3NQUB

Crystal structure of partially trypsinized (cenp-a/h4)2 heterotetramer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
67
structure length
67
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title The structure of (CENP-A-H4)(2) reveals physical features that mark centromeres.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 27
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3nquB00
1HTAA 1M18A 4LD9A 5B31D 1ID3B 3WAAC 3B6FA 5AVCA 1KX4D 5B33A 4YS3D 5JRGB 2BYKA 3W97D 3MGSD 3AZHB 5AV5A 3X1TA 5B2JA 3REKC 4DRBA 4ZUXD 2NQBD 4JJNB 3REJC 3AZIB 1P3MC 3AFAD 5B1MD 1P3AC 3UTAB 3LZ1D 1KX3B 4AWLB 4QLCD 5AVBC 3AYWD 1ZLAC 4J8UC 3WTPB 3LELD 2PYOC 1H3OA 4NFTA 3AZFB 3W96D 5B24D 3TU4B 3LZ0C 5DNND 3O62D 2NZDD 3REHC 1S32D 5DNMC 3RELA 1P3IC 4R8PA 3MVDB 3WA9A 5B40D 3KUYC 3AV2A 4WNNB 1ID3C 5BNXA 1N1JA 5GSUD 3MGQB 4LD9B 3UT9A 4XUJD 5JRGC 3B0DB 3B6FB 5AVCB 1P3BB 5CPKB 2F8NH 2BYKB 4J8XD 1P3GC 5GT0A 3VH6A 3UTBD 1P3PC 3KXBD 2F8NB 5AV9A 3X1VD 1TZYA 3UTAC 1KX3C 4AWLC 5E5AB 3A6NA 5BT1D 3WTPC 3AZFC 4Z5TB 4M6BA 3AZGA 3LJAB 3TU4C 1H3OB 5F99A 4KGCA 3R45A 3MVDC 5FUGA 4E45A 3AZJB 1JFIA 3RELB 4G92B 4WU8C 3B6GA 3MGRD 3W98B 4LD9C 1AOID 5B2IA 5BNXB 1N1JB 4J8VA 3B0DC 3B6FC 5AVCC 3AZLA 5CPKC 3AZMB 1P3KA 3AZED 3C1CA 3AZKA 1KX5B 5AV5C 3WKJD 1BH9A 5B2JC 4KUDB 5B1LD 5GT3B 1EQZD 1BH8A 5CPIA 4YM6D 4J8WB 4H9SA 3W99A 3LJAC 3AZGB 5GXQD 1R4VA 5B31A 5F99B 4KGCB 3AZJC 1KX4A 3RELC 1P3FD 2HIOD 4YS3A 2AROD 3WA9C 1HQ3D 1JFIB 5BS7A 3AV2C 3W98C 1M1AD 3MGSA 3AV1D 4CSRA 3AZMC 5B2IB 3UT9C 1P3LD 5AY8D 3AZLB 4ZUXA 2NQBA 5GT0C 3AFAA 5B1MA 4UUZA 3REJB 4KUDC 3LZ1A 1WWIA 5AV9C 1WWSA 4QLCA 1F66D 1P3AB 1A7WA 3AYWA 5CP6A 3LELA 1TZYC 3W96A 5B24A 1BH8B 5CPIB 5DNNA 3O62A 2NZDA 3C1BD 2BYMA 1S32A 3AZNA 5CPJD 3MNND 3AZGC 5B40A 5DNMB 1P3IB 5GSUA 5F99C 4KGCC 3X1UD 4H9OA 3KUYB 4XUJA 4HGAB 3REKD 1KX4B 4J8XA 5G49A 5B2IC 1P3MD 4J8VC 3AZLC 4CSRB 1P3GB 1P3KC 5B31G 3KXBA 4H9RB 1P3PB 5AVBD 2NQBB 3REID 3C1CC 4J8UD 3X1VA 2YFWA 3AZKC 1B6WA 4H9NB 4CAYA 3LZ0D 3AFAB 4UUZB 5BO0A 3MGPD 4QLCB 3KWQB 3AYWB 5CP6B 1M19A 5CPIC 4KHAA 2FJ7D 4Z66D 2CV5D 2BYMB 1S32B 5AV6D 3AZNB 4WNNA 3AZHD 1AOIA 4EO5C 5AV8B 5B31C 4HGAC 4WU8B 1KX4C 1M18B 4YS3C 1U35D 4JJND 3AZEA 3AZID 5B33B 3MGSC 2RVQD 4J8XB 5G49B 4X23D 3WKJA 3NQUA 5B1LA 5AV5B 3X1TB 2NQBC 3WTPD 3KXBB 5B2JB 1EQZA 3AFAC 5B1MC 4YM6A 4CAYB 4QLCC 3KWQC 3AYWC 3NQJA 5CP6C 3LELC 3AN2D 3W96C 5B24C 3MGQD 4LD9D 1M19B 5GXQA 5DNNC 3O62C 3WTPE 1P3BD 5CPKD 1S32C 1P3FA 3AZNC 2HIOA 5B0ZA 1HQ3A 1P34D 5B40C 1P3OD 1M1AA 5AV8C 5GSUC 4R8PB 3WA9B 3AV1A 3AV2B 1M18C 4XUJC 1P3LA 5AY8A 2F8ND 5B33C 3UT9B 4J8XC 4NE5A 1F1EA 5E5AD 5GT0B 5CHLB 3X1TC 2F8NG 3KXBC 4Z5TD 1F66A 5B32D 3LJAD 3X1VC 5AV9B 4YM6B 1TZYB 5BT1C 3C1BA 3AZJD 3X1SD 3RELD 5B32G 4WU9D 3MNNA 3NQJB 3A6NB 5CPJA 1M19C 3W98D 3V9RA 4Z2MH 3X1UA 3AZMD 1B67A 3REKA 1P3FB 2YFVA 3R45B 5B0ZB 1HQ3B 5FUGB 4R8PC 4XZQD 1KX5D 1AOIC 3VH5T 1P3MA 3B6GB 3W97A 4WV4B 4KUDD 4E44A 1P3LB 2CWEA 2JSSA 4J8VB 4H9PA 5GT3D 5AVBA 1P3KB 3REIA 4H9QA 3WKJC 4J8WD 3B0CT 5B0YD 3LZ0A 3C1CB 3AZKB 5B1LC 1BH9B 3MGPA 1F66B 1EQZC 4G91B 4YM6C 2FJ7A 4KGCD 4Z66A 3WAAD 3A6NC 3C1BB 2CV5A 5AV6A 3B0BA 3W99B 5CPJB 3MNNB 5GXQC 5B2ID 3AZHA 2IO5B 3X1UB 1P3FC 2HIOC 1U35A 5B31B 5B0ZC 1HQ3C 4JJNA 3AZIA 1M1AC 3B6GC 4YS3B 3AV1C 5C3IB 4X23A 3REJD 4WU8A 1P3LC 3W97B 1TAFA 5AY8C 3MGSB 3UTBA 1P3AD 4H9PB 4ZUXB 3REIB 2LY8A 1ZLAD 2HUEC 2PYOD 5B1MB 5BNVA 1F66C 3LZ1B 3REHD 4G91C 5DNMD 3AN2A 1P3ID 3MGQA 3KUYD 3LELB 1ID3D 3VH5W 1P3BA 3C1BC 5B24B 5CPKA 2FJ7B 4H9SC 3W96B 3W99C 5DNNB 4Z66B 3MNNC 5JRGD 3O62B 5CPJC 2CV5B 1P34A 5AV6B 1P3OA 2NZDB 2IO5C 5JA4A 3X1UC 1P3GD 3MGRA 5B40B 5GSUB 2F8NA 3B0CW 1P3PD 4H9OB 1U35B 4XUJB 5C3IC 5BS7C 3W97C 4X23B 5E5AA 3UTAD 1TAFB 1KX3D 3UTBB 4Z5TA 3KWQD 5B32A 4ZUXC 5CP6D 3LJAA 3REIC 3AZFD 3KSYA 4ZBJC 3TU4D 3X1VB 2YFWB 1BFMA 3AZJA 3LZ1C 3X1SA 5KDMA 3MGPC 3AZND 5BNVB 3MVDD 4WU9A 3W98A 3AN2B 5AV8D 1KU5A 5BO0B 4WU8D 2FJ7C 3AZMA 1M18D 4Z66C 2CV5C 4KHAB 3B6FD 5AVCD 2NZDC 5AV6C 5B33D 1P34B 2AROA 4XZQA 3AZHC 1P3OB 1KX5A 1Q9CA 5JA4B 4KUDA 3MGRB 1AOIB 5AV5D 3X1TD 1U35C 4JJNC 3AZIC 5B2JD 3VH5A 5GT3A 2RVQC 4X23C 3AZEB 4J8WA 5B0YA 3UTBC 3WKJB 4DRAA 3NQUB 5B32B 5B1LB 1M19D 1EQZB 3WAAA 3X1SB 5KDMB 3AN2C 4R8PD 4WU9B 3MGQC 3WA9D 3AV2D 1P3BC 4WZSB 4NE3A 5GXQB 3UT9D 1P34C 3VH6T 1P3OC 2HIOB 2AROB 4XZQB 1ULYA 3MGRC 3REJA 5GT0D 1M1AB 3AV1B 1P3AA 4NE6A 3AZEC 5AY8B 5AV9D 1ZLAA 4J8UA 5E5AC 2PYOA 1TZYD 5B0YB 4Z5TC 2HUEB 5B32C 3A6ND 3REHA 5DNMA 1P3IA 3AZGD 3KUYA 4EO5B 1ID3A 2L5AA 5F99D 3X1SC 4G92C 5B0ZD 4WU9C 5JRGA 3WAAB 3B6GD 1P3GA 3V9RB 4J8VD 4H9RA 3AZLD 1P3PA 1P3KD 4Z2MG 2AROC 4XZQC 3REKB 1KX5C 4H9NA 2YFVB 3C1CD 3AZKD 1P3MB 3UTAA 1KX3A 5GT3C 3KWQA 3WTPA 3AZFA 4J8WC 5AVBB 5B0YC 1ZLAB 3TU4A 4J8UB 5CPID 2PYOB 4H9QB 2F8NK 4ZBJB 3LZ0B 3W99D 3MVDA 3REHB 5AV8A 3VH6W 3MGPB
