4XZQB

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xzqB00
4KGCB 1U35A 5BO0A 3UTBD 1M1AC 5GXQC 5AV5B 4G91B 5GT3A 2CV5C 4G92C 5FUGA 4WU9B 1P3BC 3LZ0C 3AV1D 5AV6D 1EQZD 4WV4B 3AZIA 2RVQD 1P3MC 4Z66B 2PYOA 4KUDC 5B2JC 2JSSA 3X1VA 3B6FD 3UT9D 3W96C 3REIB 3AZED 3AYWC 5GSUC 1AOID 5B1LA 5BO0B 3KUYD 5F99D 5AVCA 3AZLC 1M18C 1F66D 1HTAA 5GT3B 3AFAD 3AZGC 1P3IC 3MGPC 5DNNB 3MGQD 5FUGB 3MNNC 1HQ3A 3B0DB 4H9SA 2FJ7A 3B0CW 4M6BA 1P3KD 2BYMA 5C3IB 4ZBJB 2PYOB 3MGRC 2HIOB 3RELD 3AV2A 3X1TD 3WTPC 3X1SA 5B33C 3X1VB 1P3GB 4KGCC 3W98A 2YFWA 5B2ID 1M1AD 4G91C 3MVDC 5CP6B 5AV9D 3AZMB 4R8PA 1KX5C 3LJAA 1ZLAD 4YM6A 3LZ0D 5CPJC 5KDMB 3KXBD 4JJNA 3WAAB 3TU4A 3A6NB 5JA4A 2FJ7B 2NQBA 2BYMB 1H3OB 4WU8A 5AV8C 3AZJA 3AV2B 5GSUD 3X1SB 2NZDD 3WKJA 3AN2A 1KX3D 2YFWB 3AV1B 3C1CD 2YFVA 5JRGC 4R8PB 4XUJA 3LJAB 3WA9C 3REKA 3AZKA 3KWQC 1N1JA 4JJNB 3UT9B 5B31C 5B32G 1KX4A 4X23C 3KUYB 4CAYB 3MGSB 5AV5D 3LZ1C 3O62C 5AY8B 3MGQB 3AZMC 4J8UA 4J8VC 5B24B 4WU9D 4H9QA 1P3KB 1P3AB 1KU5A 4DRAA 3WAAC 4XUJB 4Z66D 3LELA 3REKB 4J8WA 3W97B 3AZHD 3REID 5B2IB 3UTBC 5BNVB 3VH6W 5AV9B 1U35D 5B0YB 2CWEA 3REHA 3AV1C 5AV6C 1EQZC 1P3LA 5GT3D 2RVQC 5DNND 4J8UB 1M19A 3B6FC 3W96A 3UT9C 3AZID 4H9RB 4ZUXB 3AYWA 2PYOD 4J8WB 2HIOD 1AOIC 3X1VD 3KUYC 1P3GD 5F99C 3B6GB 1KX3B 3MGSC 4UUZA 1F66C 3AFAC 5BS7C 4YS3A 4H9OB 5CP6D 5B1LD 3MGQC 3AZMD 1TAFA 2F8NB 5AVCD 3REHB 1P3LB 1P3OA 1P3KC 4QLCA 1P3AC 1WWIA 3C1BB 3RELC 1M19B 3X1TC 4J8XA 3A6ND 3R45A 2FJ7D 4LD9A 5B2IC 3AV2D 1B67A 5AV9C 1P34A 3X1SD 2IO5C 2LY8A 4Z2MH 1ID3B 1ZLAC 3KXBC 3VH5T 1P3FA 4R8PD 1TAFB 3LJAD 3VH6T 5B40A 4AWLC 3UTAB 3AZHB 4JJND 4QLCB 3AZNB 1P3OB 5G49A 5DNMA 1TZYB 3TU4D 1U35B 3B6GC 2NZDC 1KX3C 3MGSD 3C1CC 4DRBA 3AZJD 1BH8A 5AY8D 1A7WA 3WA9A 3WKJD 3AN2D 5GT0A 4NE6A 5B24D 4Z5TA 3AZIB 5E5AA 1P3AD 2AROA 4XUJD 3C1BC 3REKD 3AZKD 3W97D 4X23A 4XZQA 3KSYA 5G49B 1S32A 5B0ZA 5DNMB 5AV5C 5CPIA 1P3PA 1KX4D 5B1LB 3X1UA 5B0YD 5AVCB 4J8VA 4WU9C 5BT1D 5B31G 1BH9A 1BH8B 1BFMA 4Z66C 5GT0B 4J8UD 1HQ3B 3UTAC 3AZHC 3AZNC 5E5AB 3REIC 4HGAB 2AROB 5B32A 4ZUXD 4J8WD 1TZYC 1F1EA 3W98B 1U35C 3B6GD 4XZQB 4NFTA 5AV6A 5B0ZB 5CPKA 3V9RA 5GT3C 4WZSB 3X1UB 5DNNC 2F8ND 4YM6B 3REHD 1P3LD 1BH9B 3B0DC 3AZIC 3AZFA 5C3IC 3AZEA 4ZBJC 2PYOC 3REJA 2HUEB 2HIOC 3C1BD 3TU4B 1M19D 2F8NH 5JA4B 3X1VC 1P3GC 2NQBB 4WU8B 3AZJB 5AVBA 5CP6C 5B1LC 3B0CT 3AN2B 3WKJB 5AVCC 1ID3D 5CPKB 2YFVB 3V9RB 3W99A 5B1MA 3AZKB 3X1TA 1N1JB 1HQ3C 3A6NC 4H9SC 3UTAD 3AZND 1P3OD 3NQJA 2FJ7C 4QLCD 1M1AA 5GXQA 3REJB 4NE3A 3AV2C 3NQUA 1KX4B 1TZYD 4J8XD 3X1SC 2CV5A 4E45A 1P3BA 4LD9D 3LZ0A 3KXBA 5AVBB 1P3MA 1P34D 4R8PC 4KUDA 3LJAC 4H9QB 5B2JA 4YM6C 4JJNC 3B0BA 5B1MB 1P3FD 3LELB 5GSUA 3TU4C 5B40D 3AZLA 1M18A 4H9PA 4WU8C 5DNMD 3AZJC 3AZGA 3NQUB 1P3IA 3MGPA 2CV5B 5AY8C 1P3BB 3AN2C 3WKJC 3MNNA 5B24C 1P3MB 4WNNA 3MGRA 4KUDB 4XUJC 5GT0D 3REKC 3WTPA 3AZKC 5B33A 3W97C 4KGCA 1HQ3D 3W96B 5E5AD 3AYWB 5AV5A 2AROD 4EO5B 3MVDA 1KX4C 1KX5A 2F8NG 3W98D 5B0YC 4XZQD 4UUZB 1S32D 5BT1C 5CPJA 5B0ZD 3AZGB 1P3IB 3MGPB 4YS3B 1P3PD 1Q9CA 3X1UD 4J8UC 3MNNB 4YM6D 4WNNB 3REIA 3MGRB 5AV8A 4ZUXC 3LELC 3WTPB 4J8WC 5B33B 4J8XB 3R45B 2NQBD 4LD9B 4WU8D 5B32D 3MVDB 5JRGA 1P34B 1KX5B 5DNNA 3KWQA 5CPJB 3REHC 5CPKD 1P3LC 4KHAA 5B31A 1P3FB 2HIOA 1M19C 5B40B 1P3GA 3AZFD 5AV8B 3LZ1A 3REJD 4EO5C 5CP6A 3O62A 1R4VA 4E44A 3AZMA 1ID3C 1ULYA 5KDMA 5JRGB 5AVBD 4YS3C 3WTPE 3WAAA 3WA9B 2BYKA 3KWQB 3A6NA 4Z5TB 4KHAB 1P3OC 5B31B 4QLCC 3UTBA 3W99D 1H3OA 5B1MD 3LELD 4X23B 4J8XC 4LD9C 3AV1A 1S32B 5GXQD 1EQZA 3LZ1B 5CPIB 3O62B 1P3PB 1P34C 2CV5D 4J8VB 1P3BD 4Z2MG 3B6FA 3UT9A 1P3MD 1P3FC 4H9NA 4KUDD 2BYKB 4CSRA 5B2JD 1AOIA 5B40C 3KUYA 5F99A 3W96D 3UTBB 4CAYA 3MGSA 1F66A 5B32B 3AYWD 5DNMC 3AFAA 5BS7A 5AY8A 3MGQA 3AZLD 1M18D 5B24A 5AV6B 1EQZB 1P3KA 3AZGD 1P3ID 4YS3D 3MGPD 1P3AA 3RELA 5GT0C 3W97A 3MNND 3B6FB 4Z5TC 5E5AC 3AZFB 5B2IA 3AZEB 4H9NB 3MGRD 4CSRB 5BNVA 4HGAC 2AROC 5AV9A 3WTPD 1AOIB 5B33D 4KGCD 5F99B 5B0YA 3W98C 1ZLAA 4XZQC 1F66B 1S32C 3VH5A 5B0ZC 3AFAB 5CPIC 3MVDD 1P3PC 1KX5D 3X1UC 3VH6A 1JFIA 5CPJD 2L5AA 4H9RA 3W99B 4ZUXA 3RELB 2HUEC 3X1TB 3VH5W 3B6GA 2NZDA 3NQJB 1KX3A 2NQBC 1M1AB 5GXQB 3C1CA 5AV8D 5B32C 4H9OA 2F8NK 2IO5B 4G92B 1ZLAB 5BNXA 2F8NA 3LZ0B 5CPKC 3KXBB 5JRGD 3C1BA 3WA9D 5B2JB 1JFIB 3KWQD 4AWLB 4Z5TD 5B31D 3AZFC 3AZEC 3REJC 5GSUB 4X23D 2NZDB 3AZLB 1M18B 1ID3A 4WU9A 3C1CB 4H9PB 1B6WA 3LZ1D 5AVBC 5CPID 3O62D 5BNXB 4Z66A 4J8VD 3UTAA 3AZNA 3AZHA 1WWSA 5CHLB 3W99C 5B1MC 3WAAD 4NE5A 1TZYA
