3NQUB

Crystal structure of partially trypsinized (cenp-a/h4)2 heterotetramer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
67
structure length
67
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3-like centromeric protein A
publication title The structure of (CENP-A-H4)(2) reveals physical features that mark centromeres.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3nquB00
1P3BA 2FJ7D 3AZMD 3W99D 4E44A 4WU9C 1P3FB 5B32D 1M1AC 3AZJA 5JA4A 3AV1B 3REJB 2NQBC 1HQ3D 4WU8A 1U35C 5GT3B 5AV9B 5B0ZD 3WTPD 1P3FC 4ZUXD 4AWLB 1ID3C 3B0DC 5F99B 5B1LC 3O62D 3LZ1C 1P34B 4UUZB 3B6GA 3LJAB 2HUEC 3AZNB 5BNVB 4ZBJC 4AWLC 2CV5A 3AZGC 3WKJC 5B24B 4KUDD 5E5AA 3LJAC 4LD9A 3AZNC 3AZMA 5CPKB 3W99A 4R8PB 1KX5A 1TZYA 2YFWB 3UT9A 1P3PB 3LZ0A 3KUYA 3AV1D 3REJD 3W98A 5DNNC 3REKC 4G91B 5GT3D 4ZUXA 5AV9D 4QLCA 5AV8B 5F99D 5AVBB 3R45A 1P34D 4H9RA 4M6BA 2LY8A 4YS3B 3AZND 4WU9A 3REHB 3AZKB 1M1AA 5B2IC 1ZLAD 1WWSA 4G91C 5AV8C 2NQBA 4J8UB 5B24D 3NQJB 5BT1C 5GXQC 3AFAC 5CPKD 1P3FA 4R8PD 4J8XC 1ID3A 5B1LA 3LZ1A 4WZSB 1P3PD 3KXBB 5C3IC 3REJA 1P3AB 3MGPB 1AOIC 5GT3A 3MGSD 4KHAB 4WNNB 3C1CC 5AV8D 3AZGA 3KSYA 1P3MC 4UUZA 3V9RB 5KDMA 5AV5C 5AVBD 3LJAA 3WKJA 3AZNA 4CSRB 1P3LB 3AYWC 4YS3D 3MNNB 5BNVA 2AROB 3REHD 3REID 3AZKD 5CPIB 5BNXA 3VH6A 5DNNA 4YM6B 4J8UD 1P3LC 2AROC 5CPIC 3AZIB 1P3PA 2F8NK 3VH6T 3UTBD 4NFTA 5B31D 3KXBD 1P3AD 3MGPD 5B2IA 5AV8A 3AZIC 3X1UB 5DNMD 5GXQA 4X23C 3LELC 1F1EA 3MNND 4J8XA 2AROD 5CPJB 3X1SB 1P3KC 1EQZB 4J8UA 3NQJA 4YM6D 1AOIA 4HGAB 3AN2B 3C1CA 4EO5B 5CPJC 5GT0C 5AV5A 4J8VC 3AYWA 4G92C 4HGAC 4KHAA 3AN2C 3RELB 2FJ7B 3V9RA 5B33D 3X1UD 1P3LA 4CSRA 2AROA 5CPIA 2FJ7C 3AZMC 3W99C 4XZQD 3X1SD 5B32C 5B40B 1EQZD 1HQ3C 3VH5T 3AZIA 3KWQB 3WTPC 5B0ZC 1M19B 3TU4B 1P3OB 4X23A 2BYMB 3O62C 3LELA 3MVDB 2F8NG 1P3KA 3RELD 2HIOB 4H9QB 2CWEA 4KUDC 5CPJA 2F8NH 5GT0A 5B0YB 3WAAB 5AVCD 5B40D 5B1MB 4J8VA 3AV2B 1BH9B 3WTPE 3AV1C 3REJC 3AN2A 4CAYA 3KWQD 1ZLAB 5GT3C 5AV9C 1S32B 5B1MC 1M19D 3TU4D 1P3OD 5F99C 5AV6D 1P34C 2L5AA 3MVDD 1KX4B 2FJ7A 1ZLAC 1N1JB 5B32A 2HIOD 4KGCB 4Z5TB 3X1TD 1F66B 1HQ3A 4JJNB 5B24C 5CPKC 3WTPA 5B0ZA 1B6WA 4R8PC 5B40A 5B0YD 3MGSB 3WAAD 3W96B 5B1MD 3O62A 3AV2D 1P3PC 3REIB 2JSSA 3MGSC 3X1VD 1S32D 2BYMA 1B67A 4H9OA 4KUDA 5AVBC 5AY8B 4J8WB 4YS3C 4NE3A 1KX3B 1KX4D 4H9QA 3REHC 3AZKC 3REIC 3C1BB 3MGQD 4KGCD 4Z5TD 3AV1A 5CP6B 3UTBB 5B31B 1F66D 3NQUB 4NE6A 4J8UC 4JJND 3W97B 5AV9A 3W96D 5B1MA 5F99A 1ULYA 4H9PB 4H9SC 5DNMB 5B31C 3KXBC 3UTBC 1P3AC 1P34A 3MGPC 3W97C 1ZLAA 3UTAB 2RVQD 3AZHB 5B24A 5DNMC 5CPKA 5AY8D 4J8WD 3WA9B 4R8PA 1N1JA 3MNNC 1KX3D 2YFWA 3C1BD 2NZDD 1M18D 5CP6D 1P3ID 5FUGB 1Q9CA 4YM6C 3W97D 3MGSA 3AZLD 2F8NB 5AVBA 5B33B 3B0CT 2BYKB 4YS3A 3REHA 3AZKA 3REIA 3B6FB 3AZFB 4XZQB 3UTAD 3AZHD 5B33C 4KUDB 3X1UC 3WA9D 5G49B 3A6ND 1KU5A 3MGRB 5JRGB 3VH6W 4XZQC 5CP6A 3X1SC 4H9SA 3UTBA 5B31A 3KXBA 1EQZC 3NQUA 1P3AA 3W97A 3MGPA 4NE5A 1H3OB 1P3BB 4WNNA 4EO5C 2F8ND 3AZJB 5DNMA 5JA4B 1P3GD 3MNNA 3AZED 3B6FD 3AZFD 3RELC 3VH5A 5AVCB 4E45A 4YM6A 2YFVB 3MGRD 5JRGD 5AVCC 5FUGA 5B40C 2CV5B 5B2JD 2PYOB 5AV6B 5E5AB 4LD9B 5BS7A 1R4VA 1P3BD 1KX5B 3KWQC 5B33A 4Z66B 3AZJD 3X1UA 1M19C 3TU4C 1P3OC 3LZ0B 3KUYB 3X1TB 2PYOC 5AV6C 2IO5B 3W98B 3MVDC 4Z2MG 4WU8D 4XZQA 3X1SA 2HIOC 1EQZA 4QLCB 1JFIB 3X1TC 3R45B 3VH5W 5G49A 3B6GD 2IO5C 1M1AB 4Z2MH 3WAAC 5B0YC 3X1VB 3AV2C 2CV5D 2NQBB 2PYOD 1HTAA 5E5AD 1H3OA 1U35B 4LD9D 3RELA 1KX5D 1TZYD 3UT9D 3MGQB 3B0DB 3X1VC 1S32C 4Z66D 1ID3B 5B1LB 3LZ1B 2HUEB 3LZ0D 3KUYD 3W98D 1KX4C 4ZBJB 5AVCA 3MGQC 4QLCD 4KGCC 3AZGB 4Z5TC 3WKJB 5KDMB 2YFVA 1F66C 4JJNC 1TAFB 3KWQA 4WU9D 1M1AD 3W96C 1M19A 3TU4A 1P3OA 5BNXB 2PYOA 5AV6A 2NQBD 5DNNB 3MVDA 5GSUB 5B32G 3REKB 1BH8B 1U35D 1WWIA 2HIOA 1P3FD 1BFMA 4Z66A 1ID3D 2NZDB 2RVQC 5B1LD 3LZ1D 3X1TA 1M18B 1P3IB 5GSUC 5AY8C 4J8WC 5B2IB 5B0YA 3WAAA 1KX3C 3C1BC 3AZLB 1JFIA 3AV2A 2NZDC 1BH9A 3AZGD 1M18C 3WKJD 5CP6C 1P3IC 3LJAD 5GXQB 3AFAB 3B0BA 5BO0B 4J8XB 3X1VA 1S32A 3AZLC 5C3IB 1U35A 5DNND 5GSUD 1AOIB 3REKD 4DRBA 1KX4A 3A6NB 3MGQA 3C1CB 4KGCA 4Z5TA 1P3MB 5AV5B 3UTAC 3AZHC 1F66A 4JJNA 3AYWB 3WA9C 3A6NC 5B2ID 3W96A 4XUJB 5GXQD 1TAFA 5BT1D 3AFAD 1P3GB 3AZEB 4XUJC 4J8XD 5CHLB 5BS7C 4H9NB 5GSUA 3REKA 5AY8A 1BH8A 4J8WA 1P3GC 1AOID 1KX3A 3AZEC 3B6FC 3C1BA 3AZFC 3C1CD 2NZDA 1M18A 1P3MD 1P3IA 5AV5D 4X23B 3LELB 3AYWD 5B2JB 4XUJD 3AZLA 3MGRC 1P3KB 5JRGC 3B0CW 4H9PA 3AFAA 1P3LD 5B2JC 5BO0A 5CPID 5GT0B 4WU8B 1P3BC 3UTAA 3AZHA 4J8VB 3AZJC 4G92B 3B6GB 3WA9A 3A6NA 3AZID 5B31G 4WU8C 4CAYB 1P3MA 4X23D 3LELD 3B6GC 4XUJA 3AZMB 3W99B 5B32B 1P3KD 2F8NA 1TZYB 3UT9B 2BYKA 1A7WA 2CV5C 1P3GA 1HQ3B 3AZEA 5E5AC 3B6FA 3AZFA 4LD9C 5CPJD 3WTPB 5B0ZB 5GT0D 4H9NA 1KX5C 1TZYC 4ZUXB 3UT9C 4Z66C 4J8VD 3O62B 4WV4B 3LZ0C 3KUYC 4H9RB 3W98C 3MGRA 3AN2D 5JRGA 4WU9B 4ZUXC 4QLCC 5B2JA 4H9OB 4DRAA
