4XZQB

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
b'DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4xzqB00
4KGCD 3B0BA 3MGPC 3UT9C 5B1MB 3B6FD 3MNNC 1P3IA 4R8PC 3AN2D 5AVCA 3AZIA 3O62D 4QLCA 1TAFB 2BYMB 1P3BA 5B32C 3REJD 1M18A 5B31G 3W96A 3AZEC 4X23D 3W97D 4H9OA 3A6ND 3AV2C 3LZ1A 1P3GC 3AZJC 4KHAA 5GT3C 4ZUXD 3NQUB 3REID 2PYOD 3AV1C 4H9SC 5CP6D 5AVBC 3W99D 4J8WA 3X1TB 3X1VB 3B6GB 5BT1D 4H9NA 4XZQB 4EO5C 1ZLAD 2AROB 2HIOA 1P3IC 2BYKA 3KUYD 5AVCC 3AZIC 4QLCC 5AV9B 3MVDB 1P3BC 1M18C 3W96C 5B2IB 3VH6T 1TZYB 3REHA 3LZ0B 3X1SA 3WKJA 1P3AA 1M19B 1P3KB 3LZ1C 5AV5B 1P3LD 1R4VA 3AFAD 1JFIA 1BH8B 5B40D 3C1CD 5GT0D 1N1JA 5JRGD 1ID3A 3NQJA 4J8WC 3AZKD 1P34A 1AOID 2F8NK 4XUJB 3AZMA 2HIOC 5CPKD 2JSSA 5F99A 4Z66A 4Z5TA 3AZLD 4YM6D 5E5AB 3REHC 3X1SC 3WKJC 2YFVB 3MGPB 3UT9B 1P3AC 3MNNB 2NQBD 4R8PB 3UTAA 2L5AA 3O62A 4WU8D 1P3MA 5AY8D 5B1LA 1KU5A 3MGRD 5B32B 3AZGA 4Z2MH 3MGQA 3AZEB 1P3FA 1ID3C 3W97A 4X23A 1BFMA 1P34C 4ZBJC 3A6NA 3AV2B 1P3GB 3AZJB 4WU9A 2RVQC 3AZMC 4ZUXA 3AZFD 3C1BD 2PYOA 5F99C 4WNNB 4Z66C 3AV1B 4Z5TC 5AVBB 1KX4D 5GXQD 3TU4D 3X1UD 3R45B 1P3IB 3UTAC 3O62C 3WTPE 3KXBD 3LJAC 5AVCB 3AZIB 1P3MC 4QLCB 2F8ND 5B1LC 5B2JA 1P3BB 1M18B 3AZGC 5B0YA 3V9RA 3MGQC 3W96B 4JJNA 1P3FC 3W97C 5BNXA 5B33D 4Z2MG 4YS3B 3A6NC 4H9OB 3LZ1B 4WU9C 3AFAA 4KHAB 4ZUXC 3WA9D 5B40A 3KWQD 5GT0A 2PYOC 3W98A 2FJ7B 5JRGA 5KDMA 1KX5D 3REKD 5BNVB 3RELA 4J8WB 3VH5A 1EQZA 1A7WA 5CPJD 3LELB 5B0ZA 2HIOB 2BYKB 5B1MD 1Q9CA 3AZHB 3B0DB 5B2JC 4H9PA 5BO0A 3AZLA 5B0YC 4J8UA 4G91C 4JJNC 4LD9D 2F8NH 1HQ3D 3X1SB 3WKJB 1P3AB 5G49A 2NQBA 3AFAC 5AY8A 4H9QA 3MGRA 3WTPB 5B40C 5GT0C 3W98C 5JRGC 1HTAA 5B31A 1N1JB 1ID3B 3B0CT 1M1AD 3NQJB 3RELC 5DNNA 1EQZC 1P34B 4ZBJB 3X1TD 5B0ZC 3X1VD 1H3OB 3AZMB 3AZFA 4UUZA 3C1BA 1P3PA 2AROD 1P3OA 5F99B 4Z66B 5C3IC 3AZLC 2HUEC 4J8UC 1KX4A 4Z5TB 5AV9D 3VH5T 1WWSA 3WAAA 5CPIB 5B2ID 1B67A 1F66A 4E45A 3AZND 3TU4A 3LZ0D 3X1UA 2F8NG 2NQBC 5AV6A 1KX3A 3UTAB 1P3KD 5AY8C 1BH9A 3LJAB 5GSUD 1P3MB 5AV5D 5B1LB 3AZGB 5B31C 3MGQB 1P3FB 3VH6W 5B33A 3UTBD 3W97B 5BS7A 5B24D 5DNNC 3A6NB 4WZSB 4WU9B 4HGAC 3WA9A 4ZUXB 3AZFC 3C1BC 1S32D 5DNMD 4XUJD 1P3PC 1P3OC 3MGSA 2PYOB 5AV8A 3REKA 1KX4C 4H9RA 3WAAC 4KUDA 5CPJA 1ULYA 1F1EA 3AYWD 1F66C 3TU4C 3X1UC 5B1MA 2CV5A 3MGPD 5AV6C 1KX3C 2CWEA 5B2JB 4R8PD 4KGCA 5B0YB 3V9RB 4G91B 4LD9A 2NZDD 4JJNB 5FUGA 5B33C 1HQ3A 5BNXB 5B32D 3B6FA 5BS7C 4E44A 3AN2A 2LY8A 3REJA 1P3GD 4CSRA 3AZJD 5B40B 4NE3A 5GT0B 3MGSC 3W98B 5JRGB 5AV8C 5KDMB 1M1AA 3REKC 3RELB 4KUDC 3AV1D 5CPJC 1EQZB 5AVBD 5B0ZB 5GT3B 3REIA 5B1MC 2CV5C 5CP6A 3W99A 4DRBA 4H9PB 5C3IB 5BO0B 5AVCD 4QLCD 2HUEB 4J8UB 3AZID 3AZLB 4KGCC 4LD9C 5CHLB 1ZLAA 1P3BD 1HQ3C 4EO5B 5B2IA 3B6FC 3W96D 3KUYA 3AN2C 3AZNA 5G49B 2NQBB 4YS3D 3REJC 5GSUA 5AY8B 4H9QB 3LZ1D 1U35D 4X23C 5B31B 3UTBA 1M1AC 2FJ7D 5B24A 1P3LA 4J8VD 5DNNB 4J8WD 3C1CA 3REIC 4HGAB 3LELD 1S32A 5DNMA 5CP6C 4UUZB 3C1BB 3AZFB 1P3PB 3W99C 2HIOD 3AZKA 1P3OB 4J8XD 3AZHD 1AOIA 5BT1C 1KX4B 3WAAB 4H9NB 1ZLAC 5B2IC 3AYWA 3KUYC 3AZNC 5CPKA 1F66B 3TU4B 3X1SD 3X1UB 3MGPA 1P3AD 5AV6B 1KX3B 5GSUC 1BH9B 4YM6A 4CAYA 5B32G 3WTPD 3REHB 3UTBC 2NZDA 5B33B 3KSYA 5B24C 1P3LC 1ID3D 4WU8A 1JFIB 3C1CC 1B6WA 1S32C 5DNMC 3AZMD 3MGSB 3AZKC 5AV8B 1AOIC 3REKB 3B0CW 4H9RB 4KUDB 5CPJB 3B6GD 3AYWC 4XZQD 2IO5C 5CPID 5CPKC 2CV5B 3R45A 4M6BA 4YM6C 4NE6A 5JA4A 5GXQA 3UTAD 3MVDD 3LJAD 1P3MD 4KGCB 2NZDC 2YFWA 5B1LD 3VH5W 4LD9B 5FUGB 3B6FB 1HQ3B 3AZGD 1TZYD 3MGQD 1P3FD 3AN2B 4WU8C 3KXBA 1M19D 4YS3A 3O62B 2F8NA 3MGRC 3REJB 1U35A 4CSRB 4WU9D 4X23B 1M1AB 2FJ7A 4J8VA 5BNVA 3KWQA 3LELA 3REIB 4NE5A 5CP6B 1KX5A 3W99B 4J8XA 3AZHA 5GXQC 4WV4B 5B2JD 5E5AD 1ZLAB 5B0YD 4JJND 1WWIA 3KUYB 3AZNB 3KXBC 3UT9D 4YS3C 3MNND 5GSUB 1TAFA 1U35C 2BYMA 3WTPA 3UTBB 3AZED 2FJ7C 4AWLC 3W98D 4J8VC 5B24B 4G92C 1P3LB 3AFAB 3RELD 3AV2D 3WA9C 3KWQC 1EQZD 3LELC 3C1CB 1H3OA 5B0ZD 5GT3D 3NQUA 5DNMB 1S32B 1KX5C 3AZKB 4J8XC 3B0DC 3AZHC 1AOIB 3X1TA 3X1VA 3B6GA 4J8UD 4XZQA 5CPIA 3AYWB 2IO5B 2AROA 5CPKB 1P3ID 5AV9A 4YM6B 3MVDA 3LJAA 4CAYB 3WTPC 1M18D 2NZDB 1TZYA 3LZ0A 5B31D 1M19A 1P3KA 4WU8B 5AV5A 5DNND 3MGRB 1BH8A 1P3PD 1P3OD 3X1TC 3X1VC 3B6GC 4XZQC 5CPIC 3WAAD 2AROC 4XUJA 4NFTA 1F66D 5AV9C 5JA4B 5AV6D 3MVDC 5GXQB 1KX3D 2YFWB 5E5AA 1TZYC 3LZ0C 3REHD 2YFVA 1M19C 3UT9A 1P3KC 3MNNA 3WKJD 3KXBB 4DRAA 5AV5C 2F8NB 4R8PA 1U35B 5B32A 3AZEA 3MGSD 4AWLB 5AV8D 4J8VB 4G92B 1P34D 3AV2A 1P3GA 3WA9B 3AZJA 4KUDD 3KWQB 4XUJC 2RVQD 5GT3A 1KX5B 4WNNA 2CV5D 5F99D 4H9SA 4Z66D 4J8XB 3AV1A 5AVBA 4Z5TD 5E5AC 3VH6A
