Y D;  5CPJ C;  2XD5 A;  1Z2C B;  5GT3 B;  3AZG D;  5AY8 D;  4HGA C;  5B0Z C;  1P3O D;  3MGR C;  2G5H C;  1P34 A;  3O62 B;  3W98 C;  4LD9 B;  4WU8 C;  1ID3 B;  1P3A A;  4WU9 C;  1KX4 C;  3WAA A;  2ARO D;  3V9R A;  5AV6 C;  1M1A D;  3VH6 A;  4XZQ A;  5AVB A;  3A6N D;  3LZ1 C;  4J8V C;  1M19 C;  3WA9 A;  4H9Q A;  2Y2P A;  3AFA A;  4KUD B;  2ZY3 A;  2BYM B;  1P3K A;  2NQB B;  4DQY B;  1F66 D;  5B31 B;  1KU5 A;  1P3P D;  1R4V A;  3KXB B;  3UTA D;  2CV5 D;  5CPK B;  5B1M C;  1M18 D;  4J8W A;  1N1J B;  2LY8 A;  5CP6 A;  3REL B;  3MGP B;  1P34 C;  3B6G A;  1HQ3 B;  3AZH A;  1WWS A;  5E5A A;  1P3G A;  1P3A C;  2FJ7 B;  3WAA C;  3TU4 C;  3W99 B;  4J8U B;  3B0B A;  4XZQ C;  3NQJ B;  5AVB C;  3WA9 C;  2YFW B;  2F8N D;  3WTP B;  3KUY A;  1P3L A;  5GXQ B;  3UT9 B;  4KHA B;  1P3K C;  2DF4 C;  1AOI B;  3C1B D;  1B6W A;  3REH B;  3B6F C;  2PYO B;  4Z5T A;  5CP6 C;  3B6G C;  2BG1 A;  5B40 B;  3AZH C;  5E5A C;  3MGP D;  3MGS B;  3UTB D;  3AV2 A;  1P3G C;  2NZD D;  4J8X B;  1A7W A;  3REI A;  4G91 B;  5JRG D;  5B32 D;  3AZL C;  3X1U A;  5GT0 D;  3LJA B;  4J8U D;  3MGQ B;  5BNX A;  5BS7 A;  1S32 C;  5B0Z D;  2HIO B;  3AZE D;  5AV8 B;  5F99 B;  3KUY C;  1P3L C;  3KFU G;  3W98 D;  4WU9 D;  5B1L A;  1KX4 D;  5GSU B;  4R8P A;  4UUZ A;  5B2J B;  3LEL B;  3C1C B;  1EQZ B;  4AWL C;  5AV5 A;  3AV1 B;  3AZJ B;  4XUJ B;  3W96 A;  4H9S C;  4H9N A;  1ZLA C;  4H9P A;  2J8P A;  3LZ1 D;  1M19 D;  4YM6 C;  3MNN A;  4Z5T C;  2Y2H A;  4YS3 B;  2Y2G A;  5B2I B;  3KWQ B;  5BT1 C;  3AV2 C;  5B0Y B;  1TAF B;  5B24 D;  3MGS D;  3W97 A;  3REI C;  3AZG B;  4X23 D;  5AY8 B;  2BYM A;  2JCH A;  5DNM C;  5CPJ A;  5B1M D;  3MGR A;  1P3I A;  4WU8 A;  5CPK A;  3EG5 B;  3X1S D;  4JJN A;  1P34 D;  3MVD A;  5GT3 C;  3AN2 D;  1P3A D;  5B1L C;  5AV9 A;  4R8P C;  3A6N B;  5AV5 C;  4DRB A;  1EQZ D;  4G92 C;  4J8V A;  2F2A C;  3W96 C;  4XZQ D;  4XUJ D;  5AVB D;  3REK A;  2IO5 B;  4CAY A;  3F6T A;  3MNN C;  4KGC A;  3WKJ A;  4QLC A;  1H3O B;  2ZY5 A;  3AFA D;  1P3P B;  3UTA B;  2YFW