chains in the Genus database with same CATH superfamily
1HTAA 3A1IA 1M18A 4LD9A 2Y2KA 5B31D 3EPKA 2BG1A 3WAAC 1ID3B 3B6FA 5AVCA 1KX4D 5B33A 3P5JB 4YS3D 5JRGB 2BYKA 3W97D 3MGSD 3AZHB 5AV5A 3X1TA 5B2JA 3REKC 4DRBA 4ZUXD 2NQBD 4JJNB 3REJC 3AZIB 1P3MC 3AFAD 5B1MD 1P3AC 3UTAB 3LZ1D 1KX3B 4AWLB 4QLCD 5AVBC 3AYWD 1ZLAC 4J8UC 3WTPB 3LELD 2PYOC 1H3OA 4NFTA 3AZFB 3W96D 5B24D 3TU4B 3LZ0C 5DNND 3O62D 2NZDD 3REHC 1S32D 5DNMC 3RELA 1P3IC 4R8PA 3MVDB 3WA9A 5B40D 2VQRA 3KUYC 3AV2A 4WNNB 1ID3C 5BNXA 1N1JA 5GSUD 3MGQB 4LD9B 3UT9A 4XUJD 5JRGC 3B0DB 3B6FB 5AVCB 1P3BB 5CPKB 4UPKA 4WJ3C 2F8NH 2BYKB 4J8XD 1P3GC 5GT0A 3VH6A 3UTBD 1P3PC 3KXBD 2F8NB 5AV9A 2J8PA 2ZM5A 3X1VD 1TZYA 3UTAC 1KX3C 4AWLC 5E5AB 3A6NA 5BT1D 3WTPC 3AZFC 4Z5TB 4M6BA 3AZGA 2Y2LA 3LJAB 3TU4C 1H3OB 5F99A 4KGCA 3R45A 3MVDC 5FUGA 4E45A 3AZJB 2Y2HA 1JFIA 3RELB 4G92B 4WU8C 3B6GA 3MGRD 3W98B 4LD9C 1AOID 5B2IA 5BNXB 1N1JB 4J8VA 3B0DC 3B6FC 5AVCC 3AZLA 1W2EA 3AZMB 5CPKC 1P3KA 3AZED 3C1CA 3AZKA 1KX5B 5AV5C 3WKJD 1BH9A 5B2JC 4KUDB 5B1LD 5GT3B 3H0LC 1EQZD 1BH8A 5CPIA 4YM6D 4J8WB 4H9SA 3W99A 3LJAC 2Y2PA 3AZGB 2FFFB 1R4VA 5GXQD 5B31A 5F99B 4KGCB 3AZJC 1KX4A 3RELC 1P3FD 2HIOD 4YS3A 2AROD 3WA9C 1HQ3D 1JFIB 5BS7A 3AV2C 3A1KA 3W98C 1M1AD 3MGSA 3AV1D 2Y2IA 4CSRA 3AZMC 5B2IB 3UT9C 1P3LD 5AY8D 3AZLB 4ZUXA 2NQBA 2JCHA 5GT0C 3AFAA 5B1MA 4UUZA 3REJB 4KUDC 3LZ1A 3H0RC 1WWIA 5AV9C 1WWSA 4QLCA 1F66D 1P3AB 1A7WA 3AYWA 2ZY4A 5CP6A 3LELA 2F2AC 1TZYC 3W96A 5B24A 1BH8B 5CPIB 5DNNA 3O62A 2NZDA 3C1BD 2BYMA 1S32A 3AZNA 5CPJD 3MNND 3AZGC 5B40A 5DNMB 1P3IB 5GSUA 5F99C 4KGCC 3X1UD 4H9OA 3KUYB 1T3UA 4XUJA 4HGAB 3REKD 1KX4B 4J8XA 5G49A 5B2IC 1P3MD 4J8VC 3AZLC 4CSRB 1P3GB 1P3KC 5B31G 2G5HC 3KXBA 4H9RB 1P3PB 5AVBD 2NQBB 3REID 3C1CC 4J8UD 3X1VA 2YFWA 2ZY2A 1B6WA 2ZY3A 4H9NB 3AZKC 3H0MC 4CAYA 3LZ0D 3AFAB 4UUZB 3EPHA 5BO0A 3MGPD 4QLCB 3KWQB 3AYWB 5CP6B 1M19A 5CPIC 4KHAA 2FJ7D 1PZRA 4Z66D 2CV5D 2BYMB 1S32B 5AV6D 3AZNB 4WNNA 3AZHD 1AOIA 4EO5C 5AV8B 5B31C 4HGAC 4WU8B 1KX4C 1M18B 4YS3C 1U35D 4JJND 3AZEA 3AZID 5B33B 2Y2GA 3MGSC 2RVQD 4J8XB 5G49B 4X23D 3WKJA 3NQUA 5B1LA 5AV5B 3X1TB 2NQBC 3WTPD 3KXBB 5B2JB 1EQZA 3AFAC 5B1MC 4YM6A 4CAYB 3EPJA 3AL0C 2ZY5A 4QLCC 3KWQC 3AYWC 3NQJA 5CP6C 3EG5B 3LELC 3AN2D 3W96C 5B24C 3MGQD 4LD9D 1M19B 5GXQA 5DNNC 3O62C 3WTPE 1P3BD 5CPKD 1S32C 1P3FA 3AZNC 2HIOA 5B0ZA 1HQ3A 1P34D 5B40C 1P3OD 1M1AA 5AV8C 5GSUC 4R8PB 3WA9B 3AV1A 3AV2B 1M18C 4XUJC 1P3LA 5AY8A 2F8ND 5B33C 3UT9B 4J8XC 4NE5A 1F1EA 5E5AD 2XD5A 5GT0B 5CHLB 3X1TC 2F8NG 3KXBC 4Z5TD 1F66A 5B32D 3LJAD 3X1VC 5AV9B 4YM6B 1TZYB 5BT1C 3C1BA 3AZJD 3X1SD 3RELD 5B32G 4WU9D 3MNNA 3NQJB 3A6NB 5CPJA 2Y2QA 1M19C 3V9RA 3W98D 4Z2MH 2JE5A 1Z2CB 3X1UA 3AZMD 2DQNC 1B67A 3REKA 1P3FB 2YFVA 3R45B 5B0ZB 1HQ3B 5FUGB 4R8PC 4XZQD 1KX5D 2RIQA 3VH5T 1P3MA 1AOIC 3B6GB 3W97A 4WV4B 4KUDD 4E44A 1P3LB 2CWEA 2JSSA 4J8VB 2XD1A 4H9PA 5GT3D 5AVBA 1P3KB 3REIA 4H9QA 3IP4C 4J8WD 3WKJC 3B0CT 5B0YD 3LZ0A 3C1CB 3AZKB 5B1LC 2DF4C 2UWXA 1BH9B 3MGPA 1F66B 1EQZC 4G91B 4YM6C 2FJ7A 4KGCD 4DQYB 4Z66A 3WAAD 3A6NC 3C1BB 2CV5A 5AV6A 3B0BA 3W99B 5CPJB 3MNNB 5GXQC 5B2ID 3AZHA 2IO5B 3X1UB 1P3FC 2HIOC 1U35A 5B31B 5B0ZC 1HQ3C 4JJNA 3AZIA 1M1AC 3B6GC 4YS3B 3AV1C 5C3IB 4X23A 3REJD 4WU8A 1P3LC 3W97B 1TAFA 5AY8C 3MGSB 3UTBA 1P3AD 4H9PB 4ZUXB 3REIB 2LY8A 1ZLAD 2HUEC 2PYOD 5B1MB 5BNVA 1F66C 3LZ1B 3REHD 4G91C 5DNMD 3AN2A 1P3ID 3MGQA 3KUYD 3LELB 1ID3D 3VH5W 1P3BA 3C1BC 5B24B 5CPKA 2FJ7B 4H9SC 3W96B 5DNNB 3W99C 4Z66B 3MNNC 5JRGD 3O62B 5CPJC 2CV5B 1P34A 5AV6B 1P3OA 2NZDB 2IO5C 5JA4A 3X1UC 1P3GD 2W8SA 5B40B 3MGRA 5GSUB 2F8NA 3B0CW 1P3PD 4H9OB 1U35B 4XUJB 5C3IC 5BS7C 3F6TA 3W97C 4X23B 5E5AA 3UTAD 1TAFB 1KX3D 3UTBB 4Z5TA 3KWQD 5B32A 4ZUXC 5CP6D 3LJAA 3REIC 3AZFD 3KSYA 4ZBJC 3TU4D 3X1VB 2YFWB 1BFMA 3AZJA 3LZ1C 3X1SA 5KDMA 3MGPC 3AZND 5BNVB 3MVDD 4WU9A 3W98A 2Y2OA 3AN2B 5AV8D 1KU5A 5BO0B 4WU8D 2FJ7C 3AZMA 1M18D 4Z66C 2CV5C 4KHAB 3B6FD 5AVCD 2NZDC 5AV6C 5B33D 1P34B 2AROA 4XZQA 3AZHC 1P3OB 1KX5A 1Q9CA 5JA4B 4KUDA 3MGRB 1AOIB 5AV5D 3X1TD 1U35C 4JJNC 3AZIC 