5B0YA

Crystal structure of the nucleosome containing histone h3 with the crotonylated lysine 122
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
96
structure length
95
Chain Sequence
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 33
structure length 95
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0yA00
4J8WA 1P34D 3B0CW 5GXQB 3O62A 2NZDA 3LZ0B 4LD9A 3MGSB 4YS3A 3WKJA 3AZLD 3AN2D 2PYOC 2AROB 3X1UC 5BNVA 4H9PB 4J8WC 3UTAA 5JRGC 3O62C 3AZMD 2NZDC 3WA9C 4LD9C 1P3OA 5CHLB 2RVQC 5B2ID 3WKJC 5AV9A 3WTPA 5AV5C 5AVBD 3X1VB 3AZJB 1P3OC 1P3KD 5GSUD 4H9RB 5AV9C 3WTPC 5CPJB 4J8XA 1S32A 1EQZA 4EO5B 1N1JA 4R8PA 4ZUXB 4JJNA 5B1MD 5AVCD 3W99B 5C3IB 3MGRD 3MNNB 4XZQB 4J8XC 1B6WA 3MVDA 5B33D 1EQZC 4G92B 5AV6B 4JJNC 4KGCA 5AV8A 3AFAB 3UT9B 1ID3C 2BYKA 3LZ1B 3C1CA 1P3PC 5BNXA 3MVDC 3LZ0D 3RELA 3REID 5CPIB 1ID3D 3AV2B 1U35D 2AROD 3WAAB 5AV8C 4E44A 3C1CC 3C1BA 1BH8A 3MGPB 3RELC 5B32B 5B31A 1R4VA 1KX3B 5G49B 3X1VD 3W98C 1Q9CA 1TZYD 3AZGC 1KX5B 5F99A 5B40C 1KX4B 4AWLB 4ZBJB 1ZLAA 1HQ3B 4H9NA 5B40D 3MNND 5B24C 5AV6D 3REJC 1ZLAC 2HUEC 3AFAD 3UT9D 1AOIC 4QLCB 4G91C 4WU9B 1P3AA 2IO5B 5CPID 5BS7A 3AV2D 5B1LB 3WAAD 1P3LB 3AV1A 1M1AC 4X23C 1P3AC 2FJ7D 5B32D 1P3GA 1JFIA 3W97A 5AY8B 1KX3D 5JA4B 3AYWB 3VH6A 4DRAA 5BT1D 3A6NA 4YM6A 3AV1C 3B6GA 3AZFA 1P3GC 1KX5D 1F66A 4NFTA 1P3FA 3V9RB 3AZHB 4Z2MH 3LELA 3REKD 1KX4D 3A6NC 1P3MB 4YM6C 5B32G 3MGQA 1M18C 5B0YB 4XUJB 4HGAB 3B6GC 1F66C 3X1SA 5DNNB 1P3FC 4H9OB 3X1TB 2YFWA 4WU8A 3MGQC 5CPKD 3AZEA 4KUDB 5BO0B 3AZIA 3X1SC 3B6FB 4KHAA 4WU9D 2CV5A 1P34A 3B0DB 4NE3A 5CP6B 2NQBD 3AZEC 1M19B 3NQJA 2HIOD 3REHD 3AZNB 3AZIC 3W96B 3AZLA 4Z66D 2CV5C 1P3IB 3VH5A 3KUYB 1P34C 2PYOB 3AZMA 3X1UB 5AY8D 5B2JB 4J8WB 3AYWD 2NZDB 3AZLC 5KDMA 3AN2C 4LD9B 3AZKD 1WWIA 5JRGA 2BYMA 4YS3B 3WA9A 3AZMC 1F1EA 5B2IC 3UTAB 4Z5TB 5AV5A 3TU4D 1P3KA 1P3MD 5AVBC 2F8NA 3KXBB 3WTPB 5DNND 5AVCA 3X1TD 1P3KC 5GSUC 3MGRA 5B33A 5GT0D 5B1MC 5AVCC 5E5AB 1S32B 1EQZB 1N1JB 4R8PB 3MGRC 4JJNB 5CP6D 5B33C 1M19D 3REIA 3AZND 4CSRA 3W96D 1ID3A 3MVDB 1U35A 2AROA 5DNMB 5FUGA 3VH6T 1BH9A 4J8VD 1P3ID 1P3PA 3KUYD 1P3BB 3R45A 4KGCB 5AV8B 3LZ0C 2YFVA 3REIC 5B2JD 2BYKB 3C1CB 5BNXB 1U35C 2AROC 5GXQD 2F8NH 4CAYA 4YS3D 3MGSD 1TZYA 4Z5TD 3C1BB 3W98A 5B31B 3AZGA 3X1VC 3KXBD 3LJAB 1TZYC 4J8UB 1H3OA 5B40A 3AZJD 4NE5A 1A7WA 4EO5C 5F99B 1S32D 5E5AD 5CPJD 3UT9A 5C3IC 4R8PD 3MNNC 5B24A 3KSYA 3VH5T 4H9NB 3REJA 4ZUXD 4G92C 5CPIA 5AV6C 3W99D 5DNMD 1AOIA 4XZQD 3WAAA 3AFAC 3UT9C 1WWSA 1P3BD 3B0BA 4KGCD 5GT3B 5CPIC 4UUZB 2FJ7A 3AV2C 3WAAC 1P3AB 1KX3A 3LZ1D 4H9QB 1M1AA 4X23A 3KWQB 4WNNA 2FJ7C 5B32C 3AV1B 3C1BD 1KX3C 5B31D 1P3GB 3MGPD 3REKA 1JFIB 5BT1C 3W97B 3LJAD 4J8UD 4YM6B 1TAFA 1KX5C 4WV4B 1M18A 3AZFB 3B6GB 3REKC 1KX4C 5F99D 5CPKA 1P3FB 3LELB 3MGQB 5B31G 5B0ZB 3VH6W 2CWEA 3X1SB 5CPKC 1HQ3D 3UTBB 2NQBA 2YFWB 2HIOA 4WU8B 3REHA 1B67A 3AZEB 4Z66A 4WU9C 5GT3D 3AZIB 4KHAB 2CV5B 2NQBC 2HIOC 4QLCD 3REHC 5JA4A 1P34B 3AYWA 2JSSA 4Z66C 3NQJB 3KWQD 3AZKA 4Z2MG 5B1LD 3AZLB 4H9SA 1P3LD 5AY8C 3AN2A 3V9RA 3AYWC 3TU4A 3AZKC 5KDMB 5B2IA 4H9SC 5JRGB 3O62B 3WA9B 3X1TA 3TU4C 5AVBA 1P3MC 3WKJB 3NQUA 5BNVB 4XUJC 5AV5B 3VH5W 5BO0A 3AZHD 5B0ZD 5GT0A 5GSUA 5DNNC 3X1TC 2F8NB 1P3OB 5B0YD 4XUJD 5AVCB 5AV9B 3UTBD 5CP6A 1M19A 4KUDC 5B1MA 3MGRB 4WU8D 5GT0C 5B33B 4J8VA 4KUDD 4DRBA 3B0DC 2LY8A 5CP6C 1M19C 4J8XB 5B2JA 3AZNC 3B6FD 3W96C 4J8VC 3REIB 5GXQA 1P3IC 4CSRB 3LZ0A 3KUYC 1ID3B 1U35B 5FUGB 1BH9B 3MGSA 1P3PB 5B2JC 4Z5TA 3R45B 2YFVB 4H9PA 2PYOD 5GXQC 3X1UD 4YS3C 3KXBA 4J8WD 3MGSC 5JRGD 3O62D 4CAYB 2NZDD 3UTAC 3WA9D 3RELB 4LD9D 4Z5TC 2RVQD 