3W99C

Crystal structure of human nucleosome core particle lacking h4 n-terminal region
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 105
sequence length 105
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w99C00
3AZEC 5AY8C 5GT3B 1M19B 3AZGB 3AZJC 2AROC 3LZ1A 1BFMA 3AN2C 3AZID 3VH5W 3REJC 4KGCD 2F8NH 5DNMB 4WU8D 2CV5C 2YFWB 5B0ZA 2NQBC 3MGSC 3KXBB 3MVDB 5B1LA 5BS7A 3AYWC 3RELC 4Z2MG 3AZFC 5B31B 5GT0D 1M1AB 1JFIA 1AOIA 1P3GD 1KX5B 2NZDD 4WZSB 4XUJA 3AZHC 1F66A 5F99B 3W97A 5AV5B 2FJ7B 5B0YC 4R8PA 5B32B 5E5AD 3TU4B 5B40C 5CPKC 3VH5A 3B0DC 3NQJB 4LD9A 5KDMB 3UTBD 4J8UA 3MGPD 1M19D 5GT3D 3AZGD 3LZ1B 3WAAA 3LJAD 3W96C 4X23B 3WA9D 5CPJA 4KUDC 5G49A 5DNMD 5B0ZB 4YS3B 4XZQC 5BT1C 3LZ0A 3KXBD 4J8XB 4JJNA 3MVDD 4ZBJB 1JFIB 1AOIB 5B31D 4Z66A 1M1AD 1KX5D 4XUJB 1F66B 1ZLAD 3W97B 5F99D 1S32D 5AV5D 2FJ7D 3X1TA 3AV2C 5B32D 3TU4D 4LD9B 3AZND 1P3AA 3W98A 4J8UB 3B0CW 5CPIA 4QLCC 3MGRA 1P3MA 1P3LC 3LZ1D 3WAAB 5JRGA 3MGQC 3C1CA 3B6GA 1EQZA 3AZLB 5CPJB 4YM6A 4NFTA 3KUYA 2F8NG 5AVBB 5B0ZD 3LZ0B 5B1MA 3X1SC 4G91C 1AOID 3MNNA 1ID3A 3REKC 4XUJD 4UUZA 5AVCA 1F66D 3B0BA 3W97D 5AV6C 3X1TB 5GXQC 1F1EA 5B33C 1KX4A 1B67A 4R8PD 2RVQD 3WTPC 1P3AB 3O62A 4LD9D 3W98B 5AV9A 1HQ3C 5B24C 1M19A 3A6NA 4J8UD 4CSRA 1P3OC 4E45A 5CPIB 4NE5A 3MGRB 3VH6W 1P3MB 3AFAA 1P3FC 5JA4A 3AZMC 3WAAD 5JRGB 3C1BA 1P3BA 1EQZB 1TZYC 5CPJD 3LZ0D 4JJND 3WKJA 5B1MB 3AV1C 3MGPC 3REIC 4Z66D 5B2JB 3W99B 1N1JA 4HGAC 4J8VC 1M18B 4UUZB 5AVCB 3LELC 3REHB 4H9NA 3VH6A 2HIOC 1B6WA 3X1TD 3LJAC 1KX4B 1KX3C 3WA9C 4J8WC 3AZEA 5AY8A 5CP6B 3O62B 3KSYA 1P3AD 3AZJA 2AROA 5AV9B 2PYOC 3W98D 3AN2A 3A6NB 4CSRB 1P3PC 2IO5C 1WWSA 5CPID 5BO0A 3AFAB 3MGRD 5JA4B 4X23A 3REJA 1P3KC 1P3MD 2CV5A 3C1BB 3NQUA 5JRGD 3MGSA 1P3BB 2NQBA 3C1CD 1ZLAC 3B6GD 4YS3A 1EQZD 1S32C 3AYWA 3RELA 4J8XA 4YM6D 1H3OA 3AZFA 3KUYD 4AWLC 1WWIA 3UTAC 5B2IB 3AZNC 3AZHA 3WKJB 5B1MD 1N1JB 5B0YA 3MNND 1ID3D 5AVCD 5CPKA 2YFVA 4H9NB 3X1UC 3AZKC 1KX4D 3AZEB 5AY8B 4EO5C 3O62D 3AZJB 2AROB 5AV9D 3AN2B 3A6ND 3W96A 5B1LC 5GSUC 5BO0B 3REJB 3AFAD 4KUDA 2CV5B 3AZLA 3NQUB 3C1BD 3MGSB 2NQBB 4XZQA 1P3BD 2HUEC 5AVBA 3KWQC 3AYWB 3RELB 3AZFB 1H3OB 1ULYA 4R8PC 3AZHB 3WKJD 3B6FC 5B0YB 3AV2A 5B40B 4Z5TC 5CPKB 2YFVB 4H9RA 3B0DB 5AV8C 5DNNC 1P34C 3AZED 5AY8D 3AZJD 2AROD 1P3LA 3AN2D 1P3IC 1BH9A 4JJNC 3W96B 1U35C 3MGQA 3REJD 4KUDB 4X23D 4Z66C 2CV5D 4WU9C 4XZQB 3VH5T 4NE3A 3MGSD 5B31G 2NQBD 4H9OA 4YS3D 3UT9C 3X1VC 3AYWD 3RELD 4J8XD 3AZFD 5C3IC 3X1SA 4H9QA 2JSSA 4ZUXC 3REKA 5B2JA 3AZHD 3W99A 1M18A 3REHA 5GXQA 5B33A 5B0YD 3AV2B 3AZIC 4H9RB 3WTPA 5CPKD 4KGCC 1HQ3A 5CP6A 4H9PA 5B24A 4WU8C 3C1CC 1P3OA 2BYKA 3B6GC 2F8NK 4YM6C 4QLCB 3KUYC 1P3LB 1P3FA 3AZMA 1BH9B 5GT0C 3MGQB 1P3GC 3W96D 2NZDC 4G92C 1TZYA 4KHAA 4KUDD 3AZLD 3MNNC 1ID3C 5BT1D 4XZQD 4H9OB 5AVBD 5E5AC 2L5AA 5B2IA 3X1SB 4H9QB 4G91B 3AV1A 3UTBC 3REIA 3REKB 4J8VA 3LELA 5AV6B 2HIOA 5GXQB 3WTPE 1M19C 5GT3C 4H9SA 3AZGC 5B33B 1KX3A 3AV2D 4J8WA 3WTPB 1HQ3B 5B24B 4H9PB 2PYOA 1P3OB 5DNMC 2BYKB 1P3PA 3KXBC 3MVDC 1P3FB 1P3KA 3AZMB 1P3LD 3B0CT 2F8NA 4E44A 5B31C 1M1AC 3MGQD 1KX5C 1TZYB 1TAFB 4KHAB 5F99C 5AV5C 2FJ7C 3UTAA 5B32C 3TU4C 3X1SD 3AV1B 3MGPB 3REIB 4HGAB 4J8VB 3REKD 3LELB 3W99D 5B2JD 1M18D 2HIOB 5AV6D 3R45B 5B40A 3X1UA 3LJAB 5GXQD 3REHD 3AZKA 3LZ1C 5B33D 1KX3B 3WA9B 4J8WB 3WTPD 4X23C 2PYOB 1HQ3D 1HTAA 5CP6D 5B24D 1P3PB 1P3OD 5B0ZC 4YS3C 2IO5B 5GSUA 4J8XC 1P3KB 5BS7C 1P3FD 3AZMD 2F8NB 4WNNA 4ZBJC 3VH6T 1AOIC 1ZLAB 1S32B 3KWQA 1TZYD 4XUJC 1F66C 5CHLB 4AWLB 3W97C 3UTAB 4M6BA 3AZNB 2RVQC 5B2ID 3B6FA 3AV1D 4LD9C 3REID 4J8VD 4J8UC 4Z5TA 3LELD 5BNVA 5AV8A 3X1UB 2HIOD 5DNNA 3AZKB 1KX3D 5FUGA 3WAAC 4J8WD 1P34A 4EO5B 3AZLC 2LY8A 5CPJC 2PYOD 4QLCA 1P3IA 1P3PD 5B1LB 5AVBC 5GSUB 3LZ0C 1U35A 1P3KD 2BYMA 4WNNB 4WU9A 2F8ND 2HUEB 1BH8A 3KWQB 3UT9A 3X1VA 4R8PB 3X1TC 4ZUXA 3UTAD 3B6FB 1P3AC 5B32G 5AV6A 3W98C 3AZIA 4Z5TB 5BNVB 5AV8B 5CPIC 5DNNB 5B40D 3X1UD 3AZKD 3MGRC 1P3MC 4KGCA 4WU8A 2CWEA 5FUGB 5BNXA 5JRGC 1P34B 1Q9CA 4Z2MH 5G49B 1EQZC 3V9RA 4WV4B 1P3IB 5GT0A 4JJNB 1U35B 1P3GA 5B1LD 5GSUD 2NZDA 2BYMB 4Z66B 4WU9B 1TAFA 5B1MC 1BH8B 3W99C 5B2JC 3UT9B 3X1VB 3KWQD 1M18C 5E5AA 4DRBA 5C3IB 5AVCC 4NE6A 3REHC 3UTBA 4ZUXB 4CAYA 1R4VA 3MGPA 1KX4C 3O62C 5GT3A 5CP6C 3B6FD 3AZGA 5AV9C 3R45A 3AZIB 3LJAA 3A6NC 4Z5TD 5AV8D 3WA9A 5DNND 4DRAA 4KGCB 3AFAC 5BNXB 4WU8B 3C1CB 5DNMA 3B6GB 2YFWA 3C1BC 1P34D 1P3BC 3KXBA 4YM6B 1A7WA 3KUYB 3V9RB 3MVDA 4QLCD 5GT0B 1P3ID 1KU5A 5B31A 1M1AA 1P3GB 1U35D 2NZDB 4G92B 5B2IC 1KX5A 1ZLAA 5F99A 1S32A 3WKJC 3MNNB 4WU9D 5AV5A 1ID3B 2FJ7A 5E5AB 3UT9D 3X1VD 5B32A 3TU4A 4H9SC 3AZNA 3UTBB 3NQJA 4CAYB 5KDMA 4ZUXD