5B2JD 3VH5A 5GT3A 2RVQC 4X23C 3AZEB 4J8WA 5B0YA 3UTBC 3WKJB 4DRAA 3NQUB 5B32B 5B1LB 1M19D 1EQZB 3WAAA 3X1SB 5KDMB 3AN2C 3EPLA 4R8PD 4WU9B 3MGQC 3WA9D 3AV2D 3KFUG 1P3BC 4WZSB 4NE3A 5GXQB 3UT9D 1P34C 3VH6T 1P3OC 2HIOB 2AROB 4XZQB 1ULYA 3MGRC 3REJA 5GT0D 1M1AB 3AV1B 1P3AA 4NE6A 3AZEC 5AY8B 5AV9D 1ZLAA 3FDDA 4J8UA 5E5AC 2PYOA 1TZYD 5B0YB 4Z5TC 2HUEB 5B32C 3A6ND 3REHA 5DNMA 1P3IA 3AZGD 3KUYA 2Y2NA 4EO5B 1ID3A 2L5AA 5F99D 3X1SC 4G92C 5B0ZD 4WU9C 5JRGA 3WAAB 3B6GD 1P3GA 3V9RB 4J8VD 2G5IC 4H9RA 3AZLD 1P3PA 1P3KD 4Z2MG 2AROC 4XZQC 3REKB 1KX5C 4H9NA 2YFVB 3C1CD 2Y2MA 3AZKD 1P3MB 3UTAA 1KX3A 5GT3C 3KWQA 2Y2JA 3WTPA 3AZFA 4J8WC 5AVBB 5B0YC 1ZLAB 3TU4A 4J8UB 5CPID 2PYOB 4H9QB 2F8NK 4ZBJB 3LZ0B 3W99D 3MVDA 3REHB 5AV8A 3VH6W 3MGPB
chains in the Genus database with same CATH topology
1HTAA 3A1IA 1M18A 4LD9A 2Y2KA 5B31D 3EPKA 2BG1A 3WAAC 1ID3B 3B6FA 5AVCA 1KX4D 5B33A 3P5JB 4YS3D 5JRGB 2BYKA 3W97D 3MGSD 3AZHB 5AV5A 3X1TA 5B2JA 3REKC 4DRBA 4ZUXD 2NQBD 4JJNB 3REJC 3AZIB 1P3MC 3AFAD 5B1MD 1P3AC 3UTAB 3LZ1D 1KX3B 4AWLB 4QLCD 5AVBC 3AYWD 1ZLAC 4J8UC 3WTPB 3LELD 2PYOC 1H3OA 4NFTA 3AZFB 3W96D 5B24D 3TU4B 3LZ0C 5DNND 3O62D 2NZDD 3REHC 1S32D 5DNMC 3RELA 1P3IC 4R8PA 3MVDB 3WA9A 5B40D 2VQRA 3KUYC 3AV2A 4WNNB 1ID3C 5BNXA 1N1JA 5GSUD 3MGQB 4LD9B 3UT9A 4XUJD 5JRGC 3B0DB 3B6FB 5AVCB 1P3BB 5CPKB 4UPKA 4WJ3C 2F8NH 2BYKB 4J8XD 1P3GC 5GT0A 3VH6A 3UTBD 1P3PC 3KXBD 2F8NB 5AV9A 2J8PA 2ZM5A 3X1VD 1TZYA 3UTAC 1KX3C 4AWLC 5E5AB 3A6NA 5BT1D 3WTPC 3AZFC 4Z5TB 4M6BA 3AZGA 2Y2LA 3LJAB 3TU4C 1H3OB 5F99A 4KGCA 3R45A 3MVDC 5FUGA 4E45A 3AZJB 2Y2HA 1JFIA 3RELB 4G92B 4WU8C 3B6GA 3MGRD 3W98B 4LD9C 1AOID 5B2IA 5BNXB 1N1JB 4J8VA 3B0DC 3B6FC 5AVCC 3AZLA 1W2EA 3AZMB 5CPKC 1P3KA 3AZED 3C1CA 3AZKA 1KX5B 5AV5C 3WKJD 1BH9A 5B2JC 4KUDB 5B1LD 5GT3B 3H0LC 1EQZD 1BH8A 5CPIA 4YM6D 4J8WB 4H9SA 3W99A 3LJAC 2Y2PA 3AZGB 2FFFB 1R4VA 5GXQD 5B31A 5F99B 4KGCB 3AZJC 1KX4A 3RELC 1P3FD 2HIOD 4YS3A 2AROD 3WA9C 1HQ3D 1JFIB 5BS7A 3AV2C 3A1KA 3W98C 1M1AD 3MGSA 3AV1D 2Y2IA 4CSRA 3AZMC 5B2IB 3UT9C 1P3LD 5AY8D 3AZLB 4ZUXA 2NQBA 2JCHA 5GT0C 3AFAA 5B1MA 4UUZA 3REJB 4KUDC 3LZ1A 3H0RC 1WWIA 5AV9C 1WWSA 4QLCA 1F66D 1P3AB 1A7WA 3AYWA 2ZY4A 5CP6A 3LELA 2F2AC 1TZYC 3W96A 5B24A 1BH8B 5CPIB 5DNNA 3O62A 2NZDA 3C1BD 2BYMA 1S32A 3AZNA 5CPJD 3MNND 3AZGC 5B40A 5DNMB 1P3IB 5GSUA 5F99C 4KGCC 3X1UD 4H9OA 3KUYB 1T3UA 4XUJA 4HGAB 3REKD 1KX4B 4J8XA 5G49A 5B2IC 1P3MD 4J8VC 3AZLC 4CSRB 1P3GB 1P3KC 5B31G 2G5HC 3KXBA 4H9RB 1P3PB 5AVBD 2NQBB 3REID 3C1CC 4J8UD 3X1VA 2YFWA 2ZY2A 1B6WA 2ZY3A 4H9NB 3AZKC 3H0MC 4CAYA 3LZ0D 3AFAB 4UUZB 3EPHA 5BO0A 3MGPD 4QLCB 3KWQB 3AYWB 5CP6B 1M19A 5CPIC 4KHAA 2FJ7D 1PZRA 4Z66D 2CV5D 2BYMB 1S32B 5AV6D 3AZNB 4WNNA 3AZHD 1AOIA 4EO5C 5AV8B 5B31C 4HGAC 4WU8B 1KX4C 1M18B 4YS3C 1U35D 4JJND 3AZEA 3AZID 5B33B 2Y2GA 3MGSC 2RVQD 4J8XB 5G49B 4X23D 3WKJA 3NQUA 5B1LA 5AV5B 3X1TB 2NQBC 3WTPD 3KXBB 5B2JB 1EQZA 3AFAC 5B1MC 4YM6A 4CAYB 3EPJA 3AL0C 2ZY5A 4QLCC 3KWQC 3AYWC 3NQJA 5CP6C 3EG5B 3LELC 3AN2D 3W96C 5B24C 3MGQD 4LD9D 1M19B 5GXQA 5DNNC 3O62C 3WTPE 1P3BD 5CPKD 1S32C 1P3FA 3AZNC 2HIOA 5B0ZA 1HQ3A 1P34D 5B40C 1P3OD 1M1AA 5AV8C 5GSUC 4R8PB 3WA9B 3AV1A 3AV2B 1M18C 4XUJC 1P3LA 5AY8A 2F8ND 5B33C 3UT9B 4J8XC 4NE5A 1F1EA 5E5AD 2XD5A 5GT0B 5CHLB 3X1TC 2F8NG 3KXBC 4Z5TD 1F66A 5B32D 3LJAD 3X1VC 5AV9B 4YM6B 1TZYB 5BT1C 3C1BA 3AZJD 3X1SD 3RELD 5B32G 4WU9D 3MNNA 3NQJB 3A6NB 5CPJA 2Y2QA 1M19C 3V9RA 3W98D 4Z2MH 2JE5A 1Z2CB 3X1UA 3AZMD 2DQNC 1B67A 3REKA 1P3FB 2YFVA 3R45B 5B0ZB 1HQ3B 5FUGB 4R8PC 4XZQD 1KX5D 2RIQA 3VH5T 1P3MA 1AOIC 3B6GB 3W97A 4WV4B 4KUDD 4E44A 1P3LB 2CWEA 2JSSA 4J8VB 2XD1A 4H9PA 5GT3D 5AVBA 1P3KB 3REIA 4H9QA 3IP4C 4J8WD 3WKJC 3B0CT 5B0YD 3LZ0A 3C1CB 3AZKB 5B1LC 2DF4C 2UWXA 1BH9B 3MGPA 1F66B 1EQZC 4G91B 4YM6C 2FJ7A 4KGCD 4DQYB 4Z66A 3WAAD 3A6NC 3C1BB 2CV5A 5AV6A 3B0BA 3W99B 5CPJB 3MNNB 5GXQC 5B2ID 3AZHA 2IO5B 3X1UB 1P3FC 2HIOC 1U35A 5B31B 5B0ZC 1HQ3C 4JJNA 3AZIA 1M1AC 3B6GC 4YS3B 3AV1C 5C3IB 4X23A 3REJD 4WU8A 1P3LC 3W97B 1TAFA 5AY8C 3MGSB 3UTBA 1P3AD 4H9PB 4ZUXB 3REIB 2LY8A 1ZLAD 2HUEC 2PYOD 5B1MB 5BNVA 1F66C 3LZ1B 3REHD 4G91C 5DNMD 3AN2A 1P3ID 3MGQA 3KUYD 3LELB 1ID3D 3VH5W 1P3BA 3C1BC 5B24B 5CPKA 2FJ7B 4H9SC 3W96B 5DNNB 3W99C 4Z66B 3MNNC 5JRGD 3O62B 5CPJC 2CV5B 1P34A 5AV6B 1P3OA 2NZDB 2IO5C 5JA4A 3X1UC 1P3GD 2W8SA 5B40B 3MGRA 5GSUB 2F8NA 3B0CW 1P3PD 4H9OB 1U35B 4XUJB 5C3IC 5BS7C 3F6TA 3W97C 4X23B 5E5AA 3UTAD 1TAFB 1KX3D 3UTBB 