1TZYB 3WKJD 3X1VA 3AZJA 5AV5D 3KXBC 3UTAD 3W98B 4H9RA 5E5AA 1BH8B 1P3OD 5CPJA 3AZGB 2F8ND 5AV9D 3AZJC 3WTPD 1H3OB 4ZUXA 5B40B 1HTAA 3W99A 1S32C 5E5AC 2F8NK 5DNMA 3MNNA 4XZQA 5CPJC 1KU5A 4M6BA 4R8PC 1P3BA 5AV6A 4J8XD 4ZUXC 2F8NG 1EQZD 3W99C 5B24B 3AFAA 3REJB 5DNMC 4JJND 4XZQC 3LZ1A 1ZLAB 2HUEB 1P3BC 1AOIB 4KGCC 1P3PD 4G91B 3MVDD 3AV2A 4E45A 3LZ1C 2FJ7B 5AV8D 3MGPA 3C1CD 3LJAA 5B32A 1M1AB 4J8UA 4X23B 3RELD 3C1BC 5G49A 4WNNB 4NE6A 5B31C 3MGPC 3B0CT 3LJAC 3W98D 4J8UC 1KX5A 3REKB 3AZGD 2L5AA 1KX4A 1TAFB 5F99C 1HQ3A 3A6NB 1M18B 1ULYA 3WTPE 5CPKB 1F66B 4AWLC 5GT3A 4ZBJC 4UUZA 1BFMA 1HQ3C 5B24D 3REJD 4QLCA 1ZLAD 4H9QA 4WU9A 2NQBB 1AOID 2HIOB 5GT3C 3KWQA 3REHB 5B1LA 4Z66B 1P3LA 4WZSB 4QLCC 5BS7C 2IO5C 3KWQC 1M1AD 4X23D 5B1LC 5AY8A 1P3AD 1P3LC 3AZKB 3W97C 3AN2B 3AV1D 3TU4B 3AZHA 5B0ZA 3AZMB 1P3GD 1P3MA 3W97D 3AZFC 5B2IB 5B0YA 4XUJA 3A6ND 3UTBA 4YM6D 3LELC 1M18D 5AVBB 5DNNA 2BYMB 4H9OA 3AZHC 3B6GD 5B0ZC 3AZFD 3NQUB 1F66D 1P3FD 5B0YC 3LELD 1P3KB 5GT0B 4HGAC 5GSUB 4KUDA 3UTBC 3MGQD 4WU8C 3B6FA 3X1SD 5B1MB 3AZNA 4J8VB 3W96A 3AZED 3B6FC 1P3IA 3AZID 3KUYA 2PYOA 2CV5D 3X1UA
chains in the Genus database with same CATH superfamily
4J8WA 1P34D 3B0CW 5GXQB 3O62A 2NZDA 3LZ0B 4LD9A 2BG1A 3MGSB 4YS3A 3WKJA 3AZLD 3AN2D 2PYOC 2AROB 3X1UC 5BNVA 4H9PB 4J8WC 3UTAA 5JRGC 3O62C 3AZMD 2NZDC 3WA9C 4LD9C 1P3OA 5CHLB 2RVQC 5B2ID 3WKJC 5AV9A 3WTPA 5AV5C 5AVBD 2JE5A 3X1VB 3AZJB 1P3OC 1P3KD 5GSUD 4H9RB 5AV9C 3WTPC 5CPJB 4J8XA 1S32A 3IP4C 1EQZA 4EO5B 1N1JA 4R8PA 4ZUXB 4JJNA 5B1MD 5AVCD 3W99B 2Y2QA 5C3IB 3MGRD 3MNNB 4XZQB 4J8XC 1B6WA 3MVDA 5B33D 3A1KA 1EQZC 4G92B 5AV6B 4JJNC 4KGCA 5AV8A 3AFAB 3UT9B 1ID3C 2BYKA 3LZ1B 3C1CA 1P3PC 5BNXA 3MVDC 3LZ0D 3RELA 2VQRA 3REID 5CPIB 1ID3D 3AV2B 1U35D 2AROD 3WAAB 5AV8C 4E44A 3C1CC 3C1BA 1BH8A 3MGPB 3RELC 5B32B 5B31A 1R4VA 1KX3B 5G49B 3X1VD 3W98C 1Q9CA 1TZYD 3AZGC 1KX5B 3EPHA 5F99A 2Y2KA 5B40C 1KX4B 4AWLB 4ZBJB 1ZLAA 1HQ3B 4H9NA 5B40D 3MNND 5B24C 5AV6D 3REJC 1ZLAC 2HUEC 3AFAD 3UT9D 1AOIC 4QLCB 4G91C 4WU9B 1P3AA 2IO5B 4DQYB 5CPID 5BS7A 3AV2D 5B1LB 3WAAD 1P3LB 3AV1A 1M1AC 4X23C 1P3AC 2FJ7D 5B32D 1P3GA 1JFIA 3W97A 5AY8B 1KX3D 5JA4B 3AYWB 3VH6A 4DRAA 5BT1D 3A6NA 4YM6A 3AV1C 3AL0C 3B6GA 3AZFA 1P3GC 1KX5D 1F66A 4NFTA 1P3FA 3V9RB 3AZHB 4Z2MH 3LELA 3REKD 1KX4D 3A6NC 1P3MB 4YM6C 5B32G 3MGQA 1M18C 5B0YB 4XUJB 4HGAB 3B6GC 1PZRA 1F66C 3X1SA 5DNNB 1P3FC 4H9OB 3X1TB 2YFWA 1T3UA 4WU8A 3MGQC 5CPKD 3AZEA 4KUDB 5BO0B 3AZIA 3X1SC 3B6FB 4KHAA 4WU9D 2CV5A 1P34A 3B0DB 4NE3A 3A1IA 5CP6B 2NQBD 3AZEC 1M19B 3NQJA 2HIOD 3REHD 3AZNB 2CV5D 3AZIC 3W96B 3AZLA 4Z66D 2CV5C 1P3IB 2Y2IA 3VH5A 3KUYB 1P34C 2PYOB 3AZMA 3X1UB 5AY8D 5B2JB 4J8WB 2ZY4A 3AYWD 2NZDB 3AZLC 5KDMA 3AN2C 4LD9B 3AZKD 1WWIA 5JRGA 2BYMA 2F2AC 4YS3B 3WA9A 3AZMC 1F1EA 5B2IC 3UTAB 4Z5TB 5AV5A 3TU4D 1P3KA 1P3MD 5AVBC 2F8NA 2G5IC 3KXBB 3WTPB 5DNND 5AVCA 3X1TD 1P3KC 5GSUC 3MGRA 5B33A 5GT0D 5B1MC 5AVCC 5E5AB 1S32B 1EQZB 2J8PA 1N1JB 4R8PB 3EPLA 3MGRC 4JJNB 5CP6D 5B33C 1M19D 3REIA 3KFUG 3AZND 4CSRA 3W96D 1ID3A 2ZY2A 3MVDB 1U35A 2AROA 5DNMB 5FUGA 3VH6T 1BH9A 4J8VD 1P3ID 1P3PA 3KUYD 1P3BB 3R45A 4KGCB 5AV8B 3LZ0C 2YFVA 1W2EA 3REIC 5B2JD 2BYKB 3C1CB 5BNXB 1U35C 2AROC 5GXQD 2F8NH 4CAYA 4YS3D 3MGSD 1TZYA 4Z5TD 3C1BB 3W98A 5B31B 3AZGA 3X1VC 3KXBD 3LJAB 2RIQA 1TZYC 4J8UB 1H3OA 5B40A 3AZJD 4NE5A 1A7WA 4EO5C 5F99B 1S32D 5E5AD 5CPJD 3UT9A 5C3IC 4R8PD 3MNNC 5B24A 3KSYA 3VH5T 4H9NB 3REJA 4ZUXD 4G92C 5CPIA 5AV6C 3W99D 4WJ3C 5DNMD 1AOIA 4XZQD 3WAAA 3AFAC 3UT9C 1WWSA 1P3BD 3B0BA 4KGCD 5GT3B 5CPIC 4UUZB 2FJ7A 3AV2C 3WAAC 1P3AB 1KX3A 3LZ1D 4H9QB 1M1AA 