chains in the Genus database with same CATH superfamily
1P3BA 3AL0C 2FJ7D 3AZMD 3W99D 4E44A 4WU9C 1P3FB 5B32D 1M1AC 3AZJA 5JA4A 3AV1B 3REJB 2NQBC 1HQ3D 4WU8A 1U35C 5GT3B 5AV9B 5B0ZD 3WTPD 1P3FC 4ZUXD 4AWLB 1ID3C 3B0DC 5F99B 5B1LC 3O62D 3LZ1C 1P34B 4UUZB 3B6GA 3LJAB 2HUEC 3AZNB 5BNVB 2ZY2A 4ZBJC 4AWLC 2CV5A 3AZGC 3WKJC 5B24B 4KUDD 5E5AA 2JCHA 2Y2KA 3LJAC 4LD9A 3AZNC 3AZMA 5CPKB 3W99A 4R8PB 1KX5A 1TZYA 2YFWB 3UT9A 1P3PB 3LZ0A 3KUYA 3AV1D 3REJD 3W98A 5DNNC 2Y2JA 3REKC 2Y2HA 4G91B 1W2EA 5GT3D 4ZUXA 5AV9D 4QLCA 5AV8B 3H0MC 5F99D 2W8SA 2UWXA 5AVBB 3R45A 1P34D 2ZY3A 4H9RA 4M6BA 2LY8A 4YS3B 3AZND 4WU9A 3REHB 3AZKB 1M1AA 5B2IC 1ZLAD 1WWSA 4G91C 5AV8C 2NQBA 4J8UB 5B24D 3NQJB 5BT1C 5GXQC 3AFAC 5CPKD 4WJ3C 1P3FA 4R8PD 4J8XC 2Y2OA 1ID3A 5B1LA 1PZRA 4WZSB 3LZ1A 1P3PD 3KXBB 5C3IC 3REJA 1P3AB 3MGPB 1AOIC 5GT3A 3MGSD 4KHAB 4WNNB 3C1CC 5AV8D 3EPLA 3AZGA 3KSYA 1P3MC 4UUZA 2Y2QA 5AV5C 3V9RB 5KDMA 5AVBD 3LJAA 3WKJA 3AZNA 4CSRB 1P3LB 3AYWC 2Y2PA 4YS3D 3MNNB 5BNVA 2AROB 3REHD 3REID 3AZKD 5CPIB 5BNXA 2XD1A 3VH6A 5DNNA 4YM6B 4J8UD 1P3LC 1T3UA 2AROC 5CPIC 3AZIB 1P3PA 2F8NK 3VH6T 3UTBD 4NFTA 5B31D 3KXBD 1P3AD 3MGPD 5B2IA 5AV8A 3AZIC 3X1UB 5DNMD 5GXQA 4X23C 3LELC 1F1EA 3MNND 4J8XA 2AROD 5CPJB 3X1SB 1P3KC 1EQZB 4J8UA 3NQJA 4YM6D 1AOIA 4HGAB 3AN2B 3C1CA 4EO5B 5CPJC 5GT0C 5AV5A 4J8VC 3AYWA 4G92C 2Y2GA 4HGAC 4KHAA 3AN2C 3RELB 2FJ7B 3V9RA 5B33D 3X1UD 1P3LA 4CSRA 2AROA 5CPIA 2BG1A 3H0RC 2FJ7C 3AZMC 3W99C 4XZQD 3X1SD 5B32C 5B40B 1EQZD 1Z2CB 1HQ3C 3VH5T 3AZIA 3KWQB 3WTPC 5B0ZC 1M19B 2VQRA 3TU4B 1P3OB 4X23A 2BYMB 3O62C 3LELA 3MVDB 2F8NG 1P3KA 3RELD 2HIOB 4H9QB 2CWEA 3FDDA 2G5IC 4KUDC 5CPJA 2F8NH 5GT0A 5B0YB 3WAAB 2Y2IA 5AVCD 5B40D 5B1MB 4J8VA 3AV2B 4DQYB 1BH9B 3WTPE 3AV1C 3REJC 3AN2A 4CAYA 3KWQD 1ZLAB 5GT3C 5AV9C 1S32B 5B1MC 2DQNC 1M19D 3TU4D 1P3OD 2XD5A 5F99C 5AV6D 1P34C 2L5AA 3MVDD 1KX4B 2FJ7A 1ZLAC 1N1JB 5B32A 2HIOD 4KGCB 4Z5TB 3X1TD 1F66B 1HQ3A 4JJNB 5B24C 5CPKC 3WTPA 5B0ZA 1B6WA 4R8PC 5B40A 5B0YD 3MGSB 3WAAD 3W96B 5B1MD 3O62A 3AV2D 1P3PC 3REIB 2JSSA 3MGSC 3X1VD 1S32D 2BYMA 1B67A 4H9OA 4KUDA 5AVBC 5AY8B 4J8WB 4YS3C 4NE3A 1KX3B 1KX4D 4H9QA 3REHC 3AZKC 3REIC 3C1BB 3MGQD 4KGCD 4Z5TD 3AV1A 5CP6B 3UTBB 5B31B 1F66D 3NQUB 4NE6A 4J8UC 4JJND 3W97B 5AV9A 3W96D 5B1MA 5F99A 1ULYA 4H9PB 4H9SC 5DNMB 5B31C 3KXBC 3UTBC 1P3AC 1P34A 3MGPC 3W97C 1ZLAA 3UTAB 2RVQD 3AZHB 5B24A 5DNMC 5CPKA 5AY8D 4J8WD 3WA9B 4R8PA 1N1JA 3MNNC 1KX3D 2YFWA 3C1BD 2NZDD 2RIQA 1M18D 5CP6D 1P3ID 5FUGB 1Q9CA 4YM6C 3W97D 3MGSA 3EPJA 3AZLD 2F8NB 2DF4C 5AVBA 5B33B 3B0CT 2BYKB 4YS3A 3REHA 3AZKA 3REIA 3B6FB 3AZFB 4XZQB 3UTAD 3AZHD 5B33C 4KUDB 3X1UC 3WA9D 5G49B 3A6ND 1KU5A 3MGRB 5JRGB 3VH6W 4XZQC 5CP6A 3X1SC 4H9SA 3UTBA 5B31A 3KXBA 1EQZC 3NQUA 1P3AA 3W97A 3MGPA 2FFFB 4UPKA 4NE5A 1H3OB 1P3BB 4WNNA 4EO5C 2F8ND 3AZJB 5DNMA 5JA4B 1P3GD 3MNNA 3AZED 3B6FD 3AZFD 3RELC 3VH5A 5AVCB 4E45A 4YM6A 2ZM5A 2YFVB 3KFUG 3MGRD 5JRGD 5AVCC 5FUGA 5B40C 2CV5B 5B2JD 2PYOB 5AV6B 5E5AB 4LD9B 5BS7A 1R4VA 2Y2NA 1P3BD 1KX5B 3KWQC 5B33A 4Z66B 3AZJD 3X1UA 1M19C 3TU4C 1P3OC 3LZ0B 3KUYB 3X1TB 2PYOC 5AV6C 2IO5B 3W98B 3MVDC 3EG5B 4Z2MG 4WU8D 4XZQA 3EPHA 3X1SA 2HIOC 1EQZA 4QLCB 1JFIB 3X1TC 3R45B 3VH5W 5G49A 3B6GD 2IO5C 1M1AB 4Z2MH 3WAAC 5B0YC 3X1VB 3AV2C 2CV5D 2NQBB 2PYOD 1HTAA 5E5AD 1H3OA 1U35B 4LD9D 3RELA 1KX5D 1TZYD 3UT9D 3MGQB 3B0DB 3X1VC 1S32C 4Z66D 1ID3B 5B1LB 3LZ1B 2HUEB 3LZ0D 3KUYD 3W98D 1KX4C 4ZBJB 5AVCA 3MGQC 4QLCD 4KGCC 3AZGB 4Z5TC 3WKJB 5KDMB 2YFVA 1F66C 4JJNC 1TAFB 3KWQA 4WU9D 1M1AD 3W96C 1M19A 3TU4A 1P3OA 5BNXB 2PYOA 5AV6A 2NQBD 5DNNB 3MVDA 5GSUB 5B32G 2Y2LA 3REKB 3F6TA 1BH8B 1U35D 1WWIA 2HIOA 1P3FD 1BFMA 4Z66A 1ID3D 2NZDB 2RVQC 5B1LD 3LZ1D 3X1TA 1M18B 1P3IB 5GSUC 5AY8C 4J8WC 5B2IB 5B0YA 3WAAA 1KX3C 2JE5A 3C1BC 3AZLB 1JFIA 3AV2A 2NZDC 1BH9A 3AZGD 1M18C 3WKJD 5CP6C 2F2AC 3LJAD 1P3IC 5GXQB 3AFAB 3B0BA 5BO0B 4J8XB 3X1VA 1S32A 3AZLC 5C3IB 1U35A 5DNND 3IP4C 5GSUD 1AOIB 3REKD 4DRBA 1KX4A 3A6NB 3MGQA 3C1CB 4KGCA 3A1KA 4Z5TA 1P3MB 5AV5B 3UTAC 3AZHC 1F66A 4JJNA 3AYWB 3WA9C 3A6NC 5B2ID 