chains in the Genus database with same CATH superfamily
4KGCD 3B0BA 3MGPC 3UT9C 5B1MB 3B6FD 3MNNC 1P3IA 4R8PC 3AN2D 5AVCA 3AZIA 3O62D 4QLCA 1TAFB 2BYMB 1P3BA 5B32C 3REJD 1M18A 5B31G 3W96A 2Y2LA 3AZEC 4X23D 3W97D 2Y2MA 2ZY2A 4H9OA 3A6ND 3AV2C 3LZ1A 1P3GC 3AZJC 4KHAA 5GT3C 2ZM5A 4ZUXD 3NQUB 3REID 2PYOD 3AV1C 4H9SC 5CP6D 5AVBC 3W99D 4J8WA 3X1TB 3X1VB 3B6GB 5BT1D 4H9NA 4XZQB 4EO5C 1ZLAD 2AROB 2HIOA 1P3IC 2BYKA 3KUYD 5AVCC 3AZIC 4QLCC 5AV9B 3MVDB 1P3BC 1M18C 3W96C 5B2IB 3VH6T 1TZYB 3REHA 3LZ0B 3X1SA 3WKJA 1P3AA 1M19B 1P3KB 3LZ1C 2VQRA 5AV5B 1P3LD 1R4VA 3AFAD 1JFIA 1BH8B 5B40D 3C1CD 4DQYB 5GT0D 1N1JA 5JRGD 1ID3A 3NQJA 4J8WC 3AZKD 1P34A 1AOID 2F8NK 2Y2JA 4XUJB 3AZMA 2HIOC 5CPKD 2JSSA 5F99A 4Z66A 3EPLA 4Z5TA 3AZLD 4YM6D 5E5AB 3REHC 3X1SC 3WKJC 2YFVB 3MGPB 3UT9B 1P3AC 3MNNB 2NQBD 4R8PB 3UTAA 2L5AA 3O62A 4WU8D 1P3MA 5AY8D 5B1LA 1KU5A 3MGRD 5B32B 3AZGA 4Z2MH 3MGQA 3AZEB 1P3FA 1ID3C 3W97A 4X23A 1BFMA 1P34C 4ZBJC 3A6NA 3AV2B 1P3GB 3AZJB 4WU9A 2RVQC 3AZMC 4ZUXA 3AZFD 3C1BD 2PYOA 5F99C 4WNNB 4Z66C 3AV1B 4Z5TC 5AVBB 1KX4D 5GXQD 3TU4D 3X1UD 3R45B 1P3IB 3UTAC 3O62C 3WTPE 3KXBD 3LJAC 5AVCB 3AZIB 1P3MC 4QLCB 2F8ND 5B1LC 3H0MC 5B2JA 1P3BB 1M18B 3AZGC 5B0YA 3V9RA 3MGQC 3W96B 2UWXA 4JJNA 1P3FC 3W97C 5BNXA 5B33D 2Y2HA 4Z2MG 4YS3B 3A6NC 4H9OB 3LZ1B 4WU9C 3AFAA 4KHAB 4ZUXC 3WA9D 5B40A 3KWQD 5GT0A 2PYOC 3W98A 2FJ7B 5JRGA 5KDMA 1KX5D 3REKD 5BNVB 3RELA 4J8WB 3VH5A 1EQZA 1A7WA 5CPJD 3LELB 5B0ZA 2HIOB 2BYKB 5B1MD 1Q9CA 3AZHB 3B0DB 5B2JC 4H9PA 5BO0A 3AZLA 5B0YC 4J8UA 4G91C 4JJNC 4LD9D 2F8NH 1HQ3D 3X1SB 3WKJB 1P3AB 5G49A 2NQBA 3AFAC 5AY8A 4H9QA 3MGRA 3WTPB 5B40C 5GT0C 3W98C 5JRGC 1HTAA 5B31A 1N1JB 3KFUG 1ID3B 2DF4C 3B0CT 1M1AD 3NQJB 3RELC 2ZY5A 5DNNA 1EQZC 1P34B 4ZBJB 3X1TD 5B0ZC 3X1VD 1H3OB 3AZMB 3AZFA 4UUZA 3C1BA 1P3PA 2AROD 1P3OA 5F99B 4Z66B 5C3IC 3AZLC 2HUEC 4J8UC 1KX4A 4Z5TB 3H0LC 5AV9D 3VH5T 1WWSA 3WAAA 5CPIB 5B2ID 1B67A 1F66A 4E45A 3AZND 3TU4A 3LZ0D 3X1UA 2F8NG 2NQBC 5AV6A 1KX3A 3UTAB 1P3KD 5AY8C 1BH9A 3LJAB 3A1IA 5GSUD 5AV5D 1P3MB 5B1LB 3AZGB 5B31C 3MGQB 1P3FB 3VH6W 5B33A 1T3UA 3EPJA 3UTBD 3W97B 5BS7A 2Y2QA 5B24D 5DNNC 3EPKA 3A6NB 4WZSB 4WU9B 4HGAC 3WA9A 4ZUXB 3AZFC 3IP4C 1PZRA 3C1BC 1S32D 5DNMD 4XUJD 1W2EA 1P3OC 3MGSA 1P3PC 2PYOB 5AV8A 3REKA 1KX4C 4H9RA 3WAAC 4KUDA 5CPJA 1ULYA 1F1EA 3AYWD 1F66C 3TU4C 3X1UC 5B1MA 2CV5A 3MGPD 5AV6C 1KX3C 2CWEA 5B2JB 4R8PD 4KGCA 5B0YB 3V9RB 4G91B 4LD9A 2NZDD 4JJNB 5FUGA 5B33C 1HQ3A 5BNXB 5B32D 3B6FA 5BS7C 4E44A 3AN2A 2LY8A 3REJA 1P3GD 2Y2PA 4CSRA 3AZJD 5B40B 4NE3A 5GT0B 3MGSC 3W98B 5JRGB 5AV8C 5KDMB 1M1AA 3REKC 3RELB 4KUDC 3AV1D 5CPJC 1EQZB 5AVBD 2XD5A 5B0ZB 5GT3B 3REIA 5B1MC 2CV5C 5CP6A 3W99A 4DRBA 4H9PB 5C3IB 5BO0B 5AVCD 4QLCD 2HUEB 4J8UB 3AZID 3AZLB 4KGCC 4LD9C 5CHLB 1ZLAA 1P3BD 1HQ3C 4EO5B 5B2IA 3B6FC 3W96D 3KUYA 3AN2C 3AZNA 2JCHA 5G49B 2NQBB 4YS3D 3REJC 5GSUA 5AY8B 4H9QB 3LZ1D 1U35D 4X23C 5B31B 3UTBA 1M1AC 2FJ7D 5B24A 1P3LA 4J8VD 5DNNB 2DQNC 4J8WD 2W8SA 3C1CA 3REIC 4HGAB 3F6TA 3LELD 1S32A 5DNMA 5CP6C 4UUZB 3C1BB 3AZFB 1P3PB 3W99C 2HIOD 3AZKA 1P3OB 4J8XD 3AZHD 1AOIA 5BT1C 1KX4B 3EG5B 4H9NB 1ZLAC 5B2IC 3WAAB 3AYWA 3KUYC 3AZNC 5CPKA 1F66B 3TU4B 3X1SD 3X1UB 3MGPA 1P3AD 5AV6B 1KX3B 5GSUC 1BH9B 4YM6A 4CAYA 5B32G 3WTPD 3REHB 3UTBC 2NZDA 5B33B 3A1KA 3KSYA 5B24C 1P3LC 1ID3D 4WU8A 2ZY4A 1JFIB 3C1CC 1B6WA 1S32C 5DNMC 3AZMD 3MGSB 3AZKC 5AV8B 2RIQA 1AOIC 3REKB 3B0CW 4H9RB 4KUDB 5CPJB 3B6GD 3AYWC 4XZQD 2IO5C 5CPID 3EPHA 5CPKC 2CV5B 2FFFB 3R45A 4M6BA 4YM6C 4NE6A 5JA4A 5GXQA 3UTAD 3MVDD 3LJAD 1P3MD 4KGCB 2NZDC 2YFWA 5B1LD 3VH5W 4LD9B 5FUGB 3B6FB 1HQ3B 3AZGD 1TZYD 3MGQD 1P3FD 3AN2B 4WU8C 3KXBA 1M19D 4YS3A 3O62B 2F8NA 3MGRC 2J8PA 3REJB 2Y2IA 1U35A 4CSRB 4WU9D 3FDDA 4X23B 1M1AB 2FJ7A 4J8VA 5BNVA 3KWQA 3LELA 3REIB 4NE5A 5CP6B 1KX5A 2G5IC 3W99B 3H0RC 4J8XA 3AZHA 5GXQC 4WV4B 5B2JD 5E5AD 1ZLAB 5B0YD 4JJND 1WWIA 3KUYB 3AZNB 3KXBC 3UT9D 4YS3C 3MNND 2XD1A 5GSUB 2Y2KA 1TAFA 1U35C 2BYMA 3WTPA 4WJ3C 3UTBB 3AZED 2FJ7C 4AWLC 3W98D 2JE5A 4J8VC 5B24B 4G92C 1P3LB 3AFAB 3RELD 3AV2D 3WA9C 3KWQC 1EQZD 3LELC 3C1CB 1H3OA 5B0ZD 5GT3D 3NQUA 5DNMB 1S32B 1KX5C 3AZKB 4J8XC 3B0DC 3AZHC 1AOIB 3X1TA 3X1VA 3B6GA 4J8UD 2Y2NA 4XZQA 5CPIA 2ZY3A 3AYWB 2IO5B 2AROA 5CPKB 1P3ID 5AV9A 4YM6B 3MVDA 3LJAA 4CAYB 3WTPC 1M18D 2NZDB 1TZYA 3LZ0A 5B31D 1M19A 1P3KA 2Y2OA 4WU8B 5AV5A 5DNND 3MGRB 2G5HC 1BH8A 1P3PD 1P3OD 2Y2GA 3X1TC 3X1VC 3B6GC 4XZQC 5CPIC 3WAAD 2AROC 4XUJA 4NFTA 1F66D 5AV9C 5JA4B 5AV6D 3MVDC 5GXQB 1KX3D 2YFWB 5E5AA 3AL0C 2F2AC 1TZYC 3LZ0C 3REHD 2YFVA 1M19C 3UT9A 1P3KC 3MNNA 3WKJD 3KXBB 4DRAA 3P5JB 5AV5C 2F8NB 4R8PA 1U35B 5B32A 3AZEA 1Z2CB 3MGSD 4AWLB 2BG1A 5AV8D 4J8VB 4G92B 1P34D 3AV2A 1P3GA 3WA9B 3AZJA 4KUDD 3KWQB 4XUJC 2RVQD 5GT3A 4UPKA 1KX5B 4WNNA 2CV5D 5F99D 4H9SA 4Z66D 4J8XB 3AV1A 5AVBA 4Z5TD 5E5AC 3VH6A