chains in the Genus database with same CATH superfamily
4KGCB 1U35A 5BO0A 3UTBD 1M1AC 5GXQC 5AV5B 4G91B 5GT3A 3H0LC 2CV5C 4G92C 5FUGA 4WU9B 1P3BC 3LZ0C 3AV1D 5AV6D 1EQZD 4WV4B 3AZIA 2RVQD 1P3MC 3EPHA 4Z66B 2PYOA 4KUDC 5B2JC 2JSSA 2Y2HA 3X1VA 3B6FD 3UT9D 3W96C 3REIB 3AZED 3AYWC 5GSUC 1AOID 5B1LA 5BO0B 3KUYD 5F99D 5AVCA 3AZLC 1M18C 1F66D 1HTAA 5GT3B 3AFAD 3AZGC 1P3IC 3MGPC 5DNNB 3MGQD 5FUGB 3MNNC 1HQ3A 3B0DB 4H9SA 2FJ7A 3B0CW 4M6BA 1P3KD 2BYMA 5C3IB 4ZBJB 2PYOB 3MGRC 2HIOB 3RELD 3AV2A 3X1TD 3WTPC 3X1SA 5B33C 3X1VB 1P3GB 4KGCC 3W98A 2YFWA 5B2ID 1M1AD 4G91C 3MVDC 5CP6B 5AV9D 3AZMB 4R8PA 1KX5C 3LJAA 1ZLAD 4YM6A 3LZ0D 5CPJC 5KDMB 3KXBD 4JJNA 3H0RC 3WAAB 2G5HC 2Y2JA 3TU4A 3A1KA 3A6NB 5JA4A 2FJ7B 2NQBA 2BYMB 1H3OB 4WU8A 5AV8C 3AZJA 2DF4C 3AV2B 5GSUD 3X1SB 2NZDD 3WKJA 3AN2A 1KX3D 2YFWB 3AV1B 3C1CD 2YFVA 5JRGC 4R8PB 4XUJA 3LJAB 3WA9C 3REKA 3AZKA 3KWQC 1N1JA 4JJNB 3UT9B 5B31C 5B32G 1KX4A 2FFFB 4X23C 3KUYB 4CAYB 3MGSB 2BG1A 5AV5D 3LZ1C 2W8SA 5AY8B 3O62C 3MGQB 3AZMC 4J8UA 4J8VC 5B24B 4WU9D 4H9QA 2J8PA 1PZRA 1P3KB 1P3AB 1KU5A 4DRAA 3WAAC 4XUJB 4Z66D 3LELA 3REKB 4J8WA 3W97B 3AZHD 3REID 5B2IB 3UTBC 5BNVB 3VH6W 5AV9B 1U35D 5B0YB 2CWEA 3REHA 3AV1C 5AV6C 1EQZC 1P3LA 5GT3D 2RVQC 5DNND 4J8UB 1M19A 3B6FC 3W96A 3UT9C 3AZID 4H9RB 4ZUXB 3AYWA 2PYOD 4J8WB 2HIOD 2ZY3A 1AOIC 2Y2GA 3X1VD 3KUYC 1P3GD 5F99C 3B6GB 1KX3B 2G5IC 2DQNC 3MGSC 4UUZA 1F66C 3AFAC 5BS7C 4YS3A 4H9OB 5CP6D 5B1LD 3MGQC 3AZMD 1TAFA 2F8NB 5AVCD 3REHB 1P3LB 1P3OA 1P3KC 2ZY4A 4QLCA 1P3AC 1WWIA 3C1BB 3RELC 1M19B 3X1TC 4J8XA 3A6ND 3R45A 2FJ7D 4LD9A 5B2IC 3AV2D 1B67A 5AV9C 1P34A 3X1SD 1T3UA 2IO5C 2LY8A 4Z2MH 1ID3B 1ZLAC 3KXBC 3A1IA 3VH5T 1P3FA 2Y2OA 1TAFB 4R8PD 3LJAD 3VH6T 5B40A 4AWLC 3UTAB 3AZHB 4JJND 4QLCB 3AZNB 1P3OB 5G49A 5DNMA 1TZYB 3TU4D 1U35B 3B6GC 2NZDC 1KX3C 3MGSD 3C1CC 4DRBA 3AZJD 1BH8A 5AY8D 1A7WA 3WA9A 3WKJD 3AN2D 5GT0A 4NE6A 5B24D 4Z5TA 3AZIB 5E5AA 1P3AD 2AROA 4XUJD 3C1BC 3REKD 3AZKD 3W97D 4X23A 4XZQA 3KSYA 5G49B 1S32A 5B0ZA 5DNMB 5AV5C 5CPIA 1P3PA 1KX4D 5B1LB 3X1UA 5B0YD 5AVCB 4J8VA 4WU9C 5BT1D 5B31G 1BH9A 1BH8B 1BFMA 4Z66C 5GT0B 4J8UD 2UWXA 1HQ3B 3UTAC 3AZHC 3AZNC 5E5AB 3REIC 4HGAB 2AROB 5B32A 4ZUXD 4J8WD 1TZYC 1F1EA 3W98B 1U35C 3B6GD 4XZQB 4NFTA 5AV6A 5B0ZB 5CPKA 3V9RA 5GT3C 4WZSB 3X1UB 5DNNC 2F8ND 4YM6B 3REHD 2JE5A 1P3LD 1BH9B 3B0DC 3AZIC 3AZFA 5C3IC 3AZEA 4ZBJC 2PYOC 3REJA 2HUEB 2HIOC 3C1BD 3TU4B 1M19D 2F8NH 5JA4B 3X1VC 1P3GC 2NQBB 4DQYB 4WU8B 3AZJB 5AVBA 5CP6C 2JCHA 5B1LC 2Y2LA 3B0CT 3AN2B 3WKJB 5AVCC 1ID3D 5CPKB 2YFVB 3V9RB 3W99A 5B1MA 3AZKB 3X1TA 1N1JB 1HQ3C 3A6NC 4H9SC 3UTAD 3AZND 1P3OD 3NQJA 2FJ7C 4QLCD 1M1AA 5GXQA 1Z2CB 3REJB 4NE3A 3AV2C 3NQUA 1KX4B 1TZYD 4J8XD 3X1SC 2CV5A 3AL0C 4E45A 2Y2NA 1P3BA 4LD9D 3LZ0A 3KXBA 5AVBB 1P3MA 1P34D 4R8PC 4KUDA 3LJAC 4H9QB 5B2JA 4YM6C 4JJNC 2ZY5A 3B0BA 5B1MB 1P3FD 3LELB 5GSUA 3TU4C 5B40D 3AZLA 1M18A 4H9PA 4WU8C 5DNMD 3AZJC 3AZGA 3NQUB 1P3IA 3MGPA 2CV5B 5AY8C 3EPLA 3AN2C 1P3BB 3WKJC 3MNNA 5B24C 1P3MB 4WNNA 3MGRA 4KUDB 4XUJC 5GT0D 3REKC 3WTPA 3AZKC 5B33A 3W97C 4KGCA 1HQ3D 1W2EA 3W96B 5E5AD 3AYWB 5AV5A 2AROD 4EO5B 3MVDA 1KX4C 1KX5A 2F8NG 3W98D 5B0YC 4UPKA 4XZQD 4UUZB 3EPJA 1S32D 5BT1C 5CPJA 5B0ZD 3AZGB 2ZM5A 1P3IB 3MGPB 4YS3B 1P3PD 4WJ3C 1Q9CA 3X1UD 4J8UC 3MNNB 3P5JB 4YM6D 4WNNB 3REIA 2Y2PA 3MGRB 5AV8A 4ZUXC 3LELC 3WTPB 4J8WC 3EG5B 5B33B 4J8XB 3R45B 2NQBD 4LD9B 2Y2QA 5B32D 3MVDB 4WU8D 5JRGA 3KFUG 1P34B 1KX5B 5DNNA 3KWQA 5CPJB 3REHC 5CPKD 1P3LC 3FDDA 4KHAA 5B31A 1P3FB 2VQRA 2HIOA 1M19C 5B40B 2Y2IA 1P3GA 3AZFD 5AV8B 3LZ1A 3REJD 4EO5C 5CP6A 3O62A 1R4VA 4E44A 3AZMA 1ID3C 1ULYA 5KDMA 5JRGB 5AVBD 4YS3C 3WTPE 3WAAA 3WA9B 2BYKA 3EPKA 3KWQB 3A6NA 4Z5TB 4KHAB 1P3OC 5B31B 4QLCC 3UTBA 3W99D 1H3OA 5B1MD 3LELD 4X23B 4J8XC 3F6TA 4LD9C 3AV1A 1S32B 5GXQD 1EQZA 3LZ1B 5CPIB 3O62B 1P3PB 1P34C 2ZY2A 2CV5D 4J8VB 1P3BD 4Z2MG 3B6FA 3UT9A 2XD1A 1P3MD 1P3FC 4H9NA 4KUDD 2BYKB 4CSRA 5B2JD 1AOIA 5B40C 3KUYA 5F99A 3W96D 3UTBB 4CAYA 3MGSA 1F66A 5B32B 3AYWD 5DNMC 3AFAA 5BS7A 5AY8A 3MGQA 3AZLD 1M18D 5B24A 5AV6B 1EQZB 1P3KA 3AZGD 1P3ID 4YS3D 3MGPD 1P3AA 3RELA 5GT0C 3W97A 3MNND 3B6FB 2RIQA 4Z5TC 5E5AC 3H0MC 5B2IA 3AZEB 4H9NB 3MGRD 3AZFB 4CSRB 5BNVA 4HGAC 2AROC 5AV9A 3WTPD 1AOIB 5B33D 4KGCD 5F99B 5B0YA 3W98C 1ZLAA 4XZQC 1F66B 1S32C 3VH5A 5B0ZC 3AFAB 5CPIC 3MVDD 1P3PC 1KX5D 3X1UC 3VH6A 1JFIA 5CPJD 2L5AA 4H9RA 3W99B 4ZUXA 3RELB 2HUEC 3X1TB 3VH5W 3B6GA 2NZDA 3NQJB 1KX3A 2NQBC 1M1AB 5GXQB 3C1CA 5AV8D 5B32C 4H9OA 2F8NK 2IO5B 4G92B 1ZLAB 5BNXA 2F8NA 3LZ0B 5CPKC 3KXBB 5JRGD 3C1BA 3WA9D 5B2JB 1JFIB 3KWQD 4AWLB 4Z5TD 5B31D 3AZFC 3AZEC 3REJC 5GSUB 2XD5A 4X23D 2NZDB 3AZLB 1M18B 1ID3A 4WU9A 3C1CB 4H9PB 1B6WA 2Y2MA 3LZ1D 5AVBC 5CPID 3O62D 2F2AC 5BNXB 4Z66A 3IP4C 4J8VD 3UTAA 3AZNA 3AZHA 1WWSA 2Y2KA 5CHLB 3W99C 5B1MC 3WAAD 4NE5A 1TZYA