4X23A 3KWQB 4WNNA 2FJ7C 5B32C 3AV1B 3C1BD 1KX3C 5B31D 1P3GB 3MGPD 3REKA 1JFIB 5BT1C 3W97B 3LJAD 4J8UD 2FFFB 4YM6B 1TAFA 1KX5C 4WV4B 1M18A 3AZFB 3B6GB 3REKC 1KX4C 2ZY5A 5F99D 5CPKA 1P3FB 3LELB 3MGQB 5B31G 5B0ZB 3VH6W 2CWEA 3X1SB 5CPKC 1HQ3D 3UTBB 2NQBA 2YFWB 2Y2GA 2HIOA 4WU8B 3REHA 1B67A 3AZEB 4Z66A 4WU9C 5GT3D 3AZIB 4KHAB 2CV5B 2NQBC 3H0MC 2HIOC 4QLCD 3REHC 5JA4A 1P34B 3AYWA 2JSSA 4Z66C 3NQJB 3KWQD 3AZKA 4Z2MG 5B1LD 3AZLB 2Y2NA 4H9SA 1P3LD 5AY8C 3AN2A 3V9RA 3AYWC 3TU4A 2Y2OA 3AZKC 3P5JB 5KDMB 5B2IA 4H9SC 5JRGB 3O62B 4UPKA 3X1TA 3WA9B 3TU4C 5AVBA 1P3MC 3WKJB 2DQNC 3FDDA 3NQUA 5BNVB 4XUJC 5AV5B 3VH5W 5BO0A 3AZHD 5B0ZD 5GT0A 5GSUA 5DNNC 3X1TC 2F8NB 1P3OB 5B0YD 2XD1A 4XUJD 5AVCB 5AV9B 3UTBD 5CP6A 1M19A 4KUDC 5B1MA 3EPJA 3MGRB 4WU8D 5GT0C 5B33B 4J8VA 4KUDD 4DRBA 3B0DC 2G5HC 2LY8A 5CP6C 1M19C 4J8XB 5B2JA 3AZNC 3B6FD 3W96C 4J8VC 3REIB 5GXQA 1P3IC 2JCHA 4CSRB 3LZ0A 3KUYC 1ID3B 1U35B 5FUGB 1BH9B 3H0RC 3MGSA 1P3PB 5B2JC 4Z5TA 3R45B 2YFVB 4H9PA 2PYOD 5GXQC 3X1UD 4YS3C 3KXBA 4J8WD 3MGSC 5JRGD 3O62D 4CAYB 2NZDD 3UTAC 3WA9D 3RELB 3H0LC 4Z5TC 2RVQD 4LD9D 1TZYB 3WKJD 3X1VA 3AZJA 5AV5D 3KXBC 3UTAD 2XD5A 3W98B 4H9RA 5E5AA 1BH8B 1P3OD 5CPJA 3AZGB 2F8ND 5AV9D 3AZJC 3WTPD 1H3OB 4ZUXA 5B40B 1HTAA 3W99A 1S32C 5E5AC 2F8NK 5DNMA 3MNNA 4XZQA 5CPJC 1KU5A 4M6BA 4R8PC 1P3BA 5AV6A 4J8XD 4ZUXC 2F8NG 2DF4C 1EQZD 3W99C 5B24B 3AFAA 3REJB 5DNMC 4JJND 4XZQC 3LZ1A 1ZLAB 2HUEB 1P3BC 1AOIB 4KGCC 2ZM5A 1P3PD 4G91B 3MVDD 3AV2A 2Y2JA 4E45A 3LZ1C 2FJ7B 5AV8D 3MGPA 3C1CD 3LJAA 5B32A 1M1AB 4J8UA 2W8SA 4X23B 3RELD 3C1BC 5G49A 4WNNB 2Y2PA 4NE6A 5B31C 3MGPC 3B0CT 3LJAC 3EPKA 3W98D 3F6TA 4J8UC 1KX5A 3REKB 3AZGD 2L5AA 1KX4A 2Y2HA 1TAFB 5F99C 1HQ3A 3A6NB 1M18B 1ULYA 3WTPE 5CPKB 1F66B 4AWLC 5GT3A 4ZBJC 4UUZA 1BFMA 1HQ3C 5B24D 3REJD 4QLCA 1ZLAD 4H9QA 4WU9A 2NQBB 1AOID 2HIOB 5GT3C 3KWQA 3REHB 5B1LA 4Z66B 1P3LA 4WZSB 4QLCC 5BS7C 3EG5B 2IO5C 3KWQC 1M1AD 4X23D 5B1LC 5AY8A 1P3AD 2Y2MA 1P3LC 3AZKB 3W97C 3AN2B 3AV1D 3TU4B 3AZHA 5B0ZA 3AZMB 1P3GD 1P3MA 3W97D 3AZFC 5B2IB 5B0YA 4XUJA 3A6ND 3UTBA 4YM6D 3LELC 1M18D 5AVBB 5DNNA 2BYMB 4H9OA 3AZHC 3B6GD 5B0ZC 3AZFD 3NQUB 1F66D 1P3FD 5B0YC 3LELD 1P3KB 5GT0B 4HGAC 2UWXA 5GSUB 4KUDA 3UTBC 3MGQD 4WU8C 3B6FA 2Y2LA 3X1SD 5B1MB 2ZY3A 3AZNA 4J8VB 3W96A 3AZED 3B6FC 1P3IA 3AZID 3KUYA 2PYOA 1Z2CB 3X1UA
chains in the Genus database with same CATH topology
4J8WA 1P34D 3B0CW 5GXQB 3O62A 2NZDA 3LZ0B 4LD9A 2BG1A 3MGSB 4YS3A 3WKJA 3AZLD 3AN2D 2PYOC 2AROB 3X1UC 5BNVA 4H9PB 4J8WC 3UTAA 5JRGC 3O62C 3AZMD 2NZDC 3WA9C 4LD9C 1P3OA 5CHLB 2RVQC 5B2ID 3WKJC 5AV9A 3WTPA 5AV5C 5AVBD 2JE5A 3X1VB 3AZJB 1P3OC 1P3KD 5GSUD 4H9RB 5AV9C 3WTPC 5CPJB 4J8XA 1S32A 3IP4C 1EQZA 4EO5B 1N1JA 4R8PA 4ZUXB 4JJNA 5B1MD 5AVCD 3W99B 2Y2QA 5C3IB 3MGRD 3MNNB 4XZQB 4J8XC 1B6WA 3MVDA 5B33D 3A1KA 1EQZC 4G92B 5AV6B 4JJNC 4KGCA 5AV8A 3AFAB 3UT9B 1ID3C 2BYKA 3LZ1B 3C1CA 1P3PC 5BNXA 3MVDC 3LZ0D 3RELA 2VQRA 3REID 5CPIB 1ID3D 3AV2B 1U35D 2AROD 3WAAB 5AV8C 4E44A 3C1CC 3C1BA 1BH8A 3MGPB 3RELC 5B32B 5B31A 1R4VA 1KX3B 5G49B 3X1VD 3W98C 1Q9CA 1TZYD 3AZGC 1KX5B 3EPHA 5F99A 2Y2KA 5B40C 1KX4B 4AWLB 4ZBJB 1ZLAA 1HQ3B 4H9NA 5B40D 3MNND 5B24C 5AV6D 3REJC 1ZLAC 2HUEC 3AFAD 3UT9D 1AOIC 4QLCB 4G91C 4WU9B 1P3AA 2IO5B 4DQYB 5CPID 5BS7A 3AV2D 5B1LB 3WAAD 1P3LB 3AV1A 1M1AC 4X23C 1P3AC 2FJ7D 5B32D 1P3GA 1JFIA 3W97A 5AY8B 1KX3D 5JA4B 3AYWB 3VH6A 4DRAA 5BT1D 3A6NA 4YM6A 3AV1C 3AL0C 3B6GA 3AZFA 1P3GC 1KX5D 1F66A 4NFTA 1P3FA 3V9RB 3AZHB 4Z2MH 3LELA 3REKD 1KX4D 3A6NC 1P3MB 4YM6C 5B32G 3MGQA 1M18C 5B0YB 4XUJB 4HGAB 3B6GC 1PZRA 1F66C 3X1SA 5DNNB 1P3FC 4H9OB 3X1TB 