chains in the Genus database with same CATH topology
4KGCD 3B0BA 3MGPC 3UT9C 5B1MB 3B6FD 3MNNC 1P3IA 4R8PC 3AN2D 5AVCA 3AZIA 3O62D 4QLCA 1TAFB 2BYMB 1P3BA 5B32C 3REJD 1M18A 5B31G 3W96A 2Y2LA 3AZEC 4X23D 3W97D 2Y2MA 2ZY2A 4H9OA 3A6ND 3AV2C 3LZ1A 1P3GC 3AZJC 4KHAA 5GT3C 2ZM5A 4ZUXD 3NQUB 3REID 2PYOD 3AV1C 4H9SC 5CP6D 5AVBC 3W99D 4J8WA 3X1TB 3X1VB 3B6GB 5BT1D 4H9NA 4XZQB 4EO5C 1ZLAD 2AROB 2HIOA 1P3IC 2BYKA 3KUYD 5AVCC 3AZIC 4QLCC 5AV9B 3MVDB 1P3BC 1M18C 3W96C 5B2IB 3VH6T 1TZYB 3REHA 3LZ0B 3X1SA 3WKJA 1P3AA 1M19B 1P3KB 3LZ1C 2VQRA 5AV5B 1P3LD 1R4VA 3AFAD 1JFIA 1BH8B 5B40D 3C1CD 4DQYB 5GT0D 1N1JA 5JRGD 1ID3A 3NQJA 4J8WC 3AZKD 1P34A 1AOID 2F8NK 2Y2JA 4XUJB 3AZMA 2HIOC 5CPKD 2JSSA 5F99A 4Z66A 3EPLA 4Z5TA 3AZLD 4YM6D 5E5AB 3REHC 3X1SC 3WKJC 2YFVB 3MGPB 3UT9B 1P3AC 3MNNB 2NQBD 4R8PB 3UTAA 2L5AA 3O62A 4WU8D 1P3MA 5AY8D 5B1LA 1KU5A 3MGRD 5B32B 3AZGA 4Z2MH 3MGQA 3AZEB 1P3FA 1ID3C 3W97A 4X23A 1BFMA 1P34C 4ZBJC 3A6NA 3AV2B 1P3GB 3AZJB 4WU9A 2RVQC 3AZMC 4ZUXA 3AZFD 3C1BD 2PYOA 5F99C 4WNNB 4Z66C 3AV1B 4Z5TC 5AVBB 1KX4D 5GXQD 3TU4D 3X1UD 3R45B 1P3IB 3UTAC 3O62C 3WTPE 3KXBD 3LJAC 5AVCB 3AZIB 1P3MC 4QLCB 2F8ND 5B1LC 3H0MC 5B2JA 1P3BB 1M18B 3AZGC 5B0YA 3V9RA 3MGQC 3W96B 2UWXA 4JJNA 1P3FC 3W97C 5BNXA 5B33D 2Y2HA 4Z2MG 4YS3B 3A6NC 4H9OB 3LZ1B 4WU9C 3AFAA 4KHAB 4ZUXC 3WA9D 5B40A 3KWQD 5GT0A 2PYOC 3W98A 2FJ7B 5JRGA 5KDMA 1KX5D 3REKD 5BNVB 3RELA 4J8WB 3VH5A 1EQZA 1A7WA 5CPJD 3LELB 5B0ZA 2HIOB 2BYKB 5B1MD 1Q9CA 3AZHB 3B0DB 5B2JC 4H9PA 5BO0A 3AZLA 5B0YC 4J8UA 4G91C 4JJNC 4LD9D 2F8NH 1HQ3D 3X1SB 3WKJB 1P3AB 5G49A 2NQBA 3AFAC 5AY8A 4H9QA 3MGRA 3WTPB 5B40C 5GT0C 3W98C 5JRGC 1HTAA 5B31A 1N1JB 3KFUG 1ID3B 2DF4C 3B0CT 1M1AD 3NQJB 3RELC 2ZY5A 5DNNA 1EQZC 1P34B 4ZBJB 3X1TD 5B0ZC 3X1VD 1H3OB 3AZMB 3AZFA 4UUZA 3C1BA 1P3PA 2AROD 1P3OA 5F99B 4Z66B 5C3IC 3AZLC 2HUEC 4J8UC 1KX4A 4Z5TB 3H0LC 5AV9D 3VH5T 1WWSA 3WAAA 5CPIB 5B2ID 1B67A 1F66A 4E45A 3AZND 3TU4A 3LZ0D 3X1UA 2F8NG 2NQBC 5AV6A 1KX3A 3UTAB 1P3KD 5AY8C 1BH9A 3LJAB 3A1IA 5GSUD 5AV5D 1P3MB 5B1LB 3AZGB 5B31C 3MGQB 1P3FB 3VH6W 5B33A 1T3UA 3EPJA 3UTBD 3W97B 5BS7A 2Y2QA 5B24D 5DNNC 3EPKA 3A6NB 4WZSB 4WU9B 4HGAC 3WA9A 4ZUXB 3AZFC 3IP4C 1PZRA 3C1BC 1S32D 5DNMD 4XUJD 1W2EA 1P3OC 3MGSA 1P3PC 2PYOB 5AV8A 3REKA 1KX4C 4H9RA 3WAAC 4KUDA 5CPJA 1ULYA 1F1EA 3AYWD 1F66C 3TU4C 3X1UC 5B1MA 2CV5A 3MGPD 5AV6C 1KX3C 2CWEA 5B2JB 4R8PD 4KGCA 5B0YB 3V9RB 4G91B 4LD9A 2NZDD 4JJNB 5FUGA 5B33C 1HQ3A 5BNXB 5B32D 3B6FA 5BS7C 4E44A 3AN2A 2LY8A 3REJA 1P3GD 2Y2PA 4CSRA 3AZJD 5B40B 4NE3A 5GT0B 3MGSC 3W98B 5JRGB 5AV8C 5KDMB 1M1AA 3REKC 3RELB 4KUDC 3AV1D 5CPJC 1EQZB 5AVBD 2XD5A 5B0ZB 5GT3B 3REIA 5B1MC 2CV5C 5CP6A 3W99A 4DRBA 4H9PB 5C3IB 5BO0B 5AVCD 4QLCD 2HUEB 4J8UB 3AZID 3AZLB 4KGCC 4LD9C 5CHLB 1ZLAA 1P3BD 1HQ3C 4EO5B 5B2IA 3B6FC 3W96D 3KUYA 3AN2C 3AZNA 2JCHA 5G49B 2NQBB 4YS3D 3REJC 5GSUA 5AY8B 4H9QB 3LZ1D 1U35D 4X23C 5B31B 3UTBA 1M1AC 2FJ7D 5B24A 1P3LA 4J8VD 5DNNB 2DQNC 4J8WD 2W8SA 3C1CA 3REIC 4HGAB 3F6TA 3LELD 1S32A 5DNMA 5CP6C 4UUZB 3C1BB 3AZFB 1P3PB 3W99C 2HIOD 3AZKA 1P3OB 4J8XD 3AZHD 1AOIA 5BT1C 1KX4B 3EG5B 4H9NB 1ZLAC 5B2IC 3WAAB 3AYWA 3KUYC 3AZNC 5CPKA 1F66B 3TU4B 3X1SD 3X1UB 3MGPA 1P3AD 5AV6B 1KX3B 5GSUC 1BH9B 4YM6A 4CAYA 5B32G 3WTPD 3REHB 3UTBC 2NZDA 5B33B 3A1KA 3KSYA 5B24C 1P3LC 1ID3D 4WU8A 2ZY4A 1JFIB 3C1CC 1B6WA 1S32C 5DNMC 3AZMD 3MGSB 3AZKC 5AV8B 2RIQA 1AOIC 3REKB 3B0CW 4H9RB 4KUDB 5CPJB 3B6GD 3AYWC 4XZQD 2IO5C 5CPID 3EPHA 5CPKC 2CV5B 2FFFB 3R45A 4M6BA 4YM6C 4NE6A 5JA4A 5GXQA 3UTAD 3MVDD 3LJAD 1P3MD 4KGCB 2NZDC 2YFWA 5B1LD 3VH5W 4LD9B 5FUGB 3B6FB 1HQ3B 3AZGD 1TZYD 3MGQD 1P3FD 3AN2B 4WU8C 3KXBA 1M19D 4YS3A 3O62B 2F8NA 3MGRC 2J8PA 3REJB 2Y2IA 1U35A 4CSRB 4WU9D 3FDDA 4X23B 1M1AB 2FJ7A 4J8VA 5BNVA 3KWQA 3LELA 3REIB 4NE5A 5CP6B 1KX5A 2G5IC 3W99B 3H0RC 4J8XA 3AZHA 5GXQC 4WV4B 5B2JD 5E5AD 1ZLAB 5B0YD 4JJND 