chains in the Genus database with same CATH topology
4KGCB 1U35A 5BO0A 3UTBD 1M1AC 5GXQC 5AV5B 4G91B 5GT3A 3H0LC 2CV5C 4G92C 5FUGA 4WU9B 1P3BC 3LZ0C 3AV1D 5AV6D 1EQZD 4WV4B 3AZIA 2RVQD 1P3MC 3EPHA 4Z66B 2PYOA 4KUDC 5B2JC 2JSSA 2Y2HA 3X1VA 3B6FD 3UT9D 3W96C 3REIB 3AZED 3AYWC 5GSUC 1AOID 5B1LA 5BO0B 3KUYD 5F99D 5AVCA 3AZLC 1M18C 1F66D 1HTAA 5GT3B 3AFAD 3AZGC 1P3IC 3MGPC 5DNNB 3MGQD 5FUGB 3MNNC 1HQ3A 3B0DB 4H9SA 2FJ7A 3B0CW 4M6BA 1P3KD 2BYMA 5C3IB 4ZBJB 2PYOB 3MGRC 2HIOB 3RELD 3AV2A 3X1TD 3WTPC 3X1SA 5B33C 3X1VB 1P3GB 4KGCC 3W98A 2YFWA 5B2ID 1M1AD 4G91C 3MVDC 5CP6B 5AV9D 3AZMB 4R8PA 1KX5C 3LJAA 1ZLAD 4YM6A 3LZ0D 5CPJC 5KDMB 3KXBD 4JJNA 3H0RC 3WAAB 2G5HC 2Y2JA 3TU4A 3A1KA 3A6NB 5JA4A 2FJ7B 2NQBA 2BYMB 1H3OB 4WU8A 5AV8C 3AZJA 2DF4C 3AV2B 5GSUD 3X1SB 2NZDD 3WKJA 3AN2A 1KX3D 2YFWB 3AV1B 3C1CD 2YFVA 5JRGC 4R8PB 4XUJA 3LJAB 3WA9C 3REKA 3AZKA 3KWQC 1N1JA 4JJNB 3UT9B 5B31C 5B32G 1KX4A 2FFFB 4X23C 3KUYB 4CAYB 3MGSB 2BG1A 5AV5D 3LZ1C 2W8SA 5AY8B 3O62C 3MGQB 3AZMC 4J8UA 4J8VC 5B24B 4WU9D 4H9QA 2J8PA 1PZRA 1P3KB 1P3AB 1KU5A 4DRAA 3WAAC 4XUJB 4Z66D 3LELA 3REKB 4J8WA 3W97B 3AZHD 3REID 5B2IB 3UTBC 5BNVB 3VH6W 5AV9B 1U35D 5B0YB 2CWEA 3REHA 3AV1C 5AV6C 1EQZC 1P3LA 5GT3D 2RVQC 5DNND 4J8UB 1M19A 3B6FC 3W96A 3UT9C 3AZID 4H9RB 4ZUXB 3AYWA 2PYOD 4J8WB 2HIOD 2ZY3A 1AOIC 2Y2GA 3X1VD 3KUYC 1P3GD 5F99C 3B6GB 1KX3B 2G5IC 2DQNC 3MGSC 4UUZA 1F66C 3AFAC 5BS7C 4YS3A 4H9OB 5CP6D 5B1LD 3MGQC 3AZMD 1TAFA 2F8NB 5AVCD 3REHB 1P3LB 1P3OA 1P3KC 2ZY4A 4QLCA 1P3AC 1WWIA 3C1BB 3RELC 1M19B 3X1TC 4J8XA 3A6ND 3R45A 2FJ7D 4LD9A 5B2IC 3AV2D 1B67A 5AV9C 1P34A 3X1SD 1T3UA 2IO5C 2LY8A 4Z2MH 1ID3B 1ZLAC 3KXBC 3A1IA 3VH5T 1P3FA 2Y2OA 1TAFB 4R8PD 3LJAD 3VH6T 5B40A 4AWLC 3UTAB 3AZHB 4JJND 4QLCB 3AZNB 1P3OB 5G49A 5DNMA 1TZYB 3TU4D 1U35B 3B6GC 2NZDC 1KX3C 3MGSD 3C1CC 4DRBA 3AZJD 1BH8A 5AY8D 1A7WA 3WA9A 3WKJD 3AN2D 5GT0A 4NE6A 5B24D 4Z5TA 3AZIB 5E5AA 1P3AD 2AROA 4XUJD 3C1BC 3REKD 3AZKD 3W97D 4X23A 4XZQA 3KSYA 5G49B 1S32A 5B0ZA 5DNMB 5AV5C 5CPIA 1P3PA 1KX4D 5B1LB 3X1UA 5B0YD 5AVCB 4J8VA 4WU9C 5BT1D 5B31G 1BH9A 1BH8B 1BFMA 4Z66C 5GT0B 4J8UD 2UWXA 1HQ3B 3UTAC 3AZHC 3AZNC 5E5AB 3REIC 4HGAB 2AROB 5B32A 4ZUXD 4J8WD 1TZYC 1F1EA 3W98B 1U35C 3B6GD 4XZQB 4NFTA 5AV6A 5B0ZB 5CPKA 3V9RA 5GT3C 4WZSB 3X1UB 5DNNC 2F8ND 4YM6B 3REHD 2JE5A 1P3LD 1BH9B 3B0DC 3AZIC 3AZFA 5C3IC 3AZEA 4ZBJC 2PYOC 3REJA 2HUEB 2HIOC 3C1BD 3TU4B 1M19D 2F8NH 5JA4B 3X1VC 1P3GC 2NQBB 4DQYB 4WU8B 3AZJB 5AVBA 5CP6C 2JCHA 5B1LC 2Y2LA 3B0CT 3AN2B 3WKJB 5AVCC 1ID3D 5CPKB 2YFVB 3V9RB 3W99A 5B1MA 3AZKB 3X1TA 1N1JB 1HQ3C 3A6NC 4H9SC 3UTAD 3AZND 1P3OD 3NQJA 2FJ7C 4QLCD 1M1AA 5GXQA 1Z2CB 3REJB 4NE3A 3AV2C 3NQUA 1KX4B 1TZYD 4J8XD 3X1SC 2CV5A 3AL0C 4E45A 2Y2NA 1P3BA 4LD9D 3LZ0A 3KXBA 5AVBB 1P3MA 1P34D 4R8PC 4KUDA 3LJAC 4H9QB 5B2JA 4YM6C 4JJNC 2ZY5A 3B0BA 5B1MB 1P3FD 3LELB 5GSUA 3TU4C 5B40D 3AZLA 1M18A 4H9PA 4WU8C 5DNMD 3AZJC 3AZGA 3NQUB 1P3IA 3MGPA 2CV5B 5AY8C 3EPLA 3AN2C 1P3BB 3WKJC 3MNNA 5B24C 1P3MB 4WNNA 3MGRA 4KUDB 4XUJC 5GT0D 3REKC 3WTPA 3AZKC 5B33A 3W97C 4KGCA 1HQ3D 1W2EA 3W96B 5E5AD 3AYWB 5AV5A 2AROD 4EO5B 3MVDA 1KX4C 1KX5A 2F8NG 3W98D 5B0YC 4UPKA 4XZQD 4UUZB 3EPJA 1S32D 5BT1C 5CPJA 5B0ZD 3AZGB 2ZM5A 1P3IB 3MGPB 4YS3B 1P3PD 4WJ3C 1Q9CA 3X1UD 4J8UC 3MNNB 3P5JB 4YM6D 4WNNB 3REIA 2Y2PA 3MGRB 5AV8A 4ZUXC 3LELC 3WTPB 4J8WC 3EG5B 5B33B 4J8XB 3R45B 2NQBD 4LD9B 2Y2QA 5B32D 3MVDB 4WU8D 5JRGA 3KFUG 1P34B 1KX5B 5DNNA 3KWQA 5CPJB 3REHC 5CPKD 1P3LC 3FDDA 4KHAA 5B31A 1P3FB 2VQRA 2HIOA 1M19C 5B40B 2Y2IA 1P3GA 3AZFD 5AV8B 3LZ1A 3REJD 4EO5C 5CP6A 3O62A 1R4VA 4E44A 3AZMA 1ID3C 1ULYA 5KDMA 5JRGB 5AVBD 4YS3C 3WTPE 3WAAA 3WA9B 2BYKA 3EPKA 3KWQB 3A6NA 4Z5TB 4KHAB 1P3OC 5B31B 4QLCC 3UTBA 3W99D 1H3OA 5B1MD 3LELD 4X23B 4J8XC 3F6TA 4LD9C 3AV1A 1S32B 5GXQD 1EQZA 3LZ1B 5CPIB 3O62B 1P3PB 1P34C 2ZY2A 2CV5D 4J8VB 1P3BD 4Z2MG 3B6FA 3UT9A 2XD1A 1P3MD 1P3FC 4H9NA 4KUDD 