2YFWA 1T3UA 4WU8A 3MGQC 5CPKD 3AZEA 4KUDB 5BO0B 3AZIA 3X1SC 3B6FB 4KHAA 4WU9D 2CV5A 1P34A 3B0DB 4NE3A 3A1IA 5CP6B 2NQBD 3AZEC 1M19B 3NQJA 2HIOD 3REHD 3AZNB 2CV5D 3AZIC 3W96B 3AZLA 4Z66D 2CV5C 1P3IB 2Y2IA 3VH5A 3KUYB 1P34C 2PYOB 3AZMA 3X1UB 5AY8D 5B2JB 4J8WB 2ZY4A 3AYWD 2NZDB 3AZLC 5KDMA 3AN2C 4LD9B 3AZKD 1WWIA 5JRGA 2BYMA 2F2AC 4YS3B 3WA9A 3AZMC 1F1EA 5B2IC 3UTAB 4Z5TB 5AV5A 3TU4D 1P3KA 1P3MD 5AVBC 2F8NA 2G5IC 3KXBB 3WTPB 5DNND 5AVCA 3X1TD 1P3KC 5GSUC 3MGRA 5B33A 5GT0D 5B1MC 5AVCC 5E5AB 1S32B 1EQZB 2J8PA 1N1JB 4R8PB 3EPLA 3MGRC 4JJNB 5CP6D 5B33C 1M19D 3REIA 3KFUG 3AZND 4CSRA 3W96D 1ID3A 2ZY2A 3MVDB 1U35A 2AROA 5DNMB 5FUGA 3VH6T 1BH9A 4J8VD 1P3ID 1P3PA 3KUYD 1P3BB 3R45A 4KGCB 5AV8B 3LZ0C 2YFVA 1W2EA 3REIC 5B2JD 2BYKB 3C1CB 5BNXB 1U35C 2AROC 5GXQD 2F8NH 4CAYA 4YS3D 3MGSD 1TZYA 4Z5TD 3C1BB 3W98A 5B31B 3AZGA 3X1VC 3KXBD 3LJAB 2RIQA 1TZYC 4J8UB 1H3OA 5B40A 3AZJD 4NE5A 1A7WA 4EO5C 5F99B 1S32D 5E5AD 5CPJD 3UT9A 5C3IC 4R8PD 3MNNC 5B24A 3KSYA 3VH5T 4H9NB 3REJA 4ZUXD 4G92C 5CPIA 5AV6C 3W99D 4WJ3C 5DNMD 1AOIA 4XZQD 3WAAA 3AFAC 3UT9C 1WWSA 1P3BD 3B0BA 4KGCD 5GT3B 5CPIC 4UUZB 2FJ7A 3AV2C 3WAAC 1P3AB 1KX3A 3LZ1D 4H9QB 1M1AA 4X23A 3KWQB 4WNNA 2FJ7C 5B32C 3AV1B 3C1BD 1KX3C 5B31D 1P3GB 3MGPD 3REKA 1JFIB 5BT1C 3W97B 3LJAD 4J8UD 2FFFB 4YM6B 1TAFA 1KX5C 4WV4B 1M18A 3AZFB 3B6GB 3REKC 1KX4C 2ZY5A 5F99D 5CPKA 1P3FB 3LELB 3MGQB 5B31G 5B0ZB 3VH6W 2CWEA 3X1SB 5CPKC 1HQ3D 3UTBB 2NQBA 2YFWB 2Y2GA 2HIOA 4WU8B 3REHA 1B67A 3AZEB 4Z66A 4WU9C 5GT3D 3AZIB 4KHAB 2CV5B 2NQBC 3H0MC 2HIOC 4QLCD 3REHC 5JA4A 1P34B 3AYWA 2JSSA 4Z66C 3NQJB 3KWQD 3AZKA 4Z2MG 5B1LD 3AZLB 2Y2NA 4H9SA 1P3LD 5AY8C 3AN2A 3V9RA 3AYWC 3TU4A 2Y2OA 3AZKC 3P5JB 5KDMB 5B2IA 4H9SC 5JRGB 3O62B 4UPKA 3X1TA 3WA9B 3TU4C 5AVBA 1P3MC 3WKJB 2DQNC 3FDDA 3NQUA 5BNVB 4XUJC 5AV5B 3VH5W 5BO0A 3AZHD 5B0ZD 5GT0A 5GSUA 5DNNC 3X1TC 2F8NB 1P3OB 5B0YD 2XD1A 4XUJD 5AVCB 5AV9B 3UTBD 5CP6A 1M19A 4KUDC 5B1MA 3EPJA 3MGRB 4WU8D 5GT0C 5B33B 4J8VA 4KUDD 4DRBA 3B0DC 2G5HC 2LY8A 5CP6C 1M19C 4J8XB 5B2JA 3AZNC 3B6FD 3W96C 4J8VC 3REIB 5GXQA 1P3IC 2JCHA 4CSRB 3LZ0A 3KUYC 1ID3B 1U35B 5FUGB 1BH9B 3H0RC 3MGSA 1P3PB 5B2JC 4Z5TA 3R45B 2YFVB 4H9PA 2PYOD 5GXQC 3X1UD 4YS3C 3KXBA 4J8WD 3MGSC 5JRGD 3O62D 4CAYB 2NZDD 3UTAC 3WA9D 3RELB 3H0LC 4Z5TC 2RVQD 4LD9D 1TZYB 3WKJD 3X1VA 3AZJA 5AV5D 3KXBC 3UTAD 2XD5A 3W98B 4H9RA 5E5AA 1BH8B 1P3OD 5CPJA 3AZGB 2F8ND 5AV9D 3AZJC 3WTPD 1H3OB 4ZUXA 5B40B 1HTAA 3W99A 1S32C 5E5AC 2F8NK 5DNMA 3MNNA 4XZQA 5CPJC 1KU5A 4M6BA 4R8PC 1P3BA 5AV6A 4J8XD 4ZUXC 2F8NG 2DF4C 1EQZD 3W99C 5B24B 3AFAA 3REJB 5DNMC 4JJND 4XZQC 3LZ1A 1ZLAB 2HUEB 1P3BC 1AOIB 4KGCC 2ZM5A 1P3PD 4G91B 3MVDD 3AV2A 2Y2JA 4E45A 3LZ1C 2FJ7B 5AV8D 3MGPA 3C1CD 3LJAA 5B32A 1M1AB 4J8UA 2W8SA 4X23B 3RELD 3C1BC 5G49A 4WNNB 2Y2PA 4NE6A 5B31C 3MGPC 3B0CT 3LJAC 3EPKA 3W98D 3F6TA 4J8UC 1KX5A 3REKB 3AZGD 2L5AA 1KX4A 2Y2HA 1TAFB 5F99C 1HQ3A 3A6NB 1M18B 1ULYA 3WTPE 5CPKB 1F66B 4AWLC 5GT3A 4ZBJC 4UUZA 1BFMA 1HQ3C 5B24D 3REJD 4QLCA 1ZLAD 4H9QA 4WU9A 2NQBB 1AOID 2HIOB 5GT3C 3KWQA 3REHB 5B1LA 4Z66B 1P3LA 4WZSB 4QLCC 5BS7C 3EG5B 2IO5C 3KWQC 1M1AD 4X23D 5B1LC 5AY8A 1P3AD 2Y2MA 1P3LC 3AZKB 3W97C 3AN2B 3AV1D 3TU4B 3AZHA 5B0ZA 3AZMB 1P3GD 1P3MA 3W97D 3AZFC 5B2IB 5B0YA 4XUJA 3A6ND 3UTBA 4YM6D 3LELC 1M18D 5AVBB 5DNNA 2BYMB 4H9OA 3AZHC 3B6GD 5B0ZC 3AZFD 3NQUB 1F66D 1P3FD 5B0YC 3LELD 1P3KB 5GT0B 4HGAC 2UWXA 5GSUB 4KUDA 3UTBC 3MGQD 4WU8C 3B6FA 2Y2LA 3X1SD 5B1MB 2ZY3A 3AZNA 4J8VB 3W96A 3AZED 3B6FC 1P3IA 3AZID 3KUYA 2PYOA 1Z2CB 3X1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8W A;  1P34 D;  3B0C W;  