3W99C

Crystal structure of human nucleosome core particle lacking h4 n-terminal region
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w99C00
3AZKD 3MGQD 2F8NB 1P3PC 1P3PD 4YM6C 5JRGB 3NQJB 3MVDB 3WKJA 5AVCC 3MVDD 5AVCD 5B31G 2FJ7C 3AZGB 5B33C 5CPJD 5AV6A 1H3OB 4EO5C 4YS3A 1JFIB 3W98A 4H9QB 3WTPB 4Z66C 5C3IC 5B24C 1AOIC 3AN2D 4G91B 5B24D 5F99B 4X23B 1P3GA 4HGAC 4KHAB 3WA9A 4WV4B 4J8UC 5CPKA 4J8UD 5B1LC 3X1UA 5DNMC 1P3IB 3MGPC 3X1VD 1S32C 1S32D 2PYOB 2F8NA 1HQ3D 3NQJA 3AZLC 1M19B 4H9OA 5B2IC 2HUEC 3AZGA 5BS7A 5JA4B 1H3OA 1JFIA 3WTPA 3AZIC 5F99A 4X23A 3AZJC 1KX3A 3AZJD 2IO5C 4KHAA 5GXQC 5BT1D 2YFVA 1TZYD 1P34C 5DNNB 1M1AB 1P3IA 3MNNC 3MNND 2L5AA 3LZ0B 3AZMC 4R8PC 3W97C 3AZED 3X1TD 3W96C 3AZFC 4G92B 5B31B 4XZQD 3C1BD 3B0CW 1M19A 5GT3B 3AV1D 5AY8B 3VH5W 3REJB 2AROD 3AZHC 3AZHD 5GT3D 1P3AB 4WU8C 2HIOC 5B40B 2HIOD 3REHD 1P3KA 2BYKB 4M6BA 3LJAC 3LJAD 5B0YC 1EQZD 4J8VB 4NFTA 3KUYB 1KX5C 1P3LB 4Z5TB 5DNNA 1KX4B 3MGRA 4JJNC 1WWIA 5B1MA 4LD9B 4KGCD 3VH6A 1ID3C 2JSSA 2NQBD 2NZDD 5E5AC 2YFWB 3KWQD 4QLCD 1R4VA 4J8WC 5B31A 5AV5B 4AWLB 3W99B 5AY8A 4H9RB 5AV5D 3REJA 3AV2D 3B6FC 1P3AA 3V9RA 3B6FD 5KDMB 5B40A 3REIB 3WTPE 3UTBC 3UT9B 4J8XC 3REID 4E44A 3UTAD 3KXBC 3A6NB 4J8VA 3UT9D 2CV5D 1F66C 4H9NA 1F66D 3KUYA 4ZBJC 3A6ND 4Z5TA 1KX4A 4CAYA 1U35B 5B32B 3LELD 5GT0B 4LD9A 1P3FA 4ZUXA 5GSUC 5B2JC 1N1JB 3REKA 1P3BC 1P3OC 1P3OD 3LZ1C 3O62C 2YFWA 3LZ1D 3O62D 4WU9C 3AZNB 5CP6A 1M18B 3R45B 4H9RA 3MGSD 5CPIC 3RELD 5AV8B 3X1SC 5AVBD 4KUDD 3B6GC 3AFAC 2BYMB 3AFAD 1P3MD 1U35A 5B32A 4H9SC 1N1JA 3AZKB 3MGQB 1P3PB 5B0ZA 3AZNA 4WNNB 4E45A 3TU4A 1M18A 3B0DC 3WKJC 3AYWA 4YM6D 5AVCB 5AV8A 5BNVB 5CPJB 4NE3A 2FJ7D 5AV6C 5B33D 4YS3C 5AV9A 3C1CA 3W98C 3W98D 3AN2B 5B24B 4Z66D 1BH8B 2BYMA 1P3GC 4HGAB 1AOID 4J8UB 3WA9C 4XUJA 3WA9D 5CPKC 5DNMB 3X1UC 3AZKA 5B1LD 3MGQA 3X1VB 5DNMD 1S32B 3MGPD 1P3PA 4WNNA 1HQ3B 2CWEA 4DRBA 5JRGA 3MVDA 3AZLD 3AZGC 5B2ID 5CPJA 5BS7C 3NQUB 3VH6W 3WTPC 3AN2A 5B24A 4H9QA 4G91C 5F99C 3AZID 4X23C 3AZJB 2IO5B 1KX3C 3B0BA 5GXQB 1TZYB 1P34B 5GXQD 3WAAC 3WAAD 3MNNB 1P34D 1P3IC 3X1VA 5BO0B 3B0CT 5B32G 4R8PB 3AZMD 3AZEB 1HQ3A 2PYOA 3X1TB 1WWSA 1F1EA 3VH5T 4R8PD 4XZQB 3C1BB 3W97D 3AV1B 1M19C 3AZFD 3W96D 2AROB 3AZHB 4WU8B 2HIOB 3REHB 3NQUA 4WU8D 5JA4A 1P3KC 3LJAB 1EQZB 5FUGB 5B0YD 1TZYA 1BFMA 3MNNA 1KX5D 3MGRC 1M1AA 4KGCB 3MGRD 5B1MC 5B1MD 4JJND 1TAFB 2NQBB 5BO0A 3LZ0A 2NZDB 3AZEA 1ZLAC 1ID3D 1ZLAD 1KU5A 3X1TA 3KWQB 4QLCB 4XZQA 3C1BA 4J8WB 5E5AD 5B31C 3AV1A 3AV2B 4J8WD 2AROA 5AY8C 5GT3A 3REJC 3B6FB 1P3AC 3REHA 5B40C 3UTBB 2BYKA 3UTAB 3UTBD 2CV5B 1EQZA 5FUGA 4J8XD 4J8VC 1F66B 4ZBJB 3KXBD 3KUYC 5G49B 4Z5TC 1P3LA 1KX4C 3LELB 4KGCA 4LD9C 1P3FC 1TAFA 4ZUXC 1P3FD 1P3OB 2NQBA 2NZDA 3REKC 3LZ1B 5GSUD 3O62B 5B2JD 4QLCA 3KWQA 1P3BD 4WU9D 5CP6C 5AV5A 3AV2A 3MGSB 3RELB 3W99A 5CPID 5AVBB 5KDMA 3X1SD 4KUDB 3REIA 3UTAA 3UT9A 2CV5A 3B6GD 3A6NA 3AFAB 1P3MB 5G49A 5BNXB 3LELA 1U35C 5GT0A 1P3OA 2F8NK 5B0ZC 3AZNC 3TU4C 3TU4D 3B0DB 4YM6B 3MGSA 1M18C 3RELA 3AYWC 3R45A 3AYWD 3WKJD 5AV8C 2FJ7B 5AVBA 4NE5A 4KUDA 5B33B 5AV6B 3W98B 4EO5B 5AV9C 5AV6D 5AV9D 3C1CC 3C1CD 4Z66B 4YS3D 1P3MA 5C3IB 1AOIB 1P3GD 3WA9B 4XUJC 4XUJD 5B1LB 5CPKD 3AZKC 3X1UD 3MGQC 3MGPB 5CHLB 2F8ND 4YM6A 5JRGC 3MVDC 5JRGD 4H9OB 3AZLB 5AVCA 3VH6T 5B2IB 2FJ7A 2HUEB 5CPJC 5B33A 5BNVA 3AZGD 3AN2C 4NE6A 4Z66A 3AZIB 3WTPD 1AOIA 1KX3B 1BH8A 5F99D 4X23D 2YFVB 1KX3D 4J8UA 3WAAB 5B1LA 5DNMA 3X1VC 3MGPA 1P3ID 3AZMB 1S32A 1HQ3C 2PYOC 3W97B 2PYOD 3AZFB 3W96B 3AZLA 5B2IA 1M19D 1P3KB 3AZIA 1P3KD 3KSYA 3AZJA 1BH9B 5B0YB 5BT1C 1TZYC 5GXQA 3WAAA 1KX5B 1P34A 3MGRB 5DNNC 1M1AC 5B1MB 5DNND 2LY8A 4JJNB 1M1AD 3AZMA 3LZ0C 1ID3B 1ZLAB 4Z2MH 3LZ0D 3AZEC 4R8PA 3W97A 3X1TC 5E5AB 4DRAA 4XZQC 3C1BC 3W96A 3AZFA 4CSRB 2F8NH 3AV1C 4G92C 2AROC 5B31D 5GT3C 3AZHA 3V9RB 5AY8D 3REHC 4WU8A 3REJD 2HIOA 1P3AD 5B40D 4J8XB 3LJAA 1EQZC 1BH9A 5B0YA 3KXBB 4H9NB 4J8VD 1KX5A 4CAYB 3KUYD 1P3LC 1P3LD 4KGCC 4Z5TD 2RVQC 4JJNA 1KX4D 2RVQD 1P3FB 4ZUXB 2NQBC 5GSUB 3REKB 1ID3A 1ZLAA 4LD9D 2NZDC 5B2JB 1P3BB 4ZUXD 4Z2MG 5E5AA 4QLCC 3KWQC 3REKD 1ULYA 4WU9B 5CP6B 4CSRA 4J8WA 5AV5C 3AV2C 2F8NG 4AWLC 5CP6D 3W99C 3W99D 5CPIB 3B6FA 1A7WA 3X1SB 1B67A 1HTAA 4H9PB 3REIC 3UTBA 4J8XA 3UTAC 1B6WA 3UT9C 2CV5C 3B6GB 3KXBA 4UUZB 3A6NC 1F66A 3VH5A 3LELC 4WZSB 5B32C 1U35D 5GT0C 5GSUA 5B32D 5GT0D 5B2JA 1P3BA 3LZ1A 3O62A 5B0ZB 4WU9A 3TU4B 5B0ZD 3AZND 3MGSC 3AYWB 3RELC 3WKJB 1M18D 5CPIA 3X1SA 5AVBC 5AV8D 4H9PA 4KUDC 1Q9CA 5AV9B 3C1CB 3B6GA 4YS3B 4UUZA 1P3MC 3AFAA 1P3GB 4XUJB 5BNXA 5CPKB 3X1UB 4H9SA