2BYKB 4CSRA 5B2JD 1AOIA 5B40C 3KUYA 5F99A 3W96D 3UTBB 4CAYA 3MGSA 1F66A 5B32B 3AYWD 5DNMC 3AFAA 5BS7A 5AY8A 3MGQA 3AZLD 1M18D 5B24A 5AV6B 1EQZB 1P3KA 3AZGD 1P3ID 4YS3D 3MGPD 1P3AA 3RELA 5GT0C 3W97A 3MNND 3B6FB 2RIQA 4Z5TC 5E5AC 3H0MC 5B2IA 3AZEB 4H9NB 3MGRD 3AZFB 4CSRB 5BNVA 4HGAC 2AROC 5AV9A 3WTPD 1AOIB 5B33D 4KGCD 5F99B 5B0YA 3W98C 1ZLAA 4XZQC 1F66B 1S32C 3VH5A 5B0ZC 3AFAB 5CPIC 3MVDD 1P3PC 1KX5D 3X1UC 3VH6A 1JFIA 5CPJD 2L5AA 4H9RA 3W99B 4ZUXA 3RELB 2HUEC 3X1TB 3VH5W 3B6GA 2NZDA 3NQJB 1KX3A 2NQBC 1M1AB 5GXQB 3C1CA 5AV8D 5B32C 4H9OA 2F8NK 2IO5B 4G92B 1ZLAB 5BNXA 2F8NA 3LZ0B 5CPKC 3KXBB 5JRGD 3C1BA 3WA9D 5B2JB 1JFIB 3KWQD 4AWLB 4Z5TD 5B31D 3AZFC 3AZEC 3REJC 5GSUB 2XD5A 4X23D 2NZDB 3AZLB 1M18B 1ID3A 4WU9A 3C1CB 4H9PB 1B6WA 2Y2MA 3LZ1D 5AVBC 5CPID 3O62D 2F2AC 5BNXB 4Z66A 3IP4C 4J8VD 3UTAA 3AZNA 3AZHA 1WWSA 2Y2KA 5CHLB 3W99C 5B1MC 3WAAD 4NE5A 1TZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGC B;  1U35 A;  5BO0 A;  3UTB D;  1M1A C;  5GXQ C;  5AV5 B;  4G91 B;  5GT3 A;  2CV5 C;  4G92 C;  5FUG A;  4WU9 B;  1P3B C;  3LZ0 C;  3AV1 D;  5AV6 D;  1EQZ D;  4WV4 B;  3AZI A;  2RVQ D;  1P3M C;  4Z66 B;  2PYO A;  4KUD C;  5B2J C;  2JSS A;  3X1V A;  3B6F D;  3UT9 D;  3W96 C;  3REI B;  3AZE D;  3AYW C;  5GSU C;  1AOI D;  5B1L A;  5BO0 B;  3KUY D;  5F99 D;  5AVC A;  3AZL C;  1M18 C;  1F66 D;  1HTA A;  5GT3 B;  3AFA D;  3AZG C;  1P3I C;  3MGP C;  5DNN B;  3MGQ D;  5FUG B;  3MNN C;  1HQ3 A;  3B0D B;  4H9S A;  2FJ7 A;  3B0C W;  4M6B A;  1P3K D;  2BYM A;  5C3I B;  4ZBJ B;  2PYO B;  3MGR C;  2HIO B;  3REL D;  3AV2 A;  3X1T D;  3WTP C;  3X1S A;  5B33 C;  3X1V B;  1P3G B;  4KGC C;  3W98 A;  2YFW A;  5B2I D;  1M1A D;  4G91 C;  3MVD C;  5CP6 B;  5AV9 D;  3AZM B;  4R8P A;  1KX5 C;  3LJA A;  1ZLA D;  4YM6 A;  3LZ0 D;  5CPJ C;  5KDM B;  3KXB D;  4JJN A;  3WAA B;  3TU4 A;  3A6N B;  5JA4 A;  2FJ7 B;  2NQB A;  2BYM B;  1H3O B;  4WU8 A;  5AV8 C;  3AZJ A;  3AV2 B;  5GSU D;  3X1S B;  2NZD D;  3WKJ A;  3AN2 A;  1KX3 D;  2YFW B;  3AV1 B;  3C1C D;  2YFV A;  5JRG C;  4R8P B;  4XUJ A;  3LJA B;  3WA9 C;  3REK A;  3AZK A;  3KWQ C;  1N1J A;  4JJN B;  3UT9 B;  5B31 C;  5B32 G;  1KX4 A;  4X23 C;  3KUY B;  4CAY B;  3MGS B;  5AV5 D;  3LZ1 C;  3O62 C;  5AY8 B;  3MGQ B;  3AZM C;  4J8U A;  4J8V C;  5B24 B;  4WU9 D;  4H9Q A;  1P3K B;  1P3A B;  1KU5 A;  4DRA A;  3WAA C;  4XUJ B;  4Z66 D;  3LEL A;  3REK B;  4J8W A;  3W97 B;  3AZH D;  3REI D;  5B2I B;  3UTB C;  5BNV B;  3VH6 W;  5AV9 B;  1U35 D;  5B0Y B;  2CWE A;  3REH A;  3AV1 C;  5AV6 C;  1EQZ C;  1P3L A;  5GT3 D;  2RVQ C;  5DNN D;  4J8U B;  1M19 A;  3B6F C;  3W96 A;  3UT9 C;  3AZI D;  4H9R B;  4ZUX B;  3AYW A;  2PYO D;  4J8W B;  2HIO D;  1AOI C;  3X1V D;  3KUY C;  1P3G D;  5F99 C;  3B6G B;  1KX3 B;  3MGS C;  4UUZ A;  1F66 C;  3AFA C;  5BS7 C;  4YS3 A;  4H9O B;  5CP6 D;  5B1L D;  3MGQ C;  3AZM D;  1TAF A;  2F8N B;  5AVC D;  3REH B;  1P3L B;  1P3O A;  1P3K C;  4QLC A;  1P3A C;  1WWI A;  3C1B B;  3REL C;  1M19 B;  3X1T C;  4J8X A;  3A6N D;  3R45 A;  2FJ7 D;  4LD9 A;  5B2I C;  3AV2 D;  1B67 A;  5AV9 C;  1P34 A;  3X1S D;  2IO5 C;  2LY8 A;  4Z2M H;  1ID3 B;  1ZLA C;  3KXB C;  3VH5 T;  1P3F A;  4R8P D;  1TAF B;  3LJA D;  3VH6 T;  5B40 A;  4AWL C;  3UTA B;  3AZH B;  4JJN D;  4QLC B;  3AZN B;  1P3O B;  5G49 A;  5DNM A;  1TZY B;  3TU4 D;  1U35 B;  3B6G C;  2NZD C;  1KX3 C;  3MGS D;  3C1C C;  4DRB A;  3AZJ D;  1BH8 A;  5AY8 D;  1A7W A;  3WA9 A;  3WKJ D;  3AN2 D;  5GT0 A;  4NE6 A;  5B24 D;  4Z5T A;  3AZI B;  5E5A A;  1P3A D;  2ARO A;  4XUJ D;  3C1B C;  3REK D;  3AZK D;  3W97 D;  4X23 A;  4XZQ A;  3KSY A;  5G49 B;  1S32 A;  5B0Z A;  5DNM B;  5AV5 C;  5CPI A;  1P3P A;  1KX4 D;  5B1L B;  3X1U A;  5B0Y D;  5AVC B;  4J8V A;  4WU9 C;  5BT1 D;  5B31 G;  1BH9 A;  1BH8 B;  1BFM A;  4Z66 C;  5GT0 B;  4J8U D;  1HQ3 B;  3UTA C;  3AZH C;  3AZN C;  5E5A B;  3REI C;  4HGA B;  2ARO B;  5B32 A;  4ZUX D;  4J8W D;  1TZY C;  1F1E A;  3W98 B;  1U35 C;  3B6G D;  4XZQ B;  4NFT A;  5AV6 A;  5B0Z B;  5CPK A;  3V9R A;  5GT3 C;  4WZS B;  3X1U B;  5DNN C;  2F8N D;  4YM6 B;  3REH D;  1P3L D;  1BH9 B;  3B0D C;  3AZI C;  3AZF A;  5C3I C;  3AZE A;  4ZBJ C;  2PYO C;  3REJ A;  2HUE B;  2HIO C;  3C1B D;  3TU4 B;  1M19 D;  2F8N H;  5JA4 B;  3X1V C;  1P3G C;  2NQB B;  4WU8 B;  3AZJ B;  5AVB A;  5CP6 C;  5B1L C;  3B0C T;  3AN2 B;  