chains in the Genus database with same CATH superfamily
3AZEC 5AY8C 5GT3B 1M19B 3AZGB 3AZJC 2AROC 3LZ1A 1BFMA 3AN2C 3AZID 3VH5W 3REJC 4KGCD 2F8NH 3H0MC 5DNMB 4WU8D 2CV5C 2YFWB 5B0ZA 2NQBC 3MGSC 3KXBB 3MVDB 5B1LA 5BS7A 3AYWC 3RELC 4Z2MG 3AZFC 5B31B 5GT0D 1M1AB 1JFIA 1AOIA 1P3GD 1KX5B 2NZDD 4WZSB 4XUJA 3AZHC 1F66A 5F99B 3W97A 5AV5B 2ZY5A 2FJ7B 5B0YC 3A1KA 4R8PA 5B32B 5E5AD 3TU4B 5B40C 5CPKC 3VH5A 3B0DC 3NQJB 4LD9A 5KDMB 3UTBD 2Y2MA 4J8UA 3MGPD 3A1IA 1M19D 5GT3D 3AZGD 3LZ1B 3WAAA 3LJAD 3W96C 4X23B 3WA9D 5CPJA 4KUDC 5G49A 2J8PA 5DNMD 5B0ZB 4YS3B 4XZQC 5BT1C 3LZ0A 3KXBD 4J8XB 4JJNA 3MVDD 4ZBJB 1JFIB 1AOIB 5B31D 4Z66A 1M1AD 1T3UA 1KX5D 4XUJB 1F66B 1ZLAD 3W97B 5F99D 1S32D 2XD5A 5AV5D 2FJ7D 3X1TA 3AV2C 2DQNC 5B32D 3TU4D 4LD9B 3AZND 1P3AA 3W98A 4J8UB 2DF4C 3B0CW 5CPIA 4QLCC 3MGRA 1P3MA 1P3LC 3LZ1D 3WAAB 5JRGA 3MGQC 3C1CA 3B6GA 1EQZA 3AZLB 2Y2JA 5CPJB 4YM6A 4NFTA 3KUYA 2F8NG 5AVBB 5B0ZD 3LZ0B 3H0LC 5B1MA 3X1SC 4G91C 1AOID 3MNNA 1ID3A 3REKC 4XUJD 4UUZA 5AVCA 1F66D 3B0BA 3W97D 5AV6C 2Y2OA 3X1TB 5GXQC 1F1EA 2BG1A 5B33C 1KX4A 1B67A 4R8PD 2RVQD 3WTPC 3EPJA 1P3AB 3O62A 4LD9D 3W98B 5AV9A 5B24C 1HQ3C 1M19A 3A6NA 2JCHA 4J8UD 4CSRA 1P3OC 4E45A 5CPIB 4UPKA 4NE5A 3MGRB 3VH6W 1P3MB 3AFAA 1P3FC 5JA4A 3AZMC 3WAAD 5JRGB 3C1BA 1P3BA 1EQZB 1TZYC 5CPJD 3LZ0D 4JJND 3WKJA 5B1MB 3AV1C 3MGPC 3REIC 4Z66D 5B2JB 3W99B 1N1JA 4HGAC 4J8VC 1M18B 4UUZB 5AVCB 3LELC 3REHB 4H9NA 3EPHA 3VH6A 2HIOC 1B6WA 3X1TD 3LJAC 1KX4B 1KX3C 3WA9C 4J8WC 2Y2NA 2XD1A 3AZEA 5AY8A 5CP6B 3O62B 3KSYA 1P3AD 3AZJA 2AROA 5AV9B 2Y2PA 2PYOC 3W98D 3AN2A 3A6NB 4CSRB 1P3PC 1W2EA 1WWSA 2IO5C 5CPID 5BO0A 3AFAB 3MGRD 5JA4B 4X23A 3REJA 1P3KC 1P3MD 2CV5A 3C1BB 3NQUA 5JRGD 3MGSA 1P3BB 2NQBA 3C1CD 1ZLAC 3B6GD 4YS3A 1EQZD 1S32C 3AYWA 3RELA 4J8XA 4YM6D 1H3OA 3AZFA 3KUYD 4AWLC 1WWIA 3P5JB 3UTAC 5B2IB 3AZNC 3AZHA 3WKJB 5B1MD 1N1JB 5B0YA 3MNND 1ID3D 5AVCD 5CPKA 2YFVA 2Y2LA 4H9NB 3X1UC 3AZKC 1KX4D 2Y2KA 5AY8B 3AZEB 4EO5C 3O62D 3EPLA 3AZJB 2AROB 5AV9D 3AN2B 3A6ND 3W96A 5B1LC 5GSUC 5BO0B 3KFUG 3REJB 3AFAD 4KUDA 2CV5B 1PZRA 3AZLA 3F6TA 3NQUB 3C1BD 3MGSB 2NQBB 4XZQA 2UWXA 1P3BD 2HUEC 5AVBA 3KWQC 3AYWB 3RELB 3AZFB 1H3OB 1ULYA 4R8PC 3AZHB 2Y2HA 3WKJD 3B6FC 5B0YB 3AV2A 2Y2GA 5B40B 4Z5TC 5CPKB 2YFVB 4H9RA 3B0DB 5AV8C 5DNNC 3FDDA 1P34C 3AZED 5AY8D 3AZJD 2AROD 1P3LA 3AN2D 1P3IC 1BH9A 4JJNC 3W96B 1U35C 3MGQA 3REJD 4KUDB 4X23D 4Z66C 2CV5D 4WU9C 4XZQB 3VH5T 4NE3A 3MGSD 5B31G 2NQBD 4H9OA 4YS3D 3UT9C 3X1VC 3AYWD 3RELD 4J8XD 3AZFD 5C3IC 3X1SA 4H9QA 2JSSA 4ZUXC 3REKA 5B2JA 3AZHD 3W99A 1M18A 3REHA 5GXQA 5B33A 5B0YD 3AV2B 3AZIC 4H9RB 2Y2IA 3WTPA 5CPKD 4KGCC 1HQ3A 5CP6A 4H9PA 5B24A 4WU8C 3C1CC 1P3OA 2BYKA 3B6GC 2F8NK 4YM6C 4QLCB 3KUYC 1P3LB 1P3FA 3AZMA 1BH9B 2ZY2A 5GT0C 3MGQB 1P3GC 3W96D 2NZDC 4G92C 1TZYA 4KHAA 4KUDD 3AZLD 3MNNC 1ID3C 5BT1D 4XZQD 4H9OB 5AVBD 5E5AC 2L5AA 5B2IA 3X1SB 4H9QB 4G91B 3AV1A 3UTBC 3REIA 3REKB 4J8VA 2G5IC 3LELA 5AV6B 2HIOA 5GXQB 3WTPE 1M19C 5GT3C 4H9SA 3AZGC 5B33B 1KX3A 3AV2D 2RIQA 4J8WA 3WTPB 1HQ3B 5B24B 4H9PB 2PYOA 1P3OB 5DNMC 2BYKB 1P3PA 2W8SA 2ZY4A 3KXBC 3MVDC 1P3FB 1P3KA 3AZMB 1P3LD 3B0CT 2F8NA 4E44A 3EPKA 5B31C 1M1AC 3MGQD 1KX5C 1TZYB 1TAFB 4KHAB 3EG5B 4DQYB 5F99C 5AV5C 2FJ7C 3UTAA 5B32C 3TU4C 2VQRA 3X1SD 3AV1B 3MGPB 3REIB 4HGAB 4J8VB 3REKD 3LELB 3W99D 5B2JD 1M18D 2HIOB 5AV6D 3R45B 5B40A 3X1UA 3LJAB 5GXQD 3REHD 3AZKA 3LZ1C 5B33D 1KX3B 3WA9B 4J8WB 3WTPD 3H0RC 4X23C 2PYOB 1HQ3D 1HTAA 5CP6D 5B24D 1P3PB 1P3OD 5B0ZC 4YS3C 2IO5B 5GSUA 4J8XC 1P3KB 5BS7C 1P3FD 3AZMD 2F8NB 4WNNA 4ZBJC 1Z2CB 3VH6T 1AOIC 1ZLAB 1S32B 3KWQA 1TZYD 4XUJC 1F66C 5CHLB 2G5HC 4AWLB 3W97C 3UTAB 4M6BA 3AZNB 2RVQC 5B2ID 3B6FA 3AV1D 4LD9C 3REID 4J8VD 4J8UC 2F2AC 4Z5TA 3LELD 5BNVA 5AV8A 3X1UB 2HIOD 5DNNA 3AZKB 1KX3D 5FUGA 3WAAC 4J8WD 1P34A 4EO5B 3AZLC 2LY8A 5CPJC 2PYOD 4QLCA 1P3IA 1P3PD 5B1LB 5AVBC 5GSUB 3LZ0C 1U35A 1P3KD 2BYMA 4WNNB 4WU9A 2F8ND 2HUEB 1BH8A 3KWQB 3UT9A 3X1VA 4R8PB 3X1TC 4ZUXA 3UTAD 3B6FB 1P3AC 5B32G 5AV6A 3W98C 3AZIA 4Z5TB 5BNVB 5AV8B 5CPIC 5DNNB 5B40D 3X1UD 3AZKD 3MGRC 1P3MC 4KGCA 2CWEA 5FUGB 5BNXA 4WU8A 5JRGC 1P34B 1Q9CA 4Z2MH 5G49B 1EQZC 3V9RA 4WV4B 1P3IB 5GT0A 4JJNB 1U35B 1P3GA 5B1LD 5GSUD 2NZDA 2BYMB 4Z66B 4WU9B 1TAFA 5B1MC 1BH8B 3W99C 5B2JC 3UT9B 3X1VB 3KWQD 1M18C 5E5AA 4DRBA 5C3IB 5AVCC 4NE6A 3REHC 3UTBA 4ZUXB 4CAYA 1R4VA 3MGPA 1KX4C 3O62C 5GT3A 3IP4C 5CP6C 2ZM5A 3AZGA 3B6FD 5AV9C 3R45A 3AZIB 3LJAA 3A6NC 4Z5TD 3AL0C 2Y2QA 5AV8D 3WA9A 5DNND 4DRAA 4KGCB 3AFAC 5BNXB 4WU8B 3C1CB 5DNMA 3B6GB 2YFWA 3C1BC 1P34D 1P3BC 3KXBA 4YM6B 1A7WA 3KUYB 3V9RB 3MVDA 2FFFB 4QLCD 5GT0B 1P3ID 1KU5A 5B31A 1M1AA 1P3GB 2JE5A 1U35D 2NZDB 4G92B 5B2IC 1KX5A 1ZLAA 5F99A 2ZY3A 1S32A 3MNNB 3WKJC 4WU9D 5AV5A 1ID3B 2FJ7A 4WJ3C 5E5AB 3UT9D 3X1VD 5B32A 3TU4A 4H9SC 3AZNA 3UTBB 3NQJA 4CAYB 5KDMA 4ZUXD