chains in the Genus database with same CATH superfamily
3AZKD 3MGQD 2G5HC 2F8NB 1P3PC 1P3PD 4YM6C 5JRGB 3NQJB 3MVDB 3WKJA 5AVCC 3MVDD 5AVCD 5B31G 2FJ7C 3AZGB 5B33C 4WJ3C 5CPJD 5AV6A 1H3OB 4EO5C 4YS3A 1JFIB 3W98A 4H9QB 3WTPB 4Z66C 5C3IC 5B24C 1AOIC 2ZM5A 4G91B 5B24D 5F99B 4X23B 3AN2D 1P3GA 3AL0C 2JE5A 4HGAC 4KHAB 3WA9A 4WV4B 4J8UC 5CPKA 4J8UD 5B1LC 3X1UA 5DNMC 1P3IB 3MGPC 3X1VD 1S32C 1S32D 2PYOB 2F8NA 2Y2IA 1HQ3D 3NQJA 3AZLC 1M19B 4H9OA 5B2IC 2HUEC 3AZGA 5BS7A 5JA4B 1H3OA 1JFIA 3WTPA 3AZIC 5F99A 4X23A 3AZJC 1KX3A 3AZJD 2IO5C 4KHAA 5GXQC 5BT1D 2YFVA 1TZYD 1P34C 5DNNB 1M1AB 1P3IA 3MNNC 3MNND 2L5AA 3LZ0B 3AZMC 4R8PC 3IP4C 3W97C 3AZED 3X1TD 3W96C 3AZFC 4G92B 5B31B 4XZQD 3C1BD 3B0CW 1M19A 5GT3B 3AV1D 5AY8B 3VH5W 3REJB 2AROD 3AZHC 3AZHD 5GT3D 1P3AB 4WU8C 2HIOC 5B40B 2HIOD 3REHD 1P3KA 2BYKB 4M6BA 3LJAC 3LJAD 5B0YC 2Y2LA 1EQZD 4J8VB 4NFTA 3KUYB 2W8SA 1KX5C 1P3LB 4Z5TB 5DNNA 1KX4B 3MGRA 4JJNC 1WWIA 5B1MA 4LD9B 4KGCD 3VH6A 1ID3C 2JSSA 2NQBD 2NZDD 5E5AC 2YFWB 2Y2KA 3KWQD 4QLCD 1R4VA 4J8WC 5B31A 5AV5B 1W2EA 4AWLB 3W99B 5AY8A 4H9RB 5AV5D 3REJA 3AV2D 3B6FC 1P3AA 3V9RA 3B6FD 5KDMB 5B40A 3REIB 3WTPE 3UTBC 3UT9B 4J8XC 3REID 4E44A 3UTAD 3KXBC 3A6NB 4J8VA 3UT9D 2CV5D 1F66C 4H9NA 1F66D 3KUYA 4ZBJC 3A6ND 4Z5TA 1KX4A 4CAYA 1U35B 5B32B 3LELD 5GT0B 4LD9A 3H0MC 1P3FA 4ZUXA 5GSUC 3EPLA 3KFUG 5B2JC 1N1JB 3REKA 1P3BC 1P3OC 1P3OD 3LZ1C 3O62C 2YFWA 3LZ1D 3O62D 4WU9C 3AZNB 5CP6A 1M18B 2F2AC 4UPKA 3R45B 4H9RA 3MGSD 5CPIC 3RELD 5AV8B 3X1SC 3EPHA 5AVBD 4KUDD 3B6GC 3AFAC 2BYMB 3AFAD 1P3MD 2Y2PA 1U35A 5B32A 4H9SC 2Y2QA 1N1JA 3AZKB 3MGQB 1P3PB 5B0ZA 3AZNA 4WNNB 4E45A 3TU4A 1M18A 3B0DC 3WKJC 3AYWA 4YM6D 5AVCB 5AV8A 5BNVB 5CPJB 4NE3A 2FJ7D 2Y2GA 5AV6C 5B33D 4YS3C 5AV9A 3C1CA 3W98C 3W98D 3AN2B 5B24B 4Z66D 1BH8B 2BYMA 1P3GC 4HGAB 1AOID 4J8UB 3WA9C 4XUJA 3WA9D 5CPKC 5DNMB 3X1UC 3AZKA 5B1LD 3MGQA 3X1VB 5DNMD 1S32B 3A1KA 3MGPD 2ZY5A 1P3PA 4WNNA 1HQ3B 2CWEA 2XD5A 4DRBA 5JRGA 2ZY4A 3MVDA 3AZLD 3AZGC 5B2ID 5CPJA 5BS7C 3NQUB 2ZY2A 3VH6W 3WTPC 3AN2A 5B24A 4H9QA 4G91C 5F99C 3AZID 4X23C 3AZJB 2IO5B 1KX3C 3B0BA 5GXQB 1TZYB 1P34B 2DF4C 5GXQD 3WAAC 3WAAD 3MNNB 1P34D 1P3IC 3X1VA 2ZY3A 2Y2NA 5BO0B 3B0CT 5B32G 4R8PB 3AZMD 3AZEB 1HQ3A 2PYOA 3X1TB 1WWSA 1F1EA 3VH5T 4R8PD 4XZQB 3C1BB 3W97D 3AV1B 3A1IA 1M19C 3AZFD 3W96D 2Y2HA 2AROB 3AZHB 4WU8B 2HIOB 3REHB 3NQUA 4WU8D 5JA4A 1P3KC 3LJAB 3EPKA 1EQZB 5FUGB 5B0YD 1TZYA 1BFMA 2UWXA 3MNNA 1KX5D 3MGRC 1M1AA 4KGCB 3MGRD 5B1MC 5B1MD 4JJND 1TAFB 2NQBB 5BO0A 3LZ0A 2NZDB 3AZEA 1ZLAC 1ID3D 1ZLAD 1KU5A 3X1TA 3KWQB 4QLCB 4XZQA 3C1BA 4J8WB 5E5AD 5B31C 3AV1A 3AV2B 4J8WD 2AROA 5AY8C 5GT3A 3REJC 3B6FB 1P3AC 3REHA 5B40C 3UTBB 2BYKA 3UTAB 3UTBD 2CV5B 1EQZA 5FUGA 4J8XD 4J8VC 1F66B 4ZBJB 3KXBD 3KUYC 5G49B 4Z5TC 1P3LA 1KX4C 3LELB 4KGCA 2G5IC 4LD9C 1P3FC 1TAFA 4ZUXC 1P3FD 1P3OB 2NQBA 2NZDA 3REKC 3LZ1B 5GSUD 3O62B 5B2JD 4QLCA 3KWQA 1P3BD 4WU9D 5CP6C 5AV5A 3AV2A 3MGSB 3RELB 3W99A 5CPID 5AVBB 5KDMA 3X1SD 4KUDB 3REIA 3UTAA 3UT9A 2CV5A 3B6GD 3A6NA 3AFAB 1P3MB 5G49A 5BNXB 3LELA 4DQYB 1U35C 5GT0A 1Z2CB 1P3OA 2F8NK 3F6TA 5B0ZC 3AZNC 3TU4C 3TU4D 3B0DB 4YM6B 3MGSA 1M18C 3RELA 3AYWC 3R45A 3AYWD 3WKJD 5AV8C 2FJ7B 5AVBA 4NE5A 4KUDA 5B33B 5AV6B 3W98B 4EO5B 5AV9C 5AV6D 5AV9D 3C1CC 3C1CD 4Z66B 4YS3D 1P3MA 5C3IB 1AOIB 1P3GD 3WA9B 4XUJC 4XUJD 2Y2MA 5B1LB 5CPKD 3AZKC 3X1UD 3MGQC 3MGPB 5CHLB 2F8ND 4YM6A 5JRGC 3MVDC 5JRGD 4H9OB 3AZLB 5AVCA 3VH6T 5B2IB 2FJ7A 2HUEB 5CPJC 5B33A 5BNVA 3AZGD 3AN2C 4NE6A 4Z66A 3AZIB 3WTPD 1AOIA 1KX3B 2FFFB 1BH8A 5F99D 4X23D 2YFVB 1KX3D 4J8UA 3WAAB 5B1LA 5DNMA 3X1VC 3MGPA 1P3ID 3AZMB 1S32A 1HQ3C 2PYOC 3W97B 2PYOD 3AZFB 3W96B 3AZLA 5B2IA 1M19D 1P3KB 3AZIA 1P3KD 3KSYA 3AZJA 1BH9B 5B0YB 5BT1C 3P5JB 1TZYC 5GXQA 3WAAA 1KX5B 1P34A 3MGRB 5DNNC 1M1AC 5B1MB 5DNND 2LY8A 4JJNB 1M1AD 3AZMA 3LZ0C 1ID3B 1ZLAB 4Z2MH 3LZ0D 2JCHA 3AZEC 4R8PA 3W97A 3X1TC 5E5AB 4DRAA 4XZQC 3C1BC 1T3UA 3W96A 4CSRB 3AZFA 3AV1C 2F8NH 4G92C 2AROC 5B31D 5GT3C 3AZHA 3V9RB 5AY8D 3REHC 4WU8A 3REJD 3FDDA 2HIOA 1P3AD 2Y2OA 5B40D 4J8XB 3LJAA 1EQZC 1BH9A 5B0YA 3KXBB 4H9NB 4J8VD 2Y2JA 1KX5A 4CAYB 3KUYD 1P3LC 1P3LD 4KGCC 4Z5TD 2RVQC 4JJNA 1KX4D 2RVQD 1P3FB 4ZUXB 2NQBC 5GSUB 3REKB 1ID3A 1ZLAA 4LD9D 2NZDC 5B2JB 1P3BB 4ZUXD 4Z2MG 5E5AA 4QLCC 3KWQC 3REKD 1ULYA 3H0RC 4WU9B 5CP6B 4CSRA 4J8WA 5AV5C 3AV2C 2F8NG 4AWLC 5CP6D 2J8PA 3W99C 3W99D 5CPIB 3B6FA 1A7WA 3EPJA 3X1SB 1B67A 1HTAA 4H9PB 3REIC 3UTBA 4J8XA 3UTAC 1B6WA 3UT9C 2CV5C 3B6GB 2VQRA 2BG1A 3KXBA 4UUZB 3A6NC 1F66A 2RIQA 3VH5A 3LELC 4WZSB 5B32C 1U35D 5GT0C 5GSUA 5B32D 5GT0D 5B2JA 1P3BA 3LZ1A 3O62A 5B0ZB 4WU9A 3TU4B 5B0ZD 3AZND 3MGSC 1PZRA 3AYWB 3RELC 3WKJB 1M18D 5CPIA 3H0LC 3X1SA 5AVBC 2DQNC 3EG5B 5AV8D 4H9PA 4KUDC 1Q9CA 5AV9B 3C1CB 3B6GA 4YS3B 4UUZA 1P3MC 3AFAA 1P3GB 4XUJB 5BNXA 5CPKB 3X1UB 4H9SA 2XD1A