3WKJ B;  5AVC C;  1ID3 D;  5CPK B;  2YFV B;  3V9R B;  3W99 A;  5B1M A;  3AZK B;  3X1T A;  1N1J B;  1HQ3 C;  3A6N C;  4H9S C;  3UTA D;  3AZN D;  1P3O D;  3NQJ A;  2FJ7 C;  4QLC D;  1M1A A;  5GXQ A;  3REJ B;  4NE3 A;  3AV2 C;  3NQU A;  1KX4 B;  1TZY D;  4J8X D;  3X1S C;  2CV5 A;  4E45 A;  1P3B A;  4LD9 D;  3LZ0 A;  3KXB A;  5AVB B;  1P3M A;  1P34 D;  4R8P C;  4KUD A;  3LJA C;  4H9Q B;  5B2J A;  4YM6 C;  4JJN C;  3B0B A;  5B1M B;  1P3F D;  3LEL B;  5GSU A;  3TU4 C;  5B40 D;  3AZL A;  1M18 A;  4H9P A;  4WU8 C;  5DNM D;  3AZJ C;  3AZG A;  3NQU B;  1P3I A;  3MGP A;  2CV5 B;  5AY8 C;  1P3B B;  3AN2 C;  3WKJ C;  3MNN A;  5B24 C;  1P3M B;  4WNN A;  3MGR A;  4KUD B;  4XUJ C;  5GT0 D;  3REK C;  3WTP A;  3AZK C;  5B33 A;  3W97 C;  4KGC A;  1HQ3 D;  3W96 B;  5E5A D;  3AYW B;  5AV5 A;  2ARO D;  4EO5 B;  3MVD A;  1KX4 C;  1KX5 A;  2F8N G;  3W98 D;  5B0Y C;  4XZQ D;  4UUZ B;  1S32 D;  5BT1 C;  5CPJ A;  5B0Z D;  3AZG B;  1P3I B;  3MGP B;  4YS3 B;  1P3P D;  1Q9C A;  3X1U D;  4J8U C;  3MNN B;  4YM6 D;  4WNN B;  3REI A;  3MGR B;  5AV8 A;  4ZUX C;  3LEL C;  3WTP B;  4J8W C;  5B33 B;  4J8X B;  3R45 B;  2NQB D;  4LD9 B;  4WU8 D;  5B32 D;  3MVD B;  5JRG A;  1P34 B;  1KX5 B;  5DNN A;  3KWQ A;  5CPJ B;  3REH C;  5CPK D;  1P3L C;  4KHA A;  5B31 A;  1P3F B;  2HIO A;  1M19 C;  5B40 B;  1P3G A;  3AZF D;  5AV8 B;  3LZ1 A;  3REJ D;  4EO5 C;  5CP6 A;  3O62 A;  1R4V A;  4E44 A;  3AZM A;  1ID3 C;  1ULY A;  5KDM A;  5JRG B;  5AVB D;  4YS3 C;  3WTP E;  3WAA A;  3WA9 B;  2BYK A;  3KWQ B;  3A6N A;  4Z5T B;  4KHA B;  1P3O C;  5B31 B;  4QLC C;  3UTB A;  3W99 D;  1H3O A;  5B1M D;  3LEL D;  4X23 B;  4J8X C;  4LD9 C;  3AV1 A;  1S32 B;  5GXQ D;  1EQZ A;  3LZ1 B;  5CPI B;  3O62 B;  1P3P B;  1P34 C;  2CV5 D;  4J8V B;  1P3B D;  4Z2M G;  3B6F A;  3UT9 A;  1P3M D;  1P3F C;  4H9N A;  4KUD D;  2BYK B;  4CSR A;  5B2J D;  1AOI A;  5B40 C;  3KUY A;  5F99 A;  3W96 D;  3UTB B;  4CAY A;  3MGS A;  1F66 A;  5B32 B;  3AYW D;  5DNM C;  3AFA A;  5BS7 A;  5AY8 A;  3MGQ A;  3AZL D;  1M18 D;  5B24 A;  5AV6 B;  1EQZ B;  1P3K A;  3AZG D;  1P3I D;  4YS3 D;  3MGP D;  1P3A A;  3REL A;  5GT0 C;  3W97 A;  3MNN D;  3B6F B;  4Z5T C;  5E5A C;  3AZF B;  5B2I A;  3AZE B;  4H9N B;  3MGR D;  4CSR B;  5BNV A;  4HGA C;  2ARO C;  5AV9 A;  3WTP D;  1AOI B;  5B33 D;  4KGC D;  5F99 B;  5B0Y A;  3W98 C;  1ZLA A;  4XZQ C;  1F66 B;  1S32 C;  3VH5 A;  5B0Z C;  3AFA B;  5CPI C;  3MVD D;  1P3P C;  1KX5 D;  3X1U C;  3VH6 A;  1JFI A;  5CPJ D;  2L5A A;  4H9R A;  3W99 B;  4ZUX A;  3REL B;  2HUE C;  3X1T B;  3VH5 W;  3B6G A;  2NZD A;  3NQJ B;  1KX3 A;  2NQB C;  1M1A B;  5GXQ B;  3C1C A;  5AV8 D;  5B32 C;  4H9O A;  2F8N K;  2IO5 B;  4G92 B;  1ZLA B;  5BNX A;  2F8N A;  3LZ0 B;  5CPK C;  3KXB B;  5JRG D;  3C1B A;  3WA9 D;  5B2J B;  1JFI B;  3KWQ D;  4AWL B;  4Z5T D;  5B31 D;  3AZF C;  3AZE C;  3REJ C;  5GSU B;  4X23 D;  2NZD B;  3AZL B;  1M18 B;  1ID3 A;  4WU9 A;  3C1C B;  4H9P B;  1B6W A;  3LZ1 D;  5AVB C;  5CPI D;  3O62 D;  5BNX B;  4Z66 A;  4J8V D;  3UTA A;  3AZN A;  3AZH A;  1WWS A;  5CHL B;  3W99 C;  5B1M C;  3WAA D;  4NE5 A;  1TZY A; 
#chains in the Genus database with same CATH topology
 4KGC B;  1U35 A;  5BO0 A;  3UTB D;  1M1A C;  5GXQ C;  5AV5 B;  4G91 B;  5GT3 A;  3H0L C;  2CV5 C;  4G92 C;  5FUG A;  4WU9 B;  1P3B C;  3LZ0 C;  3AV1 D;  5AV6 D;  1EQZ D;  4WV4 B;  3AZI A;  2RVQ D;  1P3M C;  3EPH A;  4Z66 B;  2PYO A;  4KUD C;  5B2J C;  2JSS A;  2Y2H A;  3X1V A;  3B6F D;  3UT9 D;  3W96 C;  3REI B;  3AZE D;  3AYW C;  5GSU C;  1AOI D;  5B1L A;  5BO0 B;  3KUY D;  5F99 D;  5AVC A;  3AZL C;  1M18 C;  1F66 D;  1HTA A;  5GT3 B;  3AFA D;  3AZG C;  1P3I C;  3MGP C;  5DNN B;  3MGQ D;  5FUG B;  3MNN C;  1HQ3 A;  3B0D B;  4H9S A;  2FJ7 A;  3B0C W;  4M6B A;  1P3K D;  2BYM A;  5C3I B;  4ZBJ B;  2PYO B;  3MGR C;  2HIO B;  3REL D;  3AV2 A;  3X1T D;  3WTP C;  3X1S A;  5B33 C;  3X1V B;  1P3G B;  4KGC C;  3W98 A;  2YFW A;  5B2I D;  1M1A D;  4G91 C;  3MVD C;  5CP6 B;  5AV9 D;  3AZM B;  4R8P A;  1KX5 C;  3LJA A;  1ZLA D;  4YM6 A;  3LZ0 D;  5CPJ C;  5KDM B;  3KXB D;  4JJN A;  3H0R C;  3WAA B;  2G5H C;  2Y2J A;  3TU4 A;  3A1K A;  3A6N B;  5JA4 A;  2FJ7 B;  2NQB A;  2BYM B;  1H3O B;  4WU8 A;  5AV8 C;  3AZJ A;  2DF4 C;  3AV2 B;  5GSU D;  3X1S B;  2NZD D;  3WKJ A;  3AN2 A;  1KX3 D;  2YFW B;  3AV1 B;  3C1C D;  