1WWIA 3KUYB 3AZNB 3KXBC 3UT9D 4YS3C 3MNND 2XD1A 5GSUB 2Y2KA 1TAFA 1U35C 2BYMA 3WTPA 4WJ3C 3UTBB 3AZED 2FJ7C 4AWLC 3W98D 2JE5A 4J8VC 5B24B 4G92C 1P3LB 3AFAB 3RELD 3AV2D 3WA9C 3KWQC 1EQZD 3LELC 3C1CB 1H3OA 5B0ZD 5GT3D 3NQUA 5DNMB 1S32B 1KX5C 3AZKB 4J8XC 3B0DC 3AZHC 1AOIB 3X1TA 3X1VA 3B6GA 4J8UD 2Y2NA 4XZQA 5CPIA 2ZY3A 3AYWB 2IO5B 2AROA 5CPKB 1P3ID 5AV9A 4YM6B 3MVDA 3LJAA 4CAYB 3WTPC 1M18D 2NZDB 1TZYA 3LZ0A 5B31D 1M19A 1P3KA 2Y2OA 4WU8B 5AV5A 5DNND 3MGRB 2G5HC 1BH8A 1P3PD 1P3OD 2Y2GA 3X1TC 3X1VC 3B6GC 4XZQC 5CPIC 3WAAD 2AROC 4XUJA 4NFTA 1F66D 5AV9C 5JA4B 5AV6D 3MVDC 5GXQB 1KX3D 2YFWB 5E5AA 3AL0C 2F2AC 1TZYC 3LZ0C 3REHD 2YFVA 1M19C 3UT9A 1P3KC 3MNNA 3WKJD 3KXBB 4DRAA 3P5JB 5AV5C 2F8NB 4R8PA 1U35B 5B32A 3AZEA 1Z2CB 3MGSD 4AWLB 2BG1A 5AV8D 4J8VB 4G92B 1P34D 3AV2A 1P3GA 3WA9B 3AZJA 4KUDD 3KWQB 4XUJC 2RVQD 5GT3A 4UPKA 1KX5B 4WNNA 2CV5D 5F99D 4H9SA 4Z66D 4J8XB 3AV1A 5AVBA 4Z5TD 5E5AC 3VH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGC D;  3B0B A;  3MGP C;  3UT9 C;  5B1M B;  3B6F D;  3MNN C;  1P3I A;  4R8P C;  3AN2 D;  5AVC A;  3AZI A;  3O62 D;  4QLC A;  1TAF B;  2BYM B;  1P3B A;  5B32 C;  3REJ D;  1M18 A;  5B31 G;  3W96 A;  3AZE C;  4X23 D;  3W97 D;  4H9O A;  3A6N D;  3AV2 C;  3LZ1 A;  1P3G C;  3AZJ C;  4KHA A;  5GT3 C;  4ZUX D;  3NQU B;  3REI D;  2PYO D;  3AV1 C;  4H9S C;  5CP6 D;  5AVB C;  3W99 D;  4J8W A;  3X1T B;  3X1V B;  3B6G B;  5BT1 D;  4H9N A;  4XZQ B;  4EO5 C;  1ZLA D;  2ARO B;  2HIO A;  1P3I C;  2BYK A;  3KUY D;  5AVC C;  3AZI C;  4QLC C;  5AV9 B;  3MVD B;  1P3B C;  1M18 C;  3W96 C;  5B2I B;  3VH6 T;  1TZY B;  3REH A;  3LZ0 B;  3X1S A;  3WKJ A;  1P3A A;  1M19 B;  1P3K B;  3LZ1 C;  5AV5 B;  1P3L D;  1R4V A;  3AFA D;  1JFI A;  1BH8 B;  5B40 D;  3C1C D;  5GT0 D;  1N1J A;  5JRG D;  1ID3 A;  3NQJ A;  4J8W C;  3AZK D;  1P34 A;  1AOI D;  2F8N K;  4XUJ B;  3AZM A;  2HIO C;  5CPK D;  2JSS A;  5F99 A;  4Z66 A;  4Z5T A;  3AZL D;  4YM6 D;  5E5A B;  3REH C;  3X1S C;  3WKJ C;  2YFV B;  3MGP B;  3UT9 B;  1P3A C;  3MNN B;  2NQB D;  4R8P B;  3UTA A;  2L5A A;  3O62 A;  4WU8 D;  1P3M A;  5AY8 D;  5B1L A;  1KU5 A;  3MGR D;  5B32 B;  3AZG A;  4Z2M H;  3MGQ A;  3AZE B;  1P3F A;  1ID3 C;  3W97 A;  4X23 A;  1BFM A;  1P34 C;  4ZBJ C;  3A6N A;  3AV2 B;  1P3G B;  3AZJ B;  4WU9 A;  2RVQ C;  3AZM C;  4ZUX A;  3AZF D;  3C1B D;  2PYO A;  5F99 C;  4WNN B;  4Z66 C;  3AV1 B;  4Z5T C;  5AVB B;  1KX4 D;  5GXQ D;  3TU4 D;  3X1U D;  3R45 B;  1P3I B;  3UTA C;  3O62 C;  3WTP E;  3KXB D;  3LJA C;  5AVC B;  3AZI B;  1P3M C;  4QLC B;  2F8N D;  5B1L C;  5B2J A;  1P3B B;  1M18 B;  3AZG C;  5B0Y A;  3V9R A;  3MGQ C;  3W96 B;  4JJN A;  1P3F C;  3W97 C;  5BNX A;  5B33 D;  4Z2M G;  4YS3 B;  3A6N C;  4H9O B;  3LZ1 B;  4WU9 C;  3AFA A;  4KHA B;  4ZUX C;  3WA9 D;  5B40 A;  3KWQ D;  5GT0 A;  2PYO C;  3W98 A;  2FJ7 B;  5JRG A;  5KDM A;  1KX5 D;  3REK D;  5BNV B;  3REL A;  4J8W B;  3VH5 A;  1EQZ A;  1A7W A;  5CPJ D;  3LEL B;  5B0Z A;  2HIO B;  2BYK B;  5B1M D;  1Q9C A;  3AZH B;  3B0D B;  5B2J C;  4H9P A;  5BO0 A;  3AZL A;  5B0Y C;  4J8U A;  4G91 C;  4JJN C;  4LD9 D;  2F8N H;  1HQ3 D;  3X1S B;  3WKJ B;  1P3A B;  5G49 A;  2NQB A;  3AFA C;  5AY8 A;  4H9Q A;  3MGR A;  3WTP B;  5B40 C;  5GT0 C;  3W98 C;  5JRG C;  1HTA A;  5B31 A;  1N1J B;  1ID3 B;  3B0C T;  1M1A D;  3NQJ B;  3REL C;  5DNN A;  1EQZ C;  1P34 B;  4ZBJ B;  3X1T D;  5B0Z C;  3X1V D;  1H3O B;  3AZM B;  3AZF A;  4UUZ A;  3C1B A;  1P3P A;  2ARO D;  1P3O A;  5F99 B;  4Z66 B;  5C3I C;  3AZL C;  2HUE C;  4J8U C;  1KX4 A;  4Z5T B;  5AV9 D;  3VH5 T;  1WWS A;  3WAA A;  5CPI B;  5B2I D;  1B67 A;  1F66 A;  4E45 A;  3AZN D;  3TU4 A;  3LZ0 D;  3X1U A;  2F8N G;  2NQB C;  5AV6 A;  1KX3 A;  3UTA B;  1P3K D;  5AY8 C;  1BH9 A;  3LJA B;  5GSU D;  1P3M B;  5AV5 D;  5B1L B;  3AZG B;  5B31 C;  3MGQ B;  1P3F B;  3VH6 W;  5B33 A;  3UTB D;  3W97 B;  5BS7 A;  5B24 D;  5DNN C;  3A6N B;  4WZS B;  4WU9 B;  4HGA C;  3WA9 A;  4ZUX B;  3AZF C;  3C1B C;  1S32 D;  5DNM D;  4XUJ D;  1P3P C;  1P3O C;  3MGS A;  2PYO B;  5AV8 A;  3REK A;  1KX4 C;  4H9R A;  3WAA C;  4KUD A;  5CPJ A;  1ULY A;  1F1E A;  3AYW D;  1F66 C;  3TU4 C;  3X1U C;  5B1M A;  2CV5 A;  3MGP D;  5AV6 C;  1KX3 C;  2CWE A;  5B2J B;  4R8P D;  4KGC A;  5B0Y B;  3V9R B;  4G91 B;  4LD9 A;  2NZD D;  4JJN B;  5FUG A;  5B33 C;  1HQ3 A;  5BNX B;  5B32 D;  3B6F A;  