chains in the Genus database with same CATH topology
3AZKD 3MGQD 2G5HC 2F8NB 1P3PC 1P3PD 4YM6C 5JRGB 3NQJB 3MVDB 3WKJA 5AVCC 3MVDD 5AVCD 5B31G 2FJ7C 3AZGB 5B33C 4WJ3C 5CPJD 5AV6A 1H3OB 4EO5C 4YS3A 1JFIB 3W98A 4H9QB 3WTPB 4Z66C 5C3IC 5B24C 1AOIC 2ZM5A 4G91B 5B24D 5F99B 4X23B 3AN2D 1P3GA 3AL0C 2JE5A 4HGAC 4KHAB 3WA9A 4WV4B 4J8UC 5CPKA 4J8UD 5B1LC 3X1UA 5DNMC 1P3IB 3MGPC 3X1VD 1S32C 1S32D 2PYOB 2F8NA 2Y2IA 1HQ3D 3NQJA 3AZLC 1M19B 4H9OA 5B2IC 2HUEC 3AZGA 5BS7A 5JA4B 1H3OA 1JFIA 3WTPA 3AZIC 5F99A 4X23A 3AZJC 1KX3A 3AZJD 2IO5C 4KHAA 5GXQC 5BT1D 2YFVA 1TZYD 1P34C 5DNNB 1M1AB 1P3IA 3MNNC 3MNND 2L5AA 3LZ0B 3AZMC 4R8PC 3IP4C 3W97C 3AZED 3X1TD 3W96C 3AZFC 4G92B 5B31B 4XZQD 3C1BD 3B0CW 1M19A 5GT3B 3AV1D 5AY8B 3VH5W 3REJB 2AROD 3AZHC 3AZHD 5GT3D 1P3AB 4WU8C 2HIOC 5B40B 2HIOD 3REHD 1P3KA 2BYKB 4M6BA 3LJAC 3LJAD 5B0YC 2Y2LA 1EQZD 4J8VB 4NFTA 3KUYB 2W8SA 1KX5C 1P3LB 4Z5TB 5DNNA 1KX4B 3MGRA 4JJNC 1WWIA 5B1MA 4LD9B 4KGCD 3VH6A 1ID3C 2JSSA 2NQBD 2NZDD 5E5AC 2YFWB 2Y2KA 3KWQD 4QLCD 1R4VA 4J8WC 5B31A 5AV5B 1W2EA 4AWLB 3W99B 5AY8A 4H9RB 5AV5D 3REJA 3AV2D 3B6FC 1P3AA 3V9RA 3B6FD 5KDMB 5B40A 3REIB 3WTPE 3UTBC 3UT9B 4J8XC 3REID 4E44A 3UTAD 3KXBC 3A6NB 4J8VA 3UT9D 2CV5D 1F66C 4H9NA 1F66D 3KUYA 4ZBJC 3A6ND 4Z5TA 1KX4A 4CAYA 1U35B 5B32B 3LELD 5GT0B 4LD9A 3H0MC 1P3FA 4ZUXA 5GSUC 3EPLA 3KFUG 5B2JC 1N1JB 3REKA 1P3BC 1P3OC 1P3OD 3LZ1C 3O62C 2YFWA 3LZ1D 3O62D 4WU9C 3AZNB 5CP6A 1M18B 2F2AC 4UPKA 3R45B 4H9RA 3MGSD 5CPIC 3RELD 5AV8B 3X1SC 3EPHA 5AVBD 4KUDD 3B6GC 3AFAC 2BYMB 3AFAD 1P3MD 2Y2PA 1U35A 5B32A 4H9SC 2Y2QA 1N1JA 3AZKB 3MGQB 1P3PB 5B0ZA 3AZNA 4WNNB 4E45A 3TU4A 1M18A 3B0DC 3WKJC 3AYWA 4YM6D 5AVCB 5AV8A 5BNVB 5CPJB 4NE3A 2FJ7D 2Y2GA 5AV6C 5B33D 4YS3C 5AV9A 3C1CA 3W98C 3W98D 3AN2B 5B24B 4Z66D 1BH8B 2BYMA 1P3GC 4HGAB 1AOID 4J8UB 3WA9C 4XUJA 3WA9D 5CPKC 5DNMB 3X1UC 3AZKA 5B1LD 3MGQA 3X1VB 5DNMD 1S32B 3A1KA 3MGPD 2ZY5A 1P3PA 4WNNA 1HQ3B 2CWEA 2XD5A 4DRBA 5JRGA 2ZY4A 3MVDA 3AZLD 3AZGC 5B2ID 5CPJA 5BS7C 3NQUB 2ZY2A 3VH6W 3WTPC 3AN2A 5B24A 4H9QA 4G91C 5F99C 3AZID 4X23C 3AZJB 2IO5B 1KX3C 3B0BA 5GXQB 1TZYB 1P34B 2DF4C 5GXQD 3WAAC 3WAAD 3MNNB 1P34D 1P3IC 3X1VA 2ZY3A 2Y2NA 5BO0B 3B0CT 5B32G 4R8PB 3AZMD 3AZEB 1HQ3A 2PYOA 3X1TB 1WWSA 1F1EA 3VH5T 4R8PD 4XZQB 3C1BB 3W97D 3AV1B 3A1IA 1M19C 3AZFD 3W96D 2Y2HA 2AROB 3AZHB 4WU8B 2HIOB 3REHB 3NQUA 4WU8D 5JA4A 1P3KC 3LJAB 3EPKA 1EQZB 5FUGB 5B0YD 1TZYA 1BFMA 2UWXA 3MNNA 1KX5D 3MGRC 1M1AA 4KGCB 3MGRD 5B1MC 5B1MD 4JJND 1TAFB 2NQBB 5BO0A 3LZ0A 2NZDB 3AZEA 1ZLAC 1ID3D 1ZLAD 1KU5A 3X1TA 3KWQB 4QLCB 4XZQA 3C1BA 4J8WB 5E5AD 5B31C 3AV1A 3AV2B 4J8WD 2AROA 5AY8C 5GT3A 3REJC 3B6FB 1P3AC 3REHA 5B40C 3UTBB 2BYKA 3UTAB 3UTBD 2CV5B 1EQZA 5FUGA 4J8XD 4J8VC 1F66B 4ZBJB 3KXBD 3KUYC 5G49B 4Z5TC 1P3LA 1KX4C 3LELB 4KGCA 2G5IC 4LD9C 1P3FC 1TAFA 4ZUXC 1P3FD 1P3OB 2NQBA 2NZDA 3REKC 3LZ1B 5GSUD 3O62B 5B2JD 4QLCA 3KWQA 1P3BD 4WU9D 5CP6C 5AV5A 3AV2A 3MGSB 3RELB 3W99A 5CPID 5AVBB 5KDMA 3X1SD 4KUDB 3REIA 3UTAA 3UT9A 2CV5A 3B6GD 3A6NA 3AFAB 1P3MB 5G49A 5BNXB 3LELA 4DQYB 1U35C 5GT0A 1Z2CB 1P3OA 2F8NK 3F6TA 5B0ZC 3AZNC 3TU4C 3TU4D 3B0DB 4YM6B 3MGSA 1M18C 3RELA 3AYWC 3R45A 3AYWD 3WKJD 5AV8C 2FJ7B 5AVBA 4NE5A 4KUDA 5B33B 5AV6B 3W98B 4EO5B 5AV9C 5AV6D 5AV9D 3C1CC 3C1CD 4Z66B 4YS3D 1P3MA 5C3IB 1AOIB 1P3GD 3WA9B 4XUJC 4XUJD 2Y2MA 5B1LB 5CPKD 3AZKC 3X1UD 3MGQC 3MGPB 5CHLB 2F8ND 4YM6A 5JRGC 3MVDC 5JRGD 4H9OB 3AZLB 5AVCA 3VH6T 5B2IB 2FJ7A 2HUEB 5CPJC 5B33A 5BNVA 3AZGD 3AN2C 4NE6A 4Z66A 3AZIB 3WTPD 1AOIA 1KX3B 2FFFB 1BH8A 5F99D 4X23D 2YFVB 1KX3D 4J8UA 3WAAB 5B1LA 5DNMA 3X1VC 3MGPA 1P3ID 3AZMB 1S32A 1HQ3C 2PYOC 3W97B 2PYOD 3AZFB 3W96B 3AZLA 5B2IA 1M19D 1P3KB 3AZIA 1P3KD 3KSYA 3AZJA 1BH9B 5B0YB 5BT1C 3P5JB 1TZYC 5GXQA 3WAAA 1KX5B 1P34A 3MGRB 5DNNC 1M1AC 5B1MB 5DNND 2LY8A 4JJNB 1M1AD 3AZMA 3LZ0C 1ID3B 1ZLAB 4Z2MH 3LZ0D 2JCHA 