4Z5TA 3KWQD 5B32A 4ZUXC 5CP6D 3LJAA 3REIC 3AZFD 3KSYA 4ZBJC 3TU4D 3X1VB 2YFWB 1BFMA 3AZJA 3LZ1C 3X1SA 5KDMA 3MGPC 3AZND 5BNVB 3MVDD 4WU9A 3W98A 2Y2OA 3AN2B 5AV8D 1KU5A 5BO0B 4WU8D 2FJ7C 3AZMA 1M18D 4Z66C 2CV5C 4KHAB 3B6FD 5AVCD 2NZDC 5AV6C 5B33D 1P34B 2AROA 4XZQA 3AZHC 1P3OB 1KX5A 1Q9CA 5JA4B 4KUDA 3MGRB 1AOIB 5AV5D 3X1TD 1U35C 4JJNC 3AZIC 5B2JD 3VH5A 5GT3A 2RVQC 4X23C 3AZEB 4J8WA 5B0YA 3UTBC 3WKJB 4DRAA 3NQUB 5B32B 5B1LB 1M19D 1EQZB 3WAAA 3X1SB 5KDMB 3AN2C 3EPLA 4R8PD 4WU9B 3MGQC 3WA9D 3AV2D 3KFUG 1P3BC 4WZSB 4NE3A 5GXQB 3UT9D 1P34C 3VH6T 1P3OC 2HIOB 2AROB 4XZQB 1ULYA 3MGRC 3REJA 5GT0D 1M1AB 3AV1B 1P3AA 4NE6A 3AZEC 5AY8B 5AV9D 1ZLAA 3FDDA 4J8UA 5E5AC 2PYOA 1TZYD 5B0YB 4Z5TC 2HUEB 5B32C 3A6ND 3REHA 5DNMA 1P3IA 3AZGD 3KUYA 2Y2NA 4EO5B 1ID3A 2L5AA 5F99D 3X1SC 4G92C 5B0ZD 4WU9C 5JRGA 3WAAB 3B6GD 1P3GA 3V9RB 4J8VD 2G5IC 4H9RA 3AZLD 1P3PA 1P3KD 4Z2MG 2AROC 4XZQC 3REKB 1KX5C 4H9NA 2YFVB 3C1CD 2Y2MA 3AZKD 1P3MB 3UTAA 1KX3A 5GT3C 3KWQA 2Y2JA 3WTPA 3AZFA 4J8WC 5AVBB 5B0YC 1ZLAB 3TU4A 4J8UB 5CPID 2PYOB 4H9QB 2F8NK 4ZBJB 3LZ0B 3W99D 3MVDA 3REHB 5AV8A 3VH6W 3MGPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTA A;  1M18 A;  4LD9 A;  5B31 D;  1ID3 B;  3WAA C;  3B6F A;  5AVC A;  1KX4 D;  5B33 A;  4YS3 D;  5JRG B;  2BYK A;  3W97 D;  3MGS D;  3AZH B;  5AV5 A;  3X1T A;  5B2J A;  3REK C;  4DRB A;  4ZUX D;  2NQB D;  4JJN B;  3REJ C;  3AZI B;  1P3M C;  3AFA D;  5B1M D;  1P3A C;  3UTA B;  3LZ1 D;  1KX3 B;  4AWL B;  4QLC D;  5AVB C;  3AYW D;  1ZLA C;  4J8U C;  3WTP B;  3LEL D;  2PYO C;  1H3O A;  4NFT A;  3AZF B;  3W96 D;  5B24 D;  3TU4 B;  3LZ0 C;  5DNN D;  3O62 D;  2NZD D;  3REH C;  1S32 D;  5DNM C;  3REL A;  1P3I C;  4R8P A;  3MVD B;  3WA9 A;  5B40 D;  3KUY C;  3AV2 A;  4WNN B;  1ID3 C;  5BNX A;  1N1J A;  5GSU D;  3MGQ B;  4LD9 B;  3UT9 A;  4XUJ D;  5JRG C;  3B0D B;  3B6F B;  5AVC B;  1P3B B;  5CPK B;  2F8N H;  2BYK B;  4J8X D;  1P3G C;  5GT0 A;  3VH6 A;  3UTB D;  1P3P C;  3KXB D;  2F8N B;  5AV9 A;  3X1V D;  1TZY A;  3UTA C;  1KX3 C;  4AWL C;  5E5A B;  3A6N A;  5BT1 D;  3WTP C;  3AZF C;  4Z5T B;  4M6B A;  3AZG A;  3LJA B;  3TU4 C;  1H3O B;  5F99 A;  4KGC A;  3R45 A;  3MVD C;  5FUG A;  4E45 A;  3AZJ B;  1JFI A;  3REL B;  4G92 B;  4WU8 C;  3B6G A;  3MGR D;  3W98 B;  4LD9 C;  1AOI D;  5B2I A;  5BNX B;  1N1J B;  4J8V A;  3B0D C;  3B6F C;  5AVC C;  3AZL A;  5CPK C;  3AZM B;  1P3K A;  3AZE D;  3C1C A;  3AZK A;  1KX5 B;  5AV5 C;  3WKJ D;  1BH9 A;  5B2J C;  4KUD B;  5B1L D;  5GT3 B;  1EQZ D;  1BH8 A;  5CPI A;  4YM6 D;  4J8W B;  4H9S A;  3W99 A;  3LJA C;  3AZG B;  5GXQ D;  1R4V A;  5B31 A;  5F99 B;  4KGC B;  3AZJ C;  1KX4 A;  3REL C;  1P3F D;  2HIO D;  4YS3 A;  2ARO D;  3WA9 C;  1HQ3 D;  1JFI B;  5BS7 A;  3AV2 C;  3W98 C;  1M1A D;  3MGS A;  3AV1 D;  4CSR A;  3AZM C;  5B2I B;  3UT9 C;  1P3L D;  5AY8 D;  3AZL B;  4ZUX A;  2NQB A;  5GT0 C;  3AFA A;  5B1M A;  4UUZ A;  3REJ B;  4KUD C;  3LZ1 A;  1WWI A;  5AV9 C;  1WWS A;  4QLC A;  1F66 D;  1P3A B;  1A7W A;  3AYW A;  5CP6 A;  3LEL A;  1TZY C;  3W96 A;  5B24 A;  1BH8 B;  5CPI B;  5DNN A;  3O62 A;  2NZD A;  3C1B D;  2BYM A;  1S32 A;  3AZN A;  5CPJ D;  3MNN D;  3AZG C;  5B40 A;  5DNM B;  1P3I B;  5GSU A;  5F99 C;  4KGC C;  3X1U D;  4H9O A;  3KUY B;  4XUJ A;  4HGA B;  3REK D;  1KX4 B;  4J8X A;  5G49 A;  5B2I C;  1P3M D;  4J8V C;  3AZL C;  4CSR B;  1P3G B;  1P3K C;  5B31 G;  3KXB A;  4H9R B;  1P3P B;  5AVB D;  2NQB B;  3REI D;  3C1C C;  4J8U D;  3X1V A;  2YFW A;  3AZK C;  1B6W A;  4H9N B;  4CAY A;  3LZ0 D;  3AFA B;  4UUZ B;  5BO0 A;  3MGP D;  4QLC B;  3KWQ B;  3AYW B;  5CP6 B;  1M19 A;  5CPI C;  4KHA A;  2FJ7 D;  4Z66 D;  2CV5 D;  2BYM B;  1S32 B;  5AV6 D;  3AZN B;  4WNN A;  3AZH D;  1AOI A;  4EO5 C;  5AV8 B;  5B31 C;  4HGA C;  4WU8 B;  1KX4 C;  1M18 B;  4YS3 C;  1U35 D;  4JJN D;  3AZE A;  3AZI D;  5B33 B;  3MGS C;  2RVQ D;  4J8X B;  5G49 B;  4X23 D;  3WKJ A;  3NQU A;  5B1L A;  5AV5 B;  3X1T B;  2NQB C;  3WTP D;  3KXB B;  5B2J B;  1EQZ A;  3AFA C;  5B1M C;  4YM6 A;  4CAY B;  4QLC C;  3KWQ C;  3AYW C;  3NQJ A;  5CP6 C;  3LEL C;  3AN2 D;  3W96 C;  5B24 C;  3MGQ D;  4LD9 D;  1M19 B;  5GXQ A;  5DNN C;  3O62 C;  3WTP E;  1P3B D;  5CPK D;  1S32 C;  1P3F A;  3AZN C;  2HIO A;  5B0Z A;  1HQ3 A;  1P34 D;  5B40 C;  1P3O D;  1M1A A;  5AV8 C;  5GSU C;  4R8P B;  3WA9 B;  3AV1 A;  3AV2 B;  1M18 C;  4XUJ C;  1P3L A;  5AY8 A;  