5BS7 C;  4E44 A;  3AN2 A;  2LY8 A;  3REJ A;  1P3G D;  4CSR A;  3AZJ D;  5B40 B;  4NE3 A;  5GT0 B;  3MGS C;  3W98 B;  5JRG B;  5AV8 C;  5KDM B;  1M1A A;  3REK C;  3REL B;  4KUD C;  3AV1 D;  5CPJ C;  1EQZ B;  5AVB D;  5B0Z B;  5GT3 B;  3REI A;  5B1M C;  2CV5 C;  5CP6 A;  3W99 A;  4DRB A;  4H9P B;  5C3I B;  5BO0 B;  5AVC D;  4QLC D;  2HUE B;  4J8U B;  3AZI D;  3AZL B;  4KGC C;  4LD9 C;  5CHL B;  1ZLA A;  1P3B D;  1HQ3 C;  4EO5 B;  5B2I A;  3B6F C;  3W96 D;  3KUY A;  3AN2 C;  3AZN A;  5G49 B;  2NQB B;  4YS3 D;  3REJ C;  5GSU A;  5AY8 B;  4H9Q B;  3LZ1 D;  1U35 D;  4X23 C;  5B31 B;  3UTB A;  1M1A C;  2FJ7 D;  5B24 A;  1P3L A;  4J8V D;  5DNN B;  4J8W D;  3C1C A;  3REI C;  4HGA B;  3LEL D;  1S32 A;  5DNM A;  5CP6 C;  4UUZ B;  3C1B B;  3AZF B;  1P3P B;  3W99 C;  2HIO D;  3AZK A;  1P3O B;  4J8X D;  3AZH D;  1AOI A;  5BT1 C;  1KX4 B;  3WAA B;  4H9N B;  1ZLA C;  5B2I C;  3AYW A;  3KUY C;  3AZN C;  5CPK A;  1F66 B;  3TU4 B;  3X1S D;  3X1U B;  3MGP A;  1P3A D;  5AV6 B;  1KX3 B;  5GSU C;  1BH9 B;  4YM6 A;  4CAY A;  5B32 G;  3WTP D;  3REH B;  3UTB C;  2NZD A;  5B33 B;  3KSY A;  5B24 C;  1P3L C;  1ID3 D;  4WU8 A;  1JFI B;  3C1C C;  1B6W A;  1S32 C;  5DNM C;  3AZM D;  3MGS B;  3AZK C;  5AV8 B;  1AOI C;  3REK B;  3B0C W;  4H9R B;  4KUD B;  5CPJ B;  3B6G D;  3AYW C;  4XZQ D;  2IO5 C;  5CPI D;  5CPK C;  2CV5 B;  3R45 A;  4M6B A;  4YM6 C;  4NE6 A;  5JA4 A;  5GXQ A;  3UTA D;  3MVD D;  3LJA D;  1P3M D;  4KGC B;  2NZD C;  2YFW A;  5B1L D;  3VH5 W;  4LD9 B;  5FUG B;  3B6F B;  1HQ3 B;  3AZG D;  1TZY D;  3MGQ D;  1P3F D;  3AN2 B;  4WU8 C;  3KXB A;  1M19 D;  4YS3 A;  3O62 B;  2F8N A;  3MGR C;  3REJ B;  1U35 A;  4CSR B;  4WU9 D;  4X23 B;  1M1A B;  2FJ7 A;  4J8V A;  5BNV A;  3KWQ A;  3LEL A;  3REI B;  4NE5 A;  5CP6 B;  1KX5 A;  3W99 B;  4J8X A;  3AZH A;  5GXQ C;  4WV4 B;  5B2J D;  5E5A D;  1ZLA B;  5B0Y D;  4JJN D;  1WWI A;  3KUY B;  3AZN B;  3KXB C;  3UT9 D;  4YS3 C;  3MNN D;  5GSU B;  1TAF A;  1U35 C;  2BYM A;  3WTP A;  3UTB B;  3AZE D;  2FJ7 C;  4AWL C;  3W98 D;  4J8V C;  5B24 B;  4G92 C;  1P3L B;  3AFA B;  3REL D;  3AV2 D;  3WA9 C;  3KWQ C;  1EQZ D;  3LEL C;  3C1C B;  1H3O A;  5B0Z D;  5GT3 D;  3NQU A;  5DNM B;  1S32 B;  1KX5 C;  3AZK B;  4J8X C;  3B0D C;  3AZH C;  1AOI B;  3X1T A;  3X1V A;  3B6G A;  4J8U D;  4XZQ A;  5CPI A;  3AYW B;  2IO5 B;  2ARO A;  5CPK B;  1P3I D;  5AV9 A;  4YM6 B;  3MVD A;  3LJA A;  4CAY B;  3WTP C;  1M18 D;  2NZD B;  1TZY A;  3LZ0 A;  5B31 D;  1M19 A;  1P3K A;  4WU8 B;  5AV5 A;  5DNN D;  3MGR B;  1BH8 A;  1P3P D;  1P3O D;  3X1T C;  3X1V C;  3B6G C;  4XZQ C;  5CPI C;  3WAA D;  2ARO C;  4XUJ A;  4NFT A;  1F66 D;  5AV9 C;  5JA4 B;  5AV6 D;  3MVD C;  5GXQ B;  1KX3 D;  2YFW B;  5E5A A;  1TZY C;  3LZ0 C;  3REH D;  2YFV A;  1M19 C;  3UT9 A;  1P3K C;  3MNN A;  3WKJ D;  3KXB B;  4DRA A;  5AV5 C;  2F8N B;  4R8P A;  1U35 B;  5B32 A;  3AZE A;  3MGS D;  4AWL B;  5AV8 D;  4J8V B;  4G92 B;  1P34 D;  3AV2 A;  1P3G A;  3WA9 B;  3AZJ A;  4KUD D;  3KWQ B;  4XUJ C;  2RVQ D;  5GT3 A;  1KX5 B;  4WNN A;  2CV5 D;  5F99 D;  4H9S A;  4Z66 D;  4J8X B;  3AV1 A;  5AVB A;  4Z5T D;  5E5A C;  3VH6 A; 
#chains in the Genus database with same CATH topology
 4KGC D;  3B0B A;  3MGP C;  3UT9 C;  5B1M B;  3B6F D;  3MNN C;  1P3I A;  4R8P C;  3AN2 D;  5AVC A;  3AZI A;  3O62 D;  4QLC A;  1TAF B;  2BYM B;  1P3B A;  5B32 C;  3REJ D;  1M18 A;  5B31 G;  3W96 A;  2Y2L A;  3AZE C;  4X23 D;  3W97 D;  2Y2M A;  2ZY2 A;  4H9O A;  3A6N D;  3AV2 C;  3LZ1 A;  1P3G C;  3AZJ C;  4KHA A;  5GT3 C;  2ZM5 A;  4ZUX D;  3NQU B;  3REI D;  2PYO D;  3AV1 C;  4H9S C;  5CP6 D;  5AVB C;  3W99 D;  4J8W A;  3X1T B;  3X1V B;  3B6G B;  5BT1 D;  4H9N A;  4XZQ B;  4EO5 C;  1ZLA D;  2ARO B;  2HIO A;  1P3I C;  2BYK A;  3KUY D;  5AVC C;  3AZI C;  4QLC C;  5AV9 B;  3MVD B;  1P3B C;  1M18 C;  3W96 C;  5B2I B;  3VH6 T;  1TZY B;  3REH A;  3LZ0 B;  3X1S A;  3WKJ A;  1P3A A;  1M19 B;  1P3K B;  3LZ1 C;  2VQR A;  5AV5 B;  1P3L D;  1R4V A;  3AFA D;  1JFI A;  1BH8 B;  5B40 D;  3C1C D;  4DQY B;  5GT0 D;  1N1J A;  5JRG D;  1ID3 A;  3NQJ A;  4J8W C;  3AZK D;  1P34 A;  1AOI D;  2F8N K;  2Y2J A;  4XUJ B;  3AZM A;  2HIO C;  5CPK D;  2JSS A;  5F99 A;  4Z66 A;  3EPL A;  4Z5T A;  3AZL D;  4YM6 D;  5E5A B;  3REH C;  3X1S C;  3WKJ C;  2YFV B;  3MGP B;  3UT9 B;  1P3A C;  3MNN B;  2NQB D;  4R8P