3W99C

Crystal structure of human nucleosome core particle lacking h4 n-terminal region
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w99C00
3AZLB 4Z2MH 3WTPB 2AROA 3LZ1B 1U35B 1KX4A 2BYKA 4R8PD 4J8UD 4J8WB 1BH8A 5CPKA 3C1CD 4YM6C 1P3PD 2NQBC 5CPID 1P3MD 3B6GB 1ULYA 3X1SD 5BS7A 3X1UC 3MGRC 4J8VD 3REKD 1R4VA 4X23A 5AY8D 2NZDA 3AZEC 1P3BD 3KUYA 5B33D 3UTAA 1P3OC 5BO0A 5BNXB 1P34D 1P3MB 3REIC 3W98D 5AV6A 4R8PC 2YFVA 4H9SC 5GSUB 5B31G 2FJ7A 3AYWA 1P3LB 4QLCD 5AV8D 4J8XD 3C1CC 1KX3D 5B32B 1P3PC 3AFAB 1BH9B 4KHAA 3KXBD 3W97A 3REHD 5B31A 3LELC 3AV1B 1TAFA 3AZKA 1P3BC 5B33C 1F66D 5B1MB 5B0YA 1P34C 1ZLAB 1KX5A 5BNVA 3VH5A 3AZLA 3W98C 3WTPA 4XUJD 5CPJB 5DNNB 2F8NB 3MNNB 3LZ1A 5GXQC 3UT9A 3X1TD 1F1EA 5F99C 4QLCC 1M1AC 5AV8C 4J8WA 3VH6A 4Z2MG 1KX3C 3AZFD 3MVDD 5GT0D 3REHC 4WU8D 4HGAC 1P3IA 3KWQB 3B6GA 3A6NB 1P3GB 3X1TB 1P3AD 1F66C 1M18D 3LJAD 3WKJC 5JRGD 3TU4C 5BNXA 3O62B 5C3IC 1TZYB 5B1LC 4Z66B 2PYOC 4CAYB 1P3FC 1ID3D 5B2ID 1P3AB 3AZID 1P3LA 3UTBD 3REJD 5GT0C 5B32A 3AFAA 4KUDD 5B2JB 1BH9A 4G91C 5AVBD 1S32B 5AVCD 4NE5A 5BT1C 3AV1A 5AV9B 3AZJD 5B24D 3AV2B 3LJAC 1EQZC 3LZ0C 5B1MA 3W96C 1ZLAA 3AZMB 3B0DB 4WU9A 1JFIA 3AN2C 1ID3C 5E5AD 5CPJA 5DNNA 3AZHD 2F8NA 4XZQB 3WA9B 1HQ3C 1N1JB 4ZUXD 3C1BD 5B0ZD 2RVQD 3AZND 2AROD 4JJNC 4NFTA 3WAAB 4KUDC 2CV5A 5JA4B 1B6WA 5G49B 5AVCC 3MGQC 3KWQA 5CPKD 3A6NA 4NE3A 1P3GA 1AOID 5DNMD 5B40B 4H9QB 3X1VB 3B0BA 3O62A 5E5AC 3VH6W 1TZYA 1M19C 4E45A 4Z66A 4Z5TC 4CAYA 3KUYD 1P3KC 3B6FC 4ZUXC 3MGSB 2RVQC 3AZNC 2AROC 2LY8A 4YM6D 5AV6D 1KX4C 2NQBD 4WNNB 3AZGB 3MGRD 5B2JA 5CPKC 5AV5B 3NQJB 1P3OD 5AV9A 5BS7C 3W97D 5B31D 3REID 3X1UB 4X23C 3AZMA 2NZDC 3KUYC 3UTAC 3AZEB 3MGPD 1KX5D 3WA9A 1N1JA 4G92C 5AV6C 3B0CT 2FJ7C 3WAAA 3UT9D 3AYWC 4R8PB 4J8UB 2L5AA 3LELD 5JA4A 5G49A 3C1CB 3W99D 3W97C 1P3PB 5B31C 5CPIB 3X1SB 5B40A 4J8VB 1P3ID 4UUZB 4H9QA 3REKB 3AZKC 3LELB 5AY8B 4EO5C 5GXQD 5B0YC 5F99D 3MGPC 5B33B 1P3BB 1M1AD 1KX5C 2F8NH 3RELD 3AZLC 1P34B 3WTPC 3MGSA 2YFWB 4YS3A 4DRAA 3W98B 3V9RB 4LD9A 3LZ1C 3UT9C 3AZGA 5GXQB 4QLCB 5AV8B 4J8XB 5AV5A 3NQJA 5CP6D 3W99C 1KX3B 3WKJD 3TU4D 3NQUB 3REHB 3KXBB 1P3IC 3R45B 5B1LD 2PYOD 1P3FD 1U35A 4ZBJB 5CHLB 1H3OB 1F66B 3RELC 3AZEA 4KGCD 4XUJB 1WWSA 5C3IB 4J8UA 3VH5T 5BT1D 5CP6C 1EQZD 3LZ0D 3AZFB 3MVDB 3AFAC 5GT0B 2CV5D 3W96D 4WU8B 2HIOD 1P3PA 5CPIA 1P3MA 5B32G 3AN2D 3X1SA 4J8VA 3AV1C 3REKA 3KSYA 5GSUA 5AY8A 1HQ3D 1M18B 4CSRB 5B1MC 3LJAB 4KGCC 5B33A 4E44A 5JRGB 4WU9C 5GT3D 4JJND 1P34A 2YFWA 5CPJC 5DNNC 1KU5A 3W98A 3V9RA 1ID3B 3MGQD 5B2IB 3AZIB 2F8NG 3UTBB 2HUEB 5AV8A 4J8XA 3REJB 2CV5C 1KX3A 2HIOC 4KUDB 5AVBB 3NQUA 3REHA 3KXBA 3KWQC 3A6NC 1P3GC 1M19D 5AVCB 3B6FD 4Z5TD 5FUGB 3MNNA 1P3KD 3AZJB 5B24B 1H3OA 5GT3C 1F66A 1TZYC 1KX4D 4NE6A 4Z66C 4XUJA 5E5AB 3AZHB 1P3KB 4ZUXB 3C1BB 3X1TA 5B0ZB 3AZNB 4H9PB 2AROB 3AZFA 3MVDA 1KX4B 5B2JC 4X23D 4WU8A 4H9NB 2NZDD 3UTAD 5CPKB 5AV9C 1P3AA 1AOIB 2IO5C 5DNMB 1M18A 5JRGA 3B0DC 2FJ7D 3AYWD 3KUYB 5BO0B 1S32A 3WA9C 5B2IA 4YS3D 3AZIA 3AV2A 4LD9D 4G92B 3UTBA 4YM6B 5AV6B 4H9OB 3WAAC 2NQBB 3REJA 3MGRB 4KUDA 3AZKD 5AVBA 5B0YD 5AVCA 1P3OB 5FUGA 4XZQA 3AZJA 5B24A 3WTPD 3AZLD 3W97B 5B31B 3REIB 3LZ1D 1U35D 4J8WD 4EO5B 3AZHA 3MGPB 1KX5B 4YS3C 3C1BA 5B0ZA 4LD9C 4H9RB 3AZNA 4H9PA 3AZGC 2BYMB 3B6GD 1Q9CA 3UT9B 3X1VA 5AV5C 4H9NA 4AWLC 1HTAA 3W99B 1AOIA 5DNMA 1WWIA 1P3IB 1U35C 4WNNA 4J8WC 5GSUD 5F99B 1P3LD 1M1AB 3RELB 5B32D 3AFAD 3B6GC 4YM6A 4HGAB 4H9OA 2NQBA 4J8UC 3X1UA 3MGRA 3AV1D 5KDMB 5CP6B 5B1MD 1ZLAD 3WKJB 1P3OA 4WU9D 3TU4B 5CPIC 1P3MC 3X1SC 4J8VC 5CPJD 5B1LB 5DNND 3REKC 2PYOB 3REIA 1P3FB 5GSUC 3MNND 2F8ND 5AY8C 4R8PA 1P3LC 4H9SA 2F8NK 3MGPA 4KGCB 5B32C 4WU9B 3C1CA 4M6BA 1JFIB 4H9RA 4G91B 2BYMA 3KWQD 3VH6T 4UUZA 3A6ND 1P3GD 3LELA 4J8XC 1P3BA 1ZLAC 1EQZB 3LZ0B 2CV5B 3W96B 3W99A 3KXBC 3B0CW 2HIOB 3O62D 1TZYD 4Z66D 3AN2B 3MNNC 4ZBJC 1HQ3B 2JSSA 5GXQA 5F99A 4QLCA 1M1AA 5GT3B 3RELA 4JJNB 4XUJC 3WTPE 5B2JD 3R45A 1S32D 3X1TC 3MGQB 5AV9D 3AV2D 3AZFC 3MVDC 5KDMA 5CP6A 3O62C 3WKJA 3AZMD 4WU8C 3TU4A 1M19B 5B1LA 2PYOA 2CWEA 4Z5TB 3B6FB 1P3AC 1P3FA 4XZQD 3WA9D 1M18C 2IO5B 5JRGC 4DRBA 4KGCA 3WAAD 2BYKB 5GT0A 1BH8B 1S32C 5B2IC 3AZIC 4WV4B 3AV2C 3UTBC 2HUEC 3REJC 4CSRA 3LJAA 5B40D 3LZ0A 3AZMC 1A7WA 1EQZA 3X1VD 5AVBC 3W96A 4X23B 2HIOA 2NZDB 3UTAB 3AN2A 1ID3A 3VH5W 4XZQC 3AZJC 5B24C 3MGSD 1HQ3A 4WZSB 5GT3A 4JJNA 2YFVB 3AZGD 2FJ7B 3AYWB 3AZHC 5AV5D 3C1BC 3MGQA 5B0ZC 4YS3B 1B67A 4LD9B 4KHAB 5B40C 3X1VC 3X1UD 1TAFB 3AZKB 5E5AA 1M19A 5B0YB 4AWLB 3B6FA 4Z5TA 3MGSC 3AZED 1P3KA 5BNVB 1BFMA 1AOIC 4ZUXA 5DNMC