A;  5FUG A;  1P3K D;  1M18 B;  3W97 C;  4DRA A;  5CPI D;  5B31 C;  3KXB C;  1P3I C;  1BH8 B;  4J8W D;  3NQU A;  5CPK C;  3B0C W;  4NE5 A;  5CP6 D;  3B6G D;  4JJN C;  3AYW A;  3MVD C;  3TU4 A;  3AZH D;  1ULY A;  3B0D C;  5E5A D;  3AZM A;  4CSR B;  5AV9 C;  3AZK A;  1HQ3 C;  1P3M A;  4ZUX A;  1U35 A;  2Y2O A;  2F8N B;  3REJ A;  5KDM B;  4EO5 B;  2F8N G;  3REK C;  4KGC C;  3WKJ C;  4QLC C;  3P5J B;  4H9O A;  3C1B B;  1KX3 A;  2ZM5 A;  5B33 A;  2Y2M A;  3AZN D;  5BNV A;  1TZY A;  5AV8 A;  4ZBJ B;  3B0C T;  2W8S A;  4Z66 D;  5C3I C;  5B2J A;  3B6F A;  2YFV A;  2NZD B;  3UTB B;  3EPK A;  3EPJ A;  2RIQ A;  4Z5T D;  3AYW C;  5JRG B;  5B32 B;  3AZI B;  5BT1 D;  3VH5 W;  3AZM C;  3AV2 D;  2UWX A;  5GT0 B;  5B32 G;  5BO0 B;  3AZK C;  3AZL A;  1P3M C;  4ZUX C;  3REI D;  1U35 C;  1P3B A;  5B0Z B;  2Y2Q A;  1TAF A;  4J8X C;  3REJ C;  3R45 A;  3AZE B;  1S32 A;  3X1U D;  4WNN A;  2VQR A;  3W98 B;  5AY8 A;  1P3O A;  1BH9 A;  4WU9 B;  1KX4 B;  1KX3 C;  3MGQ C; 
#chains in the Genus database with same CATH homology
 5B33 C;  2ARO A;  3IP4 C;  1TZY C;  5B1L D;  4H9S A;  5AV8 C;  3LZ1 B;  1M19 B;  1M1A A;  5AV5 D;  1P3F A;  1ZLA A;  3W96 D;  4YM6 A;  3LEL C;  5B2J C;  2Y2K A;  5AVC A;  3LZ0 D;  3AV1 C;  1JFI B;  1KX5 A;  5B24 B;  3MNN D;  4X23 B;  5DNN A;  2HUE C;  2BYK A;  4UPK A;  4H9R A;  1F66 A;  5B1M B;  5DNM A;  3AZI D;  3AZF D;  3W97 D;  5B2I C;  3X1V A;  2CV5 A;  5JA4 A;  5CPJ D;  3X1T A;  1P3B C;  3X1S B;  1P34 B;  3MGR D;  5AY8 C;  3AN2 B;  1P3A B;  5GT3 A;  1P3O C;  4WU8 D;  3AL0 C;  3V9R B;  4JJN D;  2F8N H;  3MVD D;  5AV6 D;  3O62 A;  4LD9 A;  2ARO C;  4XZQ B;  1ID3 A;  2XD1 A;  5AVB B;  5AV9 D;  1M1A C;  1P3F C;  4J8V D;  4H9Q B;  3A6N C;  3AFA B;  5AVC C;  3REK D;  1KX5 C;  4E45 A;  1P3K B;  2CV5 B;  3WKJ D;  4KGC D;  4QLC D;  1B67 A;  5CPI B;  5DNN C;  4KUD A;  1WWI A;  3A1K A;  2G5I C;  1F66 C;  2NQB A;  5B31 A;  3X1V C;  4J8W B;  2CV5 C;  3KSY A;  3KXB A;  3X1T C;  5CP6 B;  3B6G B;  4NFT A;  3AZH B;  5E5A B;  1N1J A;  3REL