chains in the Genus database with same CATH topology
3AZEC 5AY8C 5GT3B 1M19B 3AZGB 3AZJC 2AROC 3LZ1A 1BFMA 3AN2C 3AZID 3VH5W 3REJC 4KGCD 2F8NH 3H0MC 5DNMB 4WU8D 2CV5C 2YFWB 5B0ZA 2NQBC 3MGSC 3KXBB 3MVDB 5B1LA 5BS7A 3AYWC 3RELC 4Z2MG 3AZFC 5B31B 5GT0D 1M1AB 1JFIA 1AOIA 1P3GD 1KX5B 2NZDD 4WZSB 4XUJA 3AZHC 1F66A 5F99B 3W97A 5AV5B 2ZY5A 2FJ7B 5B0YC 3A1KA 4R8PA 5B32B 5E5AD 3TU4B 5B40C 5CPKC 3VH5A 3B0DC 3NQJB 4LD9A 5KDMB 3UTBD 2Y2MA 4J8UA 3MGPD 3A1IA 1M19D 5GT3D 3AZGD 3LZ1B 3WAAA 3LJAD 3W96C 4X23B 3WA9D 5CPJA 4KUDC 5G49A 2J8PA 5DNMD 5B0ZB 4YS3B 4XZQC 5BT1C 3LZ0A 3KXBD 4J8XB 4JJNA 3MVDD 4ZBJB 1JFIB 1AOIB 5B31D 4Z66A 1M1AD 1T3UA 1KX5D 4XUJB 1F66B 1ZLAD 3W97B 5F99D 1S32D 2XD5A 5AV5D 2FJ7D 3X1TA 3AV2C 2DQNC 5B32D 3TU4D 4LD9B 3AZND 1P3AA 3W98A 4J8UB 2DF4C 3B0CW 5CPIA 4QLCC 3MGRA 1P3MA 1P3LC 3LZ1D 3WAAB 5JRGA 3MGQC 3C1CA 3B6GA 1EQZA 3AZLB 2Y2JA 5CPJB 4YM6A 4NFTA 3KUYA 2F8NG 5AVBB 5B0ZD 3LZ0B 3H0LC 5B1MA 3X1SC 4G91C 1AOID 3MNNA 1ID3A 3REKC 4XUJD 4UUZA 5AVCA 1F66D 3B0BA 3W97D 5AV6C 2Y2OA 3X1TB 5GXQC 1F1EA 2BG1A 5B33C 1KX4A 1B67A 4R8PD 2RVQD 3WTPC 3EPJA 1P3AB 3O62A 4LD9D 3W98B 5AV9A 5B24C 1HQ3C 1M19A 3A6NA 2JCHA 4J8UD 4CSRA 1P3OC 4E45A 5CPIB 4UPKA 4NE5A 3MGRB 3VH6W 1P3MB 3AFAA 1P3FC 5JA4A 3AZMC 3WAAD 5JRGB 3C1BA 1P3BA 1EQZB 1TZYC 5CPJD 3LZ0D 4JJND 3WKJA 5B1MB 3AV1C 3MGPC 3REIC 4Z66D 5B2JB 3W99B 1N1JA 4HGAC 4J8VC 1M18B 4UUZB 5AVCB 3LELC 3REHB 4H9NA 3EPHA 3VH6A 2HIOC 1B6WA 3X1TD 3LJAC 1KX4B 1KX3C 3WA9C 4J8WC 2Y2NA 2XD1A 3AZEA 5AY8A 5CP6B 3O62B 3KSYA 1P3AD 3AZJA 2AROA 5AV9B 2Y2PA 2PYOC 3W98D 3AN2A 3A6NB 4CSRB 1P3PC 1W2EA 1WWSA 2IO5C 5CPID 5BO0A 3AFAB 3MGRD 5JA4B 4X23A 3REJA 1P3KC 1P3MD 2CV5A 3C1BB 3NQUA 5JRGD 3MGSA 1P3BB 2NQBA 3C1CD 1ZLAC 3B6GD 4YS3A 1EQZD 1S32C 3AYWA 3RELA 4J8XA 4YM6D 1H3OA 3AZFA 3KUYD 4AWLC 1WWIA 3P5JB 3UTAC 5B2IB 3AZNC 3AZHA 3WKJB 5B1MD 1N1JB 5B0YA 3MNND 1ID3D 5AVCD 5CPKA 2YFVA 2Y2LA 4H9NB 3X1UC 3AZKC 1KX4D 2Y2KA 5AY8B 3AZEB 4EO5C 3O62D 3EPLA 3AZJB 2AROB 5AV9D 3AN2B 3A6ND 3W96A 5B1LC 5GSUC 5BO0B 3KFUG 3REJB 3AFAD 4KUDA 2CV5B 1PZRA 3AZLA 3F6TA 3NQUB 3C1BD 3MGSB 2NQBB 4XZQA 2UWXA 1P3BD 2HUEC 5AVBA 3KWQC 3AYWB 3RELB 3AZFB 1H3OB 1ULYA 4R8PC 3AZHB 2Y2HA 3WKJD 3B6FC 5B0YB 3AV2A 2Y2GA 5B40B 4Z5TC 5CPKB 2YFVB 4H9RA 3B0DB 5AV8C 5DNNC 3FDDA 1P34C 3AZED 5AY8D 3AZJD 2AROD 1P3LA 3AN2D 1P3IC 1BH9A 4JJNC 3W96B 1U35C 3MGQA 3REJD 4KUDB 4X23D 4Z66C 2CV5D 4WU9C 4XZQB 3VH5T 4NE3A 3MGSD 5B31G 2NQBD 4H9OA 4YS3D 3UT9C 3X1VC 3AYWD 3RELD 4J8XD 3AZFD 5C3IC 3X1SA 4H9QA 2JSSA 4ZUXC 3REKA 5B2JA 3AZHD 3W99A 1M18A 3REHA 5GXQA 5B33A 5B0YD 3AV2B 3AZIC 4H9RB 2Y2IA 3WTPA 5CPKD 4KGCC 1HQ3A 5CP6A 4H9PA 5B24A 4WU8C 3C1CC 1P3OA 2BYKA 3B6GC 2F8NK 4YM6C 4QLCB 3KUYC 1P3LB 1P3FA 3AZMA 1BH9B 2ZY2A 5GT0C 3MGQB 1P3GC 3W96D 2NZDC 4G92C 1TZYA 4KHAA 4KUDD 3AZLD 3MNNC 1ID3C 5BT1D 4XZQD 4H9OB 5AVBD 5E5AC 2L5AA 5B2IA 3X1SB 4H9QB 4G91B 3AV1A 3UTBC 3REIA 3REKB 4J8VA 2G5IC 3LELA 5AV6B 2HIOA 5GXQB 3WTPE 1M19C 5GT3C 4H9SA 3AZGC 5B33B 1KX3A 3AV2D 2RIQA 4J8WA 3WTPB 1HQ3B 5B24B 4H9PB 2PYOA 1P3OB 5DNMC 2BYKB 1P3PA 2W8SA 2ZY4A 3KXBC 3MVDC 1P3FB 1P3KA 3AZMB 1P3LD 3B0CT 2F8NA 4E44A 3EPKA 5B31C 1M1AC 3MGQD 1KX5C 1TZYB 1TAFB 4KHAB 3EG5B 4DQYB 5F99C 5AV5C 2FJ7C 3UTAA 5B32C 3TU4C 2VQRA 3X1SD 3AV1B 3MGPB 3REIB 4HGAB 4J8VB 3REKD 3LELB 3W99D 5B2JD 1M18D 2HIOB 5AV6D 3R45B 5B40A 3X1UA 3LJAB 5GXQD 3REHD 3AZKA 3LZ1C 5B33D 1KX3B 3WA9B 4J8WB 3WTPD 3H0RC 4X23C 2PYOB 1HQ3D 1HTAA 5CP6D 5B24D 1P3PB 1P3OD 5B0ZC 4YS3C 2IO5B 5GSUA 4J8XC 1P3KB 5BS7C 1P3FD 3AZMD 2F8NB 4WNNA 4ZBJC 1Z2CB 3VH6T 1AOIC 1ZLAB 1S32B 3KWQA 1TZYD 4XUJC 1F66C 5CHLB 2G5HC 4AWLB 3W97C 3UTAB 4M6BA 3AZNB 2RVQC 5B2ID 3B6FA 3AV1D 4LD9C 3REID 4J8VD 4J8UC 2F2AC 4Z5TA 3LELD 5BNVA 5AV8A 3X1UB 2HIOD 5DNNA 3AZKB 1KX3D 5FUGA 3WAAC 4J8WD 1P34A 4EO5B 3AZLC 