5GXQ B;  3O62 A;  2NZD A;  3LZ0 B;  4LD9 A;  3MGS B;  4YS3 A;  3WKJ A;  3AZL D;  3AN2 D;  2PYO C;  2ARO B;  3X1U C;  5BNV A;  4H9P B;  4J8W C;  3UTA A;  5JRG C;  3O62 C;  3AZM D;  2NZD C;  3WA9 C;  4LD9 C;  1P3O A;  5CHL B;  2RVQ C;  5B2I D;  3WKJ C;  5AV9 A;  3WTP A;  5AV5 C;  5AVB D;  3X1V B;  3AZJ B;  1P3O C;  1P3K D;  5GSU D;  4H9R B;  5AV9 C;  3WTP C;  5CPJ B;  4J8X A;  1S32 A;  1EQZ A;  4EO5 B;  1N1J A;  4R8P A;  4ZUX B;  4JJN A;  5B1M D;  5AVC D;  3W99 B;  5C3I B;  3MGR D;  3MNN B;  4XZQ B;  4J8X C;  1B6W A;  3MVD A;  5B33 D;  1EQZ C;  4G92 B;  5AV6 B;  4JJN C;  4KGC A;  5AV8 A;  3AFA B;  3UT9 B;  1ID3 C;  2BYK A;  3LZ1 B;  3C1C A;  1P3P C;  5BNX A;  3MVD C;  3LZ0 D;  3REL A;  3REI D;  5CPI B;  1ID3 D;  3AV2 B;  1U35 D;  2ARO D;  3WAA B;  5AV8 C;  4E44 A;  3C1C C;  3C1B A;  1BH8 A;  3MGP B;  3REL C;  5B32 B;  5B31 A;  1R4V A;  1KX3 B;  5G49 B;  3X1V D;  3W98 C;  1Q9C A;  1TZY D;  3AZG C;  1KX5 B;  5F99 A;  5B40 C;  1KX4 B;  4AWL B;  4ZBJ B;  1ZLA A;  1HQ3 B;  4H9N A;  5B40 D;  3MNN D;  5B24 C;  5AV6 D;  3REJ C;  1ZLA C;  2HUE C;  3AFA D;  3UT9 D;  1AOI C;  4QLC B;  4G91 C;  4WU9 B;  1P3A A;  2IO5 B;  5CPI D;  5BS7 A;  3AV2 D;  5B1L B;  3WAA D;  1P3L B;  3AV1 A;  1M1A C;  4X23 C;  1P3A C;  2FJ7 D;  5B32 D;  1P3G A;  1JFI A;  3W97 A;  5AY8 B;  1KX3 D;  5JA4 B;  3AYW B;  3VH6 A;  4DRA A;  5BT1 D;  3A6N A;  4YM6 A;  3AV1 C;  3B6G A;  3AZF A;  1P3G C;  1KX5 D;  1F66 A;  4NFT A;  1P3F A;  3V9R B;  3AZH B;  4Z2M H;  3LEL A;  3REK D;  1KX4 D;  3A6N C;  1P3M B;  4YM6 C;  5B32 G;  3MGQ A;  1M18 C;  5B0Y B;  4XUJ B;  4HGA B;  3B6G C;  1F66 C;  3X1S A;  5DNN B;  1P3F C;  4H9O B;  3X1T B;  2YFW A;  4WU8 A;  3MGQ C;  5CPK D;  3AZE A;  4KUD B;  5BO0 B;  3AZI A;  3X1S C;  3B6F B;  4KHA A;  4WU9 D;  2CV5 A;  1P34 A;  3B0D B;  4NE3 A;  5CP6 B;  2NQB D;  3AZE C;  1M19 B;  3NQJ A;  2HIO D;  3REH D;  3AZN B;  3AZI C;  3W96 B;  3AZL A;  4Z66 D;  2CV5 C;  1P3I B;  3VH5 A;  3KUY B;  1P34 C;  2PYO B;  3AZM A;  3X1U B;  5AY8 D;  5B2J B;  4J8W B;  3AYW D;  2NZD B;  3AZL C;  5KDM A;  3AN2 C;  4LD9 B;  3AZK D;  1WWI A;  5JRG A;  2BYM A;  4YS3 B;  3WA9 A;  3AZM C;  1F1E A;  5B2I C;  3UTA B;  4Z5T B;  5AV5 A;  3TU4 D;  1P3K A;  1P3M D;  5AVB C;  2F8N A;  3KXB B;  3WTP B;  5DNN D;  5AVC A;  3X1T D;  1P3K C;  5GSU C;  3MGR A;  5B33 A;  5GT0 D;  5B1M C;  5AVC C;  5E5A B;  1S32 B;  1EQZ B;  1N1J B;  4R8P B;  3MGR C;  4JJN B;  5CP6 D;  5B33 C;  1M19 D;  3REI A;  3AZN D;  4CSR A;  3W96 D;  1ID3 A;  3MVD B;  1U35 A;  2ARO A;  5DNM B;  5FUG A;  3VH6 T;  1BH9 A;  4J8V D;  1P3I D;  1P3P A;  3KUY D;  1P3B B;  3R45 A;  4KGC B;  5AV8 B;  3LZ0 C;  2YFV A;  3REI C;  5B2J D;  2BYK B;  3C1C B;  5BNX B;  1U35 C;  2ARO C;  5GXQ D;  2F8N H;  4CAY A;  4YS3 D;  3MGS D;  1TZY A;  4Z5T D;  3C1B B;  3W98 A;  5B31 B;  3AZG A;  3X1V C;  3KXB D;  3LJA B;  1TZY C;  4J8U B;  1H3O A;  5B40 A;  3AZJ D;  4NE5 A;  1A7W A;  4EO5 C;  5F99 B;  1S32 D;  5E5A D;  5CPJ D;  3UT9 A;  5C3I C;  4R8P D;  3MNN C;  5B24 A;  3KSY A;  3VH5 T;  4H9N B;  3REJ A;  4ZUX D;  4G92 C;  5CPI A;  5AV6 C;  3W99 D;  5DNM D;  1AOI A;  4XZQ D;  3WAA A;  3AFA C;  3UT9 C;  1WWS A;  1P3B D;  3B0B A;  4KGC D;  5GT3 B;  5CPI C;  4UUZ B;  2FJ7 A;  3AV2 C;  3WAA C;  1P3A B;  1KX3 A;  3LZ1 D;  4H9Q B;  1M1A A;  4X23 A;  3KWQ B;  4WNN A;  2FJ7 C;  5B32 C;  3AV1 B;  3C1B D;  1KX3 C;  5B31 D;  1P3G B;  3MGP D;  3REK A;  1JFI B;  5BT1 C;  3W97 B;  3LJA D;  4J8U D;  4YM6 B;  1TAF A;  1KX5 C;  4WV4 B;  1M18 A;  3AZF B;  3B6G B;  3REK C;  1KX4 C;  5F99 D;  