chains in the Genus database with same CATH superfamily
3AZLB 4Z2MH 3WTPB 3A1KA 2AROA 3LZ1B 1U35B 1KX4A 2BYKA 4R8PD 4J8UD 4J8WB 1BH8A 3KFUG 5CPKA 3C1CD 4YM6C 1P3PD 2NQBC 5CPID 1P3MD 3B6GB 1ULYA 3X1SD 5BS7A 3X1UC 3MGRC 4J8VD 3REKD 1R4VA 4X23A 5AY8D 2NZDA 3AZEC 1P3BD 3KUYA 5B33D 3UTAA 1P3OC 5BO0A 5BNXB 1P34D 1P3MB 3REIC 3W98D 5AV6A 4R8PC 3IP4C 2YFVA 4H9SC 5GSUB 5B31G 2FJ7A 3AYWA 1P3LB 4QLCD 5AV8D 4J8XD 3C1CC 1KX3D 5B32B 1P3PC 3AFAB 1BH9B 4KHAA 3KXBD 3W97A 3REHD 5B31A 3LELC 3AV1B 1TAFA 3AZKA 1P3BC 5B33C 2G5HC 1F66D 5B1MB 5B0YA 1P34C 1ZLAB 1KX5A 5BNVA 3VH5A 3AZLA 3W98C 3WTPA 4XUJD 5CPJB 5DNNB 2F8NB 3MNNB 3LZ1A 5GXQC 3UT9A 3X1TD 1F1EA 5F99C 4QLCC 1M1AC 5AV8C 4J8WA 3VH6A 4Z2MG 1KX3C 3AZFD 3MVDD 5GT0D 3REHC 4WU8D 4HGAC 1P3IA 3KWQB 3B6GA 3A6NB 1P3GB 3X1TB 1P3AD 1F66C 1M18D 3LJAD 3WKJC 5JRGD 3TU4C 5BNXA 3O62B 5C3IC 1TZYB 5B1LC 4Z66B 2PYOC 2J8PA 4CAYB 1P3FC 1ID3D 3EPHA 5B2ID 1P3AB 3AZID 2Y2KA 1P3LA 3UTBD 3REJD 5GT0C 5B32A 3AFAA 4KUDD 5B2JB 1BH9A 2ZY2A 4G91C 5AVBD 1S32B 5AVCD 4NE5A 5BT1C 3AV1A 2DF4C 2F2AC 5AV9B 3AZJD 5B24D 3AV2B 3LJAC 1EQZC 3LZ0C 5B1MA 3W96C 1ZLAA 3AZMB 3B0DB 4WU9A 1JFIA 3AN2C 1ID3C 5E5AD 5CPJA 5DNNA 3AZHD 2F8NA 4XZQB 3WA9B 1HQ3C 1N1JB 4ZUXD 3C1BD 5B0ZD 2RVQD 3AZND 2AROD 4JJNC 4NFTA 3WAAB 4KUDC 2CV5A 2JCHA 5JA4B 1B6WA 5G49B 5AVCC 3MGQC 3KWQA 5CPKD 3A6NA 4NE3A 1P3GA 2RIQA 1AOID 5DNMD 5B40B 4H9QB 3X1VB 3EPJA 3B0BA 3O62A 5E5AC 3VH6W 1TZYA 1M19C 4E45A 4Z66A 4Z5TC 4CAYA 3KUYD 1P3KC 3B6FC 4ZUXC 3MGSB 2RVQC 3AZNC 4WJ3C 2AROC 2LY8A 4YM6D 5AV6D 1KX4C 2NQBD 4WNNB 3AZGB 3MGRD 5B2JA 5CPKC 5AV5B 3NQJB 1P3OD 3F6TA 2W8SA 5AV9A 5BS7C 3W97D 5B31D 3REID 3X1UB 4X23C 3AZMA 2NZDC 3KUYC 3UTAC 2Y2IA 3AZEB 3MGPD 3A1IA 1KX5D 3WA9A 1N1JA 4G92C 5AV6C 3B0CT 2FJ7C 3WAAA 3UT9D 3AYWC 4R8PB 4J8UB 2L5AA 3LELD 5JA4A 5G49A 3C1CB 3W99D 3W97C 1P3PB 5B31C 5CPIB 3X1SB 5B40A 4J8VB 1P3ID 4UUZB 4H9QA 3REKB 3AZKC 3LELB 5AY8B 4EO5C 2Y2OA 5GXQD 5B0YC 5F99D 3MGPC 5B33B 1P3BB 1M1AD 1KX5C 2F8NH 3RELD 3AZLC 1P34B 3WTPC 3MGSA 2YFWB 4YS3A 4DRAA 3W98B 3V9RB 4LD9A 3LZ1C 3UT9C 3AZGA 5GXQB 4QLCB 5AV8B 4J8XB 5AV5A 3NQJA 5CP6D 3W99C 1KX3B 3WKJD 3TU4D 3NQUB 3REHB 3KXBB 1P3IC 3R45B 5B1LD 2PYOD 1P3FD 1U35A 4ZBJB 5CHLB 1H3OB 1F66B 3RELC 3AZEA 4KGCD 4XUJB 1WWSA 5C3IB 4J8UA 3VH5T 5BT1D 5CP6C 1EQZD 3LZ0D 3AZFB 3MVDB 3AFAC 5GT0B 2CV5D 3AL0C 3W96D 4WU8B 2HIOD 1P3PA 5CPIA 1P3MA 5B32G 3AN2D 3X1SA 2XD5A 4J8VA 3AV1C 3REKA 2ZY5A 3KSYA 5GSUA 5AY8A 1HQ3D 1M18B 4CSRB 5B1MC 3LJAB 4KGCC 5B33A 4E44A 5JRGB 4WU9C 5GT3D 4JJND 1P34A 2YFWA 5CPJC 5DNNC 1KU5A 3W98A 2FFFB 3V9RA 1ID3B 3MGQD 5B2IB 3AZIB 2F8NG 3UTBB 2HUEB 5AV8A 4J8XA 3REJB 2CV5C 1KX3A 2HIOC 4KUDB 5AVBB 3NQUA 3REHA 3KXBA 3KWQC 3A6NC 1P3GC 1M19D 5AVCB 3B6FD 4Z5TD 2JE5A 5FUGB 3MNNA 1P3KD 3AZJB 5B24B 1H3OA 5GT3C 1F66A 1TZYC 1KX4D 4NE6A 4Z66C 4XUJA 3H0LC 5E5AB 3AZHB 1P3KB 4ZUXB 3C1BB 3X1TA 5B0ZB 3AZNB 4H9PB 2AROB 3H0MC 3AZFA 3MVDA 1KX4B 3FDDA 5B2JC 4X23D 4WU8A 4H9NB 2NZDD 3UTAD 5CPKB 5AV9C 1P3AA 1PZRA 2IO5C 1AOIB 5DNMB 1T3UA 1M18A 5JRGA 3B0DC 2FJ7D 3AYWD 4UPKA 3KUYB 5BO0B 1S32A 3WA9C 5B2IA 4YS3D 3AZIA 3AV2A 4LD9D 4G92B 3UTBA 2Y2HA 4YM6B 5AV6B 4H9OB 3WAAC 1W2EA 3REJA 2NQBB 2Y2LA 2UWXA 3MGRB 4KUDA 3AZKD 5AVBA 5B0YD 5AVCA 1P3OB 5FUGA 4XZQA 3AZJA 5B24A 3WTPD 3AZLD 3W97B 5B31B 3REIB 2G5IC 3LZ1D 1U35D 4J8WD 4EO5B 3AZHA 3MGPB 1KX5B 4YS3C 3C1BA 5B0ZA 4LD9C 2ZY3A 2Y2PA 4H9RB 3AZNA 4H9PA 3AZGC 2BYMB 3B6GD 1Q9CA 1Z2CB 3UT9B 3X1VA 3P5JB 5AV5C 4H9NA 4AWLC 1HTAA 3W99B 1AOIA 5DNMA 1WWIA 1P3IB 1U35C 4WNNA 2ZY4A 4J8WC 5GSUD 2DQNC 5F99B 1P3LD 1M1AB 3RELB 5B32D 3AFAD 3B6GC 4YM6A 4HGAB 4H9OA 2NQBA 4J8UC 3X1UA 3MGRA 3AV1D 5KDMB 5CP6B 5B1MD 4DQYB 1ZLAD 3WKJB 1P3OA 4WU9D 3TU4B 2VQRA 5CPIC 1P3MC 3X1SC 3EPKA 5CPJD 4J8VC 5B1LB 5DNND 3REKC 2PYOB 3REIA 1P3FB 5GSUC 3MNND 2F8ND 5AY8C 4R8PA 1P3LC 3EPLA 4H9SA 2F8NK 3MGPA 4KGCB 5B32C 4WU9B 3C1CA 4M6BA 1JFIB 4H9RA 4G91B 2BYMA 3KWQD 3VH6T 4UUZA 3A6ND 1P3GD 3LELA 4J8XC 1P3BA 1ZLAC 1EQZB 3LZ0B 2CV5B 3W96B 3W99A 3KXBC 3B0CW 2HIOB 3O62D 2Y2QA 1TZYD 4Z66D 3AN2B 3MNNC 4ZBJC 1HQ3B 2JSSA 5GXQA 5F99A 4QLCA 1M1AA 5GT3B 3RELA 4JJNB 4XUJC 3WTPE 5B2JD 3R45A 1S32D 3X1TC 3MGQB 2ZM5A 5AV9D 3AV2D 3AZFC 3MVDC 5KDMA 5CP6A 3O62C 3WKJA 3AZMD 4WU8C 3TU4A 2Y2JA 1M19B 5B1LA 2PYOA 2CWEA 4Z5TB 3B6FB 1P3AC 1P3FA 4XZQD 3WA9D 1M18C 2BG1A 2IO5B 5JRGC 4DRBA 4KGCA 2Y2MA 3WAAD 2BYKB 5GT0A 1BH8B 1S32C 5B2IC 3AZIC 4WV4B 3AV2C 3UTBC 2HUEC 3REJC 3H0RC 4CSRA 3LJAA 5B40D 3LZ0A 3AZMC 1A7WA 1EQZA 3X1VD 5AVBC 3W96A 4X23B 2HIOA 2NZDB 3UTAB 3AN2A 1ID3A 3VH5W 4XZQC 3AZJC 5B24C 3MGSD 2Y2GA 1HQ3A 4WZSB 5GT3A 2XD1A 4JJNA 2YFVB 3AZGD 2FJ7B 3AYWB 3AZHC 5AV5D 3C1BC 3MGQA 5B0ZC 4YS3B 3EG5B 1B67A 4LD9B 4KHAB 5B40C 3X1VC 3X1UD 1TAFB 3AZKB 2Y2NA 5E5AA 1M19A 5B0YB 4AWLB 3B6FA 4Z5TA 3MGSC 3AZED 1P3KA 5BNVB 1BFMA 1AOIC 4ZUXA 5DNMC