2LY8A 5CPJC 2PYOD 4QLCA 1P3IA 1P3PD 5B1LB 5AVBC 5GSUB 3LZ0C 1U35A 1P3KD 2BYMA 4WNNB 4WU9A 2F8ND 2HUEB 1BH8A 3KWQB 3UT9A 3X1VA 4R8PB 3X1TC 4ZUXA 3UTAD 3B6FB 1P3AC 5B32G 5AV6A 3W98C 3AZIA 4Z5TB 5BNVB 5AV8B 5CPIC 5DNNB 5B40D 3X1UD 3AZKD 3MGRC 1P3MC 4KGCA 2CWEA 5FUGB 5BNXA 4WU8A 5JRGC 1P34B 1Q9CA 4Z2MH 5G49B 1EQZC 3V9RA 4WV4B 1P3IB 5GT0A 4JJNB 1U35B 1P3GA 5B1LD 5GSUD 2NZDA 2BYMB 4Z66B 4WU9B 1TAFA 5B1MC 1BH8B 3W99C 5B2JC 3UT9B 3X1VB 3KWQD 1M18C 5E5AA 4DRBA 5C3IB 5AVCC 4NE6A 3REHC 3UTBA 4ZUXB 4CAYA 1R4VA 3MGPA 1KX4C 3O62C 5GT3A 3IP4C 5CP6C 2ZM5A 3AZGA 3B6FD 5AV9C 3R45A 3AZIB 3LJAA 3A6NC 4Z5TD 3AL0C 2Y2QA 5AV8D 3WA9A 5DNND 4DRAA 4KGCB 3AFAC 5BNXB 4WU8B 3C1CB 5DNMA 3B6GB 2YFWA 3C1BC 1P34D 1P3BC 3KXBA 4YM6B 1A7WA 3KUYB 3V9RB 3MVDA 2FFFB 4QLCD 5GT0B 1P3ID 1KU5A 5B31A 1M1AA 1P3GB 2JE5A 1U35D 2NZDB 4G92B 5B2IC 1KX5A 1ZLAA 5F99A 2ZY3A 1S32A 3MNNB 3WKJC 4WU9D 5AV5A 1ID3B 2FJ7A 4WJ3C 5E5AB 3UT9D 3X1VD 5B32A 3TU4A 4H9SC 3AZNA 3UTBB 3NQJA 4CAYB 5KDMA 4ZUXD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZE C;  5AY8 C;  5GT3 B;  1M19 B;  3AZG B;  3AZJ C;  2ARO C;  3LZ1 A;  1BFM A;  3AN2 C;  3AZI D;  3VH5 W;  3REJ C;  4KGC D;  2F8N H;  5DNM B;  4WU8 D;  2CV5 C;  2YFW B;  5B0Z A;  2NQB C;  3MGS C;  3KXB B;  3MVD B;  5B1L A;  5BS7 A;  3AYW C;  3REL C;  4Z2M G;  3AZF C;  5B31 B;  5GT0 D;  1M1A B;  1JFI A;  1AOI A;  1P3G D;  1KX5 B;  2NZD D;  4WZS B;  4XUJ A;  3AZH C;  1F66 A;  5F99 B;  3W97 A;  5AV5 B;  2FJ7 B;  5B0Y C;  4R8P A;  5B32 B;  5E5A D;  3TU4 B;  5B40 C;  5CPK C;  3VH5 A;  3B0D C;  3NQJ B;  4LD9 A;  5KDM B;  3UTB D;  4J8U A;  3MGP D;  1M19 D;  5GT3 D;  3AZG D;  3LZ1 B;  3WAA A;  3LJA D;  3W96 C;  4X23 B;  3WA9 D;  5CPJ A;  4KUD C;  5G49 A;  5DNM D;  5B0Z B;  4YS3 B;  4XZQ C;  5BT1 C;  3LZ0 A;  3KXB D;  4J8X B;  4JJN A;  3MVD D;  4ZBJ B;  1JFI B;  1AOI B;  5B31 D;  4Z66 A;  1M1A D;  1KX5 D;  4XUJ B;  1F66 B;  1ZLA D;  3W97 B;  5F99 D;  1S32 D;  5AV5 D;  2FJ7 D;  3X1T A;  3AV2 C;  5B32 D;  3TU4 D;  4LD9 B;  3AZN D;  1P3A A;  3W98 A;  4J8U B;  3B0C W;  5CPI A;  4QLC C;  3MGR A;  1P3M A;  1P3L C;  3LZ1 D;  3WAA B;  5JRG A;  3MGQ C;  3C1C A;  3B6G A;  1EQZ A;  3AZL B;  5CPJ B;  4YM6 A;  4NFT A;  3KUY A;  2F8N G;  5AVB B;  5B0Z D;  3LZ0 B;  5B1M A;  3X1S C;  4G91 C;  1AOI D;  3MNN A;  1ID3 A;  3REK C;  4XUJ D;  4UUZ A;  5AVC A;  1F66 D;  3B0B A;  3W97 D;  5AV6 C;  3X1T B;  5GXQ C;  1F1E A;  5B33 C;  1KX4 A;  1B67 A;  4R8P D;  2RVQ D;  3WTP C;  1P3A B;  3O62 A;  4LD9 D;  3W98 B;  5AV9 A;  1HQ3 C;  5B24 C;  1M19 A;  3A6N A;  4J8U D;  4CSR A;  1P3O C;  4E45 A;  5CPI B;  4NE5 A;  3MGR B;  3VH6 W;  1P3M B;  3AFA A;  1P3F C;  5JA4 A;  3AZM C;  3WAA D;  5JRG B;  3C1B A;  1P3B A;  1EQZ B;  1TZY C;  5CPJ D;  3LZ0 D;  4JJN D;  3WKJ A;  5B1M B;  3AV1 C;  3MGP C;  3REI C;  4Z66 D;  5B2J B;  3W99 B;  1N1J A;  4HGA C;  4J8V C;  1M18 B;  4UUZ B;  5AVC B;  3LEL C;  3REH B;  4H9N A;  3VH6 A;  2HIO C;  1B6W A;  3X1T D;  3LJA C;  1KX4 B;  1KX3 C;  3WA9 C;  4J8W C;  3AZE A;  5AY8 A;  5CP6 B;  3O62 B;  3KSY A;  1P3A D;  3AZJ A;  2ARO A;  5AV9 B;  2PYO C;  3W98 D;  3AN2 A;  3A6N B;  4CSR B;  1P3P C;  2IO5 C;  1WWS A;  5CPI D;  5BO0 A;  3AFA B;  3MGR D;  5JA4 B;  4X23 A;  3REJ A;  1P3K C;  1P3M D;  2CV5 A;  3C1B B;  3NQU A;  5JRG D;  3MGS A;  1P3B B;  2NQB A;  3C1C D;  1ZLA C;  3B6G D;  4YS3 A;  1EQZ D;  1S32 C;  3AYW A;  3REL A;  4J8X A;  4YM6 D;  1H3O A;  3AZF A;  3KUY D;  4AWL C;  1WWI A;  3UTA C;  5B2I B;  3AZN C;  3AZH A;  3WKJ B;  5B1M D;  1N1J B;  5B0Y A;  3MNN D;  1ID3 D;  5AVC D;  5CPK A;  2YFV A;  4H9N B;  3X1U C;  3AZK C;  1KX4 D;  3AZE B;  5AY8 B;  4EO5 C;  3O62 D;  3AZJ B;  2ARO B;  5AV9 D;  3AN2 B;  3A6N D;  3W96 A;  5B1L C;  5GSU C;  5BO0 B;  3REJ B;  3AFA D;  4KUD A;  2CV5 B;  3AZL A;  3NQU B;  3C1B D;  3MGS B;  2NQB B;  4XZQ A;  1P3B D;  2HUE C;  5AVB A;  3KWQ C;  3AYW B;  3REL B;  3AZF B;  1H3O B;  1ULY A;  4R8P C;  3AZH B;  3WKJ D;  3B6F C;  5B0Y B;  3AV2 A;  5B40 B;  4Z5T C;  5CPK B;  2YFV B;  4H9R A;  3B0D B;  5AV8 C;  5DNN C;  1P34 C;  3AZE D;  5AY8 D;  3AZJ D;  2ARO D;  1P3L A;  3AN2 D;  1P3I C;  1BH9 A;  4JJN C;  3W96 B;  1U35 C;  3MGQ A;  3REJ D;  4KUD B;  4X23 D;  4Z66 C;  2CV5 D;  4WU9 C;  4XZQ B;  3VH5 T;  4NE3 A;  3MGS D;  5B31 G;  2NQB D;  4H9O A;  4YS3 D;  3UT9 C;  3X1V C;  3AYW D;  3REL D;  4J8X D;  3AZF D;  5C3I