3AZEC 4R8PA 3W97A 3X1TC 5E5AB 4DRAA 4XZQC 3C1BC 1T3UA 3W96A 4CSRB 3AZFA 3AV1C 2F8NH 4G92C 2AROC 5B31D 5GT3C 3AZHA 3V9RB 5AY8D 3REHC 4WU8A 3REJD 3FDDA 2HIOA 1P3AD 2Y2OA 5B40D 4J8XB 3LJAA 1EQZC 1BH9A 5B0YA 3KXBB 4H9NB 4J8VD 2Y2JA 1KX5A 4CAYB 3KUYD 1P3LC 1P3LD 4KGCC 4Z5TD 2RVQC 4JJNA 1KX4D 2RVQD 1P3FB 4ZUXB 2NQBC 5GSUB 3REKB 1ID3A 1ZLAA 4LD9D 2NZDC 5B2JB 1P3BB 4ZUXD 4Z2MG 5E5AA 4QLCC 3KWQC 3REKD 1ULYA 3H0RC 4WU9B 5CP6B 4CSRA 4J8WA 5AV5C 3AV2C 2F8NG 4AWLC 5CP6D 2J8PA 3W99C 3W99D 5CPIB 3B6FA 1A7WA 3EPJA 3X1SB 1B67A 1HTAA 4H9PB 3REIC 3UTBA 4J8XA 3UTAC 1B6WA 3UT9C 2CV5C 3B6GB 2VQRA 2BG1A 3KXBA 4UUZB 3A6NC 1F66A 2RIQA 3VH5A 3LELC 4WZSB 5B32C 1U35D 5GT0C 5GSUA 5B32D 5GT0D 5B2JA 1P3BA 3LZ1A 3O62A 5B0ZB 4WU9A 3TU4B 5B0ZD 3AZND 3MGSC 1PZRA 3AYWB 3RELC 3WKJB 1M18D 5CPIA 3H0LC 3X1SA 5AVBC 2DQNC 3EG5B 5AV8D 4H9PA 4KUDC 1Q9CA 5AV9B 3C1CB 3B6GA 4YS3B 4UUZA 1P3MC 3AFAA 1P3GB 4XUJB 5BNXA 5CPKB 3X1UB 4H9SA 2XD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZK D;  3MGQ D;  2F8N B;  1P3P C;  1P3P D;  4YM6 C;  5JRG B;  3NQJ B;  3MVD B;  3WKJ A;  5AVC C;  3MVD D;  5AVC D;  5B31 G;  2FJ7 C;  3AZG B;  5B33 C;  5CPJ D;  5AV6 A;  1H3O B;  4EO5 C;  4YS3 A;  1JFI B;  3W98 A;  4H9Q B;  3WTP B;  4Z66 C;  5C3I C;  5B24 C;  1AOI C;  3AN2 D;  4G91 B;  5B24 D;  5F99 B;  4X23 B;  1P3G A;  4HGA C;  4KHA B;  3WA9 A;  4WV4 B;  4J8U C;  5CPK A;  4J8U D;  5B1L C;  3X1U A;  5DNM C;  1P3I B;  3MGP C;  3X1V D;  1S32 C;  1S32 D;  2PYO B;  2F8N A;  1HQ3 D;  3NQJ A;  3AZL C;  1M19 B;  4H9O A;  5B2I C;  2HUE C;  3AZG A;  5BS7 A;  5JA4 B;  1H3O A;  1JFI A;  3WTP A;  3AZI C;  5F99 A;  4X23 A;  3AZJ C;  1KX3 A;  3AZJ D;  2IO5 C;  4KHA A;  5GXQ C;  5BT1 D;  2YFV A;  1TZY D;  1P34 C;  5DNN B;  1M1A B;  1P3I A;  3MNN C;  3MNN D;  2L5A A;  3LZ0 B;  3AZM C;  4R8P C;  3W97 C;  3AZE D;  3X1T D;  3W96 C;  3AZF C;  4G92 B;  5B31 B;  4XZQ D;  3C1B D;  3B0C W;  1M19 A;  5GT3 B;  3AV1 D;  5AY8 B;  3VH5 W;  3REJ B;  2ARO D;  3AZH C;  3AZH D;  5GT3 D;  1P3A B;  4WU8 C;  2HIO C;  5B40 B;  2HIO D;  3REH D;  1P3K A;  2BYK B;  4M6B A;  3LJA C;  3LJA D;  5B0Y C;  1EQZ D;  4J8V B;  4NFT A;  3KUY B;  1KX5 C;  1P3L B;  4Z5T B;  5DNN A;  1KX4 B;  3MGR A;  4JJN C;  1WWI A;  5B1M A;  4LD9 B;  4KGC D;  3VH6 A;  1ID3 C;  2JSS A;  2NQB D;  2NZD D;  5E5A C;  2YFW B;  3KWQ D;  4QLC D;  1R4V A;  4J8W C;  5B31 A;  5AV5 B;  4AWL B;  3W99 B;  5AY8 A;  4H9R B;  5AV5 D;  3REJ A;  3AV2 D;  3B6F C;  1P3A A;  3V9R A;  3B6F D;  5KDM B;  5B40 A;  3REI B;  3WTP E;  3UTB C;  3UT9 B;  4J8X C;  3REI D;  4E44 A;  3UTA D;  3KXB C;  3A6N B;  4J8V A;  3UT9 D;  2CV5 D;  1F66 C;  4H9N A;  1F66 D;  3KUY A;  4ZBJ C;  3A6N D;  4Z5T A;  1KX4 A;  4CAY A;  1U35 B;  5B32 B;  3LEL D;  5GT0 B;  4LD9 A;  1P3F A;  4ZUX A;  5GSU C;  5B2J C;  1N1J B;  3REK A;  1P3B C;  1P3O C;  1P3O D;  3LZ1 C;  3O62 C;  2YFW A;  3LZ1 D;  3O62 D;  4WU9 C;  3AZN B;  5CP6 A;  1M18 B;  3R45 B;  4H9R A;  3MGS D;  5CPI C;  3REL D;  5AV8 B;  3X1S C;  5AVB D;  4KUD D;  3B6G C;  3AFA C;  2BYM B;  3AFA D;  1P3M D;  1U35 A;  5B32 A;  4H9S C;  1N1J A;  3AZK B;  3MGQ B;  1P3P B;  5B0Z A;  3AZN A;  4WNN B;  4E45 A;  3TU4 A;  1M18 A;  3B0D C;  3WKJ C;  3AYW A;  4YM6 D;  5AVC B;  5AV8 A;  5BNV B;  5CPJ B;  4NE3 A;  2FJ7 D;  5AV6 C;  5B33 D;  4YS3 C;  5AV9 A;  3C1C A;  3W98 C;  3W98 D;  3AN2 B;  5B24 B;  4Z66 D;  1BH8 B;  2BYM A;  1P3G C;  4HGA B;  1AOI D;  4J8U B;  3WA9 C;  4XUJ A;  3WA9 D;  5CPK C;  5DNM B;  3X1U C;  3AZK A;  5B1L D;  3MGQ A;  3X1V B;  5DNM D;  1S32 B;  3MGP D;  1P3P A;  4WNN A;  1HQ3 B;  2CWE A;  4DRB A;  5JRG A;  3MVD A;  3AZL D;  3AZG C;  5B2I D;  5CPJ A;  5BS7 C;  3NQU B;  3VH6 W;  3WTP C;  3AN2 A;  5B24 A;  4H9Q A;  4G91 C;  5F99 C;  3AZI D;  4X23 C;  3AZJ B;  2IO5 B;  1KX3 C;  3B0B A;  5GXQ B;  1TZY B;  1P34 B;  5GXQ D;  3WAA C;  3WAA D;  3MNN B;  1P34 D;  1P3I C;  3X1V A;  5BO0 B;  3B0C T;  5B32 G;  4R8P B;  3AZM D;  3AZE B;  1HQ3 A;  2PYO A;  3X1T B;  1WWS A;  1F1E A;  3VH5 T;  4R8P D;  4XZQ B;  3C1B B;  3W97 D;  3AV1 B;  1M19 C;  3AZF D;  3W96 D;  2ARO B;  3AZH B;  4WU8 B;  2HIO B;  3REH B;  3NQU A;  4WU8 D;  5JA4 A;  1P3K C;  3LJA B;  1EQZ B;  5FUG B;  5B0Y D;  1TZY A;  1BFM A;  3MNN A;  1KX5 D;  3MGR C;  1M1A A;  4KGC B;  3MGR D;  5B1M C;  5B1M D;  4JJN D;  1TAF B;  2NQB B;  5BO0 A;  3LZ0 A;  2NZD B;  3AZE