B;  3UTA A;  2L5A A;  3O62 A;  4WU8 D;  1P3M A;  5AY8 D;  5B1L A;  1KU5 A;  3MGR D;  5B32 B;  3AZG A;  4Z2M H;  3MGQ A;  3AZE B;  1P3F A;  1ID3 C;  3W97 A;  4X23 A;  1BFM A;  1P34 C;  4ZBJ C;  3A6N A;  3AV2 B;  1P3G B;  3AZJ B;  4WU9 A;  2RVQ C;  3AZM C;  4ZUX A;  3AZF D;  3C1B D;  2PYO A;  5F99 C;  4WNN B;  4Z66 C;  3AV1 B;  4Z5T C;  5AVB B;  1KX4 D;  5GXQ D;  3TU4 D;  3X1U D;  3R45 B;  1P3I B;  3UTA C;  3O62 C;  3WTP E;  3KXB D;  3LJA C;  5AVC B;  3AZI B;  1P3M C;  4QLC B;  2F8N D;  5B1L C;  3H0M C;  5B2J A;  1P3B B;  1M18 B;  3AZG C;  5B0Y A;  3V9R A;  3MGQ C;  3W96 B;  2UWX A;  4JJN A;  1P3F C;  3W97 C;  5BNX A;  5B33 D;  2Y2H A;  4Z2M G;  4YS3 B;  3A6N C;  4H9O B;  3LZ1 B;  4WU9 C;  3AFA A;  4KHA B;  4ZUX C;  3WA9 D;  5B40 A;  3KWQ D;  5GT0 A;  2PYO C;  3W98 A;  2FJ7 B;  5JRG A;  5KDM A;  1KX5 D;  3REK D;  5BNV B;  3REL A;  4J8W B;  3VH5 A;  1EQZ A;  1A7W A;  5CPJ D;  3LEL B;  5B0Z A;  2HIO B;  2BYK B;  5B1M D;  1Q9C A;  3AZH B;  3B0D B;  5B2J C;  4H9P A;  5BO0 A;  3AZL A;  5B0Y C;  4J8U A;  4G91 C;  4JJN C;  4LD9 D;  2F8N H;  1HQ3 D;  3X1S B;  3WKJ B;  1P3A B;  5G49 A;  2NQB A;  3AFA C;  5AY8 A;  4H9Q A;  3MGR A;  3WTP B;  5B40 C;  5GT0 C;  3W98 C;  5JRG C;  1HTA A;  5B31 A;  1N1J B;  3KFU G;  1ID3 B;  2DF4 C;  3B0C T;  1M1A D;  3NQJ B;  3REL C;  2ZY5 A;  5DNN A;  1EQZ C;  1P34 B;  4ZBJ B;  3X1T D;  5B0Z C;  3X1V D;  1H3O B;  3AZM B;  3AZF A;  4UUZ A;  3C1B A;  1P3P A;  2ARO D;  1P3O A;  5F99 B;  4Z66 B;  5C3I C;  3AZL C;  2HUE C;  4J8U C;  1KX4 A;  4Z5T B;  3H0L C;  5AV9 D;  3VH5 T;  1WWS A;  3WAA A;  5CPI B;  5B2I D;  1B67 A;  1F66 A;  4E45 A;  3AZN D;  3TU4 A;  3LZ0 D;  3X1U A;  2F8N G;  2NQB C;  5AV6 A;  1KX3 A;  3UTA B;  1P3K D;  5AY8 C;  1BH9 A;  3LJA B;  3A1I A;  5GSU D;  5AV5 D;  1P3M B;  5B1L B;  3AZG B;  5B31 C;  3MGQ B;  1P3F B;  3VH6 W;  5B33 A;  1T3U A;  3EPJ A;  3UTB D;  3W97 B;  5BS7 A;  2Y2Q A;  5B24 D;  5DNN C;  3EPK A;  3A6N B;  4WZS B;  4WU9 B;  4HGA C;  3WA9 A;  4ZUX B;  3AZF C;  3IP4 C;  1PZR A;  3C1B C;  1S32 D;  5DNM D;  4XUJ D;  1W2E A;  1P3O C;  3MGS A;  1P3P C;  2PYO B;  5AV8 A;  3REK A;  1KX4 C;  4H9R A;  3WAA C;  4KUD A;  5CPJ A;  1ULY A;  1F1E A;  3AYW D;  1F66 C;  3TU4 C;  3X1U C;  5B1M A;  2CV5 A;  3MGP D;  5AV6 C;  1KX3 C;  2CWE A;  5B2J B;  4R8P D;  4KGC A;  5B0Y B;  3V9R B;  4G91 B;  4LD9 A;  2NZD D;  4JJN B;  5FUG A;  5B33 C;  1HQ3 A;  5BNX B;  5B32 D;  3B6F A;  5BS7 C;  4E44 A;  3AN2 A;  2LY8 A;  3REJ A;  1P3G D;  2Y2P A;  4CSR A;  3AZJ D;  5B40 B;  4NE3 A;  5GT0 B;  3MGS C;  3W98 B;  5JRG B;  5AV8 C;  5KDM B;  1M1A A;  3REK C;  3REL B;  4KUD C;  3AV1 D;  5CPJ C;  1EQZ B;  5AVB D;  2XD5 A;  5B0Z B;  5GT3 B;  3REI A;  5B1M C;  2CV5 C;  5CP6 A;  3W99 A;  4DRB A;  4H9P B;  5C3I B;  5BO0 B;  5AVC D;  4QLC D;  2HUE B;  4J8U B;  3AZI D;  3AZL B;  4KGC C;  4LD9 C;  5CHL B;  1ZLA A;  1P3B D;  1HQ3 C;  4EO5 B;  5B2I A;  3B6F C;  3W96 D;  3KUY A;  3AN2 C;  3AZN A;  2JCH A;  5G49 B;  2NQB B;  4YS3 D;  3REJ C;  5GSU A;  5AY8 B;  4H9Q B;  3LZ1 D;  1U35 D;  4X23 C;  5B31 B;  3UTB A;  1M1A C;  2FJ7 D;  5B24 A;  1P3L A;  4J8V D;  5DNN B;  2DQN C;  4J8W D;  2W8S A;  3C1C A;  3REI C;  4HGA B;  3F6T A;  3LEL D;  1S32 A;  5DNM A;  5CP6 C;  4UUZ B;  3C1B B;  3AZF B;  1P3P B;  3W99 C;  2HIO D;  3AZK A;  1P3O B;  4J8X D;  3AZH D;  1AOI A;  5BT1 C;  1KX4 B;  3EG5 B;  4H9N B;  1ZLA C;  5B2I C;  3WAA B;  3AYW A;  3KUY C;  3AZN C;  5CPK A;  1F66 B;  3TU4 B;  3X1S D;  3X1U B;  3MGP A;  1P3A D;  5AV6 B;  1KX3 B;  5GSU C;  1BH9 B;  4YM6 A;  4CAY A;  5B32 G;  3WTP D;  3REH B;  3UTB C;  2NZD A;  5B33 B;  3A1K A;  3KSY A;  5B24 C;  1P3L C;  1ID3 D;  4WU8 A;  2ZY4 A;  1JFI B;  3C1C C;  1B6W A;  1S32 C;  5DNM C;  3AZM D;  3MGS B;  3AZK C;  5AV8 B;  2RIQ A;  1AOI C;  3REK B;  3B0C W;  4H9R B;  4KUD B;  5CPJ B;  3B6G D;  3AYW C;  4XZQ D;  2IO5 C;  5CPI D;  3EPH A;  5CPK C;  2CV5 B;  2FFF B;  3R45 A;  4M6B A;  4YM6 C;  4NE6 A;  5JA4 A;  5GXQ A;  3UTA D;  3MVD D;  3LJA D;  1P3M D;  4KGC B;  2NZD C;  2YFW A;  5B1L D;  3VH5 W;  4LD9 B;  5FUG B;  3B6F B;  1HQ3 B;  3AZG D;  1TZY D;  3MGQ D;  1P3F D;  3AN2 B;  4WU8 C;  3KXB A;  1M19 D;  4YS3 A;  3O62 B;  2F8N A;  3MGR C;  2J8P A;  3REJ B;  2Y2I A;  1U35 A;  4CSR B;  4WU9 D;  3FDD A;  4X23 B;  1M1A B;  2FJ7 A;  4J8V A;  5BNV A;  3KWQ A;  3LEL A;  