2F8N D;  5B33 C;  3UT9 B;  4J8X C;  4NE5 A;  1F1E A;  5E5A D;  5GT0 B;  5CHL B;  3X1T C;  2F8N G;  3KXB C;  4Z5T D;  1F66 A;  5B32 D;  3LJA D;  3X1V C;  5AV9 B;  4YM6 B;  1TZY B;  5BT1 C;  3C1B A;  3AZJ D;  3X1S D;  3REL D;  5B32 G;  4WU9 D;  3MNN A;  3NQJ B;  3A6N B;  5CPJ A;  1M19 C;  3W98 D;  3V9R A;  4Z2M H;  3X1U A;  3AZM D;  1B67 A;  3REK A;  1P3F B;  2YFV A;  3R45 B;  5B0Z B;  1HQ3 B;  5FUG B;  4R8P C;  4XZQ D;  1KX5 D;  1AOI C;  3VH5 T;  1P3M A;  3B6G B;  3W97 A;  4WV4 B;  4KUD D;  4E44 A;  1P3L B;  2CWE A;  2JSS A;  4J8V B;  4H9P A;  5GT3 D;  5AVB A;  1P3K B;  3REI A;  4H9Q A;  3WKJ C;  4J8W D;  3B0C T;  5B0Y D;  3LZ0 A;  3C1C B;  3AZK B;  5B1L C;  1BH9 B;  3MGP A;  1F66 B;  1EQZ C;  4G91 B;  4YM6 C;  2FJ7 A;  4KGC D;  4Z66 A;  3WAA D;  3A6N C;  3C1B B;  2CV5 A;  5AV6 A;  3B0B A;  3W99 B;  5CPJ B;  3MNN B;  5GXQ C;  5B2I D;  3AZH A;  2IO5 B;  3X1U B;  1P3F C;  2HIO C;  1U35 A;  5B31 B;  5B0Z C;  1HQ3 C;  4JJN A;  3AZI A;  1M1A C;  3B6G C;  4YS3 B;  3AV1 C;  5C3I B;  4X23 A;  3REJ D;  4WU8 A;  1P3L C;  3W97 B;  1TAF A;  5AY8 C;  3MGS B;  3UTB A;  1P3A D;  4H9P B;  4ZUX B;  3REI B;  2LY8 A;  1ZLA D;  2HUE C;  2PYO D;  5B1M B;  5BNV A;  1F66 C;  3LZ1 B;  3REH D;  4G91 C;  5DNM D;  3AN2 A;  1P3I D;  3MGQ A;  3KUY D;  3LEL B;  1ID3 D;  3VH5 W;  1P3B A;  3C1B C;  5B24 B;  5CPK A;  2FJ7 B;  4H9S C;  3W96 B;  3W99 C;  5DNN B;  4Z66 B;  3MNN C;  5JRG D;  3O62 B;  5CPJ C;  2CV5 B;  1P34 A;  5AV6 B;  1P3O A;  2NZD B;  2IO5 C;  5JA4 A;  3X1U C;  1P3G D;  3MGR A;  5B40 B;  5GSU B;  2F8N A;  3B0C W;  1P3P D;  4H9O B;  1U35 B;  4XUJ B;  5C3I C;  5BS7 C;  3W97 C;  4X23 B;  5E5A A;  3UTA D;  1TAF B;  1KX3 D;  3UTB B;  4Z5T A;  3KWQ D;  5B32 A;  4ZUX C;  5CP6 D;  3LJA A;  3REI C;  3AZF D;  3KSY A;  4ZBJ C;  3TU4 D;  3X1V B;  2YFW B;  1BFM A;  3AZJ A;  3LZ1 C;  3X1S A;  5KDM A;  3MGP C;  3AZN D;  5BNV B;  3MVD D;  4WU9 A;  3W98 A;  3AN2 B;  5AV8 D;  1KU5 A;  5BO0 B;  4WU8 D;  2FJ7 C;  3AZM A;  1M18 D;  4Z66 C;  2CV5 C;  4KHA B;  3B6F D;  5AVC D;  2NZD C;  5AV6 C;  5B33 D;  1P34 B;  2ARO A;  4XZQ A;  3AZH C;  1P3O B;  1KX5 A;  1Q9C A;  5JA4 B;  4KUD A;  3MGR B;  1AOI B;  5AV5 D;  3X1T D;  1U35 C;  4JJN C;  3AZI C;  5B2J D;  3VH5 A;  5GT3 A;  2RVQ C;  4X23 C;  3AZE B;  4J8W A;  5B0Y A;  3UTB C;  3WKJ B;  4DRA A;  3NQU B;  5B32 B;  5B1L B;  1M19 D;  1EQZ B;  3WAA A;  3X1S B;  5KDM B;  3AN2 C;  4R8P D;  4WU9 B;  3MGQ C;  3WA9 D;  3AV2 D;  1P3B C;  4WZS B;  4NE3 A;  5GXQ B;  3UT9 D;  1P34 C;  3VH6 T;  1P3O C;  2HIO B;  2ARO B;  4XZQ B;  1ULY A;  3MGR C;  3REJ A;  5GT0 D;  1M1A B;  3AV1 B;  1P3A A;  4NE6 A;  3AZE C;  5AY8 B;  5AV9 D;  1ZLA A;  4J8U A;  5E5A C;  2PYO A;  1TZY D;  5B0Y B;  4Z5T C;  2HUE B;  5B32 C;  3A6N D;  3REH A;  5DNM A;  1P3I A;  3AZG D;  3KUY A;  4EO5 B;  1ID3 A;  2L5A A;  5F99 D;  3X1S C;  4G92 C;  5B0Z D;  4WU9 C;  5JRG A;  3WAA B;  3B6G D;  1P3G A;  3V9R B;  4J8V D;  4H9R A;  3AZL D;  1P3P A;  1P3K D;  4Z2M G;  2ARO C;  4XZQ C;  3REK B;  1KX5 C;  4H9N A;  2YFV B;  3C1C D;  3AZK D;  1P3M B;  3UTA A;  1KX3 A;  5GT3 C;  3KWQ A;  3WTP A;  3AZF A;  4J8W C;  5AVB B;  5B0Y C;  1ZLA B;  3TU4 A;  4J8U B;  5CPI D;  2PYO B;  4H9Q B;  2F8N K;  4ZBJ B;  3LZ0 B;  3W99 D;  3MVD A;  3REH B;  5AV8 A;  3VH6 W;  3MGP B; 
#chains in the Genus database with same CATH topology
 1HTA A;  3A1I A;  1M18 A;  4LD9 A;  2Y2K A;  5B31 D;  3EPK A;  2BG1 A;  3WAA C;  1ID3 B;  3B6F A;  5AVC A;  1KX4 D;  5B33 A;  3P5J B;  4YS3 D;  5JRG B;  2BYK A;  3W97 D;  3MGS D;  3AZH B;  5AV5 A;  3X1T A;  5B2J A;  3REK C;  4DRB A;  4ZUX D;  2NQB D;  4JJN B;  3REJ C;  3AZI B;  1P3M C;  3AFA D;  5B1M D;  1P3A C;  3UTA B;  3LZ1 D;  1KX3 B;  4AWL B;  4QLC D;  5AVB C;  3AYW D;  1ZLA C;  4J8U C;  3WTP B;  3LEL D;  2PYO C;  1H3O A;  4NFT A;  3AZF B;  3W96 D;  5B24 D;  3TU4 B;  3LZ0 C;  5DNN D;  3O62 D;  2NZD D;  3REH C;  1S32 D;  5DNM C;  3REL A;  1P3I C;  4R8P A;  3MVD B;  3WA9 A;  5B40 D;  2VQR A;  3KUY C;  3AV2 A;  4WNN B;  1ID3 C;  5BNX A;  1N1J A;  5GSU D;  3MGQ B;  4LD9 B;  3UT9 A;  4XUJ D;  5JRG C;  3B0D B;  3B6F B;  5AVC B;  1P3B B;  5CPK B;  4UPK A;  4WJ3 C;  2F8N H;  2BYK B;  4J8X D;  1P3G C;  5GT0 A;  3VH6 A;  3UTB D;  1P3P C;  3KXB D;  2F8N B;  5AV9 A;  2J8P A;  2ZM5 A;  3X1V D;  1TZY A;  3UTA C;  1KX3 C;  4AWL C;  5E5A B;  3A6N A;  5BT1 D;  3WTP C;  3AZF C;  4Z5T