chains in the Genus database with same CATH topology
3AZLB 4Z2MH 3WTPB 3A1KA 2AROA 3LZ1B 1U35B 1KX4A 2BYKA 4R8PD 4J8UD 4J8WB 1BH8A 3KFUG 5CPKA 3C1CD 4YM6C 1P3PD 2NQBC 5CPID 1P3MD 3B6GB 1ULYA 3X1SD 5BS7A 3X1UC 3MGRC 4J8VD 3REKD 1R4VA 4X23A 5AY8D 2NZDA 3AZEC 1P3BD 3KUYA 5B33D 3UTAA 1P3OC 5BO0A 5BNXB 1P34D 1P3MB 3REIC 3W98D 5AV6A 4R8PC 3IP4C 2YFVA 4H9SC 5GSUB 5B31G 2FJ7A 3AYWA 1P3LB 4QLCD 5AV8D 4J8XD 3C1CC 1KX3D 5B32B 1P3PC 3AFAB 1BH9B 4KHAA 3KXBD 3W97A 3REHD 5B31A 3LELC 3AV1B 1TAFA 3AZKA 1P3BC 5B33C 2G5HC 1F66D 5B1MB 5B0YA 1P34C 1ZLAB 1KX5A 5BNVA 3VH5A 3AZLA 3W98C 3WTPA 4XUJD 5CPJB 5DNNB 2F8NB 3MNNB 3LZ1A 5GXQC 3UT9A 3X1TD 1F1EA 5F99C 4QLCC 1M1AC 5AV8C 4J8WA 3VH6A 4Z2MG 1KX3C 3AZFD 3MVDD 5GT0D 3REHC 4WU8D 4HGAC 1P3IA 3KWQB 3B6GA 3A6NB 1P3GB 3X1TB 1P3AD 1F66C 1M18D 3LJAD 3WKJC 5JRGD 3TU4C 5BNXA 3O62B 5C3IC 1TZYB 5B1LC 4Z66B 2PYOC 2J8PA 4CAYB 1P3FC 1ID3D 3EPHA 5B2ID 1P3AB 3AZID 2Y2KA 1P3LA 3UTBD 3REJD 5GT0C 5B32A 3AFAA 4KUDD 5B2JB 1BH9A 2ZY2A 4G91C 5AVBD 1S32B 5AVCD 4NE5A 5BT1C 3AV1A 2DF4C 2F2AC 5AV9B 3AZJD 5B24D 3AV2B 3LJAC 1EQZC 3LZ0C 5B1MA 3W96C 1ZLAA 3AZMB 3B0DB 4WU9A 1JFIA 3AN2C 1ID3C 5E5AD 5CPJA 5DNNA 3AZHD 2F8NA 4XZQB 3WA9B 1HQ3C 1N1JB 4ZUXD 3C1BD 5B0ZD 2RVQD 3AZND 2AROD 4JJNC 4NFTA 3WAAB 4KUDC 2CV5A 2JCHA 5JA4B 1B6WA 5G49B 5AVCC 3MGQC 3KWQA 5CPKD 3A6NA 4NE3A 1P3GA 2RIQA 1AOID 5DNMD 5B40B 4H9QB 3X1VB 3EPJA 3B0BA 3O62A 5E5AC 3VH6W 1TZYA 1M19C 4E45A 4Z66A 4Z5TC 4CAYA 3KUYD 1P3KC 3B6FC 4ZUXC 3MGSB 2RVQC 3AZNC 4WJ3C 2AROC 2LY8A 4YM6D 5AV6D 1KX4C 2NQBD 4WNNB 3AZGB 3MGRD 5B2JA 5CPKC 5AV5B 3NQJB 1P3OD 3F6TA 2W8SA 5AV9A 5BS7C 3W97D 5B31D 3REID 3X1UB 4X23C 3AZMA 2NZDC 3KUYC 3UTAC 2Y2IA 3AZEB 3MGPD 3A1IA 1KX5D 3WA9A 1N1JA 4G92C 5AV6C 3B0CT 2FJ7C 3WAAA 3UT9D 3AYWC 4R8PB 4J8UB 2L5AA 3LELD 5JA4A 5G49A 3C1CB 3W99D 3W97C 1P3PB 5B31C 5CPIB 3X1SB 5B40A 4J8VB 1P3ID 4UUZB 4H9QA 3REKB 3AZKC 3LELB 5AY8B 4EO5C 2Y2OA 5GXQD 5B0YC 5F99D 3MGPC 5B33B 1P3BB 1M1AD 1KX5C 2F8NH 3RELD 3AZLC 1P34B 3WTPC 3MGSA 2YFWB 4YS3A 4DRAA 3W98B 3V9RB 4LD9A 3LZ1C 3UT9C 3AZGA 5GXQB 4QLCB 5AV8B 4J8XB 5AV5A 3NQJA 5CP6D 3W99C 1KX3B 3WKJD 3TU4D 3NQUB 3REHB 3KXBB 1P3IC 3R45B 5B1LD 2PYOD 1P3FD 1U35A 4ZBJB 5CHLB 1H3OB 1F66B 3RELC 3AZEA 4KGCD 4XUJB 1WWSA 5C3IB 4J8UA 3VH5T 5BT1D 5CP6C 1EQZD 3LZ0D 3AZFB 3MVDB 3AFAC 5GT0B 2CV5D 3AL0C 3W96D 4WU8B 2HIOD 1P3PA 5CPIA 1P3MA 5B32G 3AN2D 3X1SA 2XD5A 4J8VA 3AV1C 3REKA 2ZY5A 3KSYA 5GSUA 5AY8A 1HQ3D 1M18B 4CSRB 5B1MC 3LJAB 4KGCC 5B33A 4E44A 5JRGB 4WU9C 5GT3D 4JJND 1P34A 2YFWA 5CPJC 5DNNC 1KU5A 3W98A 2FFFB 3V9RA 1ID3B 3MGQD 5B2IB 3AZIB 2F8NG 3UTBB 2HUEB 5AV8A 4J8XA 3REJB 2CV5C 1KX3A 2HIOC 4KUDB 5AVBB 3NQUA 3REHA 3KXBA 3KWQC 3A6NC 1P3GC 1M19D 5AVCB 3B6FD 4Z5TD 2JE5A 5FUGB 3MNNA 1P3KD 3AZJB 5B24B 1H3OA 5GT3C 1F66A 1TZYC 1KX4D 4NE6A 4Z66C 4XUJA 3H0LC 5E5AB 3AZHB 1P3KB 4ZUXB 3C1BB 3X1TA 5B0ZB 3AZNB 4H9PB 2AROB 3H0MC 3AZFA 3MVDA 1KX4B 3FDDA 5B2JC 4X23D 4WU8A 4H9NB 2NZDD 3UTAD 5CPKB 5AV9C 1P3AA 1PZRA 2IO5C 1AOIB 5DNMB 1T3UA 1M18A 5JRGA 3B0DC 2FJ7D 3AYWD 4UPKA 3KUYB 5BO0B 1S32A 3WA9C 5B2IA 4YS3D 3AZIA 3AV2A 4LD9D 4G92B 3UTBA 2Y2HA 4YM6B 5AV6B 4H9OB 3WAAC 1W2EA 3REJA 2NQBB 2Y2LA 2UWXA 3MGRB 4KUDA 3AZKD 5AVBA 5B0YD 5AVCA 1P3OB 5FUGA 4XZQA 3AZJA 5B24A 3WTPD 3AZLD 3W97B 5B31B 3REIB 2G5IC 3LZ1D 1U35D 4J8WD 4EO5B 3AZHA 3MGPB 1KX5B 4YS3C 3C1BA 5B0ZA 4LD9C 2ZY3A 2Y2PA 4H9RB 3AZNA 4H9PA 3AZGC 2BYMB 3B6GD 1Q9CA 1Z2CB 3UT9B 3X1VA 3P5JB 5AV5C 4H9NA 4AWLC 1HTAA 3W99B 1AOIA 5DNMA 1WWIA 1P3IB 1U35C 4WNNA 2ZY4A 4J8WC 5GSUD 2DQNC 5F99B 1P3LD 1M1AB 3RELB 5B32D 3AFAD 3B6GC 4YM6A 4HGAB 4H9OA 2NQBA 4J8UC 3X1UA 3MGRA 3AV1D 5KDMB 5CP6B 5B1MD 4DQYB 1ZLAD 3WKJB 1P3OA 4WU9D 3TU4B 2VQRA 5CPIC 1P3MC 3X1SC 3EPKA 5CPJD 4J8VC 5B1LB 5DNND 3REKC 2PYOB 3REIA 1P3FB 5GSUC 3MNND 2F8ND 5AY8C 4R8PA 1P3LC 3EPLA 4H9SA 2F8NK 3MGPA 4KGCB 5B32C 