3REI B;  4NE5 A;  5CP6 B;  1KX5 A;  2G5I C;  3W99 B;  3H0R C;  4J8X A;  3AZH A;  5GXQ C;  4WV4 B;  5B2J D;  5E5A D;  1ZLA B;  5B0Y D;  4JJN D;  1WWI A;  3KUY B;  3AZN B;  3KXB C;  3UT9 D;  4YS3 C;  3MNN D;  2XD1 A;  5GSU B;  2Y2K A;  1TAF A;  1U35 C;  2BYM A;  3WTP A;  4WJ3 C;  3UTB B;  3AZE D;  2FJ7 C;  4AWL C;  3W98 D;  2JE5 A;  4J8V C;  5B24 B;  4G92 C;  1P3L B;  3AFA B;  3REL D;  3AV2 D;  3WA9 C;  3KWQ C;  1EQZ D;  3LEL C;  3C1C B;  1H3O A;  5B0Z D;  5GT3 D;  3NQU A;  5DNM B;  1S32 B;  1KX5 C;  3AZK B;  4J8X C;  3B0D C;  3AZH C;  1AOI B;  3X1T A;  3X1V A;  3B6G A;  4J8U D;  2Y2N A;  4XZQ A;  5CPI A;  2ZY3 A;  3AYW B;  2IO5 B;  2ARO A;  5CPK B;  1P3I D;  5AV9 A;  4YM6 B;  3MVD A;  3LJA A;  4CAY B;  3WTP C;  1M18 D;  2NZD B;  1TZY A;  3LZ0 A;  5B31 D;  1M19 A;  1P3K A;  2Y2O A;  4WU8 B;  5AV5 A;  5DNN D;  3MGR B;  2G5H C;  1BH8 A;  1P3P D;  1P3O D;  2Y2G A;  3X1T C;  3X1V C;  3B6G C;  4XZQ C;  5CPI C;  3WAA D;  2ARO C;  4XUJ A;  4NFT A;  1F66 D;  5AV9 C;  5JA4 B;  5AV6 D;  3MVD C;  5GXQ B;  1KX3 D;  2YFW B;  5E5A A;  3AL0 C;  2F2A C;  1TZY C;  3LZ0 C;  3REH D;  2YFV A;  1M19 C;  3UT9 A;  1P3K C;  3MNN A;  3WKJ D;  3KXB B;  4DRA A;  3P5J B;  5AV5 C;  2F8N B;  4R8P A;  1U35 B;  5B32 A;  3AZE A;  1Z2C B;  3MGS D;  4AWL B;  2BG1 A;  5AV8 D;  4J8V B;  4G92 B;  1P34 D;  3AV2 A;  1P3G A;  3WA9 B;  3AZJ A;  4KUD D;  3KWQ B;  4XUJ C;  2RVQ D;  5GT3 A;  4UPK A;  1KX5 B;  4WNN A;  2CV5 D;  5F99 D;  4H9S A;  4Z66 D;  4J8X B;  3AV1 A;  5AVB A;  4Z5T D;  5E5A C;  3VH6 A; 
#chains in the Genus database with same CATH homology
 4KGC D;  3B0B A;  3MGP C;  3UT9 C;  5B1M B;  3B6F D;  3MNN C;  1P3I A;  4R8P C;  3AN2 D;  5AVC A;  3AZI A;  3O62 D;  4QLC A;  1TAF B;  2BYM B;  1P3B A;  5B32 C;  3REJ D;  1M18 A;  5B31 G;  3W96 A;  2Y2L A;  3AZE C;  4X23 D;  3W97 D;  2Y2M A;  2ZY2 A;  4H9O A;  3A6N D;  3AV2 C;  3LZ1 A;  1P3G C;  3AZJ C;  4KHA A;  5GT3 C;  2ZM5 A;  4ZUX D;  3NQU B;  3REI D;  2PYO D;  3AV1 C;  4H9S C;  5CP6 D;  5AVB C;  3W99 D;  4J8W A;  3X1T B;  3X1V B;  3B6G B;  5BT1 D;  4H9N A;  4XZQ B;  4EO5 C;  1ZLA D;  2ARO B;  2HIO A;  1P3I C;  2BYK A;  3KUY D;  5AVC C;  3AZI C;  4QLC C;  5AV9 B;  3MVD B;  1P3B C;  1M18 C;  3W96 C;  5B2I B;  3VH6 T;  1TZY B;  3REH A;  3LZ0 B;  3X1S A;  3WKJ A;  1P3A A;  1M19 B;  1P3K B;  3LZ1 C;  2VQR A;  5AV5 B;  1P3L D;  1R4V A;  3AFA D;  1JFI A;  1BH8 B;  5B40 D;  3C1C D;  4DQY B;  5GT0 D;  1N1J A;  5JRG D;  1ID3 A;  3NQJ A;  4J8W C;  3AZK D;  1P34 A;  1AOI D;  2F8N K;  2Y2J A;  4XUJ B;  3AZM A;  2HIO C;  5CPK D;  2JSS A;  5F99 A;  4Z66 A;  3EPL A;  4Z5T A;  3AZL D;  4YM6 D;  5E5A B;  3REH C;  3X1S C;  3WKJ C;  2YFV B;  3MGP B;  3UT9 B;  1P3A C;  3MNN B;  2NQB D;  4R8P B;  3UTA A;  2L5A A;  3O62 A;  4WU8 D;  1P3M A;  5AY8 D;  5B1L A;  1KU5 A;  3MGR D;  5B32 B;  3AZG A;  4Z2M H;  3MGQ A;  3AZE B;  1P3F A;  1ID3 C;  3W97 A;  4X23 A;  1BFM A;  1P34 C;  4ZBJ C;  3A6N A;  3AV2 B;  1P3G B;  3AZJ B;  4WU9 A;  2RVQ C;  3AZM C;  4ZUX A;  3AZF D;  3C1B D;  2PYO A;  5F99 C;  4WNN B;  4Z66 C;  3AV1 B;  4Z5T C;  5AVB B;  1KX4 D;  5GXQ D;  3TU4 D;  3X1U D;  3R45 B;  1P3I B;  3UTA C;  3O62 C;  3WTP E;  3KXB D;  3LJA C;  5AVC B;  3AZI B;  1P3M C;  4QLC B;  2F8N D;  5B1L C;  3H0M C;  5B2J A;  1P3B B;  1M18 B;  3AZG C;  5B0Y A;  3V9R A;  3MGQ C;  3W96 B;  2UWX A;  4JJN A;  1P3F C;  3W97 C;  5BNX A;  5B33 D;  2Y2H A;  4Z2M G;  4YS3 B;  3A6N C;  4H9O B;  3LZ1 B;  4WU9 C;  3AFA A;  4KHA B;  4ZUX C;  3WA9 D;  5B40 A;  3KWQ D;  5GT0 A;  2PYO C;  3W98 A;  2FJ7 B;  5JRG A;  5KDM A;  1KX5 D;  3REK D;  5BNV B;  3REL A;  4J8W B;  3VH5 A;  1EQZ A;  1A7W A;  5CPJ D;  3LEL B;  5B0Z A;  2HIO B;  2BYK B;  5B1M D;  1Q9C A;  3AZH B;  3B0D B;  5B2J C;  4H9P A;  5BO0 A;  3AZL A;  5B0Y C;  4J8U A;  4G91 C;  4JJN C;  4LD9 D;  2F8N H;  1HQ3 D;  3X1S B;  3WKJ B;  1P3A B;  5G49 A;  2NQB A;  3AFA C;  5AY8 A;  4H9Q A;  3MGR A;  3WTP B;  5B40 C;  5GT0 C;  3W98 C;  5JRG C;  1HTA A;  5B31 A;  1N1J B;  3KFU G;  1ID3 B;  2DF4 C;  3B0C T;  1M1A D;  3NQJ B;  3REL C;  2ZY5 A;  5DNN A;  1EQZ C;  1P34 B;  4ZBJ B;  3X1T D;  5B0Z C;  3X1V D;  1H3O B;  3AZM B;  3AZF A;  4UUZ A;  3C1B A;  1P3P A;  2ARO D;  1P3O A;  5F99 B;  4Z66 B;  5C3I C;  3AZL C;  2HUE C;  4J8U C;  1KX4 A;  4Z5T B;  3H0L C;  5AV9 D;  3VH5 T;  1WWS A;  3WAA A;  