3W96A 4XUJB 5BT1D 1TAFA 5GXQD 3AFAD 1P3GB 3A1IA 3AZEB 4XUJC 4J8XD 5CHLB 5BS7C 4H9NB 5GSUA 3REKA 5AY8A 1BH8A 4J8WA 1P3GC 1AOID 1KX3A 3AZEC 3B6FC 3C1BA 3AZFC 3C1CD 2NZDA 1M18A 1P3MD 1P3IA 5AV5D 4X23B 3LELB 2J8PA 5B2JB 3AYWD 2G5HC 4XUJD 3AZLA 3MGRC 1P3KB 5JRGC 3B0CW 4H9PA 3AFAA 1P3LD 5B2JC 5BO0A 5CPID 5GT0B 4WU8B 1P3BC 3UTAA 3AZHA 4J8VB 3AZJC 4G92B 3EPKA 3B6GB 3WA9A 3A6NA 3AZID 5B31G 4WU8C 4CAYB 1P3MA 4X23D 3P5JB 3LELD 3B6GC 4XUJA 3AZMB 3W99B 2ZY4A 5B32B 1P3KD 2F8NA 1TZYB 3UT9B 2BYKA 1A7WA 2CV5C 1P3GA 1HQ3B 3AZEA 5E5AC 3B6FA 3AZFA 4LD9C 5CPJD 3WTPB 5B0ZB 5GT0D 4H9NA 1KX5C 3H0LC 1TZYC 4ZUXB 3UT9C 4Z66C 4J8VD 3O62B 2ZY5A 2Y2MA 4WV4B 3LZ0C 3KUYC 4H9RB 3W98C 3MGRA 3AN2D 5JRGA 4WU9B 4ZUXC 4QLCC 5B2JA 4H9OB 4DRAA
chains in the Genus database with same CATH topology
1P3BA 3AL0C 2FJ7D 3AZMD 3W99D 4E44A 4WU9C 1P3FB 5B32D 1M1AC 3AZJA 5JA4A 3AV1B 3REJB 2NQBC 1HQ3D 4WU8A 1U35C 5GT3B 5AV9B 5B0ZD 3WTPD 1P3FC 4ZUXD 4AWLB 1ID3C 3B0DC 5F99B 5B1LC 3O62D 3LZ1C 1P34B 4UUZB 3B6GA 3LJAB 2HUEC 3AZNB 5BNVB 2ZY2A 4ZBJC 4AWLC 2CV5A 3AZGC 3WKJC 5B24B 4KUDD 5E5AA 2JCHA 2Y2KA 3LJAC 4LD9A 3AZNC 3AZMA 5CPKB 3W99A 4R8PB 1KX5A 1TZYA 2YFWB 3UT9A 1P3PB 3LZ0A 3KUYA 3AV1D 3REJD 3W98A 5DNNC 2Y2JA 3REKC 2Y2HA 4G91B 1W2EA 5GT3D 4ZUXA 5AV9D 4QLCA 5AV8B 3H0MC 5F99D 2W8SA 2UWXA 5AVBB 3R45A 1P34D 2ZY3A 4H9RA 4M6BA 2LY8A 4YS3B 3AZND 4WU9A 3REHB 3AZKB 1M1AA 5B2IC 1ZLAD 1WWSA 4G91C 5AV8C 2NQBA 4J8UB 5B24D 3NQJB 5BT1C 5GXQC 3AFAC 5CPKD 4WJ3C 1P3FA 4R8PD 4J8XC 2Y2OA 1ID3A 5B1LA 1PZRA 4WZSB 3LZ1A 1P3PD 3KXBB 5C3IC 3REJA 1P3AB 3MGPB 1AOIC 5GT3A 3MGSD 4KHAB 4WNNB 3C1CC 5AV8D 3EPLA 3AZGA 3KSYA 1P3MC 4UUZA 2Y2QA 5AV5C 3V9RB 5KDMA 5AVBD 3LJAA 3WKJA 3AZNA 4CSRB 1P3LB 3AYWC 2Y2PA 4YS3D 3MNNB 5BNVA 2AROB 3REHD 3REID 3AZKD 5CPIB 5BNXA 2XD1A 3VH6A 5DNNA 4YM6B 4J8UD 1P3LC 1T3UA 2AROC 5CPIC 3AZIB 1P3PA 2F8NK 3VH6T 3UTBD 4NFTA 5B31D 3KXBD 1P3AD 3MGPD 5B2IA 5AV8A 3AZIC 3X1UB 5DNMD 5GXQA 4X23C 3LELC 1F1EA 3MNND 4J8XA 2AROD 5CPJB 3X1SB 1P3KC 1EQZB 4J8UA 3NQJA 4YM6D 1AOIA 4HGAB 3AN2B 3C1CA 4EO5B 5CPJC 5GT0C 5AV5A 4J8VC 3AYWA 4G92C 2Y2GA 4HGAC 4KHAA 3AN2C 3RELB 2FJ7B 3V9RA 5B33D 3X1UD 1P3LA 4CSRA 2AROA 5CPIA 2BG1A 3H0RC 2FJ7C 3AZMC 3W99C 4XZQD 3X1SD 5B32C 5B40B 1EQZD 1Z2CB 1HQ3C 3VH5T 3AZIA 3KWQB 3WTPC 5B0ZC 1M19B 2VQRA 3TU4B 1P3OB 4X23A 2BYMB 3O62C 3LELA 3MVDB 2F8NG 1P3KA 3RELD 2HIOB 4H9QB 2CWEA 3FDDA 2G5IC 4KUDC 5CPJA 2F8NH 5GT0A 5B0YB 3WAAB 2Y2IA 5AVCD 5B40D 5B1MB 4J8VA 3AV2B 4DQYB 1BH9B 3WTPE 3AV1C 3REJC 3AN2A 4CAYA 3KWQD 1ZLAB 5GT3C 5AV9C 1S32B 5B1MC 2DQNC 1M19D 3TU4D 1P3OD 2XD5A 5F99C 5AV6D 1P34C 2L5AA 3MVDD 1KX4B 2FJ7A 1ZLAC 1N1JB 5B32A 2HIOD 4KGCB 4Z5TB 3X1TD 1F66B 1HQ3A 4JJNB 5B24C 5CPKC 3WTPA 5B0ZA 1B6WA 4R8PC 5B40A 5B0YD 3MGSB 3WAAD 3W96B 5B1MD 3O62A 3AV2D 1P3PC 3REIB 2JSSA 3MGSC 3X1VD 1S32D 2BYMA 1B67A 4H9OA 4KUDA 5AVBC 5AY8B 4J8WB 4YS3C 4NE3A 1KX3B 1KX4D 4H9QA 3REHC 3AZKC 3REIC 3C1BB 3MGQD 4KGCD 4Z5TD 3AV1A 5CP6B 3UTBB 5B31B 1F66D 3NQUB 4NE6A 4J8UC 4JJND 3W97B 5AV9A 3W96D 5B1MA 5F99A 1ULYA 4H9PB 4H9SC 5DNMB 5B31C 3KXBC 3UTBC 1P3AC 1P34A 3MGPC 3W97C 1ZLAA 3UTAB 2RVQD 3AZHB 5B24A 5DNMC 5CPKA 5AY8D 4J8WD 3WA9B 4R8PA 1N1JA 3MNNC 1KX3D 2YFWA 3C1BD 2NZDD 2RIQA 1M18D 5CP6D 1P3ID 5FUGB 1Q9CA 4YM6C 3W97D 3MGSA 3EPJA 3AZLD 2F8NB 2DF4C 5AVBA 5B33B 3B0CT 2BYKB 4YS3A 3REHA 3AZKA 3REIA 3B6FB 3AZFB 4XZQB 3UTAD 3AZHD 5B33C 4KUDB 3X1UC 3WA9D 5G49B 3A6ND 1KU5A 3MGRB 5JRGB 3VH6W 4XZQC 5CP6A 3X1SC 4H9SA 3UTBA 5B31A 3KXBA 1EQZC 3NQUA 1P3AA 3W97A 3MGPA 2FFFB 4UPKA 4NE5A 1H3OB 1P3BB 4WNNA 4EO5C 2F8ND 3AZJB 5DNMA 5JA4B 1P3GD 3MNNA 3AZED 3B6FD 3AZFD 3RELC 3VH5A 5AVCB 4E45A 4YM6A 2ZM5A 2YFVB 3KFUG 3MGRD 5JRGD 5AVCC 5FUGA 5B40C 2CV5B 5B2JD 2PYOB 5AV6B 5E5AB 4LD9B 5BS7A 1R4VA 2Y2NA 1P3BD 1KX5B 3KWQC 5B33A 4Z66B 3AZJD 3X1UA 1M19C 3TU4C 1P3OC 3LZ0B 3KUYB 3X1TB 2PYOC 5AV6C 2IO5B 3W98B 3MVDC 3EG5B 4Z2MG 4WU8D 4XZQA 3EPHA 3X1SA 2HIOC 1EQZA 4QLCB 1JFIB 3X1TC 3R45B 3VH5W 5G49A 3B6GD 2IO5C 1M1AB 4Z2MH 3WAAC 5B0YC 3X1VB 3AV2C 2CV5D 2NQBB 2PYOD 1HTAA 5E5AD 1H3OA 1U35B 4LD9D 3RELA 1KX5D 1TZYD 3UT9D 3MGQB 3B0DB 3X1VC 1S32C 4Z66D 1ID3B 5B1LB 3LZ1B 2HUEB 3LZ0D 3KUYD 3W98D 1KX4C 4ZBJB 5AVCA 3MGQC 4QLCD 4KGCC 3AZGB 4Z5TC 3WKJB 5KDMB 2YFVA 1F66C 4JJNC 1TAFB 3KWQA 4WU9D 1M1AD 3W96C 1M19A 3TU4A 1P3OA 5BNXB 2PYOA 5AV6A 2NQBD 5DNNB 3MVDA 5GSUB 5B32G 2Y2LA 3REKB 3F6TA 1BH8B 1U35D 1WWIA 2HIOA 1P3FD 1BFMA 4Z66A 1ID3D 2NZDB 2RVQC 5B1LD 