A;  1ZLA C;  1ID3 D;  1ZLA D;  1KU5 A;  3X1T A;  3KWQ B;  4QLC B;  4XZQ A;  3C1B A;  4J8W B;  5E5A D;  5B31 C;  3AV1 A;  3AV2 B;  4J8W D;  2ARO A;  5AY8 C;  5GT3 A;  3REJ C;  3B6F B;  1P3A C;  3REH A;  5B40 C;  3UTB B;  2BYK A;  3UTA B;  3UTB D;  2CV5 B;  1EQZ A;  5FUG A;  4J8X D;  4J8V C;  1F66 B;  4ZBJ B;  3KXB D;  3KUY C;  5G49 B;  4Z5T C;  1P3L A;  1KX4 C;  3LEL B;  4KGC A;  4LD9 C;  1P3F C;  1TAF A;  4ZUX C;  1P3F D;  1P3O B;  2NQB A;  2NZD A;  3REK C;  3LZ1 B;  5GSU D;  3O62 B;  5B2J D;  4QLC A;  3KWQ A;  1P3B D;  4WU9 D;  5CP6 C;  5AV5 A;  3AV2 A;  3MGS B;  3REL B;  3W99 A;  5CPI D;  5AVB B;  5KDM A;  3X1S D;  4KUD B;  3REI A;  3UTA A;  3UT9 A;  2CV5 A;  3B6G D;  3A6N A;  3AFA B;  1P3M B;  5G49 A;  5BNX B;  3LEL A;  1U35 C;  5GT0 A;  1P3O A;  2F8N K;  5B0Z C;  3AZN C;  3TU4 C;  3TU4 D;  3B0D B;  4YM6 B;  3MGS A;  1M18 C;  3REL A;  3AYW C;  3R45 A;  3AYW D;  3WKJ D;  5AV8 C;  2FJ7 B;  5AVB A;  4NE5 A;  4KUD A;  5B33 B;  5AV6 B;  3W98 B;  4EO5 B;  5AV9 C;  5AV6 D;  5AV9 D;  3C1C C;  3C1C D;  4Z66 B;  4YS3 D;  1P3M A;  5C3I B;  1AOI B;  1P3G D;  3WA9 B;  4XUJ C;  4XUJ D;  5B1L B;  5CPK D;  3AZK C;  3X1U D;  3MGQ C;  3MGP B;  5CHL B;  2F8N D;  4YM6 A;  5JRG C;  3MVD C;  5JRG D;  4H9O B;  3AZL B;  5AVC A;  3VH6 T;  5B2I B;  2FJ7 A;  2HUE B;  5CPJ C;  5B33 A;  5BNV A;  3AZG D;  3AN2 C;  4NE6 A;  4Z66 A;  3AZI B;  3WTP D;  1AOI A;  1KX3 B;  1BH8 A;  5F99 D;  4X23 D;  2YFV B;  1KX3 D;  4J8U A;  3WAA B;  5B1L A;  5DNM A;  3X1V C;  3MGP A;  1P3I D;  3AZM B;  1S32 A;  1HQ3 C;  2PYO C;  3W97 B;  2PYO D;  3AZF B;  3W96 B;  3AZL A;  5B2I A;  1M19 D;  1P3K B;  3AZI A;  1P3K D;  3KSY A;  3AZJ A;  1BH9 B;  5B0Y B;  5BT1 C;  1TZY C;  5GXQ A;  3WAA A;  1KX5 B;  1P34 A;  3MGR B;  5DNN C;  1M1A C;  5B1M B;  5DNN D;  2LY8 A;  4JJN B;  1M1A D;  3AZM A;  3LZ0 C;  1ID3 B;  1ZLA B;  4Z2M H;  3LZ0 D;  3AZE C;  4R8P A;  3W97 A;  3X1T C;  5E5A B;  4DRA A;  4XZQ C;  3C1B C;  3W96 A;  3AZF A;  4CSR B;  2F8N H;  3AV1 C;  4G92 C;  2ARO C;  5B31 D;  5GT3 C;  3AZH A;  3V9R B;  5AY8 D;  3REH C;  4WU8 A;  3REJ D;  2HIO A;  1P3A D;  5B40 D;  4J8X B;  3LJA A;  1EQZ C;  1BH9 A;  5B0Y A;  3KXB B;  4H9N B;  4J8V D;  1KX5 A;  4CAY B;  3KUY D;  1P3L C;  1P3L D;  4KGC C;  4Z5T D;  2RVQ C;  4JJN A;  1KX4 D;  2RVQ D;  1P3F B;  4ZUX B;  2NQB C;  5GSU B;  3REK B;  1ID3 A;  1ZLA A;  4LD9 D;  2NZD C;  5B2J B;  1P3B B;  4ZUX D;  4Z2M G;  5E5A A;  4QLC C;  3KWQ C;  3REK D;  1ULY A;  4WU9 B;  5CP6 B;  4CSR A;  4J8W A;  5AV5 C;  3AV2 C;  2F8N G;  4AWL C;  5CP6 D;  3W99 C;  3W99 D;  5CPI B;  3B6F A;  1A7W A;  3X1S B;  1B67 A;  1HTA A;  4H9P B;  3REI C;  3UTB A;  4J8X A;  3UTA C;  1B6W A;  3UT9 C;  2CV5 C;  3B6G B;  3KXB A;  4UUZ B;  3A6N C;  1F66 A;  3VH5 A;  3LEL C;  4WZS B;  5B32 C;  1U35 D;  5GT0 C;  5GSU A;  5B32 D;  5GT0 D;  5B2J A;  1P3B A;  3LZ1 A;  3O62 A;  5B0Z B;  4WU9 A;  3TU4 B;  5B0Z D;  3AZN D;  3MGS C;  3AYW B;  3REL C;  3WKJ B;  1M18 D;  5CPI A;  3X1S A;  5AVB C;  5AV8 D;  4H9P A;  4KUD C;  1Q9C A;  5AV9 B;  3C1C B;  3B6G A;  4YS3 B;  4UUZ A;  1P3M C;  3AFA A;  1P3G B;  4XUJ B;  5BNX A;  5CPK B;  3X1U B;  4H9S A; 
#chains in the Genus database with same CATH topology
 3AZK D;  3MGQ D;  2G5H C;  2F8N B;  1P3P C;  1P3P D;  4YM6 C;  5JRG B;  3NQJ B;  3MVD B;  3WKJ A;  5AVC C;  3MVD D;  5AVC D;  5B31 G;  2FJ7 C;  3AZG B;  5B33 C;  4WJ3 C;  5CPJ D;  5AV6 A;  1H3O B;  4EO5 C;  4YS3 A;  1JFI B;  3W98 A;  4H9Q B;  3WTP B;  4Z66 C;  5C3I C;  5B24 C;  1AOI C;  2ZM5 A;  4G91 B;  5B24 D;  5F99 B;  4X23 B;  3AN2 D;  1P3G A;  3AL0 C;  2JE5 A;  4HGA C;  4KHA B;  3WA9 A;  4WV4 B;  4J8U C;  5CPK A;  4J8U D;  5B1L C;  3X1U A;  5DNM C;  1P3I B;  3MGP C;  3X1V D;  1S32 C;  1S32 D;  2PYO B;  2F8N A;  2Y2I A;  1HQ3 D;  3NQJ A;  3AZL C;  1M19 B;  4H9O A;  5B2I C;  2HUE C;  3AZG A;  5BS7 A;  5JA4 B;  1H3O A;  1JFI A;  3WTP A;  3AZI C;  5F99 A;  4X23 A;  3AZJ C;  1KX3 A;  3AZJ D;  2IO5 C;  4KHA A;  5GXQ C;  5BT1 D;  2YFV A;  1TZY D;  1P34 C;  5DNN B;  1M1A B;  1P3I A;  3MNN C;  3MNN D;  2L5A A;  3LZ0 B;  3AZM C;  4R8P C;  3IP4 C;  3W97 C;  3AZE D;  3X1T D;  3W96 C;  3AZF C;  4G92 B;  5B31 B;  4XZQ D;  3C1B D;  3B0C W;  1M19 A;  5GT3 B;  3AV1 D;  5AY8 B;  3VH5 W;  3REJ B;  2ARO D;  3AZH C;  3AZH D;  5GT3 D;  1P3A B;  4WU8 C;  2HIO C;  5B40 B;  2HIO D;  3REH