4WU9B 3C1CA 4M6BA 1JFIB 4H9RA 4G91B 2BYMA 3KWQD 3VH6T 4UUZA 3A6ND 1P3GD 3LELA 4J8XC 1P3BA 1ZLAC 1EQZB 3LZ0B 2CV5B 3W96B 3W99A 3KXBC 3B0CW 2HIOB 3O62D 2Y2QA 1TZYD 4Z66D 3AN2B 3MNNC 4ZBJC 1HQ3B 2JSSA 5GXQA 5F99A 4QLCA 1M1AA 5GT3B 3RELA 4JJNB 4XUJC 3WTPE 5B2JD 3R45A 1S32D 3X1TC 3MGQB 2ZM5A 5AV9D 3AV2D 3AZFC 3MVDC 5KDMA 5CP6A 3O62C 3WKJA 3AZMD 4WU8C 3TU4A 2Y2JA 1M19B 5B1LA 2PYOA 2CWEA 4Z5TB 3B6FB 1P3AC 1P3FA 4XZQD 3WA9D 1M18C 2BG1A 2IO5B 5JRGC 4DRBA 4KGCA 2Y2MA 3WAAD 2BYKB 5GT0A 1BH8B 1S32C 5B2IC 3AZIC 4WV4B 3AV2C 3UTBC 2HUEC 3REJC 3H0RC 4CSRA 3LJAA 5B40D 3LZ0A 3AZMC 1A7WA 1EQZA 3X1VD 5AVBC 3W96A 4X23B 2HIOA 2NZDB 3UTAB 3AN2A 1ID3A 3VH5W 4XZQC 3AZJC 5B24C 3MGSD 2Y2GA 1HQ3A 4WZSB 5GT3A 2XD1A 4JJNA 2YFVB 3AZGD 2FJ7B 3AYWB 3AZHC 5AV5D 3C1BC 3MGQA 5B0ZC 4YS3B 3EG5B 1B67A 4LD9B 4KHAB 5B40C 3X1VC 3X1UD 1TAFB 3AZKB 2Y2NA 5E5AA 1M19A 5B0YB 4AWLB 3B6FA 4Z5TA 3MGSC 3AZED 1P3KA 5BNVB 1BFMA 1AOIC 4ZUXA 5DNMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL B;  4Z2M H;  3WTP B;  2ARO A;  3LZ1 B;  1U35 B;  1KX4 A;  2BYK A;  4R8P D;  4J8U D;  4J8W B;  1BH8 A;  5CPK A;  3C1C D;  4YM6 C;  1P3P D;  2NQB C;  5CPI D;  1P3M D;  3B6G B;  1ULY A;  3X1S D;  5BS7 A;  3X1U C;  3MGR C;  4J8V D;  3REK D;  1R4V A;  4X23 A;  5AY8 D;  2NZD A;  3AZE C;  1P3B D;  3KUY A;  5B33 D;  3UTA A;  1P3O C;  5BO0 A;  5BNX B;  1P34 D;  1P3M B;  3REI C;  3W98 D;  5AV6 A;  4R8P C;  2YFV A;  4H9S C;  5GSU B;  5B31 G;  2FJ7 A;  3AYW A;  1P3L B;  4QLC D;  5AV8 D;  4J8X D;  3C1C C;  1KX3 D;  5B32 B;  1P3P C;  3AFA B;  1BH9 B;  4KHA A;  3KXB D;  3W97 A;  3REH D;  5B31 A;  3LEL C;  3AV1 B;  1TAF A;  3AZK A;  1P3B C;  5B33 C;  1F66 D;  5B1M B;  5B0Y A;  1P34 C;  1ZLA B;  1KX5 A;  5BNV A;  3VH5 A;  3AZL A;  3W98 C;  3WTP A;  4XUJ D;  5CPJ B;  5DNN B;  2F8N B;  3MNN B;  3LZ1 A;  5GXQ C;  3UT9 A;  3X1T D;  1F1E A;  5F99 C;  4QLC C;  1M1A C;  5AV8 C;  4J8W A;  3VH6 A;  4Z2M G;  1KX3 C;  3AZF D;  3MVD D;  5GT0 D;  3REH C;  4WU8 D;  4HGA C;  1P3I A;  3KWQ B;  3B6G A;  3A6N B;  1P3G B;  3X1T B;  1P3A D;  1F66 C;  1M18 D;  3LJA D;  3WKJ C;  5JRG D;  3TU4 C;  5BNX A;  3O62 B;  5C3I C;  1TZY B;  5B1L C;  4Z66 B;  2PYO C;  4CAY B;  1P3F C;  1ID3 D;  5B2I D;  1P3A B;  3AZI D;  1P3L A;  3UTB D;  3REJ D;  5GT0 C;  5B32 A;  3AFA A;  4KUD D;  5B2J B;  1BH9 A;  4G91 C;  5AVB D;  1S32 B;  5AVC D;  4NE5 A;  5BT1 C;  3AV1 A;  5AV9 B;  3AZJ D;  5B24 D;  3AV2 B;  3LJA C;  1EQZ C;  3LZ0 C;  5B1M A;  3W96 C;  1ZLA A;  3AZM B;  3B0D B;  4WU9 A;  1JFI A;  3AN2 C;  1ID3 C;  5E5A D;  5CPJ A;  5DNN A;  3AZH D;  2F8N A;  4XZQ B;  3WA9 B;  1HQ3 C;  1N1J B;  4ZUX D;  3C1B D;  5B0Z D;  2RVQ D;  3AZN D;  2ARO D;  4JJN C;  4NFT A;  3WAA B;  4KUD C;  2CV5 A;  5JA4 B;  1B6W A;  5G49 B;  5AVC C;  3MGQ C;  3KWQ A;  5CPK D;  3A6N A;  4NE3 A;  1P3G A;  1AOI D;  5DNM D;  5B40 B;  4H9Q B;  3X1V B;  3B0B A;  3O62 A;  5E5A C;  3VH6 W;  1TZY A;  1M19 C;  4E45 A;  4Z66 A;  4Z5T C;  4CAY A;  3KUY D;  1P3K C;  3B6F C;  4ZUX C;  3MGS B;  2RVQ C;  3AZN C;  2ARO C;  2LY8 A;  4YM6 D;  5AV6 D;  1KX4 C;  2NQB D;  4WNN B;  3AZG B;  3MGR D;  5B2J A;  5CPK C;  5AV5 B;  3NQJ B;  1P3O D;  5AV9 A;  5BS7 C;  3W97 D;  5B31 D;  3REI D;  3X1U B;  4X23 C;  3AZM A;  2NZD C;  3KUY C;  3UTA C;  3AZE B;  3MGP D;  1KX5 D;  3WA9 A;  1N1J A;  4G92 C;  5AV6 C;  3B0C T;  2FJ7 C;  3WAA A;  3UT9 D;  3AYW C;  4R8P B;  4J8U B;  2L5A A;  3LEL D;  5JA4 A;  5G49 A;  3C1C B;  3W99 D;  3W97 C;  1P3P B;  5B31 C;  5CPI B;  3X1S B;  5B40 A;  4J8V B;  1P3I D;  4UUZ B;  4H9Q A;  3REK B;  3AZK C;  3LEL B;  5AY8 B;  4EO5 C;  5GXQ D;  5B0Y C;  5F99 D;  3MGP C;  5B33 B;  1P3B B;  1M1A D;  1KX5 C;  2F8N H;  3REL D;  3AZL C;  1P34 B;  3WTP C;  3MGS A;  2YFW B;  4YS3 A;  4DRA A;  3W98 B;  3V9R B;  4LD9 A;  3LZ1 C;  3UT9 C;  3AZG A;  5GXQ B;  4QLC B;  5AV8 B;  4J8X B;  5AV5 A;  3NQJ A;  5CP6 D;  3W99 C;  1KX3 B;  3WKJ D;  3TU4 D;  3NQU B;  3REH B;  3KXB B;  1P3I C;  3R45 B;  5B1L D;  2PYO D;  1P3F D;  1U35 A;  4ZBJ B;  5CHL B;  1H3O B;  1F66 B;  3REL C;  3AZE A;  4KGC D;  4XUJ B;  1WWS A;  5C3I B;  4J8U A;  3VH5 T;  5BT1 D;  5CP6 C;  1EQZ D;  3LZ0 D;  3AZF B;  3MVD B;  3AFA C;  5GT0 B;  2CV5 D;  3W96 D;  4WU8 B;  2HIO D;  1P3P A;  5CPI A;  1P3M A;  5B32 G;  3AN2 D;  3X1S A;  4J8V A;  3AV1 C;  3REK A;  3KSY A;  5GSU A;  5AY8 A;  1HQ3 D;  1M18 B;  