A;  3MGP A;  3WAA D;  1HQ3 A;  3TU4 D;  3O62 C;  4LD9 C;  3AZM D;  1ID3 C;  2FJ7 A;  3AZK D;  4NE6 A;  1P3M D;  4ZUX D;  3W99 A;  4J8U A;  5BO0 A;  3REJ D;  3WA9 D;  3NQJ A;  1P3L B;  3A1I A;  3AZN B;  3WTP E;  2ZY4 A;  3WTP A;  4AWL B;  1KX3 D;  5B33 D;  4Z66 B;  5GXQ A;  4KUD C;  3EPH A;  3UT9 A;  4Z2M G;  4KHA A;  1TZY D;  2NQB C;  1AOI A;  1BFM A;  3FDD A;  4Z5T B;  3B6F D;  3AV2 B;  3REH A;  1P3G D;  2PYO A;  4NE3 A;  3REI B;  3MGP C;  3REL C;  5B40 A;  2JSS A;  5B24 A;  3VH6 W;  3MGS A;  2FJ7 C;  3X1U B;  4J8X A;  3AZL D;  5BNX B;  1P3B D;  3W99 C;  4J8U C;  1S32 D;  3LJA A;  3KUY D;  3MGQ A;  1P3L D;  3X1S A;  5B1L B;  3AZE C;  4R8P B;  4UUZ B;  2HIO A;  3WTP C;  5AV5 B;  5F99 A;  4G92 B;  3AN2 A;  5GXQ C;  3W96 B;  3UT9 C;  4H9N B;  3LZ0 B;  5GSU A;  3LEL A;  4WV4 B;  4H9P B;  3C1C A;  1AOI C;  3H0L C;  1EQZ A;  3AV1 A;  1P3F D;  1ZLA D;  3MNN B;  3AZJ A;  4XUJ A;  4YM6 D;  2ZY2 A;  3VH6 T;  5AVC D;  1KX5 D;  2RVQ C;  3AZF B;  3REH C;  3W97 B;  2PYO C;  4YS3 A;  3KWQ A;  5B2I A;  5B40 C;  5CPJ B;  5DNN D;  1Q9C A;  3H0M C;  5B24 C;  3MGS C;  4HGA B;  5DNM D;  2L5A A;  5B0Y A;  3MGR B;  4X23 C;  5B31 G;  5CPI A;  3X1V D;  1P3I B;  4M6B A;  3AZG A;  3X1T D;  4G91 C;  4WU8 B;  4JJN B;  3MVD B;  3LJA C;  5AV6 B;  3B0D B;  5GT3 D;  3X1S C;  5AV9 B;  2HIO C;  4R8P D;  5F99 C;  3AN2 C;  4J8V B;  3O62 D;  4LD9 D;  3VH5 A;  1ID3 D;  2FFF B;  5GSU C;  3A6N A;  3REK B;  1EQZ C;  4CAY B;  3VH5 T;  3C1C C;  4KGC B;  3AZJ C;  3WKJ B;  4Z2M H;  4XUJ C;  4QLC B;  5G49 B;  5FUG B;  2Y2N A;  2DQN C;  3AFA C;  4YS3 C;  1H3O A;  3AZN A;  1P3P A;  3KWQ C;  3UTA A;  4KUD D;  2Y2I A;  5C3I B;  2NQB D;  5CHL B;  5B0Y C;  5B31 D;  1M18 A;  5CPI C;  4Z66 A;  3NQU B;  3AZG C;  3KXB D;  1P3I D;  5CPK D;  3AYW B;  3WAA B;  4J8W C;  3TU4 B;  1BH8 A;  3AZM B;  3AZK B;  2Y2J A;  1P3M B;  4ZUX B;  3EPL A;  3REL D;  1U35 B;  1HQ3 D;  3H0R C;  1T3U A;  3REJ B;  3WA9 B;  2FJ7 D;  4CSR A;  2F8N A;  3W99 D;  4H9O B;  5KDM A;  1KX3 B;  5B33 B;  4WJ3 