D;  1P3K A;  2BYK B;  4M6B A;  3LJA C;  3LJA D;  5B0Y C;  2Y2L A;  1EQZ D;  4J8V B;  4NFT A;  3KUY B;  2W8S A;  1KX5 C;  1P3L B;  4Z5T B;  5DNN A;  1KX4 B;  3MGR A;  4JJN C;  1WWI A;  5B1M A;  4LD9 B;  4KGC D;  3VH6 A;  1ID3 C;  2JSS A;  2NQB D;  2NZD D;  5E5A C;  2YFW B;  2Y2K A;  3KWQ D;  4QLC D;  1R4V A;  4J8W C;  5B31 A;  5AV5 B;  1W2E A;  4AWL B;  3W99 B;  5AY8 A;  4H9R B;  5AV5 D;  3REJ A;  3AV2 D;  3B6F C;  1P3A A;  3V9R A;  3B6F D;  5KDM B;  5B40 A;  3REI B;  3WTP E;  3UTB C;  3UT9 B;  4J8X C;  3REI D;  4E44 A;  3UTA D;  3KXB C;  3A6N B;  4J8V A;  3UT9 D;  2CV5 D;  1F66 C;  4H9N A;  1F66 D;  3KUY A;  4ZBJ C;  3A6N D;  4Z5T A;  1KX4 A;  4CAY A;  1U35 B;  5B32 B;  3LEL D;  5GT0 B;  4LD9 A;  3H0M C;  1P3F A;  4ZUX A;  5GSU C;  3EPL A;  3KFU G;  5B2J C;  1N1J B;  3REK A;  1P3B C;  1P3O C;  1P3O D;  3LZ1 C;  3O62 C;  2YFW A;  3LZ1 D;  3O62 D;  4WU9 C;  3AZN B;  5CP6 A;  1M18 B;  2F2A C;  4UPK A;  3R45 B;  4H9R A;  3MGS D;  5CPI C;  3REL D;  5AV8 B;  3X1S C;  3EPH A;  5AVB D;  4KUD D;  3B6G C;  3AFA C;  2BYM B;  3AFA D;  1P3M D;  2Y2P A;  1U35 A;  5B32 A;  4H9S C;  2Y2Q A;  1N1J A;  3AZK B;  3MGQ B;  1P3P B;  5B0Z A;  3AZN A;  4WNN B;  4E45 A;  3TU4 A;  1M18 A;  3B0D C;  3WKJ C;  3AYW A;  4YM6 D;  5AVC B;  5AV8 A;  5BNV B;  5CPJ B;  4NE3 A;  2FJ7 D;  2Y2G A;  5AV6 C;  5B33 D;  4YS3 C;  5AV9 A;  3C1C A;  3W98 C;  3W98 D;  3AN2 B;  5B24 B;  4Z66 D;  1BH8 B;  2BYM A;  1P3G C;  4HGA B;  1AOI D;  4J8U B;  3WA9 C;  4XUJ A;  3WA9 D;  5CPK C;  5DNM B;  3X1U C;  3AZK A;  5B1L D;  3MGQ A;  3X1V B;  5DNM D;  1S32 B;  3A1K A;  3MGP D;  2ZY5 A;  1P3P A;  4WNN A;  1HQ3 B;  2CWE A;  2XD5 A;  4DRB A;  5JRG A;  2ZY4 A;  3MVD A;  3AZL D;  3AZG C;  5B2I D;  5CPJ A;  5BS7 C;  3NQU B;  2ZY2 A;  3VH6 W;  3WTP C;  3AN2 A;  5B24 A;  4H9Q A;  4G91 C;  5F99 C;  3AZI D;  4X23 C;  3AZJ B;  2IO5 B;  1KX3 C;  3B0B A;  5GXQ B;  1TZY B;  1P34 B;  2DF4 C;  5GXQ D;  3WAA C;  3WAA D;  3MNN B;  1P34 D;  1P3I C;  3X1V A;  2ZY3 A;  2Y2N A;  5BO0 B;  3B0C T;  5B32 G;  4R8P B;  3AZM D;  3AZE B;  1HQ3 A;  2PYO A;  3X1T B;  1WWS A;  1F1E A;  3VH5 T;  4R8P D;  4XZQ B;  3C1B B;  3W97 D;  3AV1 B;  3A1I A;  1M19 C;  3AZF D;  3W96 D;  2Y2H A;  2ARO B;  3AZH B;  4WU8 B;  2HIO B;  3REH B;  3NQU A;  4WU8 D;  5JA4 A;  1P3K C;  3LJA B;  3EPK A;  1EQZ B;  5FUG B;  5B0Y D;  1TZY A;  1BFM A;  2UWX A;  3MNN A;  1KX5 D;  3MGR C;  1M1A A;  4KGC B;  3MGR D;  5B1M C;  5B1M D;  4JJN D;  1TAF B;  2NQB B;  5BO0 A;  3LZ0 A;  2NZD B;  3AZE A;  1ZLA C;  1ID3 D;  1ZLA D;  1KU5 A;  3X1T A;  3KWQ B;  4QLC B;  4XZQ A;  3C1B A;  4J8W B;  5E5A D;  5B31 C;  3AV1 A;  3AV2 B;  4J8W D;  2ARO A;  5AY8 C;  5GT3 A;  3REJ C;  3B6F B;  1P3A C;  3REH A;  5B40 C;  3UTB B;  2BYK A;  3UTA B;  3UTB D;  2CV5 B;  1EQZ A;  5FUG A;  4J8X D;  4J8V C;  1F66 B;  4ZBJ B;  3KXB D;  3KUY C;  5G49 B;  4Z5T C;  1P3L A;  1KX4 C;  3LEL B;  4KGC A;  2G5I C;  4LD9 C;  1P3F C;  1TAF A;  4ZUX C;  1P3F D;  1P3O B;  2NQB A;  2NZD A;  3REK C;  3LZ1 B;  5GSU D;  3O62 B;  5B2J D;  4QLC A;  3KWQ A;  1P3B D;  4WU9 D;  5CP6 C;  5AV5 A;  3AV2 A;  3MGS B;  3REL B;  3W99 A;  5CPI D;  5AVB B;  5KDM A;  3X1S D;  4KUD B;  3REI A;  3UTA A;  3UT9 A;  2CV5 A;  3B6G D;  3A6N A;  3AFA B;  1P3M B;  5G49 A;  5BNX B;  3LEL A;  4DQY B;  1U35 C;  5GT0 A;  1Z2C B;  1P3O A;  2F8N K;  3F6T A;  5B0Z C;  3AZN C;  3TU4 C;  3TU4 D;  3B0D B;  4YM6 B;  3MGS A;  1M18 C;  3REL A;  3AYW C;  3R45 A;  3AYW D;  3WKJ D;  5AV8 C;  2FJ7 B;  5AVB A;  4NE5 A;  4KUD A;  5B33 B;  5AV6 B;  3W98 B;  4EO5 B;  5AV9 C;  5AV6 D;  5AV9 D;  3C1C C;  3C1C D;  4Z66 B;  4YS3 D;  1P3M A;  5C3I B;  1AOI B;  1P3G D;  3WA9 B;  4XUJ C;  4XUJ D;  2Y2M A;  5B1L B;  5CPK D;  3AZK C;  3X1U D;  3MGQ C;  3MGP B;  5CHL B;  2F8N D;  4YM6 A;  5JRG C;  3MVD C;  5JRG D;  4H9O B;  3AZL B;  5AVC A;  3VH6 T;  5B2I B;  2FJ7 A;  2HUE B;  5CPJ C;  5B33 A;  5BNV A;  3AZG D;  3AN2 C;  4NE6 A;  4Z66 A;  3AZI B;  3WTP D;  1AOI A;  1KX3 B;  2FFF B;  1BH8 A;  5F99 D;  4X23 D;  2YFV B;  1KX3 D;  4J8U A;  3WAA B;  5B1L A;  5DNM A;  3X1V C;  3MGP A;  1P3I D;  3AZM B;  1S32 A;  1HQ3 C;  2PYO C;  3W97 B;  2PYO D;  3AZF B;  3W96 B;  3AZL A;  5B2I A;  1M19 D;  1P3K B;  3AZI A;  1P3K D;  3KSY A;  3AZJ A;  1BH9 B;  5B0Y B;  5BT1 C;  3P5J B;  1TZY C;  5GXQ A;  3WAA A;  1KX5 B;  1P34 A;  