4CSR B;  5B1M C;  3LJA B;  4KGC C;  5B33 A;  4E44 A;  5JRG B;  4WU9 C;  5GT3 D;  4JJN D;  1P34 A;  2YFW A;  5CPJ C;  5DNN C;  1KU5 A;  3W98 A;  3V9R A;  1ID3 B;  3MGQ D;  5B2I B;  3AZI B;  2F8N G;  3UTB B;  2HUE B;  5AV8 A;  4J8X A;  3REJ B;  2CV5 C;  1KX3 A;  2HIO C;  4KUD B;  5AVB B;  3NQU A;  3REH A;  3KXB A;  3KWQ C;  3A6N C;  1P3G C;  1M19 D;  5AVC B;  3B6F D;  4Z5T D;  5FUG B;  3MNN A;  1P3K D;  3AZJ B;  5B24 B;  1H3O A;  5GT3 C;  1F66 A;  1TZY C;  1KX4 D;  4NE6 A;  4Z66 C;  4XUJ A;  5E5A B;  3AZH B;  1P3K B;  4ZUX B;  3C1B B;  3X1T A;  5B0Z B;  3AZN B;  4H9P B;  2ARO B;  3AZF A;  3MVD A;  1KX4 B;  5B2J C;  4X23 D;  4WU8 A;  4H9N B;  2NZD D;  3UTA D;  5CPK B;  5AV9 C;  1P3A A;  1AOI B;  2IO5 C;  5DNM B;  1M18 A;  5JRG A;  3B0D C;  2FJ7 D;  3AYW D;  3KUY B;  5BO0 B;  1S32 A;  3WA9 C;  5B2I A;  4YS3 D;  3AZI A;  3AV2 A;  4LD9 D;  4G92 B;  3UTB A;  4YM6 B;  5AV6 B;  4H9O B;  3WAA C;  2NQB B;  3REJ A;  3MGR B;  4KUD A;  3AZK D;  5AVB A;  5B0Y D;  5AVC A;  1P3O B;  5FUG A;  4XZQ A;  3AZJ A;  5B24 A;  3WTP D;  3AZL D;  3W97 B;  5B31 B;  3REI B;  3LZ1 D;  1U35 D;  4J8W D;  4EO5 B;  3AZH A;  3MGP B;  1KX5 B;  4YS3 C;  3C1B A;  5B0Z A;  4LD9 C;  4H9R B;  3AZN A;  4H9P A;  3AZG C;  2BYM B;  3B6G D;  1Q9C A;  3UT9 B;  3X1V A;  5AV5 C;  4H9N A;  4AWL C;  1HTA A;  3W99 B;  1AOI A;  5DNM A;  1WWI A;  1P3I B;  1U35 C;  4WNN A;  4J8W C;  5GSU D;  5F99 B;  1P3L D;  1M1A B;  3REL B;  5B32 D;  3AFA D;  3B6G C;  4YM6 A;  4HGA B;  4H9O A;  2NQB A;  4J8U C;  3X1U A;  3MGR A;  3AV1 D;  5KDM B;  5CP6 B;  5B1M D;  1ZLA D;  3WKJ B;  1P3O A;  4WU9 D;  3TU4 B;  5CPI C;  1P3M C;  3X1S C;  4J8V C;  5CPJ D;  5B1L B;  5DNN D;  3REK C;  2PYO B;  3REI A;  1P3F B;  5GSU C;  3MNN D;  2F8N D;  5AY8 C;  4R8P A;  1P3L C;  4H9S A;  2F8N K;  3MGP A;  4KGC B;  5B32 C;  4WU9 B;  3C1C A;  4M6B A;  1JFI B;  4H9R A;  4G91 B;  2BYM A;  3KWQ D;  3VH6 T;  4UUZ A;  3A6N D;  1P3G D;  3LEL A;  4J8X C;  1P3B A;  1ZLA C;  1EQZ B;  3LZ0 B;  2CV5 B;  3W96 B;  3W99 A;  3KXB C;  3B0C W;  2HIO B;  3O62 D;  1TZY D;  4Z66 D;  3AN2 B;  3MNN C;  4ZBJ C;  1HQ3 B;  2JSS A;  5GXQ A;  5F99 A;  4QLC A;  1M1A A;  5GT3 B;  3REL A;  4JJN B;  4XUJ C;  3WTP E;  5B2J D;  3R45 A;  1S32 D;  3X1T C;  3MGQ B;  5AV9 D;  3AV2 D;  3AZF C;  3MVD C;  5KDM A;  5CP6 A;  3O62 C;  3WKJ A;  3AZM D;  4WU8 C;  3TU4 A;  1M19 B;  5B1L A;  2PYO A;  2CWE A;  4Z5T B;  3B6F B;  1P3A C;  1P3F A;  4XZQ D;  3WA9 D;  1M18 C;  2IO5 B;  5JRG C;  4DRB A;  4KGC A;  3WAA D;  2BYK B;  5GT0 A;  1BH8 B;  1S32 C;  5B2I C;  3AZI C;  4WV4 B;  3AV2 C;  3UTB C;  2HUE C;  3REJ C;  4CSR A;  3LJA A;  5B40 D;  3LZ0 A;  3AZM C;  1A7W A;  1EQZ A;  3X1V D;  5AVB C;  3W96 A;  4X23 B;  2HIO A;  2NZD B;  3UTA B;  3AN2 A;  1ID3 A;  3VH5 W;  4XZQ C;  3AZJ C;  5B24 C;  3MGS D;  1HQ3 A;  4WZS B;  5GT3 A;  4JJN A;  2YFV B;  3AZG D;  2FJ7 B;  3AYW B;  3AZH C;  5AV5 D;  3C1B C;  3MGQ A;  5B0Z C;  4YS3 B;  1B67 A;  4LD9 B;  4KHA B;  5B40 C;  3X1V C;  3X1U D;  1TAF B;  3AZK B;  5E5A A;  1M19 A;  5B0Y B;  4AWL B;  3B6F A;  4Z5T A;  3MGS C;  3AZE D;  1P3K A;  5BNV B;  1BFM A;  1AOI C;  4ZUX A;  5DNM C; 
#chains in the Genus database with same CATH topology
 3AZL B;  4Z2M H;  3WTP B;  3A1K A;  2ARO A;  3LZ1 B;  1U35 B;  1KX4 A;  2BYK A;  4R8P D;  4J8U D;  4J8W B;  1BH8 A;  3KFU G;  5CPK A;  3C1C D;  4YM6 C;  1P3P D;  2NQB C;  5CPI D;  1P3M D;  3B6G B;  1ULY A;  3X1S D;  5BS7 A;  3X1U C;  3MGR C;  4J8V D;  3REK D;  1R4V A;  4X23 A;  5AY8 D;  2NZD A;  3AZE C;  1P3B D;  3KUY A;  5B33 D;  3UTA A;  1P3O C;  5BO0 A;  5BNX B;  1P34 D;  1P3M B;  3REI C;  3W98 D;  5AV6 A;  4R8P C;  3IP4 C;  2YFV A;  4H9S C;  5GSU B;  5B31 G;  2FJ7 A;  3AYW A;  1P3L B;  4QLC D;  5AV8 D;  4J8X D;  3C1C C;  1KX3 D;  5B32 B;  1P3P C;  3AFA B;  1BH9 B;  4KHA A;  3KXB D;  3W97 A;  3REH D;  5B31 A;  3LEL C;  3AV1 B;  1TAF A;  3AZK A;  1P3B C;  5B33 C;  2G5H C;  1F66 D;  5B1M B;  5B0Y A;  1P34 C;  1ZLA B;  1KX5 A;  5BNV A;  3VH5 A;  3AZL A;  3W98 C;  3WTP A;  4XUJ D;  5CPJ B;  5DNN B;  2F8N B;  3MNN B;  3LZ1 A;  5GXQ C;  3UT9 A;  3X1T D;  1F1E A;  5F99 C;  4QLC C;  1M1A C;  5AV8 C;  4J8W A;  3VH6 A;  4Z2M G;  1KX3 C;  3AZF D;  3MVD D;  5GT0 D;  3REH C;  4WU8 D;  4HGA C;  1P3I A;  3KWQ B;  3B6G A;  3A6N B;  1P3G B;  3X1T B;  1P3A D;  1F66 C;  1M18 D;  3LJA