3LZ1D 3X1TA 1M18B 1P3IB 5GSUC 5AY8C 4J8WC 5B2IB 5B0YA 3WAAA 1KX3C 2JE5A 3C1BC 3AZLB 1JFIA 3AV2A 2NZDC 1BH9A 3AZGD 1M18C 3WKJD 5CP6C 2F2AC 3LJAD 1P3IC 5GXQB 3AFAB 3B0BA 5BO0B 4J8XB 3X1VA 1S32A 3AZLC 5C3IB 1U35A 5DNND 3IP4C 5GSUD 1AOIB 3REKD 4DRBA 1KX4A 3A6NB 3MGQA 3C1CB 4KGCA 3A1KA 4Z5TA 1P3MB 5AV5B 3UTAC 3AZHC 1F66A 4JJNA 3AYWB 3WA9C 3A6NC 5B2ID 3W96A 4XUJB 5BT1D 1TAFA 5GXQD 3AFAD 1P3GB 3A1IA 3AZEB 4XUJC 4J8XD 5CHLB 5BS7C 4H9NB 5GSUA 3REKA 5AY8A 1BH8A 4J8WA 1P3GC 1AOID 1KX3A 3AZEC 3B6FC 3C1BA 3AZFC 3C1CD 2NZDA 1M18A 1P3MD 1P3IA 5AV5D 4X23B 3LELB 2J8PA 5B2JB 3AYWD 2G5HC 4XUJD 3AZLA 3MGRC 1P3KB 5JRGC 3B0CW 4H9PA 3AFAA 1P3LD 5B2JC 5BO0A 5CPID 5GT0B 4WU8B 1P3BC 3UTAA 3AZHA 4J8VB 3AZJC 4G92B 3EPKA 3B6GB 3WA9A 3A6NA 3AZID 5B31G 4WU8C 4CAYB 1P3MA 4X23D 3P5JB 3LELD 3B6GC 4XUJA 3AZMB 3W99B 2ZY4A 5B32B 1P3KD 2F8NA 1TZYB 3UT9B 2BYKA 1A7WA 2CV5C 1P3GA 1HQ3B 3AZEA 5E5AC 3B6FA 3AZFA 4LD9C 5CPJD 3WTPB 5B0ZB 5GT0D 4H9NA 1KX5C 3H0LC 1TZYC 4ZUXB 3UT9C 4Z66C 4J8VD 3O62B 2ZY5A 2Y2MA 4WV4B 3LZ0C 3KUYC 4H9RB 3W98C 3MGRA 3AN2D 5JRGA 4WU9B 4ZUXC 4QLCC 5B2JA 4H9OB 4DRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3B A;  2FJ7 D;  3AZM D;  3W99 D;  4E44 A;  4WU9 C;  1P3F B;  5B32 D;  1M1A C;  3AZJ A;  5JA4 A;  3AV1 B;  3REJ B;  2NQB C;  1HQ3 D;  4WU8 A;  1U35 C;  5GT3 B;  5AV9 B;  5B0Z D;  3WTP D;  1P3F C;  4ZUX D;  4AWL B;  1ID3 C;  3B0D C;  5F99 B;  5B1L C;  3O62 D;  3LZ1 C;  1P34 B;  4UUZ B;  3B6G A;  3LJA B;  2HUE C;  3AZN B;  5BNV B;  4ZBJ C;  4AWL C;  2CV5 A;  3AZG C;  3WKJ C;  5B24 B;  4KUD D;  5E5A A;  3LJA C;  4LD9 A;  3AZN C;  3AZM A;  5CPK B;  3W99 A;  4R8P B;  1KX5 A;  1TZY A;  2YFW B;  3UT9 A;  1P3P B;  3LZ0 A;  3KUY A;  3AV1 D;  3REJ D;  3W98 A;  5DNN C;  3REK C;  4G91 B;  5GT3 D;  4ZUX A;  5AV9 D;  4QLC A;  5AV8 B;  5F99 D;  5AVB B;  3R45 A;  1P34 D;  4H9R A;  4M6B A;  2LY8 A;  4YS3 B;  3AZN D;  4WU9 A;  3REH B;  3AZK B;  1M1A A;  5B2I C;  1ZLA D;  1WWS A;  4G91 C;  5AV8 C;  2NQB A;  4J8U B;  5B24 D;  3NQJ B;  5BT1 C;  5GXQ C;  3AFA C;  5CPK D;  1P3F A;  4R8P D;  4J8X C;  1ID3 A;  5B1L A;  3LZ1 A;  4WZS B;  1P3P D;  3KXB B;  5C3I C;  3REJ A;  1P3A B;  3MGP B;  1AOI C;  5GT3 A;  3MGS D;  4KHA B;  4WNN B;  3C1C C;  5AV8 D;  3AZG A;  3KSY A;  1P3M C;  4UUZ A;  3V9R B;  5KDM A;  5AV5 C;  5AVB D;  3LJA A;  3WKJ A;  3AZN A;  4CSR B;  1P3L B;  3AYW C;  4YS3 D;  3MNN B;  5BNV A;  2ARO B;  3REH D;  3REI D;  3AZK D;  5CPI B;  5BNX A;  3VH6 A;  5DNN A;  4YM6 B;  4J8U D;  1P3L C;  2ARO C;  5CPI C;  3AZI B;  1P3P A;  2F8N K;  3VH6 T;  3UTB D;  4NFT A;  5B31 D;  3KXB D;  1P3A D;  3MGP D;  5B2I A;  5AV8 A;  3AZI C;  3X1U B;  5DNM D;  5GXQ A;  4X23 C;  3LEL C;  1F1E A;  3MNN D;  4J8X A;  2ARO D;  5CPJ B;  3X1S B;  1P3K C;  1EQZ B;  4J8U A;  3NQJ A;  4YM6 D;  1AOI A;  4HGA B;  3AN2 B;  3C1C A;  4EO5 B;  5CPJ C;  5GT0 C;  5AV5 A;  4J8V C;  3AYW A;  4G92 C;  4HGA C;  4KHA A;  3AN2 C;  3REL B;  2FJ7 B;  3V9R A;  5B33 D;  3X1U D;  1P3L A;  4CSR A;  2ARO A;  5CPI A;  2FJ7 C;  3AZM C;  3W99 C;  4XZQ D;  3X1S D;  5B32 C;  5B40 B;  1EQZ D;  1HQ3 C;  3VH5 T;  3AZI A;  3KWQ B;  3WTP C;  5B0Z C;  1M19 B;  3TU4 B;  1P3O B;  4X23 A;  2BYM B;  3O62 C;  3LEL A;  3MVD B;  2F8N G;  1P3K A;  3REL D;  2HIO B;  4H9Q B;  2CWE A;  4KUD C;  5CPJ A;  2F8N H;  5GT0 A;  5B0Y B;  3WAA B;  5AVC D;  5B40 D;  5B1M B;  4J8V A;  3AV2 B;  1BH9 B;  3WTP E;  3AV1 C;  3REJ C;  3AN2 A;  4CAY A;  3KWQ D;  1ZLA B;  5GT3 C;  5AV9 C;  1S32 B;  5B1M C;  1M19 D;  3TU4 D;  1P3O D;  5F99 C;  5AV6 D;  1P34 C;  2L5A A;  3MVD D;  1KX4 B;  2FJ7 A;  1ZLA C;  1N1J B;  5B32 A;  2HIO D;  4KGC B;  4Z5T B;  3X1T D;  1F66 B;  1HQ3 A;  4JJN B;  5B24 C;  5CPK C;  3WTP A;  5B0Z A;  1B6W A;  4R8P C;  5B40 A;  5B0Y D;  3MGS B;  3WAA D;  3W96 B;  5B1M D;  3O62 A;  3AV2 D;  1P3P C;  3REI B;  2JSS A;  3MGS C;  3X1V D;  1S32 D;  2BYM A;  1B67 A;  4H9O A;  4KUD A;  5AVB C;  5AY8 B;  4J8W B;  4YS3 C;  4NE3 A;  1KX3 B;  1KX4 D;  4H9Q A;  3REH C;  3AZK C;  3REI C;  3C1B B;  3MGQ D;  4KGC D;  4Z5T D;  3AV1 A;  5CP6 B;  3UTB B;  5B31 B;  1F66 D;  3NQU B;  4NE6 A;  4J8U C;  4JJN D;  3W97 B;  5AV9 A;  3W96 D;  5B1M A;  5F99 A;  1ULY A;  4H9P B;  4H9S C;  5DNM B;  5B31 C;  3KXB C;  3UTB C;  1P3A C;  1P34 A;  3MGP C;  3W97 C;  1ZLA A;  3UTA B;  2RVQ D;  3AZH B;  5B24 A;  5DNM C;  5CPK A;  5AY8 D;  4J8W D;  3WA9 B;  4R8P A;  