5CPK A;  1P3F B;  3LEL B;  3MGQ B;  5B31 G;  5B0Z B;  3VH6 W;  2CWE A;  3X1S B;  5CPK C;  1HQ3 D;  3UTB B;  2NQB A;  2YFW B;  2HIO A;  4WU8 B;  3REH A;  1B67 A;  3AZE B;  4Z66 A;  4WU9 C;  5GT3 D;  3AZI B;  4KHA B;  2CV5 B;  2NQB C;  2HIO C;  4QLC D;  3REH C;  5JA4 A;  1P34 B;  3AYW A;  2JSS A;  4Z66 C;  3NQJ B;  3KWQ D;  3AZK A;  4Z2M G;  5B1L D;  3AZL B;  4H9S A;  1P3L D;  5AY8 C;  3AN2 A;  3V9R A;  3AYW C;  3TU4 A;  3AZK C;  5KDM B;  5B2I A;  4H9S C;  5JRG B;  3O62 B;  3WA9 B;  3X1T A;  3TU4 C;  5AVB A;  1P3M C;  3WKJ B;  3NQU A;  5BNV B;  4XUJ C;  5AV5 B;  3VH5 W;  5BO0 A;  3AZH D;  5B0Z D;  5GT0 A;  5GSU A;  5DNN C;  3X1T C;  2F8N B;  1P3O B;  5B0Y D;  4XUJ D;  5AVC B;  5AV9 B;  3UTB D;  5CP6 A;  1M19 A;  4KUD C;  5B1M A;  3MGR B;  4WU8 D;  5GT0 C;  5B33 B;  4J8V A;  4KUD D;  4DRB A;  3B0D C;  2LY8 A;  5CP6 C;  1M19 C;  4J8X B;  5B2J A;  3AZN C;  3B6F D;  3W96 C;  4J8V C;  3REI B;  5GXQ A;  1P3I C;  4CSR B;  3LZ0 A;  3KUY C;  1ID3 B;  1U35 B;  5FUG B;  1BH9 B;  3MGS A;  1P3P B;  5B2J C;  4Z5T A;  3R45 B;  2YFV B;  4H9P A;  2PYO D;  5GXQ C;  3X1U D;  4YS3 C;  3KXB A;  4J8W D;  3MGS C;  5JRG D;  3O62 D;  4CAY B;  2NZD D;  3UTA C;  3WA9 D;  3REL B;  4LD9 D;  4Z5T C;  2RVQ D;  1TZY B;  3WKJ D;  3X1V A;  3AZJ A;  5AV5 D;  3KXB C;  3UTA D;  3W98 B;  4H9R A;  5E5A A;  1BH8 B;  1P3O D;  5CPJ A;  3AZG B;  2F8N D;  5AV9 D;  3AZJ C;  3WTP D;  1H3O B;  4ZUX A;  5B40 B;  1HTA A;  3W99 A;  1S32 C;  5E5A C;  2F8N K;  5DNM A;  3MNN A;  4XZQ A;  5CPJ C;  1KU5 A;  4M6B A;  4R8P C;  1P3B A;  5AV6 A;  4J8X D;  4ZUX C;  2F8N G;  1EQZ D;  3W99 C;  5B24 B;  3AFA A;  3REJ B;  5DNM C;  4JJN D;  4XZQ C;  3LZ1 A;  1ZLA B;  2HUE B;  1P3B C;  1AOI B;  4KGC C;  1P3P D;  4G91 B;  3MVD D;  3AV2 A;  4E45 A;  3LZ1 C;  2FJ7 B;  5AV8 D;  3MGP A;  3C1C D;  3LJA A;  5B32 A;  1M1A B;  4J8U A;  4X23 B;  3REL D;  3C1B C;  5G49 A;  4WNN B;  4NE6 A;  5B31 C;  3MGP C;  3B0C T;  3LJA C;  3W98 D;  4J8U C;  1KX5 A;  3REK B;  3AZG D;  2L5A A;  1KX4 A;  1TAF B;  5F99 C;  1HQ3 A;  3A6N B;  1M18 B;  1ULY A;  3WTP E;  5CPK B;  1F66 B;  4AWL C;  5GT3 A;  4ZBJ C;  4UUZ A;  1BFM A;  1HQ3 C;  5B24 D;  3REJ D;  4QLC A;  1ZLA D;  4H9Q A;  4WU9 A;  2NQB B;  1AOI D;  2HIO B;  5GT3 C;  3KWQ A;  3REH B;  5B1L A;  4Z66 B;  1P3L A;  4WZS B;  4QLC C;  5BS7 C;  2IO5 C;  3KWQ C;  1M1A D;  4X23 D;  5B1L C;  5AY8 A;  1P3A D;  1P3L C;  3AZK B;  3W97 C;  3AN2 B;  3AV1 D;  3TU4 B;  3AZH A;  5B0Z A;  3AZM B;  1P3G D;  1P3M A;  3W97 D;  3AZF C;  5B2I B;  5B0Y A;  4XUJ A;  3A6N D;  3UTB A;  4YM6 D;  3LEL C;  1M18 D;  5AVB B;  5DNN A;  2BYM B;  4H9O A;  3AZH C;  3B6G D;  5B0Z C;  3AZF D;  3NQU B;  1F66 D;  1P3F D;  5B0Y C;  3LEL D;  1P3K B;  5GT0 B;  4HGA C;  5GSU B;  4KUD A;  3UTB C;  3MGQ D;  4WU8 C;  3B6F A;  3X1S D;  5B1M B;  3AZN A;  4J8V B;  3W96 A;  3AZE D;  3B6F C;  1P3I A;  3AZI D;  3KUY A;  2PYO A;  2CV5 D;  3X1U A; 
#chains in the Genus database with same CATH topology
 4J8W A;  1P34 D;  3B0C W;  5GXQ B;  3O62 A;  2NZD A;  3LZ0 B;  4LD9 A;  2BG1 A;  3MGS B;  4YS3 A;  3WKJ A;  3AZL D;  3AN2 D;  2PYO C;  2ARO B;  3X1U C;  5BNV A;  4H9P B;  4J8W C;  3UTA A;  5JRG C;  3O62 C;  3AZM D;  2NZD C;  3WA9 C;  4LD9 C;  1P3O A;  5CHL B;  2RVQ C;  5B2I D;  3WKJ C;  5AV9 A;  3WTP A;  5AV5 C;  5AVB D;  2JE5 A;  3X1V B;  3AZJ B;  1P3O C;  1P3K D;  5GSU D;  4H9R B;  5AV9 C;  3WTP C;  5CPJ B;  4J8X A;  1S32 A;  3IP4 C;  1EQZ A;  4EO5 B;  1N1J A;  4R8P A;  4ZUX B;  4JJN A;  5B1M D;  5AVC D;  3W99 B;  2Y2Q A;  5C3I B;  3MGR D;  3MNN B;  