C;  3X1S A;  4H9Q A;  2JSS A;  4ZUX C;  3REK A;  5B2J A;  3AZH D;  3W99 A;  1M18 A;  3REH A;  5GXQ A;  5B33 A;  5B0Y D;  3AV2 B;  3AZI C;  4H9R B;  3WTP A;  5CPK D;  4KGC C;  1HQ3 A;  5CP6 A;  4H9P A;  5B24 A;  4WU8 C;  3C1C C;  1P3O A;  2BYK A;  3B6G C;  2F8N K;  4YM6 C;  4QLC B;  3KUY C;  1P3L B;  1P3F A;  3AZM A;  1BH9 B;  5GT0 C;  3MGQ B;  1P3G C;  3W96 D;  2NZD C;  4G92 C;  1TZY A;  4KHA A;  4KUD D;  3AZL D;  3MNN C;  1ID3 C;  5BT1 D;  4XZQ D;  4H9O B;  5AVB D;  5E5A C;  2L5A A;  5B2I A;  3X1S B;  4H9Q B;  4G91 B;  3AV1 A;  3UTB C;  3REI A;  3REK B;  4J8V A;  3LEL A;  5AV6 B;  2HIO A;  5GXQ B;  3WTP E;  1M19 C;  5GT3 C;  4H9S A;  3AZG C;  5B33 B;  1KX3 A;  3AV2 D;  4J8W A;  3WTP B;  1HQ3 B;  5B24 B;  4H9P B;  2PYO A;  1P3O B;  5DNM C;  2BYK B;  1P3P A;  3KXB C;  3MVD C;  1P3F B;  1P3K A;  3AZM B;  1P3L D;  3B0C T;  2F8N A;  4E44 A;  5B31 C;  1M1A C;  3MGQ D;  1KX5 C;  1TZY B;  1TAF B;  4KHA B;  5F99 C;  5AV5 C;  2FJ7 C;  3UTA A;  5B32 C;  3TU4 C;  3X1S D;  3AV1 B;  3MGP B;  3REI B;  4HGA B;  4J8V B;  3REK D;  3LEL B;  3W99 D;  5B2J D;  1M18 D;  2HIO B;  5AV6 D;  3R45 B;  5B40 A;  3X1U A;  3LJA B;  5GXQ D;  3REH D;  3AZK A;  3LZ1 C;  5B33 D;  1KX3 B;  3WA9 B;  4J8W B;  3WTP D;  4X23 C;  2PYO B;  1HQ3 D;  1HTA A;  5CP6 D;  5B24 D;  1P3P B;  1P3O D;  5B0Z C;  4YS3 C;  2IO5 B;  5GSU A;  4J8X C;  1P3K B;  5BS7 C;  1P3F D;  3AZM D;  2F8N B;  4WNN A;  4ZBJ C;  3VH6 T;  1AOI C;  1ZLA B;  1S32 B;  3KWQ A;  1TZY D;  4XUJ C;  1F66 C;  5CHL B;  4AWL B;  3W97 C;  3UTA B;  4M6B A;  3AZN B;  2RVQ C;  5B2I D;  3B6F A;  3AV1 D;  4LD9 C;  3REI D;  4J8V D;  4J8U C;  4Z5T A;  3LEL D;  5BNV A;  5AV8 A;  3X1U B;  2HIO D;  5DNN A;  3AZK B;  1KX3 D;  5FUG A;  3WAA C;  4J8W D;  1P34 A;  4EO5 B;  3AZL C;  2LY8 A;  5CPJ C;  2PYO D;  4QLC A;  1P3I A;  1P3P D;  5B1L B;  5AVB C;  5GSU B;  3LZ0 C;  1U35 A;  1P3K D;  2BYM A;  4WNN B;  4WU9 A;  2F8N D;  2HUE B;  1BH8 A;  3KWQ B;  3UT9 A;  3X1V A;  4R8P B;  3X1T C;  4ZUX A;  3UTA D;  3B6F B;  1P3A C;  5B32 G;  5AV6 A;  3W98 C;  3AZI A;  4Z5T B;  5BNV B;  5AV8 B;  5CPI C;  5DNN B;  5B40 D;  3X1U D;  3AZK D;  3MGR C;  1P3M C;  4KGC A;  4WU8 A;  2CWE A;  5FUG B;  5BNX A;  5JRG C;  1P34 B;  1Q9C A;  4Z2M H;  5G49 B;  1EQZ C;  3V9R A;  4WV4 B;  1P3I B;  5GT0 A;  4JJN B;  1U35 B;  1P3G A;  5B1L D;  5GSU D;  2NZD A;  2BYM B;  4Z66 B;  4WU9 B;  1TAF A;  5B1M C;  1BH8 B;  3W99 C;  5B2J C;  3UT9 B;  3X1V B;  3KWQ D;  1M18 C;  5E5A A;  4DRB A;  5C3I B;  5AVC C;  4NE6 A;  3REH C;  3UTB A;  4ZUX B;  4CAY A;  1R4V A;  3MGP A;  1KX4 C;  3O62 C;  5GT3 A;  5CP6 C;  3B6F D;  3AZG A;  5AV9 C;  3R45 A;  3AZI B;  3LJA A;  3A6N C;  4Z5T D;  5AV8 D;  3WA9 A;  5DNN D;  4DRA A;  4KGC B;  3AFA C;  5BNX B;  4WU8 B;  3C1C B;  5DNM A;  3B6G B;  2YFW A;  3C1B C;  1P34 D;  1P3B C;  3KXB A;  4YM6 B;  1A7W A;  3KUY B;  3V9R B;  3MVD A;  4QLC D;  5GT0 B;  1P3I D;  1KU5 A;  5B31 A;  1M1A A;  1P3G B;  1U35 D;  2NZD B;  4G92 B;  5B2I C;  1KX5 A;  1ZLA A;  5F99 A;  1S32 A;  3WKJ C;  3MNN B;  4WU9 D;  5AV5 A;  1ID3 B;  2FJ7 A;  5E5A B;  3UT9 D;  3X1V D;  5B32 A;  3TU4 A;  4H9S C;  3AZN A;  3UTB B;  3NQJ A;  4CAY B;  5KDM A;  4ZUX D; 
#chains in the Genus database with same CATH topology
 3AZE C;  5AY8 C;  5GT3 B;  1M19 B;  3AZG B;  3AZJ C;  2ARO C;  3LZ1 A;  1BFM A;  3AN2 C;  3AZI D;  3VH5 W;  3REJ C;  4KGC D;  2F8N H;  3H0M C;  5DNM B;  4WU8 D;  2CV5 C;  2YFW B;  5B0Z A;  2NQB C;  3MGS C;  3KXB B;  3MVD B;  5B1L A;  5BS7 A;  3AYW C;  3REL C;  4Z2M G;  3AZF C;  5B31 B;  5GT0 D;  1M1A B;  1JFI A;  1AOI A;  1P3G D;  1KX5 B;  2NZD D;  4WZS B;  4XUJ A;  3AZH C;  1F66 A;  5F99 B;  3W97 A;  5AV5 B;  2ZY5 A;  2FJ7 B;  5B0Y C;  3A1K A;  4R8P A;  5B32 B;  5E5A D;  3TU4 B;  5B40 C;  5CPK C;  3VH5 A;  3B0D C;  3NQJ B;  4LD9 A;  5KDM B;  3UTB D;  2Y2M A;  4J8U A;  3MGP D;  3A1I A;  1M19 D;  5GT3 D;  3AZG D;  3LZ1 B;  3WAA A;  3LJA D;  3W96 C;  4X23 B;  3WA9 D;  5CPJ A;  4KUD C;  5G49 A;  2J8P A;  5DNM D;  5B0Z B;  4YS3 B;  4XZQ C;  5BT1 C;  3LZ0 A;  3KXB D;  4J8X B;  4JJN A;  3MVD D;  4ZBJ B;  1JFI B;  1AOI B;  5B31 D;  4Z66 A;  1M1A D;  1T3U A;  1KX5 D;  4XUJ B;  1F66 B;  1ZLA D;  3W97 B;  5F99 D;  1S32 D;  2XD5 A;  5AV5 D;  2FJ7 D;  3X1T A;  3AV2 C;  2DQN C;  5B32 D;  3TU4 D;  4LD9 B;  3AZN D;  1P3A A;  3W98 A;  4J8U B;  2DF4 C;  3B0C