1N1J A;  3MNN C;  1KX3 D;  2YFW A;  3C1B D;  2NZD D;  1M18 D;  5CP6 D;  1P3I D;  5FUG B;  1Q9C A;  4YM6 C;  3W97 D;  3MGS A;  3AZL D;  2F8N B;  5AVB A;  5B33 B;  3B0C T;  2BYK B;  4YS3 A;  3REH A;  3AZK A;  3REI A;  3B6F B;  3AZF B;  4XZQ B;  3UTA D;  3AZH D;  5B33 C;  4KUD B;  3X1U C;  3WA9 D;  5G49 B;  3A6N D;  1KU5 A;  3MGR B;  5JRG B;  3VH6 W;  4XZQ C;  5CP6 A;  3X1S C;  4H9S A;  3UTB A;  5B31 A;  3KXB A;  1EQZ C;  3NQU A;  1P3A A;  3W97 A;  3MGP A;  4NE5 A;  1H3O B;  1P3B B;  4WNN A;  4EO5 C;  2F8N D;  3AZJ B;  5DNM A;  5JA4 B;  1P3G D;  3MNN A;  3AZE D;  3B6F D;  3AZF D;  3REL C;  3VH5 A;  5AVC B;  4E45 A;  4YM6 A;  2YFV B;  3MGR D;  5JRG D;  5AVC C;  5FUG A;  5B40 C;  2CV5 B;  5B2J D;  2PYO B;  5AV6 B;  5E5A B;  4LD9 B;  5BS7 A;  1R4V A;  1P3B D;  1KX5 B;  3KWQ C;  5B33 A;  4Z66 B;  3AZJ D;  3X1U A;  1M19 C;  3TU4 C;  1P3O C;  3LZ0 B;  3KUY B;  3X1T B;  2PYO C;  5AV6 C;  2IO5 B;  3W98 B;  3MVD C;  4Z2M G;  4WU8 D;  4XZQ A;  3X1S A;  2HIO C;  1EQZ A;  4QLC B;  1JFI B;  3X1T C;  3R45 B;  3VH5 W;  5G49 A;  3B6G D;  2IO5 C;  1M1A B;  4Z2M H;  3WAA C;  5B0Y C;  3X1V B;  3AV2 C;  2CV5 D;  2NQB B;  2PYO D;  1HTA A;  5E5A D;  1H3O A;  1U35 B;  4LD9 D;  3REL A;  1KX5 D;  1TZY D;  3UT9 D;  3MGQ B;  3B0D B;  3X1V C;  1S32 C;  4Z66 D;  1ID3 B;  5B1L B;  3LZ1 B;  2HUE B;  3LZ0 D;  3KUY D;  3W98 D;  1KX4 C;  4ZBJ B;  5AVC A;  3MGQ C;  4QLC D;  4KGC C;  3AZG B;  4Z5T C;  3WKJ B;  5KDM B;  2YFV A;  1F66 C;  4JJN C;  1TAF B;  3KWQ A;  4WU9 D;  1M1A D;  3W96 C;  1M19 A;  3TU4 A;  1P3O A;  5BNX B;  2PYO A;  5AV6 A;  2NQB D;  5DNN B;  3MVD A;  5GSU B;  5B32 G;  3REK B;  1BH8 B;  1U35 D;  1WWI A;  2HIO A;  1P3F D;  1BFM A;  4Z66 A;  1ID3 D;  2NZD B;  2RVQ C;  5B1L D;  3LZ1 D;  3X1T A;  1M18 B;  1P3I B;  5GSU C;  5AY8 C;  4J8W C;  5B2I B;  5B0Y A;  3WAA A;  1KX3 C;  3C1B C;  3AZL B;  1JFI A;  3AV2 A;  2NZD C;  1BH9 A;  3AZG D;  1M18 C;  3WKJ D;  5CP6 C;  1P3I C;  3LJA D;  5GXQ B;  3AFA B;  3B0B A;  5BO0 B;  4J8X B;  3X1V A;  1S32 A;  3AZL C;  5C3I B;  1U35 A;  5DNN D;  5GSU D;  1AOI B;  3REK D;  4DRB A;  1KX4 A;  3A6N B;  3MGQ A;  3C1C B;  4KGC A;  4Z5T A;  1P3M B;  5AV5 B;  3UTA C;  3AZH C;  1F66 A;  4JJN A;  3AYW B;  3WA9 C;  3A6N C;  5B2I D;  3W96 A;  4XUJ B;  5GXQ D;  1TAF A;  5BT1 D;  3AFA D;  1P3G B;  3AZE B;  4XUJ C;  4J8X D;  5CHL B;  5BS7 C;  4H9N B;  5GSU A;  3REK A;  5AY8 A;  1BH8 A;  4J8W A;  1P3G C;  1AOI D;  1KX3 A;  3AZE C;  3B6F C;  3C1B A;  3AZF C;  3C1C D;  2NZD A;  1M18 A;  1P3M D;  1P3I A;  5AV5 D;  4X23 B;  3LEL B;  3AYW D;  5B2J B;  4XUJ D;  3AZL A;  3MGR C;  1P3K B;  5JRG C;  3B0C W;  4H9P A;  3AFA A;  1P3L D;  5B2J C;  5BO0 A;  5CPI D;  5GT0 B;  4WU8 B;  1P3B C;  3UTA A;  3AZH A;  4J8V B;  3AZJ C;  4G92 B;  3B6G B;  3WA9 A;  3A6N A;  3AZI D;  5B31 G;  4WU8 C;  4CAY B;  1P3M A;  4X23 D;  3LEL D;  3B6G C;  4XUJ A;  3AZM B;  3W99 B;  5B32 B;  1P3K D;  2F8N A;  1TZY B;  3UT9 B;  2BYK A;  1A7W A;  2CV5 C;  1P3G A;  1HQ3 B;  3AZE A;  5E5A C;  3B6F A;  3AZF A;  4LD9 C;  5CPJ D;  3WTP B;  5B0Z B;  5GT0 D;  4H9N A;  1KX5 C;  1TZY C;  4ZUX B;  3UT9 C;  4Z66 C;  4J8V D;  3O62 B;  4WV4 B;  3LZ0 C;  3KUY C;  4H9R B;  3W98 C;  3MGR A;  3AN2 D;  5JRG A;  4WU9 B;  4ZUX C;  4QLC C;  5B2J A;  4H9O B;  4DRA A; 
#chains in the Genus database with same CATH topology
 1P3B A;  3AL0 C;  2FJ7 D;  3AZM D;  3W99 D;  4E44 A;  4WU9 C;  1P3F B;  5B32 D;  1M1A C;  3AZJ A;  5JA4 A;  3AV1 B;  3REJ B;  2NQB C;  1HQ3 D;  4WU8 A;  1U35 C;  5GT3 B;  5AV9 B;  5B0Z D;  3WTP D;  1P3F C;  4ZUX D;  4AWL B;  1ID3 C;  3B0D C;  5F99 B;  5B1L C;  3O62 D;  3LZ1 C;  1P34 B;  4UUZ B;  3B6G A;  3LJA B;  2HUE C;  3AZN B;  5BNV B;  2ZY2 A;  4ZBJ C;  4AWL C;  2CV5 A;  3AZG C;  3WKJ C;  5B24 B;  4KUD D;  5E5A A;  2JCH A;  2Y2K A;  3LJA C;  4LD9 A;  3AZN C;  3AZM A;  5CPK B;  3W99 A;  4R8P B;  1KX5 A;  1TZY A;  2YFW B;  3UT9 A;  1P3P B;  3LZ0 A;  3KUY A;  3AV1 D;  3REJ D;  3W98 A;  5DNN C;  2Y2J A;  3REK C;  2Y2H A;  4G91 B;  1W2E A;  5GT3 D;  4ZUX A;  5AV9 D;  4QLC A;  5AV8 B;  3H0M C;  5F99 D;  2W8S A;  2UWX A;  5AVB B;  3R45 A;  1P34 D;  2ZY3 A;  4H9R A;  4M6B A;  2LY8 A;  4YS3 B;  3AZN D;  4WU9 A;  3REH B;  3AZK B;  1M1A A;  5B2I C;  1ZLA D;  1WWS A;  4G91 C;  5AV8 C;  2NQB A;  4J8U B;  5B24 D;  3NQJ B;  5BT1 C;  5GXQ C;  3AFA C;  5CPK D;  4WJ3 C;  1P3F A;  4R8P D;  