2YFV A;  5JRG C;  4R8P B;  4XUJ A;  3LJA B;  3WA9 C;  3REK A;  3AZK A;  3KWQ C;  1N1J A;  4JJN B;  3UT9 B;  5B31 C;  5B32 G;  1KX4 A;  2FFF B;  4X23 C;  3KUY B;  4CAY B;  3MGS B;  2BG1 A;  5AV5 D;  3LZ1 C;  2W8S A;  5AY8 B;  3O62 C;  3MGQ B;  3AZM C;  4J8U A;  4J8V C;  5B24 B;  4WU9 D;  4H9Q A;  2J8P A;  1PZR A;  1P3K B;  1P3A B;  1KU5 A;  4DRA A;  3WAA C;  4XUJ B;  4Z66 D;  3LEL A;  3REK B;  4J8W A;  3W97 B;  3AZH D;  3REI D;  5B2I B;  3UTB C;  5BNV B;  3VH6 W;  5AV9 B;  1U35 D;  5B0Y B;  2CWE A;  3REH A;  3AV1 C;  5AV6 C;  1EQZ C;  1P3L A;  5GT3 D;  2RVQ C;  5DNN D;  4J8U B;  1M19 A;  3B6F C;  3W96 A;  3UT9 C;  3AZI D;  4H9R B;  4ZUX B;  3AYW A;  2PYO D;  4J8W B;  2HIO D;  2ZY3 A;  1AOI C;  2Y2G A;  3X1V D;  3KUY C;  1P3G D;  5F99 C;  3B6G B;  1KX3 B;  2G5I C;  2DQN C;  3MGS C;  4UUZ A;  1F66 C;  3AFA C;  5BS7 C;  4YS3 A;  4H9O B;  5CP6 D;  5B1L D;  3MGQ C;  3AZM D;  1TAF A;  2F8N B;  5AVC D;  3REH B;  1P3L B;  1P3O A;  1P3K C;  2ZY4 A;  4QLC A;  1P3A C;  1WWI A;  3C1B B;  3REL C;  1M19 B;  3X1T C;  4J8X A;  3A6N D;  3R45 A;  2FJ7 D;  4LD9 A;  5B2I C;  3AV2 D;  1B67 A;  5AV9 C;  1P34 A;  3X1S D;  1T3U A;  2IO5 C;  2LY8 A;  4Z2M H;  1ID3 B;  1ZLA C;  3KXB C;  3A1I A;  3VH5 T;  1P3F A;  2Y2O A;  1TAF B;  4R8P D;  3LJA D;  3VH6 T;  5B40 A;  4AWL C;  3UTA B;  3AZH B;  4JJN D;  4QLC B;  3AZN B;  1P3O B;  5G49 A;  5DNM A;  1TZY B;  3TU4 D;  1U35 B;  3B6G C;  2NZD C;  1KX3 C;  3MGS D;  3C1C C;  4DRB A;  3AZJ D;  1BH8 A;  5AY8 D;  1A7W A;  3WA9 A;  3WKJ D;  3AN2 D;  5GT0 A;  4NE6 A;  5B24 D;  4Z5T A;  3AZI B;  5E5A A;  1P3A D;  2ARO A;  4XUJ D;  3C1B C;  3REK D;  3AZK D;  3W97 D;  4X23 A;  4XZQ A;  3KSY A;  5G49 B;  1S32 A;  5B0Z A;  5DNM B;  5AV5 C;  5CPI A;  1P3P A;  1KX4 D;  5B1L B;  3X1U A;  5B0Y D;  5AVC B;  4J8V A;  4WU9 C;  5BT1 D;  5B31 G;  1BH9 A;  1BH8 B;  1BFM A;  4Z66 C;  5GT0 B;  4J8U D;  2UWX A;  1HQ3 B;  3UTA C;  3AZH C;  3AZN C;  5E5A B;  3REI C;  4HGA B;  2ARO B;  5B32 A;  4ZUX D;  4J8W D;  1TZY C;  1F1E A;  3W98 B;  1U35 C;  3B6G D;  4XZQ B;  4NFT A;  5AV6 A;  5B0Z B;  5CPK A;  3V9R A;  5GT3 C;  4WZS B;  3X1U B;  5DNN C;  2F8N D;  4YM6 B;  3REH D;  2JE5 A;  1P3L D;  1BH9 B;  3B0D C;  3AZI C;  3AZF A;  5C3I C;  3AZE A;  4ZBJ C;  2PYO C;  3REJ A;  2HUE B;  2HIO C;  3C1B D;  3TU4 B;  1M19 D;  2F8N H;  5JA4 B;  3X1V C;  1P3G C;  2NQB B;  4DQY B;  4WU8 B;  3AZJ B;  5AVB A;  5CP6 C;  2JCH A;  5B1L C;  2Y2L A;  3B0C T;  3AN2 B;  3WKJ B;  5AVC C;  1ID3 D;  5CPK B;  2YFV B;  3V9R B;  3W99 A;  5B1M A;  3AZK B;  3X1T A;  1N1J B;  1HQ3 C;  3A6N C;  4H9S C;  3UTA D;  3AZN D;  1P3O D;  3NQJ A;  2FJ7 C;  4QLC D;  1M1A A;  5GXQ A;  1Z2C B;  3REJ B;  4NE3 A;  3AV2 C;  3NQU A;  1KX4 B;  1TZY D;  4J8X D;  3X1S C;  2CV5 A;  3AL0 C;  4E45 A;  2Y2N A;  1P3B A;  4LD9 D;  3LZ0 A;  3KXB A;  5AVB B;  1P3M A;  1P34 D;  4R8P C;  4KUD A;  3LJA C;  4H9Q B;  5B2J A;  4YM6 C;  4JJN C;  2ZY5 A;  3B0B A;  5B1M B;  1P3F D;  3LEL B;  5GSU A;  3TU4 C;  5B40 D;  3AZL A;  1M18 A;  4H9P A;  4WU8 C;  5DNM D;  3AZJ C;  3AZG A;  3NQU B;  1P3I A;  3MGP A;  2CV5 B;  5AY8 C;  3EPL A;  3AN2 C;  1P3B B;  3WKJ C;  3MNN A;  5B24 C;  1P3M B;  4WNN A;  3MGR A;  4KUD B;  4XUJ C;  5GT0 D;  3REK C;  3WTP A;  3AZK C;  5B33 A;  3W97 C;  4KGC A;  1HQ3 D;  1W2E A;  3W96 B;  5E5A D;  3AYW B;  5AV5 A;  2ARO D;  4EO5 B;  3MVD A;  1KX4 C;  1KX5 A;  2F8N G;  3W98 D;  5B0Y C;  4UPK A;  4XZQ D;  4UUZ B;  3EPJ A;  1S32 D;  5BT1 C;  5CPJ A;  5B0Z D;  3AZG B;  2ZM5 A;  1P3I B;  3MGP B;  4YS3 B;  1P3P D;  4WJ3 C;  1Q9C A;  3X1U D;  4J8U C;  3MNN B;  3P5J B;  4YM6 D;  4WNN B;  3REI A;  2Y2P A;  3MGR B;  5AV8 A;  4ZUX C;  3LEL C;  3WTP B;  4J8W C;  3EG5 B;  5B33 B;  4J8X B;  3R45 B;  2NQB D;  4LD9 B;  2Y2Q A;  5B32 D;  3MVD B;  4WU8 D;  5JRG A;  3KFU G;  1P34 B;  1KX5 B;  5DNN A;  3KWQ A;  5CPJ B;  3REH C;  5CPK D;  1P3L C;  3FDD A;  4KHA A;  5B31 A;  1P3F B;  2VQR A;  2HIO A;  1M19 C;  5B40 B;  2Y2I A;  1P3G A;  3AZF D;  5AV8 B;  3LZ1 A;  3REJ D;  4EO5 C;  5CP6 A;  3O62 A;  1R4V A;  4E44 A;  3AZM A;  1ID3 C;  1ULY A;  5KDM A;  5JRG B;  5AVB D;  4YS3 C;  3WTP E;  3WAA A;  3WA9 B;  2BYK A;  3EPK A;  3KWQ B;  3A6N A;  4Z5T B;  4KHA B;  1P3O C;  5B31 B;  4QLC C;  3UTB A;  3W99 D;  1H3O A;  5B1M D;  3LEL D;  4X23 B;  4J8X C;  3F6T A;  4LD9 C;  3AV1 