3MGR B;  5DNN C;  1M1A C;  5B1M B;  5DNN D;  2LY8 A;  4JJN B;  1M1A D;  3AZM A;  3LZ0 C;  1ID3 B;  1ZLA B;  4Z2M H;  3LZ0 D;  2JCH A;  3AZE C;  4R8P A;  3W97 A;  3X1T C;  5E5A B;  4DRA A;  4XZQ C;  3C1B C;  1T3U A;  3W96 A;  4CSR B;  3AZF A;  3AV1 C;  2F8N H;  4G92 C;  2ARO C;  5B31 D;  5GT3 C;  3AZH A;  3V9R B;  5AY8 D;  3REH C;  4WU8 A;  3REJ D;  3FDD A;  2HIO A;  1P3A D;  2Y2O A;  5B40 D;  4J8X B;  3LJA A;  1EQZ C;  1BH9 A;  5B0Y A;  3KXB B;  4H9N B;  4J8V D;  2Y2J A;  1KX5 A;  4CAY B;  3KUY D;  1P3L C;  1P3L D;  4KGC C;  4Z5T D;  2RVQ C;  4JJN A;  1KX4 D;  2RVQ D;  1P3F B;  4ZUX B;  2NQB C;  5GSU B;  3REK B;  1ID3 A;  1ZLA A;  4LD9 D;  2NZD C;  5B2J B;  1P3B B;  4ZUX D;  4Z2M G;  5E5A A;  4QLC C;  3KWQ C;  3REK D;  1ULY A;  3H0R C;  4WU9 B;  5CP6 B;  4CSR A;  4J8W A;  5AV5 C;  3AV2 C;  2F8N G;  4AWL C;  5CP6 D;  2J8P A;  3W99 C;  3W99 D;  5CPI B;  3B6F A;  1A7W A;  3EPJ A;  3X1S B;  1B67 A;  1HTA A;  4H9P B;  3REI C;  3UTB A;  4J8X A;  3UTA C;  1B6W A;  3UT9 C;  2CV5 C;  3B6G B;  2VQR A;  2BG1 A;  3KXB A;  4UUZ B;  3A6N C;  1F66 A;  2RIQ A;  3VH5 A;  3LEL C;  4WZS B;  5B32 C;  1U35 D;  5GT0 C;  5GSU A;  5B32 D;  5GT0 D;  5B2J A;  1P3B A;  3LZ1 A;  3O62 A;  5B0Z B;  4WU9 A;  3TU4 B;  5B0Z D;  3AZN D;  3MGS C;  1PZR A;  3AYW B;  3REL C;  3WKJ B;  1M18 D;  5CPI A;  3H0L C;  3X1S A;  5AVB C;  2DQN C;  3EG5 B;  5AV8 D;  4H9P A;  4KUD C;  1Q9C A;  5AV9 B;  3C1C B;  3B6G A;  4YS3 B;  4UUZ A;  1P3M C;  3AFA A;  1P3G B;  4XUJ B;  5BNX A;  5CPK B;  3X1U B;  4H9S A;  2XD1 A; 
#chains in the Genus database with same CATH homology
 3AZK D;  3MGQ D;  2G5H C;  2F8N B;  1P3P C;  1P3P D;  4YM6 C;  5JRG B;  3NQJ B;  3MVD B;  3WKJ A;  5AVC C;  3MVD D;  5AVC D;  5B31 G;  2FJ7 C;  3AZG B;  5B33 C;  4WJ3 C;  5CPJ D;  5AV6 A;  1H3O B;  4EO5 C;  4YS3 A;  1JFI B;  3W98 A;  4H9Q B;  3WTP B;  4Z66 C;  5C3I C;  5B24 C;  1AOI C;  2ZM5 A;  4G91 B;  5B24 D;  5F99 B;  4X23 B;  3AN2 D;  1P3G A;  3AL0 C;  2JE5 A;  4HGA C;  4KHA B;  3WA9 A;  4WV4 B;  4J8U C;  5CPK A;  4J8U D;  5B1L C;  3X1U A;  5DNM C;  1P3I B;  3MGP C;  3X1V D;  1S32 C;  1S32 D;  2PYO B;  2F8N A;  2Y2I A;  1HQ3 D;  3NQJ A;  3AZL C;  1M19 B;  4H9O A;  5B2I C;  2HUE C;  3AZG A;  5BS7 A;  5JA4 B;  1H3O A;  1JFI A;  3WTP A;  3AZI C;  5F99 A;  4X23 A;  3AZJ C;  1KX3 A;  3AZJ D;  2IO5 C;  4KHA A;  5GXQ C;  5BT1 D;  2YFV A;  1TZY D;  1P34 C;  5DNN B;  1M1A B;  1P3I A;  3MNN C;  3MNN D;  2L5A A;  3LZ0 B;  3AZM C;  4R8P C;  3IP4 C;  3W97 C;  3AZE D;  3X1T D;  3W96 C;  3AZF C;  4G92 B;  5B31 B;  4XZQ D;  3C1B D;  3B0C W;  1M19 A;  5GT3 B;  3AV1 D;  5AY8 B;  3VH5 W;  3REJ B;  2ARO D;  3AZH C;  3AZH D;  5GT3 D;  1P3A B;  4WU8 C;  2HIO C;  5B40 B;  2HIO D;  3REH D;  1P3K A;  2BYK B;  4M6B A;  3LJA C;  3LJA D;  5B0Y C;  2Y2L A;  1EQZ D;  4J8V B;  4NFT A;  3KUY B;  2W8S A;  1KX5 C;  1P3L B;  4Z5T B;  5DNN A;  1KX4 B;  3MGR A;  4JJN C;  1WWI A;  5B1M A;  4LD9 B;  4KGC D;  3VH6 A;  1ID3 C;  2JSS A;  2NQB D;  2NZD D;  5E5A C;  2YFW B;  2Y2K A;  3KWQ D;  4QLC D;  1R4V A;  4J8W C;  5B31 A;  5AV5 B;  1W2E A;  4AWL B;  3W99 B;  5AY8 A;  4H9R B;  5AV5 D;  3REJ A;  3AV2 D;  3B6F C;  1P3A A;  3V9R A;  3B6F D;  5KDM B;  5B40 A;  3REI B;  3WTP E;  3UTB C;  3UT9 B;  4J8X C;  3REI D;  4E44 A;  3UTA D;  3KXB C;  3A6N B;  4J8V A;  3UT9 D;  2CV5 D;  1F66 C;  4H9N A;  1F66 D;  3KUY A;  4ZBJ C;  3A6N D;  4Z5T A;  1KX4 A;  4CAY A;  1U35 B;  5B32 B;  3LEL D;  5GT0 B;  4LD9 A;  3H0M C;  1P3F A;  4ZUX A;  5GSU C;  3EPL A;  3KFU G;  5B2J C;  1N1J B;  3REK A;  1P3B C;  1P3O C;  1P3O D;  3LZ1 C;  3O62 C;  2YFW A;  3LZ1 D;  3O62 D;  4WU9 C;  3AZN B;  5CP6 A;  1M18 B;  2F2A C;  4UPK A;  3R45 B;  4H9R A;  3MGS D;  5CPI C;  3REL D;  5AV8 B;  3X1S C;  3EPH A;  5AVB D;  4KUD D;  3B6G C;  3AFA C;  2BYM B;  3AFA D;  1P3M D;  2Y2P A;  1U35 A;  5B32 A;  4H9S C;  2Y2Q A;  1N1J A;  3AZK B;  3MGQ B;  1P3P B;  5B0Z A;  3AZN A;  4WNN B;  4E45 A;  3TU4 A;  1M18 A;  3B0D C;  3WKJ C;  3AYW A;  4YM6 D;  5AVC B;  5AV8 A;  5BNV B;  5CPJ B;  4NE3 A;  2FJ7 D;  2Y2G A;  5AV6 C;  5B33 D;  4YS3 C;  5AV9 A;  3C1C A;  3W98 C;  3W98 D;  3AN2 B;  5B24 B;  4Z66 D;  1BH8 B;  2BYM A;  1P3G C;  4HGA B;  1AOI D;  4J8U B;  3WA9 C;  4XUJ A;  3WA9 D;  5CPK C;  5DNM B;  3X1U C;  3AZK A;  5B1L D;  3MGQ A;  3X1V B;  5DNM D;  1S32 B;  3A1K A;  