4J8X C;  2Y2O A;  1ID3 A;  5B1L A;  1PZR A;  4WZS B;  3LZ1 A;  1P3P D;  3KXB B;  5C3I C;  3REJ A;  1P3A B;  3MGP B;  1AOI C;  5GT3 A;  3MGS D;  4KHA B;  4WNN B;  3C1C C;  5AV8 D;  3EPL A;  3AZG A;  3KSY A;  1P3M C;  4UUZ A;  2Y2Q A;  5AV5 C;  3V9R B;  5KDM A;  5AVB D;  3LJA A;  3WKJ A;  3AZN A;  4CSR B;  1P3L B;  3AYW C;  2Y2P A;  4YS3 D;  3MNN B;  5BNV A;  2ARO B;  3REH D;  3REI D;  3AZK D;  5CPI B;  5BNX A;  2XD1 A;  3VH6 A;  5DNN A;  4YM6 B;  4J8U D;  1P3L C;  1T3U A;  2ARO C;  5CPI C;  3AZI B;  1P3P A;  2F8N K;  3VH6 T;  3UTB D;  4NFT A;  5B31 D;  3KXB D;  1P3A D;  3MGP D;  5B2I A;  5AV8 A;  3AZI C;  3X1U B;  5DNM D;  5GXQ A;  4X23 C;  3LEL C;  1F1E A;  3MNN D;  4J8X A;  2ARO D;  5CPJ B;  3X1S B;  1P3K C;  1EQZ B;  4J8U A;  3NQJ A;  4YM6 D;  1AOI A;  4HGA B;  3AN2 B;  3C1C A;  4EO5 B;  5CPJ C;  5GT0 C;  5AV5 A;  4J8V C;  3AYW A;  4G92 C;  2Y2G A;  4HGA C;  4KHA A;  3AN2 C;  3REL B;  2FJ7 B;  3V9R A;  5B33 D;  3X1U D;  1P3L A;  4CSR A;  2ARO A;  5CPI A;  2BG1 A;  3H0R C;  2FJ7 C;  3AZM C;  3W99 C;  4XZQ D;  3X1S D;  5B32 C;  5B40 B;  1EQZ D;  1Z2C B;  1HQ3 C;  3VH5 T;  3AZI A;  3KWQ B;  3WTP C;  5B0Z C;  1M19 B;  2VQR A;  3TU4 B;  1P3O B;  4X23 A;  2BYM B;  3O62 C;  3LEL A;  3MVD B;  2F8N G;  1P3K A;  3REL D;  2HIO B;  4H9Q B;  2CWE A;  3FDD A;  2G5I C;  4KUD C;  5CPJ A;  2F8N H;  5GT0 A;  5B0Y B;  3WAA B;  2Y2I A;  5AVC D;  5B40 D;  5B1M B;  4J8V A;  3AV2 B;  4DQY B;  1BH9 B;  3WTP E;  3AV1 C;  3REJ C;  3AN2 A;  4CAY A;  3KWQ D;  1ZLA B;  5GT3 C;  5AV9 C;  1S32 B;  5B1M C;  2DQN C;  1M19 D;  3TU4 D;  1P3O D;  2XD5 A;  5F99 C;  5AV6 D;  1P34 C;  2L5A A;  3MVD D;  1KX4 B;  2FJ7 A;  1ZLA C;  1N1J B;  5B32 A;  2HIO D;  4KGC B;  4Z5T B;  3X1T D;  1F66 B;  1HQ3 A;  4JJN B;  5B24 C;  5CPK C;  3WTP A;  5B0Z A;  1B6W A;  4R8P C;  5B40 A;  5B0Y D;  3MGS B;  3WAA D;  3W96 B;  5B1M D;  3O62 A;  3AV2 D;  1P3P C;  3REI B;  2JSS A;  3MGS C;  3X1V D;  1S32 D;  2BYM A;  1B67 A;  4H9O A;  4KUD A;  5AVB C;  5AY8 B;  4J8W B;  4YS3 C;  4NE3 A;  1KX3 B;  1KX4 D;  4H9Q A;  3REH C;  3AZK C;  3REI C;  3C1B B;  3MGQ D;  4KGC D;  4Z5T D;  3AV1 A;  5CP6 B;  3UTB B;  5B31 B;  1F66 D;  3NQU B;  4NE6 A;  4J8U C;  4JJN D;  3W97 B;  5AV9 A;  3W96 D;  5B1M A;  5F99 A;  1ULY A;  4H9P B;  4H9S C;  5DNM B;  5B31 C;  3KXB C;  3UTB C;  1P3A C;  1P34 A;  3MGP C;  3W97 C;  1ZLA A;  3UTA B;  2RVQ D;  3AZH B;  5B24 A;  5DNM C;  5CPK A;  5AY8 D;  4J8W D;  3WA9 B;  4R8P A;  1N1J A;  3MNN C;  1KX3 D;  2YFW A;  3C1B D;  2NZD D;  2RIQ A;  1M18 D;  5CP6 D;  1P3I D;  5FUG B;  1Q9C A;  4YM6 C;  3W97 D;  3MGS A;  3EPJ A;  3AZL D;  2F8N B;  2DF4 C;  5AVB A;  5B33 B;  3B0C T;  2BYK B;  4YS3 A;  3REH A;  3AZK A;  3REI A;  3B6F B;  3AZF B;  4XZQ B;  3UTA D;  3AZH D;  5B33 C;  4KUD B;  3X1U C;  3WA9 D;  5G49 B;  3A6N D;  1KU5 A;  3MGR B;  5JRG B;  3VH6 W;  4XZQ C;  5CP6 A;  3X1S C;  4H9S A;  3UTB A;  5B31 A;  3KXB A;  1EQZ C;  3NQU A;  1P3A A;  3W97 A;  3MGP A;  2FFF B;  4UPK A;  4NE5 A;  1H3O B;  1P3B B;  4WNN A;  4EO5 C;  2F8N D;  3AZJ B;  5DNM A;  5JA4 B;  1P3G D;  3MNN A;  3AZE D;  3B6F D;  3AZF D;  3REL C;  3VH5 A;  5AVC B;  4E45 A;  4YM6 A;  2ZM5 A;  2YFV B;  3KFU G;  3MGR D;  5JRG D;  5AVC C;  5FUG A;  5B40 C;  2CV5 B;  5B2J D;  2PYO B;  5AV6 B;  5E5A B;  4LD9 B;  5BS7 A;  1R4V A;  2Y2N A;  1P3B D;  1KX5 B;  3KWQ C;  5B33 A;  4Z66 B;  3AZJ D;  3X1U A;  1M19 C;  3TU4 C;  1P3O C;  3LZ0 B;  3KUY B;  3X1T B;  2PYO C;  5AV6 C;  2IO5 B;  3W98 B;  3MVD C;  3EG5 B;  4Z2M G;  4WU8 D;  4XZQ A;  3EPH A;  3X1S A;  2HIO C;  1EQZ A;  4QLC B;  1JFI B;  3X1T C;  3R45 B;  3VH5 W;  5G49 A;  3B6G D;  2IO5 C;  1M1A B;  4Z2M H;  3WAA C;  5B0Y C;  3X1V B;  3AV2 C;  2CV5 D;  2NQB B;  2PYO D;  1HTA A;  5E5A D;  1H3O A;  1U35 B;  4LD9 D;  3REL A;  1KX5 D;  1TZY D;  3UT9 D;  3MGQ B;  3B0D B;  3X1V C;  1S32 C;  4Z66 D;  1ID3 B;  5B1L B;  3LZ1 B;  2HUE B;  3LZ0 D;  3KUY D;  3W98 D;  1KX4 C;  4ZBJ B;  5AVC A;  3MGQ C;  4QLC D;  4KGC C;  3AZG B;  4Z5T C;  3WKJ B;  5KDM B;  2YFV A;  1F66 C;  4JJN C;  1TAF B;  3KWQ A;  4WU9 D;  1M1A D;  3W96 C;  1M19 A;  3TU4 A;  1P3O A;  5BNX B;  2PYO A;  5AV6 A;  2NQB D;  5DNN B;  3MVD A;  5GSU B;  5B32 G;  2Y2L A;  3REK B;  3F6T A;  1BH8 B;  1U35 D;  1WWI A;  2HIO A;  1P3F D;  1BFM A;  4Z66 A;  1ID3 D;  2NZD B;  2RVQ C;  5B1L D;  3LZ1 D;  3X1T A;  1M18 B;  1P3I B;  5GSU