4XZQ B;  4J8X C;  1B6W A;  3MVD A;  5B33 D;  3A1K A;  1EQZ C;  4G92 B;  5AV6 B;  4JJN C;  4KGC A;  5AV8 A;  3AFA B;  3UT9 B;  1ID3 C;  2BYK A;  3LZ1 B;  3C1C A;  1P3P C;  5BNX A;  3MVD C;  3LZ0 D;  3REL A;  2VQR A;  3REI D;  5CPI B;  1ID3 D;  3AV2 B;  1U35 D;  2ARO D;  3WAA B;  5AV8 C;  4E44 A;  3C1C C;  3C1B A;  1BH8 A;  3MGP B;  3REL C;  5B32 B;  5B31 A;  1R4V A;  1KX3 B;  5G49 B;  3X1V D;  3W98 C;  1Q9C A;  1TZY D;  3AZG C;  1KX5 B;  3EPH A;  5F99 A;  2Y2K A;  5B40 C;  1KX4 B;  4AWL B;  4ZBJ B;  1ZLA A;  1HQ3 B;  4H9N A;  5B40 D;  3MNN D;  5B24 C;  5AV6 D;  3REJ C;  1ZLA C;  2HUE C;  3AFA D;  3UT9 D;  1AOI C;  4QLC B;  4G91 C;  4WU9 B;  1P3A A;  2IO5 B;  4DQY B;  5CPI D;  5BS7 A;  3AV2 D;  5B1L B;  3WAA D;  1P3L B;  3AV1 A;  1M1A C;  4X23 C;  1P3A C;  2FJ7 D;  5B32 D;  1P3G A;  1JFI A;  3W97 A;  5AY8 B;  1KX3 D;  5JA4 B;  3AYW B;  3VH6 A;  4DRA A;  5BT1 D;  3A6N A;  4YM6 A;  3AV1 C;  3AL0 C;  3B6G A;  3AZF A;  1P3G C;  1KX5 D;  1F66 A;  4NFT A;  1P3F A;  3V9R B;  3AZH B;  4Z2M H;  3LEL A;  3REK D;  1KX4 D;  3A6N C;  1P3M B;  4YM6 C;  5B32 G;  3MGQ A;  1M18 C;  5B0Y B;  4XUJ B;  4HGA B;  3B6G C;  1PZR A;  1F66 C;  3X1S A;  5DNN B;  1P3F C;  4H9O B;  3X1T B;  2YFW A;  1T3U A;  4WU8 A;  3MGQ C;  5CPK D;  3AZE A;  4KUD B;  5BO0 B;  3AZI A;  3X1S C;  3B6F B;  4KHA A;  4WU9 D;  2CV5 A;  1P34 A;  3B0D B;  4NE3 A;  3A1I A;  5CP6 B;  2NQB D;  3AZE C;  1M19 B;  3NQJ A;  2HIO D;  3REH D;  3AZN B;  2CV5 D;  3AZI C;  3W96 B;  3AZL A;  4Z66 D;  2CV5 C;  1P3I B;  2Y2I A;  3VH5 A;  3KUY B;  1P34 C;  2PYO B;  3AZM A;  3X1U B;  5AY8 D;  5B2J B;  4J8W B;  2ZY4 A;  3AYW D;  2NZD B;  3AZL C;  5KDM A;  3AN2 C;  4LD9 B;  3AZK D;  1WWI A;  5JRG A;  2BYM A;  2F2A C;  4YS3 B;  3WA9 A;  3AZM C;  1F1E A;  5B2I C;  3UTA B;  4Z5T B;  5AV5 A;  3TU4 D;  1P3K A;  1P3M D;  5AVB C;  2F8N A;  2G5I C;  3KXB B;  3WTP B;  5DNN D;  5AVC A;  3X1T D;  1P3K C;  5GSU C;  3MGR A;  5B33 A;  5GT0 D;  5B1M C;  5AVC C;  5E5A B;  1S32 B;  1EQZ B;  2J8P A;  1N1J B;  4R8P B;  3EPL A;  3MGR C;  4JJN B;  5CP6 D;  5B33 C;  1M19 D;  3REI A;  3KFU G;  3AZN D;  4CSR A;  3W96 D;  1ID3 A;  2ZY2 A;  3MVD B;  1U35 A;  2ARO A;  5DNM B;  5FUG A;  3VH6 T;  1BH9 A;  4J8V D;  1P3I D;  1P3P A;  3KUY D;  1P3B B;  3R45 A;  4KGC B;  5AV8 B;  3LZ0 C;  2YFV A;  1W2E A;  3REI C;  5B2J D;  2BYK B;  3C1C B;  5BNX B;  1U35 C;  2ARO C;  5GXQ D;  2F8N H;  4CAY A;  4YS3 D;  3MGS D;  1TZY A;  4Z5T D;  3C1B B;  3W98 A;  5B31 B;  3AZG A;  3X1V C;  3KXB D;  3LJA B;  2RIQ A;  1TZY C;  4J8U B;  1H3O A;  5B40 A;  3AZJ D;  4NE5 A;  1A7W A;  4EO5 C;  5F99 B;  1S32 D;  5E5A D;  5CPJ D;  3UT9 A;  5C3I C;  4R8P D;  3MNN C;  5B24 A;  3KSY A;  3VH5 T;  4H9N B;  3REJ A;  4ZUX D;  4G92 C;  5CPI A;  5AV6 C;  3W99 D;  4WJ3 C;  5DNM D;  1AOI A;  4XZQ D;  3WAA A;  3AFA C;  3UT9 C;  1WWS A;  1P3B D;  3B0B A;  4KGC D;  5GT3 B;  5CPI C;  4UUZ B;  2FJ7 A;  3AV2 C;  3WAA C;  1P3A B;  1KX3 A;  3LZ1 D;  4H9Q B;  1M1A A;  4X23 A;  3KWQ B;  4WNN A;  2FJ7 C;  5B32 C;  3AV1 B;  3C1B D;  1KX3 C;  5B31 D;  1P3G B;  3MGP D;  3REK A;  1JFI B;  5BT1 C;  3W97 B;  3LJA D;  4J8U D;  2FFF B;  4YM6 B;  1TAF A;  1KX5 C;  4WV4 B;  1M18 A;  3AZF B;  3B6G B;  3REK C;  1KX4 C;  2ZY5 A;  5F99 D;  5CPK A;  1P3F B;  3LEL B;  3MGQ B;  5B31 G;  5B0Z B;  3VH6 W;  2CWE A;  3X1S B;  5CPK C;  1HQ3 D;  3UTB B;  2NQB A;  2YFW B;  2Y2G A;  2HIO A;  4WU8 B;  3REH A;  1B67 A;  3AZE B;  4Z66 A;  4WU9 C;  5GT3 D;  3AZI B;  4KHA B;  2CV5 B;  2NQB C;  3H0M C;  2HIO C;  4QLC D;  3REH C;  5JA4 A;  