W;  5CPI A;  4QLC C;  3MGR A;  1P3M A;  1P3L C;  3LZ1 D;  3WAA B;  5JRG A;  3MGQ C;  3C1C A;  3B6G A;  1EQZ A;  3AZL B;  2Y2J A;  5CPJ B;  4YM6 A;  4NFT A;  3KUY A;  2F8N G;  5AVB B;  5B0Z D;  3LZ0 B;  3H0L C;  5B1M A;  3X1S C;  4G91 C;  1AOI D;  3MNN A;  1ID3 A;  3REK C;  4XUJ D;  4UUZ A;  5AVC A;  1F66 D;  3B0B A;  3W97 D;  5AV6 C;  2Y2O A;  3X1T B;  5GXQ C;  1F1E A;  2BG1 A;  5B33 C;  1KX4 A;  1B67 A;  4R8P D;  2RVQ D;  3WTP C;  3EPJ A;  1P3A B;  3O62 A;  4LD9 D;  3W98 B;  5AV9 A;  5B24 C;  1HQ3 C;  1M19 A;  3A6N A;  2JCH A;  4J8U D;  4CSR A;  1P3O C;  4E45 A;  5CPI B;  4UPK A;  4NE5 A;  3MGR B;  3VH6 W;  1P3M B;  3AFA A;  1P3F C;  5JA4 A;  3AZM C;  3WAA D;  5JRG B;  3C1B A;  1P3B A;  1EQZ B;  1TZY C;  5CPJ D;  3LZ0 D;  4JJN D;  3WKJ A;  5B1M B;  3AV1 C;  3MGP C;  3REI C;  4Z66 D;  5B2J B;  3W99 B;  1N1J A;  4HGA C;  4J8V C;  1M18 B;  4UUZ B;  5AVC B;  3LEL C;  3REH B;  4H9N A;  3EPH A;  3VH6 A;  2HIO C;  1B6W A;  3X1T D;  3LJA C;  1KX4 B;  1KX3 C;  3WA9 C;  4J8W C;  2Y2N A;  2XD1 A;  3AZE A;  5AY8 A;  5CP6 B;  3O62 B;  3KSY A;  1P3A D;  3AZJ A;  2ARO A;  5AV9 B;  2Y2P A;  2PYO C;  3W98 D;  3AN2 A;  3A6N B;  4CSR B;  1P3P C;  1W2E A;  1WWS A;  2IO5 C;  5CPI D;  5BO0 A;  3AFA B;  3MGR D;  5JA4 B;  4X23 A;  3REJ A;  1P3K C;  1P3M D;  2CV5 A;  3C1B B;  3NQU A;  5JRG D;  3MGS A;  1P3B B;  2NQB A;  3C1C D;  1ZLA C;  3B6G D;  4YS3 A;  1EQZ D;  1S32 C;  3AYW A;  3REL A;  4J8X A;  4YM6 D;  1H3O A;  3AZF A;  3KUY D;  4AWL C;  1WWI A;  3P5J B;  3UTA C;  5B2I B;  3AZN C;  3AZH A;  3WKJ B;  5B1M D;  1N1J B;  5B0Y A;  3MNN D;  1ID3 D;  5AVC D;  5CPK A;  2YFV A;  2Y2L A;  4H9N B;  3X1U C;  3AZK C;  1KX4 D;  2Y2K A;  5AY8 B;  3AZE B;  4EO5 C;  3O62 D;  3EPL A;  3AZJ B;  2ARO B;  5AV9 D;  3AN2 B;  3A6N D;  3W96 A;  5B1L C;  5GSU C;  5BO0 B;  3KFU G;  3REJ B;  3AFA D;  4KUD A;  2CV5 B;  1PZR A;  3AZL A;  3F6T A;  3NQU B;  3C1B D;  3MGS B;  2NQB B;  4XZQ A;  2UWX A;  1P3B D;  2HUE C;  5AVB A;  3KWQ C;  3AYW B;  3REL B;  3AZF B;  1H3O B;  1ULY A;  4R8P C;  3AZH B;  2Y2H A;  3WKJ D;  3B6F C;  5B0Y B;  3AV2 A;  2Y2G A;  5B40 B;  4Z5T C;  5CPK B;  2YFV B;  4H9R A;  3B0D B;  5AV8 C;  5DNN C;  3FDD A;  1P34 C;  3AZE D;  5AY8 D;  3AZJ D;  2ARO D;  1P3L A;  3AN2 D;  1P3I C;  1BH9 A;  4JJN C;  3W96 B;  1U35 C;  3MGQ A;  3REJ D;  4KUD B;  4X23 D;  4Z66 C;  2CV5 D;  4WU9 C;  4XZQ B;  3VH5 T;  4NE3 A;  3MGS D;  5B31 G;  2NQB D;  4H9O A;  4YS3 D;  3UT9 C;  3X1V C;  3AYW D;  3REL D;  4J8X D;  3AZF D;  5C3I C;  3X1S A;  4H9Q A;  2JSS A;  4ZUX C;  3REK A;  5B2J A;  3AZH D;  3W99 A;  1M18 A;  3REH A;  5GXQ A;  5B33 A;  5B0Y D;  3AV2 B;  3AZI C;  4H9R B;  2Y2I A;  3WTP A;  5CPK D;  4KGC C;  1HQ3 A;  5CP6 A;  4H9P A;  5B24 A;  4WU8 C;  3C1C C;  1P3O A;  2BYK A;  3B6G C;  2F8N K;  4YM6 C;  4QLC B;  3KUY C;  1P3L B;  1P3F A;  3AZM A;  1BH9 B;  2ZY2 A;  5GT0 C;  3MGQ B;  1P3G C;  3W96 D;  2NZD C;  4G92 C;  1TZY A;  4KHA A;  4KUD D;  3AZL D;  3MNN C;  1ID3 C;  5BT1 D;  4XZQ D;  4H9O B;  5AVB D;  5E5A C;  2L5A A;  5B2I A;  3X1S B;  4H9Q B;  4G91 B;  3AV1 A;  3UTB C;  3REI A;  3REK B;  4J8V A;  2G5I C;  3LEL A;  5AV6 B;  2HIO A;  5GXQ B;  3WTP E;  1M19 C;  5GT3 C;  4H9S A;  3AZG C;  5B33 B;  1KX3 A;  3AV2 D;  2RIQ A;  4J8W A;  3WTP B;  1HQ3 B;  5B24 B;  4H9P B;  2PYO A;  1P3O B;  5DNM C;  2BYK B;  1P3P A;  2W8S A;  2ZY4 A;  3KXB C;  3MVD C;  1P3F B;  1P3K A;  3AZM B;  1P3L D;  3B0C T;  2F8N A;  4E44 A;  3EPK A;  5B31 C;  1M1A C;  3MGQ D;  1KX5 C;  1TZY B;  1TAF B;  4KHA B;  3EG5 B;  4DQY B;  5F99 C;  5AV5 C;  2FJ7 C;  3UTA A;  5B32 C;  3TU4 C;  2VQR A;  3X1S D;  3AV1 B;  3MGP B;  3REI B;  4HGA B;  4J8V B;  3REK D;  3LEL B;  3W99 D;  5B2J D;  1M18 D;  2HIO B;  5AV6 D;  3R45 B;  5B40 A;  3X1U A;  3LJA B;  5GXQ D;  3REH D;  3AZK A;  3LZ1 C;  5B33 D;  1KX3 B;  3WA9 B;  4J8W B;  3WTP D;  3H0R C;  4X23 C;  2PYO B;  1HQ3 D;  1HTA A;  5CP6 D;  5B24 D;  1P3P B;  1P3O D;  5B0Z C;  4YS3 C;  2IO5 B;  5GSU A;  4J8X C;  1P3K B;  5BS7 C;  1P3F D;  3AZM D;  2F8N B;  4WNN A;  4ZBJ C;  1Z2C B;  3VH6 T;  1AOI C;  1ZLA B;  1S32 B;  3KWQ A;  1TZY D;  4XUJ C;  1F66 C;  5CHL B;  2G5H C;  4AWL B;  3W97 C;  3UTA B;  4M6B A;  3AZN B;  2RVQ C;  5B2I D;  3B6F A;  3AV1 D;  4LD9 C;  3REI D;  4J8V D;  4J8U C;  2F2A C;  4Z5T A;  3LEL D;  5BNV A;  5AV8 A;  3X1U B;  2HIO D;  