B;  4M6B A;  3AZG A;  2Y2L A;  3LJA B;  3TU4 C;  1H3O B;  5F99 A;  4KGC A;  3R45 A;  3MVD C;  5FUG A;  4E45 A;  3AZJ B;  2Y2H A;  1JFI A;  3REL B;  4G92 B;  4WU8 C;  3B6G A;  3MGR D;  3W98 B;  4LD9 C;  1AOI D;  5B2I A;  5BNX B;  1N1J B;  4J8V A;  3B0D C;  3B6F C;  5AVC C;  3AZL A;  1W2E A;  3AZM B;  5CPK C;  1P3K A;  3AZE D;  3C1C A;  3AZK A;  1KX5 B;  5AV5 C;  3WKJ D;  1BH9 A;  5B2J C;  4KUD B;  5B1L D;  5GT3 B;  3H0L C;  1EQZ D;  1BH8 A;  5CPI A;  4YM6 D;  4J8W B;  4H9S A;  3W99 A;  3LJA C;  2Y2P A;  3AZG B;  2FFF B;  1R4V A;  5GXQ D;  5B31 A;  5F99 B;  4KGC B;  3AZJ C;  1KX4 A;  3REL C;  1P3F D;  2HIO D;  4YS3 A;  2ARO D;  3WA9 C;  1HQ3 D;  1JFI B;  5BS7 A;  3AV2 C;  3A1K A;  3W98 C;  1M1A D;  3MGS A;  3AV1 D;  2Y2I A;  4CSR A;  3AZM C;  5B2I B;  3UT9 C;  1P3L D;  5AY8 D;  3AZL B;  4ZUX A;  2NQB A;  2JCH A;  5GT0 C;  3AFA A;  5B1M A;  4UUZ A;  3REJ B;  4KUD C;  3LZ1 A;  3H0R C;  1WWI A;  5AV9 C;  1WWS A;  4QLC A;  1F66 D;  1P3A B;  1A7W A;  3AYW A;  2ZY4 A;  5CP6 A;  3LEL A;  2F2A C;  1TZY C;  3W96 A;  5B24 A;  1BH8 B;  5CPI B;  5DNN A;  3O62 A;  2NZD A;  3C1B D;  2BYM A;  1S32 A;  3AZN A;  5CPJ D;  3MNN D;  3AZG C;  5B40 A;  5DNM B;  1P3I B;  5GSU A;  5F99 C;  4KGC C;  3X1U D;  4H9O A;  3KUY B;  1T3U A;  4XUJ A;  4HGA B;  3REK D;  1KX4 B;  4J8X A;  5G49 A;  5B2I C;  1P3M D;  4J8V C;  3AZL C;  4CSR B;  1P3G B;  1P3K C;  5B31 G;  2G5H C;  3KXB A;  4H9R B;  1P3P B;  5AVB D;  2NQB B;  3REI D;  3C1C C;  4J8U D;  3X1V A;  2YFW A;  2ZY2 A;  1B6W A;  2ZY3 A;  4H9N B;  3AZK C;  3H0M C;  4CAY A;  3LZ0 D;  3AFA B;  4UUZ B;  3EPH A;  5BO0 A;  3MGP D;  4QLC B;  3KWQ B;  3AYW B;  5CP6 B;  1M19 A;  5CPI C;  4KHA A;  2FJ7 D;  1PZR A;  4Z66 D;  2CV5 D;  2BYM B;  1S32 B;  5AV6 D;  3AZN B;  4WNN A;  3AZH D;  1AOI A;  4EO5 C;  5AV8 B;  5B31 C;  4HGA C;  4WU8 B;  1KX4 C;  1M18 B;  4YS3 C;  1U35 D;  4JJN D;  3AZE A;  3AZI D;  5B33 B;  2Y2G A;  3MGS C;  2RVQ D;  4J8X B;  5G49 B;  4X23 D;  3WKJ A;  3NQU A;  5B1L A;  5AV5 B;  3X1T B;  2NQB C;  3WTP D;  3KXB B;  5B2J B;  1EQZ A;  3AFA C;  5B1M C;  4YM6 A;  4CAY B;  3EPJ A;  3AL0 C;  2ZY5 A;  4QLC C;  3KWQ C;  3AYW C;  3NQJ A;  5CP6 C;  3EG5 B;  3LEL C;  3AN2 D;  3W96 C;  5B24 C;  3MGQ D;  4LD9 D;  1M19 B;  5GXQ A;  5DNN C;  3O62 C;  3WTP E;  1P3B D;  5CPK D;  1S32 C;  1P3F A;  3AZN C;  2HIO A;  5B0Z A;  1HQ3 A;  1P34 D;  5B40 C;  1P3O D;  1M1A A;  5AV8 C;  5GSU C;  4R8P B;  3WA9 B;  3AV1 A;  3AV2 B;  1M18 C;  4XUJ C;  1P3L A;  5AY8 A;  2F8N D;  5B33 C;  3UT9 B;  4J8X C;  4NE5 A;  1F1E A;  5E5A D;  2XD5 A;  5GT0 B;  5CHL B;  3X1T C;  2F8N G;  3KXB C;  4Z5T D;  1F66 A;  5B32 D;  3LJA D;  3X1V C;  5AV9 B;  4YM6 B;  1TZY B;  5BT1 C;  3C1B A;  3AZJ D;  3X1S D;  3REL D;  5B32 G;  4WU9 D;  3MNN A;  3NQJ B;  3A6N B;  5CPJ A;  2Y2Q A;  1M19 C;  3V9R A;  3W98 D;  4Z2M H;  2JE5 A;  1Z2C B;  3X1U A;  3AZM D;  2DQN C;  1B67 A;  3REK A;  1P3F B;  2YFV A;  3R45 B;  5B0Z B;  1HQ3 B;  5FUG B;  4R8P C;  4XZQ D;  1KX5 D;  2RIQ A;  3VH5 T;  1P3M A;  1AOI C;  3B6G B;  3W97 A;  4WV4 B;  4KUD D;  4E44 A;  1P3L B;  2CWE A;  2JSS A;  4J8V B;  2XD1 A;  4H9P A;  5GT3 D;  5AVB A;  1P3K B;  3REI A;  4H9Q A;  3IP4 C;  4J8W D;  3WKJ C;  3B0C T;  5B0Y D;  3LZ0 A;  3C1C B;  3AZK B;  5B1L C;  2DF4 C;  2UWX A;  1BH9 B;  3MGP A;  1F66 B;  1EQZ C;  4G91 B;  4YM6 C;  2FJ7 A;  4KGC D;  4DQY B;  4Z66 A;  3WAA D;  3A6N C;  3C1B B;  2CV5 A;  5AV6 A;  3B0B A;  3W99 B;  5CPJ B;  3MNN B;  5GXQ C;  5B2I D;  3AZH A;  2IO5 B;  3X1U B;  1P3F C;  2HIO C;  1U35 A;  5B31 B;  5B0Z C;  1HQ3 C;  4JJN A;  3AZI A;  1M1A C;  3B6G C;  4YS3 B;  3AV1 C;  5C3I B;  4X23 A;  3REJ D;  4WU8 A;  1P3L C;  3W97 B;  1TAF A;  5AY8 C;  3MGS B;  3UTB A;  1P3A D;  4H9P B;  4ZUX B;  3REI B;  2LY8 A;  1ZLA D;  2HUE C;  2PYO D;  5B1M B;  5BNV A;  1F66 C;  3LZ1 B;  3REH D;  4G91 C;  5DNM D;  3AN2 A;  1P3I D;  3MGQ A;  3KUY D;  3LEL B;  1ID3 D;  3VH5 W;  1P3B A;  3C1B C;  5B24 B;  5CPK A;  2FJ7 B;  4H9S C;  3W96 B;  5DNN B;  3W99 C;  4Z66 B;  3MNN C;  5JRG D;  3O62 B;  5CPJ C;  2CV5 B;  1P34 A;  5AV6 B;  1P3O A;  2NZD B;  2IO5 C;  5JA4 A;  3X1U C;  1P3G D;  2W8S A;  5B40 B;  3MGR A;  5GSU B;  2F8N A;  3B0C W;  1P3P D;  4H9O B;  1U35 B;  4XUJ B;  5C3I C;  5BS7 C;  3F6T A;  3W97 C;  4X23 B;  5E5A A;  3UTA D;  1TAF B;  1KX3 D;  3UTB B;  4Z5T A;  3KWQ D;  5B32 A;  4ZUX C;  5CP6 D;  