D;  3WKJ C;  5JRG D;  3TU4 C;  5BNX A;  3O62 B;  5C3I C;  1TZY B;  5B1L C;  4Z66 B;  2PYO C;  2J8P A;  4CAY B;  1P3F C;  1ID3 D;  3EPH A;  5B2I D;  1P3A B;  3AZI D;  2Y2K A;  1P3L A;  3UTB D;  3REJ D;  5GT0 C;  5B32 A;  3AFA A;  4KUD D;  5B2J B;  1BH9 A;  2ZY2 A;  4G91 C;  5AVB D;  1S32 B;  5AVC D;  4NE5 A;  5BT1 C;  3AV1 A;  2DF4 C;  2F2A C;  5AV9 B;  3AZJ D;  5B24 D;  3AV2 B;  3LJA C;  1EQZ C;  3LZ0 C;  5B1M A;  3W96 C;  1ZLA A;  3AZM B;  3B0D B;  4WU9 A;  1JFI A;  3AN2 C;  1ID3 C;  5E5A D;  5CPJ A;  5DNN A;  3AZH D;  2F8N A;  4XZQ B;  3WA9 B;  1HQ3 C;  1N1J B;  4ZUX D;  3C1B D;  5B0Z D;  2RVQ D;  3AZN D;  2ARO D;  4JJN C;  4NFT A;  3WAA B;  4KUD C;  2CV5 A;  2JCH A;  5JA4 B;  1B6W A;  5G49 B;  5AVC C;  3MGQ C;  3KWQ A;  5CPK D;  3A6N A;  4NE3 A;  1P3G A;  2RIQ A;  1AOI D;  5DNM D;  5B40 B;  4H9Q B;  3X1V B;  3EPJ A;  3B0B A;  3O62 A;  5E5A C;  3VH6 W;  1TZY A;  1M19 C;  4E45 A;  4Z66 A;  4Z5T C;  4CAY A;  3KUY D;  1P3K C;  3B6F C;  4ZUX C;  3MGS B;  2RVQ C;  3AZN C;  4WJ3 C;  2ARO C;  2LY8 A;  4YM6 D;  5AV6 D;  1KX4 C;  2NQB D;  4WNN B;  3AZG B;  3MGR D;  5B2J A;  5CPK C;  5AV5 B;  3NQJ B;  1P3O D;  3F6T A;  2W8S A;  5AV9 A;  5BS7 C;  3W97 D;  5B31 D;  3REI D;  3X1U B;  4X23 C;  3AZM A;  2NZD C;  3KUY C;  3UTA C;  2Y2I A;  3AZE B;  3MGP D;  3A1I A;  1KX5 D;  3WA9 A;  1N1J A;  4G92 C;  5AV6 C;  3B0C T;  2FJ7 C;  3WAA A;  3UT9 D;  3AYW C;  4R8P B;  4J8U B;  2L5A A;  3LEL D;  5JA4 A;  5G49 A;  3C1C B;  3W99 D;  3W97 C;  1P3P B;  5B31 C;  5CPI B;  3X1S B;  5B40 A;  4J8V B;  1P3I D;  4UUZ B;  4H9Q A;  3REK B;  3AZK C;  3LEL B;  5AY8 B;  4EO5 C;  2Y2O A;  5GXQ D;  5B0Y C;  5F99 D;  3MGP C;  5B33 B;  1P3B B;  1M1A D;  1KX5 C;  2F8N H;  3REL D;  3AZL C;  1P34 B;  3WTP C;  3MGS A;  2YFW B;  4YS3 A;  4DRA A;  3W98 B;  3V9R B;  4LD9 A;  3LZ1 C;  3UT9 C;  3AZG A;  5GXQ B;  4QLC B;  5AV8 B;  4J8X B;  5AV5 A;  3NQJ A;  5CP6 D;  3W99 C;  1KX3 B;  3WKJ D;  3TU4 D;  3NQU B;  3REH B;  3KXB B;  1P3I C;  3R45 B;  5B1L D;  2PYO D;  1P3F D;  1U35 A;  4ZBJ B;  5CHL B;  1H3O B;  1F66 B;  3REL C;  3AZE A;  4KGC D;  4XUJ B;  1WWS A;  5C3I B;  4J8U A;  3VH5 T;  5BT1 D;  5CP6 C;  1EQZ D;  3LZ0 D;  3AZF B;  3MVD B;  3AFA C;  5GT0 B;  2CV5 D;  3AL0 C;  3W96 D;  4WU8 B;  2HIO D;  1P3P A;  5CPI A;  1P3M A;  5B32 G;  3AN2 D;  3X1S A;  2XD5 A;  4J8V A;  3AV1 C;  3REK A;  2ZY5 A;  3KSY A;  5GSU A;  5AY8 A;  1HQ3 D;  1M18 B;  4CSR B;  5B1M C;  3LJA B;  4KGC C;  5B33 A;  4E44 A;  5JRG B;  4WU9 C;  5GT3 D;  4JJN D;  1P34 A;  2YFW A;  5CPJ C;  5DNN C;  1KU5 A;  3W98 A;  2FFF B;  3V9R A;  1ID3 B;  3MGQ D;  5B2I B;  3AZI B;  2F8N G;  3UTB B;  2HUE B;  5AV8 A;  4J8X A;  3REJ B;  2CV5 C;  1KX3 A;  2HIO C;  4KUD B;  5AVB B;  3NQU A;  3REH A;  3KXB A;  3KWQ C;  3A6N C;  1P3G C;  1M19 D;  5AVC B;  3B6F D;  4Z5T D;  2JE5 A;  5FUG B;  3MNN A;  1P3K D;  3AZJ B;  5B24 B;  1H3O A;  5GT3 C;  1F66 A;  1TZY C;  1KX4 D;  4NE6 A;  4Z66 C;  4XUJ A;  3H0L C;  5E5A B;  3AZH B;  1P3K B;  4ZUX B;  3C1B B;  3X1T A;  5B0Z B;  3AZN B;  4H9P B;  2ARO B;  3H0M C;  3AZF A;  3MVD A;  1KX4 B;  3FDD A;  5B2J C;  4X23 D;  4WU8 A;  4H9N B;  2NZD D;  3UTA D;  5CPK B;  5AV9 C;  1P3A A;  1PZR A;  2IO5 C;  1AOI B;  5DNM B;  1T3U A;  1M18 A;  5JRG A;  3B0D C;  2FJ7 D;  3AYW D;  4UPK A;  3KUY B;  5BO0 B;  1S32 A;  3WA9 C;  5B2I A;  4YS3 D;  3AZI A;  3AV2 A;  4LD9 D;  4G92 B;  3UTB A;  2Y2H A;  4YM6 B;  5AV6 B;  4H9O B;  3WAA C;  1W2E A;  3REJ A;  2NQB B;  2Y2L A;  2UWX A;  3MGR B;  4KUD A;  3AZK D;  5AVB A;  5B0Y D;  5AVC A;  1P3O B;  5FUG A;  4XZQ A;  3AZJ A;  5B24 A;  3WTP D;  3AZL D;  3W97 B;  5B31 B;  3REI B;  2G5I C;  3LZ1 D;  1U35 D;  4J8W D;  4EO5 B;  3AZH A;  3MGP B;  1KX5 B;  4YS3 C;  3C1B A;  5B0Z A;  4LD9 C;  2ZY3 A;  2Y2P A;  4H9R B;  3AZN A;  4H9P A;  3AZG C;  2BYM B;  3B6G D;  1Q9C A;  1Z2C B;  3UT9 B;  3X1V A;  3P5J B;  5AV5 C;  4H9N A;  4AWL C;  1HTA A;  3W99 B;  1AOI A;  5DNM A;  1WWI A;  1P3I B;  1U35 C;  4WNN A;  2ZY4 A;  4J8W C;  5GSU D;  2DQN C;  5F99 B;  1P3L D;  1M1A B;  3REL B;  5B32 D;  3AFA D;  3B6G C;  4YM6 A;  4HGA B;  4H9O A;  2NQB A;  4J8U C;  3X1U A;  3MGR A;  3AV1 D;  5KDM B;  5CP6 B;  5B1M D;  4DQY B;  1ZLA D;  3WKJ B;  1P3O A;  4WU9 D;  3TU4 B;  2VQR A;  5CPI C;  1P3M C;  3X1S C;  3EPK A;  5CPJ D;  4J8V C;  5B1L B;  5DNN D;  3REK C;  