5DNN A;  3AZK B;  1KX3 D;  5FUG A;  3WAA C;  4J8W D;  1P34 A;  4EO5 B;  3AZL C;  2LY8 A;  5CPJ C;  2PYO D;  4QLC A;  1P3I A;  1P3P D;  5B1L B;  5AVB C;  5GSU B;  3LZ0 C;  1U35 A;  1P3K D;  2BYM A;  4WNN B;  4WU9 A;  2F8N D;  2HUE B;  1BH8 A;  3KWQ B;  3UT9 A;  3X1V A;  4R8P B;  3X1T C;  4ZUX A;  3UTA D;  3B6F B;  1P3A C;  5B32 G;  5AV6 A;  3W98 C;  3AZI A;  4Z5T B;  5BNV B;  5AV8 B;  5CPI C;  5DNN B;  5B40 D;  3X1U D;  3AZK D;  3MGR C;  1P3M C;  4KGC A;  2CWE A;  5FUG B;  5BNX A;  4WU8 A;  5JRG C;  1P34 B;  1Q9C A;  4Z2M H;  5G49 B;  1EQZ C;  3V9R A;  4WV4 B;  1P3I B;  5GT0 A;  4JJN B;  1U35 B;  1P3G A;  5B1L D;  5GSU D;  2NZD A;  2BYM B;  4Z66 B;  4WU9 B;  1TAF A;  5B1M C;  1BH8 B;  3W99 C;  5B2J C;  3UT9 B;  3X1V B;  3KWQ D;  1M18 C;  5E5A A;  4DRB A;  5C3I B;  5AVC C;  4NE6 A;  3REH C;  3UTB A;  4ZUX B;  4CAY A;  1R4V A;  3MGP A;  1KX4 C;  3O62 C;  5GT3 A;  3IP4 C;  5CP6 C;  2ZM5 A;  3AZG A;  3B6F D;  5AV9 C;  3R45 A;  3AZI B;  3LJA A;  3A6N C;  4Z5T D;  3AL0 C;  2Y2Q A;  5AV8 D;  3WA9 A;  5DNN D;  4DRA A;  4KGC B;  3AFA C;  5BNX B;  4WU8 B;  3C1C B;  5DNM A;  3B6G B;  2YFW A;  3C1B C;  1P34 D;  1P3B C;  3KXB A;  4YM6 B;  1A7W A;  3KUY B;  3V9R B;  3MVD A;  2FFF B;  4QLC D;  5GT0 B;  1P3I D;  1KU5 A;  5B31 A;  1M1A A;  1P3G B;  2JE5 A;  1U35 D;  2NZD B;  4G92 B;  5B2I C;  1KX5 A;  1ZLA A;  5F99 A;  2ZY3 A;  1S32 A;  3MNN B;  3WKJ C;  4WU9 D;  5AV5 A;  1ID3 B;  2FJ7 A;  4WJ3 C;  5E5A B;  3UT9 D;  3X1V D;  5B32 A;  3TU4 A;  4H9S C;  3AZN A;  3UTB B;  3NQJ A;  4CAY B;  5KDM A;  4ZUX D; 
#chains in the Genus database with same CATH homology
 3AZE C;  5AY8 C;  5GT3 B;  1M19 B;  3AZG B;  3AZJ C;  2ARO C;  3LZ1 A;  1BFM A;  3AN2 C;  3AZI D;  3VH5 W;  3REJ C;  4KGC D;  2F8N H;  3H0M C;  5DNM B;  4WU8 D;  2CV5 C;  2YFW B;  5B0Z A;  2NQB C;  3MGS C;  3KXB B;  3MVD B;  5B1L A;  5BS7 A;  3AYW C;  3REL C;  4Z2M G;  3AZF C;  5B31 B;  5GT0 D;  1M1A B;  1JFI A;  1AOI A;  1P3G D;  1KX5 B;  2NZD D;  4WZS B;  4XUJ A;  3AZH C;  1F66 A;  5F99 B;  3W97 A;  5AV5 B;  2ZY5 A;  2FJ7 B;  5B0Y C;  3A1K A;  4R8P A;  5B32 B;  5E5A D;  3TU4 B;  5B40 C;  5CPK C;  3VH5 A;  3B0D C;  3NQJ B;  4LD9 A;  5KDM B;  3UTB D;  2Y2M A;  4J8U A;  3MGP D;  3A1I A;  1M19 D;  5GT3 D;  3AZG D;  3LZ1 B;  3WAA A;  3LJA D;  3W96 C;  4X23 B;  3WA9 D;  5CPJ A;  4KUD C;  5G49 A;  2J8P A;  5DNM D;  5B0Z B;  4YS3 B;  4XZQ C;  5BT1 C;  3LZ0 A;  3KXB D;  4J8X B;  4JJN A;  3MVD D;  4ZBJ B;  1JFI B;  1AOI B;  5B31 D;  4Z66 A;  1M1A D;  1T3U A;  1KX5 D;  4XUJ B;  1F66 B;  1ZLA D;  3W97 B;  5F99 D;  1S32 D;  2XD5 A;  5AV5 D;  2FJ7 D;  3X1T A;  3AV2 C;  2DQN C;  5B32 D;  3TU4 D;  4LD9 B;  3AZN D;  1P3A A;  3W98 A;  4J8U B;  2DF4 C;  3B0C W;  5CPI A;  4QLC C;  3MGR A;  1P3M A;  1P3L C;  3LZ1 D;  3WAA B;  5JRG A;  3MGQ C;  3C1C A;  3B6G A;  1EQZ A;  3AZL B;  2Y2J A;  5CPJ B;  4YM6 A;  4NFT A;  3KUY A;  2F8N G;  5AVB B;  5B0Z D;  3LZ0 B;  3H0L C;  5B1M A;  3X1S C;  4G91 C;  1AOI D;  3MNN A;  1ID3 A;  3REK C;  4XUJ D;  4UUZ A;  5AVC A;  1F66 D;  3B0B A;  3W97 D;  5AV6 C;  2Y2O A;  3X1T B;  5GXQ C;  1F1E A;  2BG1 A;  5B33 C;  1KX4 A;  1B67 A;  4R8P D;  2RVQ D;  3WTP C;  3EPJ A;  1P3A B;  3O62 A;  4LD9 D;  3W98 B;  5AV9 A;  5B24 C;  1HQ3 C;  1M19 A;  3A6N A;  2JCH A;  4J8U D;  4CSR A;  1P3O C;  4E45 A;  5CPI B;  4UPK A;  4NE5 A;  3MGR B;  3VH6 W;  1P3M B;  3AFA A;  1P3F C;  5JA4 A;  3AZM C;  3WAA D;  5JRG B;  3C1B A;  1P3B A;  1EQZ B;  1TZY C;  5CPJ D;  3LZ0 D;  4JJN D;  3WKJ A;  5B1M B;  3AV1 C;  3MGP C;  3REI C;  4Z66 D;  5B2J B;  3W99 B;  1N1J A;  4HGA C;  4J8V C;  1M18 B;  4UUZ B;  5AVC B;  3LEL C;  3REH B;  4H9N A;  3EPH A;  3VH6 A;  2HIO C;  1B6W A;  3X1T D;  3LJA C;  1KX4 B;  1KX3 C;  3WA9 C;  4J8W C;  2Y2N A;  2XD1 A;  3AZE A;  5AY8 A;  5CP6 B;  3O62 B;  3KSY A;  1P3A D;  3AZJ A;  2ARO A;  5AV9 B;  2Y2P A;  2PYO C;  3W98 D;  3AN2 A;  3A6N B;  4CSR B;  1P3P C;  1W2E A;  1WWS A;  2IO5 C;  5CPI D;  5BO0 A;  3AFA B;  3MGR D;  5JA4 B;  4X23 A;  3REJ A;  1P3K C;  1P3M D;  2CV5 A;  3C1B B;  3NQU A;  5JRG D;  3MGS A;  1P3B B;  2NQB A;  3C1C D;  1ZLA C;  3B6G D;  4YS3 A;  1EQZ D;  1S32 C;  3AYW A;  3REL A;  4J8X A;  4YM6 D;  1H3O A;  3AZF A;  3KUY D;  4AWL C;  1WWI A;  3P5J B;  3UTA C;  5B2I B;  3AZN C;  3AZH A;  3WKJ B;  5B1M D;  1N1J B;  5B0Y A;  3MNN D;  1ID3 D;  5AVC D;  