C;  5AY8 C;  4J8W C;  5B2I B;  5B0Y A;  3WAA A;  1KX3 C;  2JE5 A;  3C1B C;  3AZL B;  1JFI A;  3AV2 A;  2NZD C;  1BH9 A;  3AZG D;  1M18 C;  3WKJ D;  5CP6 C;  2F2A C;  3LJA D;  1P3I C;  5GXQ B;  3AFA B;  3B0B A;  5BO0 B;  4J8X B;  3X1V A;  1S32 A;  3AZL C;  5C3I B;  1U35 A;  5DNN D;  3IP4 C;  5GSU D;  1AOI B;  3REK D;  4DRB A;  1KX4 A;  3A6N B;  3MGQ A;  3C1C B;  4KGC A;  3A1K A;  4Z5T A;  1P3M B;  5AV5 B;  3UTA C;  3AZH C;  1F66 A;  4JJN A;  3AYW B;  3WA9 C;  3A6N C;  5B2I D;  3W96 A;  4XUJ B;  5BT1 D;  1TAF A;  5GXQ D;  3AFA D;  1P3G B;  3A1I A;  3AZE B;  4XUJ C;  4J8X D;  5CHL B;  5BS7 C;  4H9N B;  5GSU A;  3REK A;  5AY8 A;  1BH8 A;  4J8W A;  1P3G C;  1AOI D;  1KX3 A;  3AZE C;  3B6F C;  3C1B A;  3AZF C;  3C1C D;  2NZD A;  1M18 A;  1P3M D;  1P3I A;  5AV5 D;  4X23 B;  3LEL B;  2J8P A;  5B2J B;  3AYW D;  2G5H C;  4XUJ D;  3AZL A;  3MGR C;  1P3K B;  5JRG C;  3B0C W;  4H9P A;  3AFA A;  1P3L D;  5B2J C;  5BO0 A;  5CPI D;  5GT0 B;  4WU8 B;  1P3B C;  3UTA A;  3AZH A;  4J8V B;  3AZJ C;  4G92 B;  3EPK A;  3B6G B;  3WA9 A;  3A6N A;  3AZI D;  5B31 G;  4WU8 C;  4CAY B;  1P3M A;  4X23 D;  3P5J B;  3LEL D;  3B6G C;  4XUJ A;  3AZM B;  3W99 B;  2ZY4 A;  5B32 B;  1P3K D;  2F8N A;  1TZY B;  3UT9 B;  2BYK A;  1A7W A;  2CV5 C;  1P3G A;  1HQ3 B;  3AZE A;  5E5A C;  3B6F A;  3AZF A;  4LD9 C;  5CPJ D;  3WTP B;  5B0Z B;  5GT0 D;  4H9N A;  1KX5 C;  3H0L C;  1TZY C;  4ZUX B;  3UT9 C;  4Z66 C;  4J8V D;  3O62 B;  2ZY5 A;  2Y2M A;  4WV4 B;  3LZ0 C;  3KUY C;  4H9R B;  3W98 C;  3MGR A;  3AN2 D;  5JRG A;  4WU9 B;  4ZUX C;  4QLC C;  5B2J A;  4H9O B;  4DRA A; 
#chains in the Genus database with same CATH homology
 1P3B A;  3AL0 C;  2FJ7 D;  3AZM D;  3W99 D;  4E44 A;  4WU9 C;  1P3F B;  5B32 D;  1M1A C;  3AZJ A;  5JA4 A;  3AV1 B;  3REJ B;  2NQB C;  1HQ3 D;  4WU8 A;  1U35 C;  5GT3 B;  5AV9 B;  5B0Z D;  3WTP D;  1P3F C;  4ZUX D;  4AWL B;  1ID3 C;  3B0D C;  5F99 B;  5B1L C;  3O62 D;  3LZ1 C;  1P34 B;  4UUZ B;  3B6G A;  3LJA B;  2HUE C;  3AZN B;  5BNV B;  2ZY2 A;  4ZBJ C;  4AWL C;  2CV5 A;  3AZG C;  3WKJ C;  5B24 B;  4KUD D;  5E5A A;  2JCH A;  2Y2K A;  3LJA C;  4LD9 A;  3AZN C;  3AZM A;  5CPK B;  3W99 A;  4R8P B;  1KX5 A;  1TZY A;  2YFW B;  3UT9 A;  1P3P B;  3LZ0 A;  3KUY A;  3AV1 D;  3REJ D;  3W98 A;  5DNN C;  2Y2J A;  3REK C;  2Y2H A;  4G91 B;  1W2E A;  5GT3 D;  4ZUX A;  5AV9 D;  4QLC A;  5AV8 B;  3H0M C;  5F99 D;  2W8S A;  2UWX A;  5AVB B;  3R45 A;  1P34 D;  2ZY3 A;  4H9R A;  4M6B A;  2LY8 A;  4YS3 B;  3AZN D;  4WU9 A;  3REH B;  3AZK B;  1M1A A;  5B2I C;  1ZLA D;  1WWS A;  4G91 C;  5AV8 C;  2NQB A;  4J8U B;  5B24 D;  3NQJ B;  5BT1 C;  5GXQ C;  3AFA C;  5CPK D;  4WJ3 C;  1P3F A;  4R8P D;  4J8X C;  2Y2O A;  1ID3 A;  5B1L A;  1PZR A;  4WZS B;  3LZ1 A;  1P3P D;  3KXB B;  5C3I C;  3REJ A;  1P3A B;  3MGP B;  1AOI C;  5GT3 A;  3MGS D;  4KHA B;  4WNN B;  3C1C C;  5AV8 D;  3EPL A;  3AZG A;  3KSY A;  1P3M C;  4UUZ A;  2Y2Q A;  5AV5 C;  3V9R B;  5KDM A;  5AVB D;  3LJA A;  3WKJ A;  3AZN A;  4CSR B;  1P3L B;  3AYW C;  2Y2P A;  4YS3 D;  3MNN B;  5BNV A;  2ARO B;  3REH D;  3REI D;  3AZK D;  5CPI B;  5BNX A;  2XD1 A;  3VH6 A;  5DNN A;  4YM6 B;  4J8U D;  1P3L C;  1T3U A;  2ARO C;  5CPI C;  3AZI B;  1P3P A;  2F8N K;  3VH6 T;  3UTB D;  4NFT A;  5B31 D;  3KXB D;  1P3A D;  3MGP D;  5B2I A;  5AV8 A;  3AZI C;  3X1U B;  5DNM D;  5GXQ A;  4X23 C;  3LEL C;  1F1E A;  3MNN D;  4J8X A;  2ARO D;  5CPJ B;  3X1S B;  1P3K C;  1EQZ B;  4J8U A;  3NQJ A;  4YM6 D;  1AOI A;  4HGA B;  3AN2 B;  3C1C A;  4EO5 B;  5CPJ C;  5GT0 C;  5AV5 A;  4J8V C;  3AYW A;  4G92 C;  2Y2G A;  4HGA C;  4KHA A;  3AN2 C;  3REL B;  2FJ7 B;  3V9R A;  5B33 D;  3X1U D;  1P3L A;  4CSR A;  2ARO A;  5CPI A;  2BG1 A;  3H0R C;  2FJ7 C;  3AZM C;  3W99 C;  4XZQ D;  3X1S D;  5B32 C;  5B40 B;  1EQZ D;  1Z2C B;  1HQ3 C;  3VH5 T;  3AZI A;  3KWQ B;  3WTP C;  5B0Z C;  1M19 B;  2VQR A;  3TU4 B;  1P3O B;  4X23 A;  2BYM B;  3O62 C;  3LEL A;  3MVD B;  2F8N G;  1P3K A;  3REL D;  2HIO B;  4H9Q B;  2CWE A;  3FDD A;  2G5I C;  4KUD C;  5CPJ A;  2F8N H;  5GT0 A;  5B0Y B;  3WAA B;  2Y2I A;  5AVC D;  5B40 D;  5B1M B;  4J8V A;  3AV2 B;  4DQY B;  1BH9 B;  3WTP E;  3AV1 C;  3REJ C;  3AN2 A;  4CAY A;  3KWQ D;  1ZLA B;  5GT3 C;  5AV9 C;  1S32 B;  5B1M C;  2DQN C;  1M19 D;  3TU4 D;  1P3O D;  2XD5 A;  5F99 C;  5AV6 D;  1P34 C;  2L5A A;  3MVD D;  1KX4 B;  2FJ7 