5CPI B;  5B2I D;  1B67 A;  1F66 A;  4E45 A;  3AZN D;  3TU4 A;  3LZ0 D;  3X1U A;  2F8N G;  2NQB C;  5AV6 A;  1KX3 A;  3UTA B;  1P3K D;  5AY8 C;  1BH9 A;  3LJA B;  3A1I A;  5GSU D;  5AV5 D;  1P3M B;  5B1L B;  3AZG B;  5B31 C;  3MGQ B;  1P3F B;  3VH6 W;  5B33 A;  1T3U A;  3EPJ A;  3UTB D;  3W97 B;  5BS7 A;  2Y2Q A;  5B24 D;  5DNN C;  3EPK A;  3A6N B;  4WZS B;  4WU9 B;  4HGA C;  3WA9 A;  4ZUX B;  3AZF C;  3IP4 C;  1PZR A;  3C1B C;  1S32 D;  5DNM D;  4XUJ D;  1W2E A;  1P3O C;  3MGS A;  1P3P C;  2PYO B;  5AV8 A;  3REK A;  1KX4 C;  4H9R A;  3WAA C;  4KUD A;  5CPJ A;  1ULY A;  1F1E A;  3AYW D;  1F66 C;  3TU4 C;  3X1U C;  5B1M A;  2CV5 A;  3MGP D;  5AV6 C;  1KX3 C;  2CWE A;  5B2J B;  4R8P D;  4KGC A;  5B0Y B;  3V9R B;  4G91 B;  4LD9 A;  2NZD D;  4JJN B;  5FUG A;  5B33 C;  1HQ3 A;  5BNX B;  5B32 D;  3B6F A;  5BS7 C;  4E44 A;  3AN2 A;  2LY8 A;  3REJ A;  1P3G D;  2Y2P A;  4CSR A;  3AZJ D;  5B40 B;  4NE3 A;  5GT0 B;  3MGS C;  3W98 B;  5JRG B;  5AV8 C;  5KDM B;  1M1A A;  3REK C;  3REL B;  4KUD C;  3AV1 D;  5CPJ C;  1EQZ B;  5AVB D;  2XD5 A;  5B0Z B;  5GT3 B;  3REI A;  5B1M C;  2CV5 C;  5CP6 A;  3W99 A;  4DRB A;  4H9P B;  5C3I B;  5BO0 B;  5AVC D;  4QLC D;  2HUE B;  4J8U B;  3AZI D;  3AZL B;  4KGC C;  4LD9 C;  5CHL B;  1ZLA A;  1P3B D;  1HQ3 C;  4EO5 B;  5B2I A;  3B6F C;  3W96 D;  3KUY A;  3AN2 C;  3AZN A;  2JCH A;  5G49 B;  2NQB B;  4YS3 D;  3REJ C;  5GSU A;  5AY8 B;  4H9Q B;  3LZ1 D;  1U35 D;  4X23 C;  5B31 B;  3UTB A;  1M1A C;  2FJ7 D;  5B24 A;  1P3L A;  4J8V D;  5DNN B;  2DQN C;  4J8W D;  2W8S A;  3C1C A;  3REI C;  4HGA B;  3F6T A;  3LEL D;  1S32 A;  5DNM A;  5CP6 C;  4UUZ B;  3C1B B;  3AZF B;  1P3P B;  3W99 C;  2HIO D;  3AZK A;  1P3O B;  4J8X D;  3AZH D;  1AOI A;  5BT1 C;  1KX4 B;  3EG5 B;  4H9N B;  1ZLA C;  5B2I C;  3WAA B;  3AYW A;  3KUY C;  3AZN C;  5CPK A;  1F66 B;  3TU4 B;  3X1S D;  3X1U B;  3MGP A;  1P3A D;  5AV6 B;  1KX3 B;  5GSU C;  1BH9 B;  4YM6 A;  4CAY A;  5B32 G;  3WTP D;  3REH B;  3UTB C;  2NZD A;  5B33 B;  3A1K A;  3KSY A;  5B24 C;  1P3L C;  1ID3 D;  4WU8 A;  2ZY4 A;  1JFI B;  3C1C C;  1B6W A;  1S32 C;  5DNM C;  3AZM D;  3MGS B;  3AZK C;  5AV8 B;  2RIQ A;  1AOI C;  3REK B;  3B0C W;  4H9R B;  4KUD B;  5CPJ B;  3B6G D;  3AYW C;  4XZQ D;  2IO5 C;  5CPI D;  3EPH A;  5CPK C;  2CV5 B;  2FFF B;  3R45 A;  4M6B A;  4YM6 C;  4NE6 A;  5JA4 A;  5GXQ A;  3UTA D;  3MVD D;  3LJA D;  1P3M D;  4KGC B;  2NZD C;  2YFW A;  5B1L D;  3VH5 W;  4LD9 B;  5FUG B;  3B6F B;  1HQ3 B;  3AZG D;  1TZY D;  3MGQ D;  1P3F D;  3AN2 B;  4WU8 C;  3KXB A;  1M19 D;  4YS3 A;  3O62 B;  2F8N A;  3MGR C;  2J8P A;  3REJ B;  2Y2I A;  1U35 A;  4CSR B;  4WU9 D;  3FDD A;  4X23 B;  1M1A B;  2FJ7 A;  4J8V A;  5BNV A;  3KWQ A;  3LEL A;  3REI B;  4NE5 A;  5CP6 B;  1KX5 A;  2G5I C;  3W99 B;  3H0R C;  4J8X A;  3AZH A;  5GXQ C;  4WV4 B;  5B2J D;  5E5A D;  1ZLA B;  5B0Y D;  4JJN D;  1WWI A;  3KUY B;  3AZN B;  3KXB C;  3UT9 D;  4YS3 C;  3MNN D;  2XD1 A;  5GSU B;  2Y2K A;  1TAF A;  1U35 C;  2BYM A;  3WTP A;  4WJ3 C;  3UTB B;  3AZE D;  2FJ7 C;  4AWL C;  3W98 D;  2JE5 A;  4J8V C;  5B24 B;  4G92 C;  1P3L B;  3AFA B;  3REL D;  3AV2 D;  3WA9 C;  3KWQ C;  1EQZ D;  3LEL C;  3C1C B;  1H3O A;  5B0Z D;  5GT3 D;  3NQU A;  5DNM B;  1S32 B;  1KX5 C;  3AZK B;  4J8X C;  3B0D C;  3AZH C;  1AOI B;  3X1T A;  3X1V A;  3B6G A;  4J8U D;  2Y2N A;  4XZQ A;  5CPI A;  2ZY3 A;  3AYW B;  2IO5 B;  2ARO A;  5CPK B;  1P3I D;  5AV9 A;  4YM6 B;  3MVD A;  3LJA A;  4CAY B;  3WTP C;  1M18 D;  2NZD B;  1TZY A;  3LZ0 A;  5B31 D;  1M19 A;  1P3K A;  2Y2O A;  4WU8 B;  5AV5 A;  5DNN D;  3MGR B;  2G5H C;  1BH8 A;  1P3P D;  1P3O D;  2Y2G A;  3X1T C;  3X1V C;  3B6G C;  4XZQ C;  5CPI C;  3WAA D;  2ARO C;  4XUJ A;  4NFT A;  1F66 D;  5AV9 C;  5JA4 B;  5AV6 D;  3MVD C;  5GXQ B;  1KX3 D;  2YFW B;  5E5A A;  3AL0 C;  2F2A C;  1TZY C;  3LZ0 C;  3REH D;  2YFV A;  1M19 C;  3UT9 A;  1P3K C;  3MNN A;  3WKJ D;  3KXB B;  4DRA A;  3P5J B;  5AV5 C;  2F8N B;  4R8P A;  1U35 B;  5B32 A;  3AZE A;  1Z2C B;  3MGS D;  4AWL B;  2BG1 A;  5AV8 D;  4J8V B;  4G92 B;  1P34 D;  3AV2 A;  1P3G A;  3WA9 B;  3AZJ A;  4KUD D;  3KWQ B;  4XUJ C;  2RVQ D;  5GT3 A;  4UPK A;  1KX5 B;  4WNN A;  2CV5 D;  5F99 D;  4H9S A;  4Z66 D;  4J8X B;  3AV1 A;  5AVB A;  4Z5T D;  5E5A C;  3VH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...