A;  1S32 B;  5GXQ D;  1EQZ A;  3LZ1 B;  5CPI B;  3O62 B;  1P3P B;  1P34 C;  2ZY2 A;  2CV5 D;  4J8V B;  1P3B D;  4Z2M G;  3B6F A;  3UT9 A;  2XD1 A;  1P3M D;  1P3F C;  4H9N A;  4KUD D;  2BYK B;  4CSR A;  5B2J D;  1AOI A;  5B40 C;  3KUY A;  5F99 A;  3W96 D;  3UTB B;  4CAY A;  3MGS A;  1F66 A;  5B32 B;  3AYW D;  5DNM C;  3AFA A;  5BS7 A;  5AY8 A;  3MGQ A;  3AZL D;  1M18 D;  5B24 A;  5AV6 B;  1EQZ B;  1P3K A;  3AZG D;  1P3I D;  4YS3 D;  3MGP D;  1P3A A;  3REL A;  5GT0 C;  3W97 A;  3MNN D;  3B6F B;  2RIQ A;  4Z5T C;  5E5A C;  3H0M C;  5B2I A;  3AZE B;  4H9N B;  3MGR D;  3AZF B;  4CSR B;  5BNV A;  4HGA C;  2ARO C;  5AV9 A;  3WTP D;  1AOI B;  5B33 D;  4KGC D;  5F99 B;  5B0Y A;  3W98 C;  1ZLA A;  4XZQ C;  1F66 B;  1S32 C;  3VH5 A;  5B0Z C;  3AFA B;  5CPI C;  3MVD D;  1P3P C;  1KX5 D;  3X1U C;  3VH6 A;  1JFI A;  5CPJ D;  2L5A A;  4H9R A;  3W99 B;  4ZUX A;  3REL B;  2HUE C;  3X1T B;  3VH5 W;  3B6G A;  2NZD A;  3NQJ B;  1KX3 A;  2NQB C;  1M1A B;  5GXQ B;  3C1C A;  5AV8 D;  5B32 C;  4H9O A;  2F8N K;  2IO5 B;  4G92 B;  1ZLA B;  5BNX A;  2F8N A;  3LZ0 B;  5CPK C;  3KXB B;  5JRG D;  3C1B A;  3WA9 D;  5B2J B;  1JFI B;  3KWQ D;  4AWL B;  4Z5T D;  5B31 D;  3AZF C;  3AZE C;  3REJ C;  5GSU B;  2XD5 A;  4X23 D;  2NZD B;  3AZL B;  1M18 B;  1ID3 A;  4WU9 A;  3C1C B;  4H9P B;  1B6W A;  2Y2M A;  3LZ1 D;  5AVB C;  5CPI D;  3O62 D;  2F2A C;  5BNX B;  4Z66 A;  3IP4 C;  4J8V D;  3UTA A;  3AZN A;  3AZH A;  1WWS A;  2Y2K A;  5CHL B;  3W99 C;  5B1M C;  3WAA D;  4NE5 A;  1TZY A; 
#chains in the Genus database with same CATH homology
 4KGC B;  1U35 A;  5BO0 A;  3UTB D;  1M1A C;  5GXQ C;  5AV5 B;  4G91 B;  5GT3 A;  3H0L C;  2CV5 C;  4G92 C;  5FUG A;  4WU9 B;  1P3B C;  3LZ0 C;  3AV1 D;  5AV6 D;  1EQZ D;  4WV4 B;  3AZI A;  2RVQ D;  1P3M C;  3EPH A;  4Z66 B;  2PYO A;  4KUD C;  5B2J C;  2JSS A;  2Y2H A;  3X1V A;  3B6F D;  3UT9 D;  3W96 C;  3REI B;  3AZE D;  3AYW C;  5GSU C;  1AOI D;  5B1L A;  5BO0 B;  3KUY D;  5F99 D;  5AVC A;  3AZL C;  1M18 C;  1F66 D;  1HTA A;  5GT3 B;  3AFA D;  3AZG C;  1P3I C;  3MGP C;  5DNN B;  3MGQ D;  5FUG B;  3MNN C;  1HQ3 A;  3B0D B;  4H9S A;  2FJ7 A;  3B0C W;  4M6B A;  1P3K D;  2BYM A;  5C3I B;  4ZBJ B;  2PYO B;  3MGR C;  2HIO B;  3REL D;  3AV2 A;  3X1T D;  3WTP C;  3X1S A;  5B33 C;  3X1V B;  1P3G B;  4KGC C;  3W98 A;  2YFW A;  5B2I D;  1M1A D;  4G91 C;  3MVD C;  5CP6 B;  5AV9 D;  3AZM B;  4R8P A;  1KX5 C;  3LJA A;  1ZLA D;  4YM6 A;  3LZ0 D;  5CPJ C;  5KDM B;  3KXB D;  4JJN A;  3H0R C;  3WAA B;  2G5H C;  2Y2J A;  3TU4 A;  3A1K A;  3A6N B;  5JA4 A;  2FJ7 B;  2NQB A;  2BYM B;  1H3O B;  4WU8 A;  5AV8 C;  3AZJ A;  2DF4 C;  3AV2 B;  5GSU D;  3X1S B;  2NZD D;  3WKJ A;  3AN2 A;  1KX3 D;  2YFW B;  3AV1 B;  3C1C D;  2YFV A;  5JRG C;  4R8P B;  4XUJ A;  3LJA B;  3WA9 C;  3REK A;  3AZK A;  3KWQ C;  1N1J A;  4JJN B;  3UT9 B;  5B31 C;  5B32 G;  1KX4 A;  2FFF B;  4X23 C;  3KUY B;  4CAY B;  3MGS B;  2BG1 A;  5AV5 D;  3LZ1 C;  2W8S A;  5AY8 B;  3O62 C;  3MGQ B;  3AZM C;  4J8U A;  4J8V C;  5B24 B;  4WU9 D;  4H9Q A;  2J8P A;  1PZR A;  1P3K B;  1P3A B;  1KU5 A;  4DRA A;  3WAA C;  4XUJ B;  4Z66 D;  3LEL A;  3REK B;  4J8W A;  3W97 B;  3AZH D;  3REI D;  5B2I B;  3UTB C;  5BNV B;  3VH6 W;  5AV9 B;  1U35 D;  5B0Y B;  2CWE A;  3REH A;  3AV1 C;  5AV6 C;  1EQZ C;  1P3L A;  5GT3 D;  2RVQ C;  5DNN D;  4J8U B;  1M19 A;  3B6F C;  3W96 A;  3UT9 C;  3AZI D;  4H9R B;  4ZUX B;  3AYW A;  2PYO D;  4J8W B;  2HIO D;  2ZY3 A;  1AOI C;  2Y2G A;  3X1V D;  3KUY C;  1P3G D;  5F99 C;  3B6G B;  1KX3 B;  2G5I C;  2DQN C;  3MGS C;  4UUZ A;  1F66 C;  3AFA C;  5BS7 C;  4YS3 A;  4H9O B;  5CP6 D;  5B1L D;  3MGQ C;  3AZM D;  1TAF A;  2F8N B;  5AVC D;  3REH B;  1P3L B;  1P3O A;  1P3K C;  2ZY4 A;  4QLC A;  1P3A C;  1WWI A;  3C1B B;  3REL C;  1M19 B;  3X1T C;  4J8X A;  3A6N D;  3R45 A;  2FJ7 D;  4LD9 A;  5B2I C;  3AV2 D;  1B67 A;  5AV9 C;  1P34 A;  3X1S D;  1T3U A;  2IO5 C;  2LY8 A;  4Z2M H;  1ID3 B;  1ZLA C;  3KXB C;  3A1I A;  3VH5 T;  1P3F A;  2Y2O A;  1TAF B;  4R8P D;  3LJA D;  3VH6 T;  5B40 A;  4AWL C;  3UTA B;  3AZH B;  4JJN D;  4QLC B;  3AZN B;  1P3O B;  5G49 A;  5DNM A;  1TZY B;  3TU4 D;  1U35 B;  3B6G C;  2NZD C;  1KX3 C;  3MGS D;  3C1C C;  4DRB A;  3AZJ D;  1BH8 A;  5AY8 D;  1A7W A;  3WA9 A;  3WKJ D;  3AN2 D;  5GT0 A;  4NE6 A;  5B24 D;  4Z5T A;  