3MGP D;  2ZY5 A;  1P3P A;  4WNN A;  1HQ3 B;  2CWE A;  2XD5 A;  4DRB A;  5JRG A;  2ZY4 A;  3MVD A;  3AZL D;  3AZG C;  5B2I D;  5CPJ A;  5BS7 C;  3NQU B;  2ZY2 A;  3VH6 W;  3WTP C;  3AN2 A;  5B24 A;  4H9Q A;  4G91 C;  5F99 C;  3AZI D;  4X23 C;  3AZJ B;  2IO5 B;  1KX3 C;  3B0B A;  5GXQ B;  1TZY B;  1P34 B;  2DF4 C;  5GXQ D;  3WAA C;  3WAA D;  3MNN B;  1P34 D;  1P3I C;  3X1V A;  2ZY3 A;  2Y2N A;  5BO0 B;  3B0C T;  5B32 G;  4R8P B;  3AZM D;  3AZE B;  1HQ3 A;  2PYO A;  3X1T B;  1WWS A;  1F1E A;  3VH5 T;  4R8P D;  4XZQ B;  3C1B B;  3W97 D;  3AV1 B;  3A1I A;  1M19 C;  3AZF D;  3W96 D;  2Y2H A;  2ARO B;  3AZH B;  4WU8 B;  2HIO B;  3REH B;  3NQU A;  4WU8 D;  5JA4 A;  1P3K C;  3LJA B;  3EPK A;  1EQZ B;  5FUG B;  5B0Y D;  1TZY A;  1BFM A;  2UWX A;  3MNN A;  1KX5 D;  3MGR C;  1M1A A;  4KGC B;  3MGR D;  5B1M C;  5B1M D;  4JJN D;  1TAF B;  2NQB B;  5BO0 A;  3LZ0 A;  2NZD B;  3AZE A;  1ZLA C;  1ID3 D;  1ZLA D;  1KU5 A;  3X1T A;  3KWQ B;  4QLC B;  4XZQ A;  3C1B A;  4J8W B;  5E5A D;  5B31 C;  3AV1 A;  3AV2 B;  4J8W D;  2ARO A;  5AY8 C;  5GT3 A;  3REJ C;  3B6F B;  1P3A C;  3REH A;  5B40 C;  3UTB B;  2BYK A;  3UTA B;  3UTB D;  2CV5 B;  1EQZ A;  5FUG A;  4J8X D;  4J8V C;  1F66 B;  4ZBJ B;  3KXB D;  3KUY C;  5G49 B;  4Z5T C;  1P3L A;  1KX4 C;  3LEL B;  4KGC A;  2G5I C;  4LD9 C;  1P3F C;  1TAF A;  4ZUX C;  1P3F D;  1P3O B;  2NQB A;  2NZD A;  3REK C;  3LZ1 B;  5GSU D;  3O62 B;  5B2J D;  4QLC A;  3KWQ A;  1P3B D;  4WU9 D;  5CP6 C;  5AV5 A;  3AV2 A;  3MGS B;  3REL B;  3W99 A;  5CPI D;  5AVB B;  5KDM A;  3X1S D;  4KUD B;  3REI A;  3UTA A;  3UT9 A;  2CV5 A;  3B6G D;  3A6N A;  3AFA B;  1P3M B;  5G49 A;  5BNX B;  3LEL A;  4DQY B;  1U35 C;  5GT0 A;  1Z2C B;  1P3O A;  2F8N K;  3F6T A;  5B0Z C;  3AZN C;  3TU4 C;  3TU4 D;  3B0D B;  4YM6 B;  3MGS A;  1M18 C;  3REL A;  3AYW C;  3R45 A;  3AYW D;  3WKJ D;  5AV8 C;  2FJ7 B;  5AVB A;  4NE5 A;  4KUD A;  5B33 B;  5AV6 B;  3W98 B;  4EO5 B;  5AV9 C;  5AV6 D;  5AV9 D;  3C1C C;  3C1C D;  4Z66 B;  4YS3 D;  1P3M A;  5C3I B;  1AOI B;  1P3G D;  3WA9 B;  4XUJ C;  4XUJ D;  2Y2M A;  5B1L B;  5CPK D;  3AZK C;  3X1U D;  3MGQ C;  3MGP B;  5CHL B;  2F8N D;  4YM6 A;  5JRG C;  3MVD C;  5JRG D;  4H9O B;  3AZL B;  5AVC A;  3VH6 T;  5B2I B;  2FJ7 A;  2HUE B;  5CPJ C;  5B33 A;  5BNV A;  3AZG D;  3AN2 C;  4NE6 A;  4Z66 A;  3AZI B;  3WTP D;  1AOI A;  1KX3 B;  2FFF B;  1BH8 A;  5F99 D;  4X23 D;  2YFV B;  1KX3 D;  4J8U A;  3WAA B;  5B1L A;  5DNM A;  3X1V C;  3MGP A;  1P3I D;  3AZM B;  1S32 A;  1HQ3 C;  2PYO C;  3W97 B;  2PYO D;  3AZF B;  3W96 B;  3AZL A;  5B2I A;  1M19 D;  1P3K B;  3AZI A;  1P3K D;  3KSY A;  3AZJ A;  1BH9 B;  5B0Y B;  5BT1 C;  3P5J B;  1TZY C;  5GXQ A;  3WAA A;  1KX5 B;  1P34 A;  3MGR B;  5DNN C;  1M1A C;  5B1M B;  5DNN D;  2LY8 A;  4JJN B;  1M1A D;  3AZM A;  3LZ0 C;  1ID3 B;  1ZLA B;  4Z2M H;  3LZ0 D;  2JCH A;  3AZE C;  4R8P A;  3W97 A;  3X1T C;  5E5A B;  4DRA A;  4XZQ C;  3C1B C;  1T3U A;  3W96 A;  4CSR B;  3AZF A;  3AV1 C;  2F8N H;  4G92 C;  2ARO C;  5B31 D;  5GT3 C;  3AZH A;  3V9R B;  5AY8 D;  3REH C;  4WU8 A;  3REJ D;  3FDD A;  2HIO A;  1P3A D;  2Y2O A;  5B40 D;  4J8X B;  3LJA A;  1EQZ C;  1BH9 A;  5B0Y A;  3KXB B;  4H9N B;  4J8V D;  2Y2J A;  1KX5 A;  4CAY B;  3KUY D;  1P3L C;  1P3L D;  4KGC C;  4Z5T D;  2RVQ C;  4JJN A;  1KX4 D;  2RVQ D;  1P3F B;  4ZUX B;  2NQB C;  5GSU B;  3REK B;  1ID3 A;  1ZLA A;  4LD9 D;  2NZD C;  5B2J B;  1P3B B;  4ZUX D;  4Z2M G;  5E5A A;  4QLC C;  3KWQ C;  3REK D;  1ULY A;  3H0R C;  4WU9 B;  5CP6 B;  4CSR A;  4J8W A;  5AV5 C;  3AV2 C;  2F8N G;  4AWL C;  5CP6 D;  2J8P A;  3W99 C;  3W99 D;  5CPI B;  3B6F A;  1A7W A;  3EPJ A;  3X1S B;  1B67 A;  1HTA A;  4H9P B;  3REI C;  3UTB A;  4J8X A;  3UTA C;  1B6W A;  3UT9 C;  2CV5 C;  3B6G B;  2VQR A;  2BG1 A;  3KXB A;  4UUZ B;  3A6N C;  1F66 A;  2RIQ A;  3VH5 A;  3LEL C;  4WZS B;  5B32 C;  1U35 D;  5GT0 C;  5GSU A;  5B32 D;  5GT0 D;  5B2J A;  1P3B A;  3LZ1 A;  3O62 A;  5B0Z B;  4WU9 A;  3TU4 B;  5B0Z D;  3AZN D;  3MGS C;  1PZR A;  3AYW B;  3REL C;  3WKJ B;  1M18 D;  5CPI A;  3H0L C;  3X1S A;  5AVB C;  2DQN C;  3EG5 B;  5AV8 D;  4H9P A;  4KUD C;  1Q9C A;  5AV9 B;  3C1C B;  3B6G A;  4YS3 B;  4UUZ A;  1P3M C;  3AFA A;  1P3G B;  4XUJ B;  5BNX A;  5CPK B;  3X1U B;  4H9S A;  2XD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...