3LJA A;  3REI C;  3AZF D;  3KSY A;  4ZBJ C;  3TU4 D;  3X1V B;  2YFW B;  1BFM A;  3AZJ A;  3LZ1 C;  3X1S A;  5KDM A;  3MGP C;  3AZN D;  5BNV B;  3MVD D;  4WU9 A;  3W98 A;  2Y2O A;  3AN2 B;  5AV8 D;  1KU5 A;  5BO0 B;  4WU8 D;  2FJ7 C;  3AZM A;  1M18 D;  4Z66 C;  2CV5 C;  4KHA B;  3B6F D;  5AVC D;  2NZD C;  5AV6 C;  5B33 D;  1P34 B;  2ARO A;  4XZQ A;  3AZH C;  1P3O B;  1KX5 A;  1Q9C A;  5JA4 B;  4KUD A;  3MGR B;  1AOI B;  5AV5 D;  3X1T D;  1U35 C;  4JJN C;  3AZI C;  5B2J D;  3VH5 A;  5GT3 A;  2RVQ C;  4X23 C;  3AZE B;  4J8W A;  5B0Y A;  3UTB C;  3WKJ B;  4DRA A;  3NQU B;  5B32 B;  5B1L B;  1M19 D;  1EQZ B;  3WAA A;  3X1S B;  5KDM B;  3AN2 C;  3EPL A;  4R8P D;  4WU9 B;  3MGQ C;  3WA9 D;  3AV2 D;  3KFU G;  1P3B C;  4WZS B;  4NE3 A;  5GXQ B;  3UT9 D;  1P34 C;  3VH6 T;  1P3O C;  2HIO B;  2ARO B;  4XZQ B;  1ULY A;  3MGR C;  3REJ A;  5GT0 D;  1M1A B;  3AV1 B;  1P3A A;  4NE6 A;  3AZE C;  5AY8 B;  5AV9 D;  1ZLA A;  3FDD A;  4J8U A;  5E5A C;  2PYO A;  1TZY D;  5B0Y B;  4Z5T C;  2HUE B;  5B32 C;  3A6N D;  3REH A;  5DNM A;  1P3I A;  3AZG D;  3KUY A;  2Y2N A;  4EO5 B;  1ID3 A;  2L5A A;  5F99 D;  3X1S C;  4G92 C;  5B0Z D;  4WU9 C;  5JRG A;  3WAA B;  3B6G D;  1P3G A;  3V9R B;  4J8V D;  2G5I C;  4H9R A;  3AZL D;  1P3P A;  1P3K D;  4Z2M G;  2ARO C;  4XZQ C;  3REK B;  1KX5 C;  4H9N A;  2YFV B;  3C1C D;  2Y2M A;  3AZK D;  1P3M B;  3UTA A;  1KX3 A;  5GT3 C;  3KWQ A;  2Y2J A;  3WTP A;  3AZF A;  4J8W C;  5AVB B;  5B0Y C;  1ZLA B;  3TU4 A;  4J8U B;  5CPI D;  2PYO B;  4H9Q B;  2F8N K;  4ZBJ B;  3LZ0 B;  3W99 D;  3MVD A;  3REH B;  5AV8 A;  3VH6 W;  3MGP B; 
#chains in the Genus database with same CATH homology
 1HTA A;  3A1I A;  1M18 A;  4LD9 A;  2Y2K A;  5B31 D;  3EPK A;  2BG1 A;  3WAA C;  1ID3 B;  3B6F A;  5AVC A;  1KX4 D;  5B33 A;  3P5J B;  4YS3 D;  5JRG B;  2BYK A;  3W97 D;  3MGS D;  3AZH B;  5AV5 A;  3X1T A;  5B2J A;  3REK C;  4DRB A;  4ZUX D;  2NQB D;  4JJN B;  3REJ C;  3AZI B;  1P3M C;  3AFA D;  5B1M D;  1P3A C;  3UTA B;  3LZ1 D;  1KX3 B;  4AWL B;  4QLC D;  5AVB C;  3AYW D;  1ZLA C;  4J8U C;  3WTP B;  3LEL D;  2PYO C;  1H3O A;  4NFT A;  3AZF B;  3W96 D;  5B24 D;  3TU4 B;  3LZ0 C;  5DNN D;  3O62 D;  2NZD D;  3REH C;  1S32 D;  5DNM C;  3REL A;  1P3I C;  4R8P A;  3MVD B;  3WA9 A;  5B40 D;  2VQR A;  3KUY C;  3AV2 A;  4WNN B;  1ID3 C;  5BNX A;  1N1J A;  5GSU D;  3MGQ B;  4LD9 B;  3UT9 A;  4XUJ D;  5JRG C;  3B0D B;  3B6F B;  5AVC B;  1P3B B;  5CPK B;  4UPK A;  4WJ3 C;  2F8N H;  2BYK B;  4J8X D;  1P3G C;  5GT0 A;  3VH6 A;  3UTB D;  1P3P C;  3KXB D;  2F8N B;  5AV9 A;  2J8P A;  2ZM5 A;  3X1V D;  1TZY A;  3UTA C;  1KX3 C;  4AWL C;  5E5A B;  3A6N A;  5BT1 D;  3WTP C;  3AZF C;  4Z5T B;  4M6B A;  3AZG A;  2Y2L A;  3LJA B;  3TU4 C;  1H3O B;  5F99 A;  4KGC A;  3R45 A;  3MVD C;  5FUG A;  4E45 A;  3AZJ B;  2Y2H A;  1JFI A;  3REL B;  4G92 B;  4WU8 C;  3B6G A;  3MGR D;  3W98 B;  4LD9 C;  1AOI D;  5B2I A;  5BNX B;  1N1J B;  4J8V A;  3B0D C;  3B6F C;  5AVC C;  3AZL A;  1W2E A;  3AZM B;  5CPK C;  1P3K A;  3AZE D;  3C1C A;  3AZK A;  1KX5 B;  5AV5 C;  3WKJ D;  1BH9 A;  5B2J C;  4KUD B;  5B1L D;  5GT3 B;  3H0L C;  1EQZ D;  1BH8 A;  5CPI A;  4YM6 D;  4J8W B;  4H9S A;  3W99 A;  3LJA C;  2Y2P A;  3AZG B;  2FFF B;  1R4V A;  5GXQ D;  5B31 A;  5F99 B;  4KGC B;  3AZJ C;  1KX4 A;  3REL C;  1P3F D;  2HIO D;  4YS3 A;  2ARO D;  3WA9 C;  1HQ3 D;  1JFI B;  5BS7 A;  3AV2 C;  3A1K A;  3W98 C;  1M1A D;  3MGS A;  3AV1 D;  2Y2I A;  4CSR A;  3AZM C;  5B2I B;  3UT9 C;  1P3L D;  5AY8 D;  3AZL B;  4ZUX A;  2NQB A;  2JCH A;  5GT0 C;  3AFA A;  5B1M A;  4UUZ A;  3REJ B;  4KUD C;  3LZ1 A;  3H0R C;  1WWI A;  5AV9 C;  1WWS A;  4QLC A;  1F66 D;  1P3A B;  1A7W A;  3AYW A;  2ZY4 A;  5CP6 A;  3LEL A;  2F2A C;  1TZY C;  3W96 A;  5B24 A;  1BH8 B;  5CPI B;  5DNN A;  3O62 A;  2NZD A;  3C1B D;  2BYM A;  1S32 A;  3AZN A;  5CPJ D;  3MNN D;  3AZG C;  5B40 A;  5DNM B;  1P3I B;  5GSU A;  5F99 C;  4KGC C;  3X1U D;  4H9O A;  3KUY B;  1T3U A;  4XUJ A;  4HGA B;  3REK D;  1KX4 B;  4J8X A;  5G49 A;  5B2I C;  1P3M D;  4J8V C;  3AZL C;  4CSR B;  1P3G B;  1P3K C;  5B31 G;  2G5H C;  3KXB A;  4H9R B;  1P3P B;  5AVB D;  2NQB B;  3REI D;  3C1C C;  4J8U D;  3X1V A;  2YFW A;  2ZY2 A;  1B6W A;  2ZY3 A;  4H9N B;  3AZK C;  3H0M C;  4CAY A;  3LZ0 D;  3AFA B;  4UUZ B;  3EPH A;  5BO0 A;  3MGP D;  4QLC B;  3KWQ B;  3AYW B;  5CP6 B;  