A;  1ZLA C;  1N1J B;  5B32 A;  2HIO D;  4KGC B;  4Z5T B;  3X1T D;  1F66 B;  1HQ3 A;  4JJN B;  5B24 C;  5CPK C;  3WTP A;  5B0Z A;  1B6W A;  4R8P C;  5B40 A;  5B0Y D;  3MGS B;  3WAA D;  3W96 B;  5B1M D;  3O62 A;  3AV2 D;  1P3P C;  3REI B;  2JSS A;  3MGS C;  3X1V D;  1S32 D;  2BYM A;  1B67 A;  4H9O A;  4KUD A;  5AVB C;  5AY8 B;  4J8W B;  4YS3 C;  4NE3 A;  1KX3 B;  1KX4 D;  4H9Q A;  3REH C;  3AZK C;  3REI C;  3C1B B;  3MGQ D;  4KGC D;  4Z5T D;  3AV1 A;  5CP6 B;  3UTB B;  5B31 B;  1F66 D;  3NQU B;  4NE6 A;  4J8U C;  4JJN D;  3W97 B;  5AV9 A;  3W96 D;  5B1M A;  5F99 A;  1ULY A;  4H9P B;  4H9S C;  5DNM B;  5B31 C;  3KXB C;  3UTB C;  1P3A C;  1P34 A;  3MGP C;  3W97 C;  1ZLA A;  3UTA B;  2RVQ D;  3AZH B;  5B24 A;  5DNM C;  5CPK A;  5AY8 D;  4J8W D;  3WA9 B;  4R8P A;  1N1J A;  3MNN C;  1KX3 D;  2YFW A;  3C1B D;  2NZD D;  2RIQ A;  1M18 D;  5CP6 D;  1P3I D;  5FUG B;  1Q9C A;  4YM6 C;  3W97 D;  3MGS A;  3EPJ A;  3AZL D;  2F8N B;  2DF4 C;  5AVB A;  5B33 B;  3B0C T;  2BYK B;  4YS3 A;  3REH A;  3AZK A;  3REI A;  3B6F B;  3AZF B;  4XZQ B;  3UTA D;  3AZH D;  5B33 C;  4KUD B;  3X1U C;  3WA9 D;  5G49 B;  3A6N D;  1KU5 A;  3MGR B;  5JRG B;  3VH6 W;  4XZQ C;  5CP6 A;  3X1S C;  4H9S A;  3UTB A;  5B31 A;  3KXB A;  1EQZ C;  3NQU A;  1P3A A;  3W97 A;  3MGP A;  2FFF B;  4UPK A;  4NE5 A;  1H3O B;  1P3B B;  4WNN A;  4EO5 C;  2F8N D;  3AZJ B;  5DNM A;  5JA4 B;  1P3G D;  3MNN A;  3AZE D;  3B6F D;  3AZF D;  3REL C;  3VH5 A;  5AVC B;  4E45 A;  4YM6 A;  2ZM5 A;  2YFV B;  3KFU G;  3MGR D;  5JRG D;  5AVC C;  5FUG A;  5B40 C;  2CV5 B;  5B2J D;  2PYO B;  5AV6 B;  5E5A B;  4LD9 B;  5BS7 A;  1R4V A;  2Y2N A;  1P3B D;  1KX5 B;  3KWQ C;  5B33 A;  4Z66 B;  3AZJ D;  3X1U A;  1M19 C;  3TU4 C;  1P3O C;  3LZ0 B;  3KUY B;  3X1T B;  2PYO C;  5AV6 C;  2IO5 B;  3W98 B;  3MVD C;  3EG5 B;  4Z2M G;  4WU8 D;  4XZQ A;  3EPH A;  3X1S A;  2HIO C;  1EQZ A;  4QLC B;  1JFI B;  3X1T C;  3R45 B;  3VH5 W;  5G49 A;  3B6G D;  2IO5 C;  1M1A B;  4Z2M H;  3WAA C;  5B0Y C;  3X1V B;  3AV2 C;  2CV5 D;  2NQB B;  2PYO D;  1HTA A;  5E5A D;  1H3O A;  1U35 B;  4LD9 D;  3REL A;  1KX5 D;  1TZY D;  3UT9 D;  3MGQ B;  3B0D B;  3X1V C;  1S32 C;  4Z66 D;  1ID3 B;  5B1L B;  3LZ1 B;  2HUE B;  3LZ0 D;  3KUY D;  3W98 D;  1KX4 C;  4ZBJ B;  5AVC A;  3MGQ C;  4QLC D;  4KGC C;  3AZG B;  4Z5T C;  3WKJ B;  5KDM B;  2YFV A;  1F66 C;  4JJN C;  1TAF B;  3KWQ A;  4WU9 D;  1M1A D;  3W96 C;  1M19 A;  3TU4 A;  1P3O A;  5BNX B;  2PYO A;  5AV6 A;  2NQB D;  5DNN B;  3MVD A;  5GSU B;  5B32 G;  2Y2L A;  3REK B;  3F6T A;  1BH8 B;  1U35 D;  1WWI A;  2HIO A;  1P3F D;  1BFM A;  4Z66 A;  1ID3 D;  2NZD B;  2RVQ C;  5B1L D;  3LZ1 D;  3X1T A;  1M18 B;  1P3I B;  5GSU C;  5AY8 C;  4J8W C;  5B2I B;  5B0Y A;  3WAA A;  1KX3 C;  2JE5 A;  3C1B C;  3AZL B;  1JFI A;  3AV2 A;  2NZD C;  1BH9 A;  3AZG D;  1M18 C;  3WKJ D;  5CP6 C;  2F2A C;  3LJA D;  1P3I C;  5GXQ B;  3AFA B;  3B0B A;  5BO0 B;  4J8X B;  3X1V A;  1S32 A;  3AZL C;  5C3I B;  1U35 A;  5DNN D;  3IP4 C;  5GSU D;  1AOI B;  3REK D;  4DRB A;  1KX4 A;  3A6N B;  3MGQ A;  3C1C B;  4KGC A;  3A1K A;  4Z5T A;  1P3M B;  5AV5 B;  3UTA C;  3AZH C;  1F66 A;  4JJN A;  3AYW B;  3WA9 C;  3A6N C;  5B2I D;  3W96 A;  4XUJ B;  5BT1 D;  1TAF A;  5GXQ D;  3AFA D;  1P3G B;  3A1I A;  3AZE B;  4XUJ C;  4J8X D;  5CHL B;  5BS7 C;  4H9N B;  5GSU A;  3REK A;  5AY8 A;  1BH8 A;  4J8W A;  1P3G C;  1AOI D;  1KX3 A;  3AZE C;  3B6F C;  3C1B A;  3AZF C;  3C1C D;  2NZD A;  1M18 A;  1P3M D;  1P3I A;  5AV5 D;  4X23 B;  3LEL B;  2J8P A;  5B2J B;  3AYW D;  2G5H C;  4XUJ D;  3AZL A;  3MGR C;  1P3K B;  5JRG C;  3B0C W;  4H9P A;  3AFA A;  1P3L D;  5B2J C;  5BO0 A;  5CPI D;  5GT0 B;  4WU8 B;  1P3B C;  3UTA A;  3AZH A;  4J8V B;  3AZJ C;  4G92 B;  3EPK A;  3B6G B;  3WA9 A;  3A6N A;  3AZI D;  5B31 G;  4WU8 C;  4CAY B;  1P3M A;  4X23 D;  3P5J B;  3LEL D;  3B6G C;  4XUJ A;  3AZM B;  3W99 B;  2ZY4 A;  5B32 B;  1P3K D;  2F8N A;  1TZY B;  3UT9 B;  2BYK A;  1A7W A;  2CV5 C;  1P3G A;  1HQ3 B;  3AZE A;  5E5A C;  3B6F A;  3AZF A;  4LD9 C;  5CPJ D;  3WTP B;  5B0Z B;  5GT0 D;  4H9N A;  1KX5 C;  3H0L C;  1TZY C;  4ZUX B;  3UT9 C;  4Z66 C;  4J8V D;  3O62 B;  2ZY5 A;  2Y2M A;  4WV4 B;  3LZ0 C;  3KUY C;  4H9R B;  3W98 C;  3MGR A;  3AN2 D;  5JRG A;  4WU9 B;  4ZUX C;  4QLC C;  5B2J A;  4H9O B;  4DRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...