C;  2IO5 C;  5BNV B;  1TZY B;  3WTP D;  3C1B A;  3AZN C;  1P3P C;  3UTA C;  5GXQ D;  3UT9 D;  3B6F B;  2YFV B;  1M18 C;  1AOI D;  2CWE A;  4Z66 C;  1HTA A;  1P3G B;  3LZ0 A;  2HUE B;  2NZD A;  3UTB A;  3AYW D;  4WZS B;  2RVQ D;  3REH D;  3AZL B;  2PYO D;  5JRG A;  5B40 D;  1P3B B;  5B32 A;  3AZI A;  3AZF A;  1U35 D;  1S32 B;  3R45 B;  5GT0 A;  4WNN B;  4J8X D;  3KUY B;  1P3O B;  1BH9 B;  5B0Z A;  4E44 A;  3X1U C;  3AZE A;  4EO5 C;  3LJA D;  3W98 A;  5BS7 C;  2ARO B;  3MGQ D;  4WU9 A;  1PZR A;  1KX4 A;  2HIO D;  5AV6 A;  1M1A B;  1P3F B;  5AV8 D;  5F99 D;  3C1B C;  1ZLA B;  4YM6 B;  2F8N K;  5AVC B;  5GSU D;  3LEL D;  5B2J D;  4ZBJ C;  3C1C D;  1KX5 B;  3LZ1 A;  1M19 A;  3AV1 D;  1W2E A;  3AZJ D;  3LZ0 C;  1JFI A;  2Y2L A;  5DNN B;  2BYK B;  3UTB C;  4H9R B;  1F66 B;  2NZD C;  5DNM B;  3X1V B;  4YS3 D;  5G49 A;  4X23 A;  1F1E A;  5JA4 B;  5JRG C;  5B2I D;  3KWQ D;  3X1T B;  5B32 C;  3AZF C;  3AZI C;  2JE5 A;  5B1M A;  5GT0 C;  5B0Y D;  5CPJ C;  2XD5 A;  1Z2C B;  5GT3 B;  3AZG D;  5AY8 D;  4HGA C;  5B0Z C;  1P3O D;  3MGR C;  2G5H C;  1P34 A;  3O62 B;  3W98 C;  4LD9 B;  4WU8 C;  1ID3 B;  1P3A A;  4WU9 C;  1KX4 C;  3WAA A;  2ARO D;  3V9R A;  5AV6 C;  1M1A D;  3VH6 A;  4XZQ A;  5AVB A;  3A6N D;  3LZ1 C;  4J8V C;  1M19 C;  3WA9 A;  4H9Q A;  2Y2P A;  3AFA A;  4KUD B;  2ZY3 A;  2BYM B;  1P3K A;  2NQB B;  4DQY B;  1F66 D;  5B31 B;  1KU5 A;  1P3P D;  1R4V A;  3KXB B;  3UTA D;  2CV5 D;  5CPK B;  5B1M C;  1M18 D;  4J8W A;  1N1J B;  2LY8 A;  5CP6 A;  3REL B;  3MGP B;  1P34 C;  3B6G A;  1HQ3 B;  3AZH A;  1WWS A;  5E5A A;  1P3G A;  1P3A C;  2FJ7 B;  3WAA C;  3TU4 C;  3W99 B;  4J8U B;  3B0B A;  4XZQ C;  3NQJ B;  5AVB C;  3WA9 C;  2YFW B;  2F8N D;  3WTP B;  3KUY A;  1P3L A;  5GXQ B;  3UT9 B;  4KHA B;  1P3K C;  2DF4 C;  1AOI B;  3C1B D;  1B6W A;  3REH B;  3B6F C;  2PYO B;  4Z5T A;  5CP6 C;  3B6G C;  2BG1 A;  5B40 B;  3AZH C;  5E5A C;  3MGP D;  3MGS B;  3UTB D;  3AV2 A;  1P3G C;  2NZD D;  4J8X B;  1A7W A;  3REI A;  4G91 B;  5JRG D;  5B32 