5CPK A;  2YFV A;  2Y2L A;  4H9N B;  3X1U C;  3AZK C;  1KX4 D;  2Y2K A;  5AY8 B;  3AZE B;  4EO5 C;  3O62 D;  3EPL A;  3AZJ B;  2ARO B;  5AV9 D;  3AN2 B;  3A6N D;  3W96 A;  5B1L C;  5GSU C;  5BO0 B;  3KFU G;  3REJ B;  3AFA D;  4KUD A;  2CV5 B;  1PZR A;  3AZL A;  3F6T A;  3NQU B;  3C1B D;  3MGS B;  2NQB B;  4XZQ A;  2UWX A;  1P3B D;  2HUE C;  5AVB A;  3KWQ C;  3AYW B;  3REL B;  3AZF B;  1H3O B;  1ULY A;  4R8P C;  3AZH B;  2Y2H A;  3WKJ D;  3B6F C;  5B0Y B;  3AV2 A;  2Y2G A;  5B40 B;  4Z5T C;  5CPK B;  2YFV B;  4H9R A;  3B0D B;  5AV8 C;  5DNN C;  3FDD A;  1P34 C;  3AZE D;  5AY8 D;  3AZJ D;  2ARO D;  1P3L A;  3AN2 D;  1P3I C;  1BH9 A;  4JJN C;  3W96 B;  1U35 C;  3MGQ A;  3REJ D;  4KUD B;  4X23 D;  4Z66 C;  2CV5 D;  4WU9 C;  4XZQ B;  3VH5 T;  4NE3 A;  3MGS D;  5B31 G;  2NQB D;  4H9O A;  4YS3 D;  3UT9 C;  3X1V C;  3AYW D;  3REL D;  4J8X D;  3AZF D;  5C3I C;  3X1S A;  4H9Q A;  2JSS A;  4ZUX C;  3REK A;  5B2J A;  3AZH D;  3W99 A;  1M18 A;  3REH A;  5GXQ A;  5B33 A;  5B0Y D;  3AV2 B;  3AZI C;  4H9R B;  2Y2I A;  3WTP A;  5CPK D;  4KGC C;  1HQ3 A;  5CP6 A;  4H9P A;  5B24 A;  4WU8 C;  3C1C C;  1P3O A;  2BYK A;  3B6G C;  2F8N K;  4YM6 C;  4QLC B;  3KUY C;  1P3L B;  1P3F A;  3AZM A;  1BH9 B;  2ZY2 A;  5GT0 C;  3MGQ B;  1P3G C;  3W96 D;  2NZD C;  4G92 C;  1TZY A;  4KHA A;  4KUD D;  3AZL D;  3MNN C;  1ID3 C;  5BT1 D;  4XZQ D;  4H9O B;  5AVB D;  5E5A C;  2L5A A;  5B2I A;  3X1S B;  4H9Q B;  4G91 B;  3AV1 A;  3UTB C;  3REI A;  3REK B;  4J8V A;  2G5I C;  3LEL A;  5AV6 B;  2HIO A;  5GXQ B;  3WTP E;  1M19 C;  5GT3 C;  4H9S A;  3AZG C;  5B33 B;  1KX3 A;  3AV2 D;  2RIQ A;  4J8W A;  3WTP B;  1HQ3 B;  5B24 B;  4H9P B;  2PYO A;  1P3O B;  5DNM C;  2BYK B;  1P3P A;  2W8S A;  2ZY4 A;  3KXB C;  3MVD C;  1P3F B;  1P3K A;  3AZM B;  1P3L D;  3B0C T;  2F8N A;  4E44 A;  3EPK A;  5B31 C;  1M1A C;  3MGQ D;  1KX5 C;  1TZY B;  1TAF B;  4KHA B;  3EG5 B;  4DQY B;  5F99 C;  5AV5 C;  2FJ7 C;  3UTA A;  5B32 C;  3TU4 C;  2VQR A;  3X1S D;  3AV1 B;  3MGP B;  3REI B;  4HGA B;  4J8V B;  3REK D;  3LEL B;  3W99 D;  5B2J D;  1M18 D;  2HIO B;  5AV6 D;  3R45 B;  5B40 A;  3X1U A;  3LJA B;  5GXQ D;  3REH D;  3AZK A;  3LZ1 C;  5B33 D;  1KX3 B;  3WA9 B;  4J8W B;  3WTP D;  3H0R C;  4X23 C;  2PYO B;  1HQ3 D;  1HTA A;  5CP6 D;  5B24 D;  1P3P B;  1P3O D;  5B0Z C;  4YS3 C;  2IO5 B;  5GSU A;  4J8X C;  1P3K B;  5BS7 C;  1P3F D;  3AZM D;  2F8N B;  4WNN A;  4ZBJ C;  1Z2C B;  3VH6 T;  1AOI C;  1ZLA B;  1S32 B;  3KWQ A;  1TZY D;  4XUJ C;  1F66 C;  5CHL B;  2G5H C;  4AWL B;  3W97 C;  3UTA B;  4M6B A;  3AZN B;  2RVQ C;  5B2I D;  3B6F A;  3AV1 D;  4LD9 C;  3REI D;  4J8V D;  4J8U C;  2F2A C;  4Z5T A;  3LEL D;  5BNV A;  5AV8 A;  3X1U B;  2HIO D;  5DNN A;  3AZK B;  1KX3 D;  5FUG A;  3WAA C;  4J8W D;  1P34 A;  4EO5 B;  3AZL C;  2LY8 A;  5CPJ C;  2PYO D;  4QLC A;  1P3I A;  1P3P D;  5B1L B;  5AVB C;  5GSU B;  3LZ0 C;  1U35 A;  1P3K D;  2BYM A;  4WNN B;  4WU9 A;  2F8N D;  2HUE B;  1BH8 A;  3KWQ B;  3UT9 A;  3X1V A;  4R8P B;  3X1T C;  4ZUX A;  3UTA D;  3B6F B;  1P3A C;  5B32 G;  5AV6 A;  3W98 C;  3AZI A;  4Z5T B;  5BNV B;  5AV8 B;  5CPI C;  5DNN B;  5B40 D;  3X1U D;  3AZK D;  3MGR C;  1P3M C;  4KGC A;  2CWE A;  5FUG B;  5BNX A;  4WU8 A;  5JRG C;  1P34 B;  1Q9C A;  4Z2M H;  5G49 B;  1EQZ C;  3V9R A;  4WV4 B;  1P3I B;  5GT0 A;  4JJN B;  1U35 B;  1P3G A;  5B1L D;  5GSU D;  2NZD A;  2BYM B;  4Z66 B;  4WU9 B;  1TAF A;  5B1M C;  1BH8 B;  3W99 C;  5B2J C;  3UT9 B;  3X1V B;  3KWQ D;  1M18 C;  5E5A A;  4DRB A;  5C3I B;  5AVC C;  4NE6 A;  3REH C;  3UTB A;  4ZUX B;  4CAY A;  1R4V A;  3MGP A;  1KX4 C;  3O62 C;  5GT3 A;  3IP4 C;  5CP6 C;  2ZM5 A;  3AZG A;  3B6F D;  5AV9 C;  3R45 A;  3AZI B;  3LJA A;  3A6N C;  4Z5T D;  3AL0 C;  2Y2Q A;  5AV8 D;  3WA9 A;  5DNN D;  4DRA A;  4KGC B;  3AFA C;  5BNX B;  4WU8 B;  3C1C B;  5DNM A;  3B6G B;  2YFW A;  3C1B C;  1P34 D;  1P3B C;  3KXB A;  4YM6 B;  1A7W A;  3KUY B;  3V9R B;  3MVD A;  2FFF B;  4QLC D;  5GT0 B;  1P3I D;  1KU5 A;  5B31 A;  1M1A A;  1P3G B;  2JE5 A;  1U35 D;  2NZD B;  4G92 B;  5B2I C;  1KX5 A;  1ZLA A;  5F99 A;  2ZY3 A;  1S32 A;  3MNN B;  3WKJ C;  4WU9 D;  5AV5 A;  1ID3 B;  2FJ7 A;  4WJ3 C;  5E5A B;  3UT9 D;  3X1V D;  5B32 A;  3TU4 A;  4H9S C;  3AZN A;  3UTB B;  3NQJ A;  4CAY B;  5KDM A;  4ZUX D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...