3AZI B;  5E5A A;  1P3A D;  2ARO A;  4XUJ D;  3C1B C;  3REK D;  3AZK D;  3W97 D;  4X23 A;  4XZQ A;  3KSY A;  5G49 B;  1S32 A;  5B0Z A;  5DNM B;  5AV5 C;  5CPI A;  1P3P A;  1KX4 D;  5B1L B;  3X1U A;  5B0Y D;  5AVC B;  4J8V A;  4WU9 C;  5BT1 D;  5B31 G;  1BH9 A;  1BH8 B;  1BFM A;  4Z66 C;  5GT0 B;  4J8U D;  2UWX A;  1HQ3 B;  3UTA C;  3AZH C;  3AZN C;  5E5A B;  3REI C;  4HGA B;  2ARO B;  5B32 A;  4ZUX D;  4J8W D;  1TZY C;  1F1E A;  3W98 B;  1U35 C;  3B6G D;  4XZQ B;  4NFT A;  5AV6 A;  5B0Z B;  5CPK A;  3V9R A;  5GT3 C;  4WZS B;  3X1U B;  5DNN C;  2F8N D;  4YM6 B;  3REH D;  2JE5 A;  1P3L D;  1BH9 B;  3B0D C;  3AZI C;  3AZF A;  5C3I C;  3AZE A;  4ZBJ C;  2PYO C;  3REJ A;  2HUE B;  2HIO C;  3C1B D;  3TU4 B;  1M19 D;  2F8N H;  5JA4 B;  3X1V C;  1P3G C;  2NQB B;  4DQY B;  4WU8 B;  3AZJ B;  5AVB A;  5CP6 C;  2JCH A;  5B1L C;  2Y2L A;  3B0C T;  3AN2 B;  3WKJ B;  5AVC C;  1ID3 D;  5CPK B;  2YFV B;  3V9R B;  3W99 A;  5B1M A;  3AZK B;  3X1T A;  1N1J B;  1HQ3 C;  3A6N C;  4H9S C;  3UTA D;  3AZN D;  1P3O D;  3NQJ A;  2FJ7 C;  4QLC D;  1M1A A;  5GXQ A;  1Z2C B;  3REJ B;  4NE3 A;  3AV2 C;  3NQU A;  1KX4 B;  1TZY D;  4J8X D;  3X1S C;  2CV5 A;  3AL0 C;  4E45 A;  2Y2N A;  1P3B A;  4LD9 D;  3LZ0 A;  3KXB A;  5AVB B;  1P3M A;  1P34 D;  4R8P C;  4KUD A;  3LJA C;  4H9Q B;  5B2J A;  4YM6 C;  4JJN C;  2ZY5 A;  3B0B A;  5B1M B;  1P3F D;  3LEL B;  5GSU A;  3TU4 C;  5B40 D;  3AZL A;  1M18 A;  4H9P A;  4WU8 C;  5DNM D;  3AZJ C;  3AZG A;  3NQU B;  1P3I A;  3MGP A;  2CV5 B;  5AY8 C;  3EPL A;  3AN2 C;  1P3B B;  3WKJ C;  3MNN A;  5B24 C;  1P3M B;  4WNN A;  3MGR A;  4KUD B;  4XUJ C;  5GT0 D;  3REK C;  3WTP A;  3AZK C;  5B33 A;  3W97 C;  4KGC A;  1HQ3 D;  1W2E A;  3W96 B;  5E5A D;  3AYW B;  5AV5 A;  2ARO D;  4EO5 B;  3MVD A;  1KX4 C;  1KX5 A;  2F8N G;  3W98 D;  5B0Y C;  4UPK A;  4XZQ D;  4UUZ B;  3EPJ A;  1S32 D;  5BT1 C;  5CPJ A;  5B0Z D;  3AZG B;  2ZM5 A;  1P3I B;  3MGP B;  4YS3 B;  1P3P D;  4WJ3 C;  1Q9C A;  3X1U D;  4J8U C;  3MNN B;  3P5J B;  4YM6 D;  4WNN B;  3REI A;  2Y2P A;  3MGR B;  5AV8 A;  4ZUX C;  3LEL C;  3WTP B;  4J8W C;  3EG5 B;  5B33 B;  4J8X B;  3R45 B;  2NQB D;  4LD9 B;  2Y2Q A;  5B32 D;  3MVD B;  4WU8 D;  5JRG A;  3KFU G;  1P34 B;  1KX5 B;  5DNN A;  3KWQ A;  5CPJ B;  3REH C;  5CPK D;  1P3L C;  3FDD A;  4KHA A;  5B31 A;  1P3F B;  2VQR A;  2HIO A;  1M19 C;  5B40 B;  2Y2I A;  1P3G A;  3AZF D;  5AV8 B;  3LZ1 A;  3REJ D;  4EO5 C;  5CP6 A;  3O62 A;  1R4V A;  4E44 A;  3AZM A;  1ID3 C;  1ULY A;  5KDM A;  5JRG B;  5AVB D;  4YS3 C;  3WTP E;  3WAA A;  3WA9 B;  2BYK A;  3EPK A;  3KWQ B;  3A6N A;  4Z5T B;  4KHA B;  1P3O C;  5B31 B;  4QLC C;  3UTB A;  3W99 D;  1H3O A;  5B1M D;  3LEL D;  4X23 B;  4J8X C;  3F6T A;  4LD9 C;  3AV1 A;  1S32 B;  5GXQ D;  1EQZ A;  3LZ1 B;  5CPI B;  3O62 B;  1P3P B;  1P34 C;  2ZY2 A;  2CV5 D;  4J8V B;  1P3B D;  4Z2M G;  3B6F A;  3UT9 A;  2XD1 A;  1P3M D;  1P3F C;  4H9N A;  4KUD D;  2BYK B;  4CSR A;  5B2J D;  1AOI A;  5B40 C;  3KUY A;  5F99 A;  3W96 D;  3UTB B;  4CAY A;  3MGS A;  1F66 A;  5B32 B;  3AYW D;  5DNM C;  3AFA A;  5BS7 A;  5AY8 A;  3MGQ A;  3AZL D;  1M18 D;  5B24 A;  5AV6 B;  1EQZ B;  1P3K A;  3AZG D;  1P3I D;  4YS3 D;  3MGP D;  1P3A A;  3REL A;  5GT0 C;  3W97 A;  3MNN D;  3B6F B;  2RIQ A;  4Z5T C;  5E5A C;  3H0M C;  5B2I A;  3AZE B;  4H9N B;  3MGR D;  3AZF B;  4CSR B;  5BNV A;  4HGA C;  2ARO C;  5AV9 A;  3WTP D;  1AOI B;  5B33 D;  4KGC D;  5F99 B;  5B0Y A;  3W98 C;  1ZLA A;  4XZQ C;  1F66 B;  1S32 C;  3VH5 A;  5B0Z C;  3AFA B;  5CPI C;  3MVD D;  1P3P C;  1KX5 D;  3X1U C;  3VH6 A;  1JFI A;  5CPJ D;  2L5A A;  4H9R A;  3W99 B;  4ZUX A;  3REL B;  2HUE C;  3X1T B;  3VH5 W;  3B6G A;  2NZD A;  3NQJ B;  1KX3 A;  2NQB C;  1M1A B;  5GXQ B;  3C1C A;  5AV8 D;  5B32 C;  4H9O A;  2F8N K;  2IO5 B;  4G92 B;  1ZLA B;  5BNX A;  2F8N A;  3LZ0 B;  5CPK C;  3KXB B;  5JRG D;  3C1B A;  3WA9 D;  5B2J B;  1JFI B;  3KWQ D;  4AWL B;  4Z5T D;  5B31 D;  3AZF C;  3AZE C;  3REJ C;  5GSU B;  2XD5 A;  4X23 D;  2NZD B;  3AZL B;  1M18 B;  1ID3 A;  4WU9 A;  3C1C B;  4H9P B;  1B6W A;  2Y2M A;  3LZ1 D;  5AVB C;  5CPI D;  3O62 D;  2F2A C;  5BNX B;  4Z66 A;  3IP4 C;  4J8V D;  3UTA A;  3AZN A;  3AZH A;  1WWS A;  2Y2K A;  5CHL B;  3W99 C;  5B1M C;  3WAA D;  4NE5 A;  1TZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...