D;  3AZL C;  3X1U A;  5GT0 D;  3LJA B;  4J8U D;  3MGQ B;  5BNX A;  5BS7 A;  1S32 C;  5B0Z D;  2HIO B;  3AZE D;  5AV8 B;  5F99 B;  3KUY C;  1P3L C;  3KFU G;  3W98 D;  4WU9 D;  5B1L A;  1KX4 D;  5GSU B;  4R8P A;  4UUZ A;  5B2J B;  3LEL B;  3C1C B;  1EQZ B;  4AWL C;  5AV5 A;  3AV1 B;  3AZJ B;  4XUJ B;  3W96 A;  4H9S C;  4H9N A;  1ZLA C;  4H9P A;  2J8P A;  3LZ1 D;  1M19 D;  4YM6 C;  3MNN A;  4Z5T C;  2Y2H A;  4YS3 B;  2Y2G A;  5B2I B;  3KWQ B;  5BT1 C;  3AV2 C;  5B0Y B;  1TAF B;  5B24 D;  3MGS D;  3W97 A;  3REI C;  3AZG B;  4X23 D;  5AY8 B;  2BYM A;  2JCH A;  5DNM C;  5CPJ A;  5B1M D;  3MGR A;  1P3I A;  4WU8 A;  5CPK A;  3EG5 B;  3X1S D;  4JJN A;  1P34 D;  3MVD A;  5GT3 C;  3AN2 D;  1P3A D;  5B1L C;  5AV9 A;  4R8P C;  3A6N B;  5AV5 C;  4DRB A;  1EQZ D;  4G92 C;  4J8V A;  2F2A C;  3W96 C;  4XZQ D;  4XUJ D;  5AVB D;  3REK A;  2IO5 B;  4CAY A;  3F6T A;  3MNN C;  4KGC A;  3WKJ A;  4QLC A;  1H3O B;  2ZY5 A;  3AFA D;  1P3P B;  3UTA B;  2YFW A;  5FUG A;  1P3K D;  1M18 B;  3W97 C;  4DRA A;  5CPI D;  5B31 C;  3KXB C;  1P3I C;  1BH8 B;  4J8W D;  3NQU A;  5CPK C;  3B0C W;  4NE5 A;  5CP6 D;  3B6G D;  4JJN C;  3AYW A;  3MVD C;  3TU4 A;  3AZH D;  1ULY A;  3B0D C;  5E5A D;  3AZM A;  4CSR B;  5AV9 C;  3AZK A;  1HQ3 C;  1P3M A;  4ZUX A;  1U35 A;  2Y2O A;  2F8N B;  3REJ A;  5KDM B;  4EO5 B;  2F8N G;  3REK C;  4KGC C;  3WKJ C;  4QLC C;  3P5J B;  4H9O A;  3C1B B;  1KX3 A;  2ZM5 A;  5B33 A;  2Y2M A;  3AZN D;  5BNV A;  1TZY A;  5AV8 A;  4ZBJ B;  3B0C T;  2W8S A;  4Z66 D;  5C3I C;  5B2J A;  3B6F A;  2YFV A;  2NZD B;  3UTB B;  3EPK A;  3EPJ A;  2RIQ A;  4Z5T D;  3AYW C;  5JRG B;  5B32 B;  3AZI B;  5BT1 D;  3VH5 W;  3AZM C;  3AV2 D;  2UWX A;  5GT0 B;  5B32 G;  5BO0 B;  3AZK C;  3AZL A;  1P3M C;  4ZUX C;  3REI D;  1U35 C;  1P3B A;  5B0Z B;  2Y2Q A;  1TAF A;  4J8X C;  3REJ C;  3R45 A;  3AZE B;  1S32 A;  3X1U D;  4WNN A;  2VQR A;  3W98 B;  5AY8 A;  1P3O A;  1BH9 A;  4WU9 B;  1KX4 B;  1KX3 C;  3MGQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...