1M19 A;  5CPI C;  4KHA A;  2FJ7 D;  1PZR A;  4Z66 D;  2CV5 D;  2BYM B;  1S32 B;  5AV6 D;  3AZN B;  4WNN A;  3AZH D;  1AOI A;  4EO5 C;  5AV8 B;  5B31 C;  4HGA C;  4WU8 B;  1KX4 C;  1M18 B;  4YS3 C;  1U35 D;  4JJN D;  3AZE A;  3AZI D;  5B33 B;  2Y2G A;  3MGS C;  2RVQ D;  4J8X B;  5G49 B;  4X23 D;  3WKJ A;  3NQU A;  5B1L A;  5AV5 B;  3X1T B;  2NQB C;  3WTP D;  3KXB B;  5B2J B;  1EQZ A;  3AFA C;  5B1M C;  4YM6 A;  4CAY B;  3EPJ A;  3AL0 C;  2ZY5 A;  4QLC C;  3KWQ C;  3AYW C;  3NQJ A;  5CP6 C;  3EG5 B;  3LEL C;  3AN2 D;  3W96 C;  5B24 C;  3MGQ D;  4LD9 D;  1M19 B;  5GXQ A;  5DNN C;  3O62 C;  3WTP E;  1P3B D;  5CPK D;  1S32 C;  1P3F A;  3AZN C;  2HIO A;  5B0Z A;  1HQ3 A;  1P34 D;  5B40 C;  1P3O D;  1M1A A;  5AV8 C;  5GSU C;  4R8P B;  3WA9 B;  3AV1 A;  3AV2 B;  1M18 C;  4XUJ C;  1P3L A;  5AY8 A;  2F8N D;  5B33 C;  3UT9 B;  4J8X C;  4NE5 A;  1F1E A;  5E5A D;  2XD5 A;  5GT0 B;  5CHL B;  3X1T C;  2F8N G;  3KXB C;  4Z5T D;  1F66 A;  5B32 D;  3LJA D;  3X1V C;  5AV9 B;  4YM6 B;  1TZY B;  5BT1 C;  3C1B A;  3AZJ D;  3X1S D;  3REL D;  5B32 G;  4WU9 D;  3MNN A;  3NQJ B;  3A6N B;  5CPJ A;  2Y2Q A;  1M19 C;  3V9R A;  3W98 D;  4Z2M H;  2JE5 A;  1Z2C B;  3X1U A;  3AZM D;  2DQN C;  1B67 A;  3REK A;  1P3F B;  2YFV A;  3R45 B;  5B0Z B;  1HQ3 B;  5FUG B;  4R8P C;  4XZQ D;  1KX5 D;  2RIQ A;  3VH5 T;  1P3M A;  1AOI C;  3B6G B;  3W97 A;  4WV4 B;  4KUD D;  4E44 A;  1P3L B;  2CWE A;  2JSS A;  4J8V B;  2XD1 A;  4H9P A;  5GT3 D;  5AVB A;  1P3K B;  3REI A;  4H9Q A;  3IP4 C;  4J8W D;  3WKJ C;  3B0C T;  5B0Y D;  3LZ0 A;  3C1C B;  3AZK B;  5B1L C;  2DF4 C;  2UWX A;  1BH9 B;  3MGP A;  1F66 B;  1EQZ C;  4G91 B;  4YM6 C;  2FJ7 A;  4KGC D;  4DQY B;  4Z66 A;  3WAA D;  3A6N C;  3C1B B;  2CV5 A;  5AV6 A;  3B0B A;  3W99 B;  5CPJ B;  3MNN B;  5GXQ C;  5B2I D;  3AZH A;  2IO5 B;  3X1U B;  1P3F C;  2HIO C;  1U35 A;  5B31 B;  5B0Z C;  1HQ3 C;  4JJN A;  3AZI A;  1M1A C;  3B6G C;  4YS3 B;  3AV1 C;  5C3I B;  4X23 A;  3REJ D;  4WU8 A;  1P3L C;  3W97 B;  1TAF A;  5AY8 C;  3MGS B;  3UTB A;  1P3A D;  4H9P B;  4ZUX B;  3REI B;  2LY8 A;  1ZLA D;  2HUE C;  2PYO D;  5B1M B;  5BNV A;  1F66 C;  3LZ1 B;  3REH D;  4G91 C;  5DNM D;  3AN2 A;  1P3I D;  3MGQ A;  3KUY D;  3LEL B;  1ID3 D;  3VH5 W;  1P3B A;  3C1B C;  5B24 B;  5CPK A;  2FJ7 B;  4H9S C;  3W96 B;  5DNN B;  3W99 C;  4Z66 B;  3MNN C;  5JRG D;  3O62 B;  5CPJ C;  2CV5 B;  1P34 A;  5AV6 B;  1P3O A;  2NZD B;  2IO5 C;  5JA4 A;  3X1U C;  1P3G D;  2W8S A;  5B40 B;  3MGR A;  5GSU B;  2F8N A;  3B0C W;  1P3P D;  4H9O B;  1U35 B;  4XUJ B;  5C3I C;  5BS7 C;  3F6T A;  3W97 C;  4X23 B;  5E5A A;  3UTA D;  1TAF B;  1KX3 D;  3UTB B;  4Z5T A;  3KWQ D;  5B32 A;  4ZUX C;  5CP6 D;  3LJA A;  3REI C;  3AZF D;  3KSY A;  4ZBJ C;  3TU4 D;  3X1V B;  2YFW B;  1BFM A;  3AZJ A;  3LZ1 C;  3X1S A;  5KDM A;  3MGP C;  3AZN D;  5BNV B;  3MVD D;  4WU9 A;  3W98 A;  2Y2O A;  3AN2 B;  5AV8 D;  1KU5 A;  5BO0 B;  4WU8 D;  2FJ7 C;  3AZM A;  1M18 D;  4Z66 C;  2CV5 C;  4KHA B;  3B6F D;  5AVC D;  2NZD C;  5AV6 C;  5B33 D;  1P34 B;  2ARO A;  4XZQ A;  3AZH C;  1P3O B;  1KX5 A;  1Q9C A;  5JA4 B;  4KUD A;  3MGR B;  1AOI B;  5AV5 D;  3X1T D;  1U35 C;  4JJN C;  3AZI C;  5B2J D;  3VH5 A;  5GT3 A;  2RVQ C;  4X23 C;  3AZE B;  4J8W A;  5B0Y A;  3UTB C;  3WKJ B;  4DRA A;  3NQU B;  5B32 B;  5B1L B;  1M19 D;  1EQZ B;  3WAA A;  3X1S B;  5KDM B;  3AN2 C;  3EPL A;  4R8P D;  4WU9 B;  3MGQ C;  3WA9 D;  3AV2 D;  3KFU G;  1P3B C;  4WZS B;  4NE3 A;  5GXQ B;  3UT9 D;  1P34 C;  3VH6 T;  1P3O C;  2HIO B;  2ARO B;  4XZQ B;  1ULY A;  3MGR C;  3REJ A;  5GT0 D;  1M1A B;  3AV1 B;  1P3A A;  4NE6 A;  3AZE C;  5AY8 B;  5AV9 D;  1ZLA A;  3FDD A;  4J8U A;  5E5A C;  2PYO A;  1TZY D;  5B0Y B;  4Z5T C;  2HUE B;  5B32 C;  3A6N D;  3REH A;  5DNM A;  1P3I A;  3AZG D;  3KUY A;  2Y2N A;  4EO5 B;  1ID3 A;  2L5A A;  5F99 D;  3X1S C;  4G92 C;  5B0Z D;  4WU9 C;  5JRG A;  3WAA B;  3B6G D;  1P3G A;  3V9R B;  4J8V D;  2G5I C;  4H9R A;  3AZL D;  1P3P A;  1P3K D;  4Z2M G;  2ARO C;  4XZQ C;  3REK B;  1KX5 C;  4H9N A;  2YFV B;  3C1C D;  2Y2M A;  3AZK D;  1P3M B;  3UTA A;  1KX3 A;  5GT3 C;  3KWQ A;  2Y2J A;  3WTP A;  3AZF A;  4J8W C;  5AVB B;  5B0Y C;  1ZLA B;  3TU4 A;  4J8U B;  5CPI D;  2PYO B;  4H9Q B;  2F8N K;  4ZBJ B;  3LZ0 B;  3W99 D;  3MVD A;  3REH B;  5AV8 A;  3VH6 W;  3MGP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...