2PYO B;  3REI A;  1P3F B;  5GSU C;  3MNN D;  2F8N D;  5AY8 C;  4R8P A;  1P3L C;  3EPL A;  4H9S A;  2F8N K;  3MGP A;  4KGC B;  5B32 C;  4WU9 B;  3C1C A;  4M6B A;  1JFI B;  4H9R A;  4G91 B;  2BYM A;  3KWQ D;  3VH6 T;  4UUZ A;  3A6N D;  1P3G D;  3LEL A;  4J8X C;  1P3B A;  1ZLA C;  1EQZ B;  3LZ0 B;  2CV5 B;  3W96 B;  3W99 A;  3KXB C;  3B0C W;  2HIO B;  3O62 D;  2Y2Q A;  1TZY D;  4Z66 D;  3AN2 B;  3MNN C;  4ZBJ C;  1HQ3 B;  2JSS A;  5GXQ A;  5F99 A;  4QLC A;  1M1A A;  5GT3 B;  3REL A;  4JJN B;  4XUJ C;  3WTP E;  5B2J D;  3R45 A;  1S32 D;  3X1T C;  3MGQ B;  2ZM5 A;  5AV9 D;  3AV2 D;  3AZF C;  3MVD C;  5KDM A;  5CP6 A;  3O62 C;  3WKJ A;  3AZM D;  4WU8 C;  3TU4 A;  2Y2J A;  1M19 B;  5B1L A;  2PYO A;  2CWE A;  4Z5T B;  3B6F B;  1P3A C;  1P3F A;  4XZQ D;  3WA9 D;  1M18 C;  2BG1 A;  2IO5 B;  5JRG C;  4DRB A;  4KGC A;  2Y2M A;  3WAA D;  2BYK B;  5GT0 A;  1BH8 B;  1S32 C;  5B2I C;  3AZI C;  4WV4 B;  3AV2 C;  3UTB C;  2HUE C;  3REJ C;  3H0R C;  4CSR A;  3LJA A;  5B40 D;  3LZ0 A;  3AZM C;  1A7W A;  1EQZ A;  3X1V D;  5AVB C;  3W96 A;  4X23 B;  2HIO A;  2NZD B;  3UTA B;  3AN2 A;  1ID3 A;  3VH5 W;  4XZQ C;  3AZJ C;  5B24 C;  3MGS D;  2Y2G A;  1HQ3 A;  4WZS B;  5GT3 A;  2XD1 A;  4JJN A;  2YFV B;  3AZG D;  2FJ7 B;  3AYW B;  3AZH C;  5AV5 D;  3C1B C;  3MGQ A;  5B0Z C;  4YS3 B;  3EG5 B;  1B67 A;  4LD9 B;  4KHA B;  5B40 C;  3X1V C;  3X1U D;  1TAF B;  3AZK B;  2Y2N A;  5E5A A;  1M19 A;  5B0Y B;  4AWL B;  3B6F A;  4Z5T A;  3MGS C;  3AZE D;  1P3K A;  5BNV B;  1BFM A;  1AOI C;  4ZUX A;  5DNM C; 
#chains in the Genus database with same CATH homology
 3AZL B;  4Z2M H;  3WTP B;  3A1K A;  2ARO A;  3LZ1 B;  1U35 B;  1KX4 A;  2BYK A;  4R8P D;  4J8U D;  4J8W B;  1BH8 A;  3KFU G;  5CPK A;  3C1C D;  4YM6 C;  1P3P D;  2NQB C;  5CPI D;  1P3M D;  3B6G B;  1ULY A;  3X1S D;  5BS7 A;  3X1U C;  3MGR C;  4J8V D;  3REK D;  1R4V A;  4X23 A;  5AY8 D;  2NZD A;  3AZE C;  1P3B D;  3KUY A;  5B33 D;  3UTA A;  1P3O C;  5BO0 A;  5BNX B;  1P34 D;  1P3M B;  3REI C;  3W98 D;  5AV6 A;  4R8P C;  3IP4 C;  2YFV A;  4H9S C;  5GSU B;  5B31 G;  2FJ7 A;  3AYW A;  1P3L B;  4QLC D;  5AV8 D;  4J8X D;  3C1C C;  1KX3 D;  5B32 B;  1P3P C;  3AFA B;  1BH9 B;  4KHA A;  3KXB D;  3W97 A;  3REH D;  5B31 A;  3LEL C;  3AV1 B;  1TAF A;  3AZK A;  1P3B C;  5B33 C;  2G5H C;  1F66 D;  5B1M B;  5B0Y A;  1P34 C;  1ZLA B;  1KX5 A;  5BNV A;  3VH5 A;  3AZL A;  3W98 C;  3WTP A;  4XUJ D;  5CPJ B;  5DNN B;  2F8N B;  3MNN B;  3LZ1 A;  5GXQ C;  3UT9 A;  3X1T D;  1F1E A;  5F99 C;  4QLC C;  1M1A C;  5AV8 C;  4J8W A;  3VH6 A;  4Z2M G;  1KX3 C;  3AZF D;  3MVD D;  5GT0 D;  3REH C;  4WU8 D;  4HGA C;  1P3I A;  3KWQ B;  3B6G A;  3A6N B;  1P3G B;  3X1T B;  1P3A D;  1F66 C;  1M18 D;  3LJA D;  3WKJ C;  5JRG D;  3TU4 C;  5BNX A;  3O62 B;  5C3I C;  1TZY B;  5B1L C;  4Z66 B;  2PYO C;  2J8P A;  4CAY B;  1P3F C;  1ID3 D;  3EPH A;  5B2I D;  1P3A B;  3AZI D;  2Y2K A;  1P3L A;  3UTB D;  3REJ D;  5GT0 C;  5B32 A;  3AFA A;  4KUD D;  5B2J B;  1BH9 A;  2ZY2 A;  4G91 C;  5AVB D;  1S32 B;  5AVC D;  4NE5 A;  5BT1 C;  3AV1 A;  2DF4 C;  2F2A C;  5AV9 B;  3AZJ D;  5B24 D;  3AV2 B;  3LJA C;  1EQZ C;  3LZ0 C;  5B1M A;  3W96 C;  1ZLA A;  3AZM B;  3B0D B;  4WU9 A;  1JFI A;  3AN2 C;  1ID3 C;  5E5A D;  5CPJ A;  5DNN A;  3AZH D;  2F8N A;  4XZQ B;  3WA9 B;  1HQ3 C;  1N1J B;  4ZUX D;  3C1B D;  5B0Z D;  2RVQ D;  3AZN D;  2ARO D;  4JJN C;  4NFT A;  3WAA B;  4KUD C;  2CV5 A;  2JCH A;  5JA4 B;  1B6W A;  5G49 B;  5AVC C;  3MGQ C;  3KWQ A;  5CPK D;  3A6N A;  4NE3 A;  1P3G A;  2RIQ A;  1AOI D;  5DNM D;  5B40 B;  4H9Q B;  3X1V B;  3EPJ A;  3B0B A;  3O62 A;  5E5A C;  3VH6 W;  1TZY A;  1M19 C;  4E45 A;  4Z66 A;  4Z5T C;  4CAY A;  3KUY D;  1P3K C;  3B6F C;  4ZUX C;  3MGS B;  2RVQ C;  3AZN C;  4WJ3 C;  2ARO C;  2LY8 A;  4YM6 D;  5AV6 D;  1KX4 C;  2NQB D;  4WNN B;  3AZG B;  3MGR D;  5B2J A;  5CPK C;  5AV5 B;  3NQJ B;  1P3O D;  3F6T A;  2W8S A;  5AV9 A;  5BS7 C;  3W97 D;  5B31 D;  3REI D;  3X1U B;  4X23 C;  3AZM A;  2NZD C;  3KUY C;  3UTA C;  2Y2I A;  3AZE B;  3MGP D;  3A1I A;  1KX5 D;  3WA9 A;  1N1J A;  4G92 C;  5AV6 C;  3B0C T;  2FJ7 C;  3WAA A;  3UT9 D;  3AYW C;  4R8P B;  4J8U B;  2L5A A;  3LEL D;  5JA4 A;  5G49 A;  3C1C B;  3W99 D;  3W97 C;  1P3P B;  5B31 C;  5CPI B;  3X1S B;  5B40 A;  4J8V B;  1P3I D;  4UUZ B;  4H9Q A;  3REK B;  3AZK C;  3LEL B;  5AY8 B;  4EO5 C;  2Y2O A;  5GXQ D;  5B0Y C;  5F99 D;  3MGP C;  5B33 B;  1P3B B;  1M1A D;  1KX5 C;  2F8N H;  3REL D;  3AZL C;  1P34 B;  3WTP C;  3MGS A;  2YFW B;  4YS3 A;  4DRA A;  3W98 B;  3V9R B;  4LD9 A;  3LZ1 C;  3UT9 C;  3AZG A;  5GXQ B;  4QLC B;  5AV8 B;  4J8X B;  5AV5 A;  3NQJ A;  5CP6 D;  3W99 C;  1KX3 B;  3WKJ D;  3TU4 D;  3NQU B;  3REH B;  3KXB B;  1P3I C;  3R45 B;  5B1L D;  2PYO D;  1P3F D;  1U35 A;  4ZBJ B;  5CHL B;  1H3O B;  1F66 B;  3REL C;  3AZE A;  4KGC D;  4XUJ B;  1WWS A;  5C3I B;  4J8U A;  3VH5 T;  5BT1 D;  5CP6 C;  1EQZ D;  3LZ0 D;  3AZF B;  3MVD B;  3AFA C;  5GT0 B;  2CV5 D;  3AL0 C;  3W96 D;  4WU8 B;  2HIO D;  1P3P A;  5CPI A;  1P3M A;  5B32 G;  3AN2 D;  3X1S A;  2XD5 A;  4J8V A;  3AV1 C;  3REK A;  2ZY5 A;  3KSY A;  5GSU A;  5AY8 A;  1HQ3 D;  1M18 B;  4CSR B;  5B1M C;  3LJA B;  4KGC C;  5B33 A;  4E44 A;  5JRG B;  4WU9 C;  5GT3 D;  4JJN D;  1P34 A;  2YFW A;  5CPJ C;  5DNN C;  1KU5 A;  3W98 A;  2FFF B;  3V9R A;  1ID3 B;  3MGQ D;  5B2I B;  3AZI B;  2F8N G;  3UTB B;  2HUE B;  5AV8 A;  4J8X A;  3REJ B;  2CV5 C;  1KX3 A;  2HIO C;  4KUD B;  5AVB B;  3NQU A;  3REH A;  3KXB A;  3KWQ C;  3A6N C;  1P3G C;  1M19 D;  5AVC B;  3B6F D;  4Z5T D;  2JE5 A;  5FUG B;  3MNN A;  1P3K D;  3AZJ B;  5B24 B;  1H3O A;  5GT3 C;  1F66 A;  1TZY C;  1KX4 D;  4NE6 A;  4Z66 C;  4XUJ A;  3H0L C;  5E5A B;  3AZH B;  1P3K B;  4ZUX B;  3C1B B;  3X1T A;  5B0Z B;  3AZN B;  4H9P B;  2ARO B;  3H0M C;  3AZF A;  3MVD A;  1KX4 B;  3FDD A;  5B2J C;  4X23 D;  4WU8 A;  4H9N B;  2NZD D;  3UTA D;  5CPK B;  5AV9 C;  1P3A A;  1PZR A;  2IO5 C;  1AOI B;  5DNM B;  1T3U A;  1M18 A;  5JRG A;  3B0D C;  2FJ7 D;  3AYW D;  4UPK A;  3KUY B;  5BO0 B;  1S32 A;  3WA9 C;  5B2I A;  4YS3 D;  3AZI A;  3AV2 A;  4LD9 D;  4G92 B;  3UTB A;  2Y2H A;  4YM6 B;  5AV6 B;  4H9O B;  3WAA C;  1W2E A;  3REJ A;  2NQB B;  2Y2L A;  2UWX A;  3MGR B;  4KUD A;  3AZK D;  5AVB A;  5B0Y D;  5AVC A;  1P3O B;  5FUG A;  4XZQ A;  3AZJ A;  5B24 A;  3WTP D;  3AZL D;  3W97 B;  5B31 B;  3REI B;  2G5I C;  3LZ1 D;  1U35 D;  4J8W D;  4EO5 B;  3AZH A;  3MGP B;  1KX5 B;  4YS3 C;  3C1B A;  5B0Z A;  4LD9 C;  2ZY3 A;  2Y2P A;  4H9R B;  3AZN A;  4H9P A;  3AZG C;  2BYM B;  3B6G D;  1Q9C A;  1Z2C B;  3UT9 B;  3X1V A;  3P5J B;  5AV5 C;  4H9N A;  4AWL C;  1HTA A;  3W99 B;  1AOI A;  5DNM A;  1WWI A;  1P3I B;  1U35 C;  4WNN A;  2ZY4 A;  4J8W C;  5GSU D;  2DQN C;  5F99 B;  1P3L D;  1M1A B;  3REL B;  5B32 D;  3AFA D;  3B6G C;  4YM6 A;  4HGA B;  4H9O A;  2NQB A;  4J8U C;  3X1U A;  3MGR A;  3AV1 D;  5KDM B;  5CP6 B;  5B1M D;  4DQY B;  1ZLA D;  3WKJ B;  1P3O A;  4WU9 D;  3TU4 B;  2VQR A;  5CPI C;  1P3M C;  3X1S C;  3EPK A;  5CPJ D;  4J8V C;  5B1L B;  5DNN D;  3REK C;  2PYO B;  3REI A;  1P3F B;  5GSU C;  3MNN D;  2F8N D;  5AY8 C;  4R8P A;  1P3L C;  3EPL A;  4H9S A;  2F8N K;  3MGP A;  4KGC B;  5B32 C;  4WU9 B;  3C1C A;  4M6B A;  1JFI B;  4H9R A;  4G91 B;  2BYM A;  3KWQ D;  3VH6 T;  4UUZ A;  3A6N D;  1P3G D;  3LEL A;  4J8X C;  1P3B A;  1ZLA C;  1EQZ B;  3LZ0 B;  2CV5 B;  3W96 B;  3W99 A;  3KXB C;  3B0C W;  2HIO B;  3O62 D;  2Y2Q A;  1TZY D;  4Z66 D;  3AN2 B;  3MNN C;  4ZBJ C;  1HQ3 B;  2JSS A;  5GXQ A;  5F99 A;  4QLC A;  1M1A A;  5GT3 B;  3REL A;  4JJN B;  4XUJ C;  3WTP E;  5B2J D;  3R45 A;  1S32 D;  3X1T C;  3MGQ B;  2ZM5 A;  5AV9 D;  3AV2 D;  3AZF C;  3MVD C;  5KDM A;  5CP6 A;  3O62 C;  3WKJ A;  3AZM D;  4WU8 C;  3TU4 A;  2Y2J A;  1M19 B;  5B1L A;  2PYO A;  2CWE A;  4Z5T B;  3B6F B;  1P3A C;  1P3F A;  4XZQ D;  3WA9 D;  1M18 C;  2BG1 A;  2IO5 B;  5JRG C;  4DRB A;  4KGC A;  2Y2M A;  3WAA D;  2BYK B;  5GT0 A;  1BH8 B;  1S32 C;  5B2I C;  3AZI C;  4WV4 B;  3AV2 C;  3UTB C;  2HUE C;  3REJ C;  3H0R C;  4CSR A;  3LJA A;  5B40 D;  3LZ0 A;  3AZM C;  1A7W A;  1EQZ A;  3X1V D;  5AVB C;  3W96 A;  4X23 B;  2HIO A;  2NZD B;  3UTA B;  3AN2 A;  1ID3 A;  3VH5 W;  4XZQ C;  3AZJ C;  5B24 C;  3MGS D;  2Y2G A;  1HQ3 A;  4WZS B;  5GT3 A;  2XD1 A;  4JJN A;  2YFV B;  3AZG D;  2FJ7 B;  3AYW B;  3AZH C;  5AV5 D;  3C1B C;  3MGQ A;  5B0Z C;  4YS3 B;  3EG5 B;  1B67 A;  4LD9 B;  4KHA B;  5B40 C;  3X1V C;  3X1U D;  1TAF B;  3AZK B;  2Y2N A;  5E5A A;  1M19 A;  5B0Y B;  4AWL B;  3B6F A;  4Z5T A;  3MGS C;  3AZE D;  1P3K A;  5BNV B;  1BFM A;  1AOI C;  4ZUX A;  5DNM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...