1P34 B;  3AYW A;  2JSS A;  4Z66 C;  3NQJ B;  3KWQ D;  3AZK A;  4Z2M G;  5B1L D;  3AZL B;  2Y2N A;  4H9S A;  1P3L D;  5AY8 C;  3AN2 A;  3V9R A;  3AYW C;  3TU4 A;  2Y2O A;  3AZK C;  3P5J B;  5KDM B;  5B2I A;  4H9S C;  5JRG B;  3O62 B;  4UPK A;  3X1T A;  3WA9 B;  3TU4 C;  5AVB A;  1P3M C;  3WKJ B;  2DQN C;  3FDD A;  3NQU A;  5BNV B;  4XUJ C;  5AV5 B;  3VH5 W;  5BO0 A;  3AZH D;  5B0Z D;  5GT0 A;  5GSU A;  5DNN C;  3X1T C;  2F8N B;  1P3O B;  5B0Y D;  2XD1 A;  4XUJ D;  5AVC B;  5AV9 B;  3UTB D;  5CP6 A;  1M19 A;  4KUD C;  5B1M A;  3EPJ A;  3MGR B;  4WU8 D;  5GT0 C;  5B33 B;  4J8V A;  4KUD D;  4DRB A;  3B0D C;  2G5H C;  2LY8 A;  5CP6 C;  1M19 C;  4J8X B;  5B2J A;  3AZN C;  3B6F D;  3W96 C;  4J8V C;  3REI B;  5GXQ A;  1P3I C;  2JCH A;  4CSR B;  3LZ0 A;  3KUY C;  1ID3 B;  1U35 B;  5FUG B;  1BH9 B;  3H0R C;  3MGS A;  1P3P B;  5B2J C;  4Z5T A;  3R45 B;  2YFV B;  4H9P A;  2PYO D;  5GXQ C;  3X1U D;  4YS3 C;  3KXB A;  4J8W D;  3MGS C;  5JRG D;  3O62 D;  4CAY B;  2NZD D;  3UTA C;  3WA9 D;  3REL B;  3H0L C;  4Z5T C;  2RVQ D;  4LD9 D;  1TZY B;  3WKJ D;  3X1V A;  3AZJ A;  5AV5 D;  3KXB C;  3UTA D;  2XD5 A;  3W98 B;  4H9R A;  5E5A A;  1BH8 B;  1P3O D;  5CPJ A;  3AZG B;  2F8N D;  5AV9 D;  3AZJ C;  3WTP D;  1H3O B;  4ZUX A;  5B40 B;  1HTA A;  3W99 A;  1S32 C;  5E5A C;  2F8N K;  5DNM A;  3MNN A;  4XZQ A;  5CPJ C;  1KU5 A;  4M6B A;  4R8P C;  1P3B A;  5AV6 A;  4J8X D;  4ZUX C;  2F8N G;  2DF4 C;  1EQZ D;  3W99 C;  5B24 B;  3AFA A;  3REJ B;  5DNM C;  4JJN D;  4XZQ C;  3LZ1 A;  1ZLA B;  2HUE B;  1P3B C;  1AOI B;  4KGC C;  2ZM5 A;  1P3P D;  4G91 B;  3MVD D;  3AV2 A;  2Y2J A;  4E45 A;  3LZ1 C;  2FJ7 B;  5AV8 D;  3MGP A;  3C1C D;  3LJA A;  5B32 A;  1M1A B;  4J8U A;  2W8S A;  4X23 B;  3REL D;  3C1B C;  5G49 A;  4WNN B;  2Y2P A;  4NE6 A;  5B31 C;  3MGP C;  3B0C T;  3LJA C;  3EPK A;  3W98 D;  3F6T A;  4J8U C;  1KX5 A;  3REK B;  3AZG D;  2L5A A;  1KX4 A;  2Y2H A;  1TAF B;  5F99 C;  1HQ3 A;  3A6N B;  1M18 B;  1ULY A;  3WTP E;  5CPK B;  1F66 B;  4AWL C;  5GT3 A;  4ZBJ C;  4UUZ A;  1BFM A;  1HQ3 C;  5B24 D;  3REJ D;  4QLC A;  1ZLA D;  4H9Q A;  4WU9 A;  2NQB B;  1AOI D;  2HIO B;  5GT3 C;  3KWQ A;  3REH B;  5B1L A;  4Z66 B;  1P3L A;  4WZS B;  4QLC C;  5BS7 C;  3EG5 B;  2IO5 C;  3KWQ C;  1M1A D;  4X23 D;  5B1L C;  5AY8 A;  1P3A D;  2Y2M A;  1P3L C;  3AZK B;  3W97 C;  3AN2 B;  3AV1 D;  3TU4 B;  3AZH A;  5B0Z A;  3AZM B;  1P3G D;  1P3M A;  3W97 D;  3AZF C;  5B2I B;  5B0Y A;  4XUJ A;  3A6N D;  3UTB A;  4YM6 D;  3LEL C;  1M18 D;  5AVB B;  5DNN A;  2BYM B;  4H9O A;  3AZH C;  3B6G D;  5B0Z C;  3AZF D;  3NQU B;  1F66 D;  1P3F D;  5B0Y C;  3LEL D;  1P3K B;  5GT0 B;  4HGA C;  2UWX A;  5GSU B;  4KUD A;  3UTB C;  3MGQ D;  4WU8 C;  3B6F A;  2Y2L A;  3X1S D;  5B1M B;  2ZY3 A;  3AZN A;  4J8V B;  3W96 A;  3AZE D;  3B6F C;  1P3I A;  3AZI D;  3KUY A;  2PYO A;  1Z2C B;  3X1U A; 
#chains in the Genus database with same CATH homology
 4J8W A;  1P34 D;  3B0C W;  5GXQ B;  3O62 A;  2NZD A;  3LZ0 B;  4LD9 A;  2BG1 A;  3MGS B;  4YS3 A;  3WKJ A;  3AZL D;  3AN2 D;  2PYO C;  2ARO B;  3X1U C;  5BNV A;  4H9P B;  4J8W C;  3UTA A;  5JRG C;  3O62 C;  3AZM D;  2NZD C;  3WA9 C;  4LD9 C;  1P3O A;  5CHL B;  2RVQ C;  5B2I D;  3WKJ C;  5AV9 A;  3WTP A;  5AV5 C;  5AVB D;  2JE5 A;  3X1V B;  3AZJ B;  1P3O C;  1P3K D;  5GSU D;  4H9R B;  5AV9 C;  3WTP C;  5CPJ B;  4J8X A;  1S32 A;  3IP4 C;  1EQZ A;  4EO5 B;  1N1J A;  4R8P A;  4ZUX B;  4JJN A;  5B1M D;  5AVC D;  3W99 B;  2Y2Q A;  5C3I B;  3MGR D;  3MNN B;  4XZQ B;  4J8X C;  1B6W A;  3MVD A;  5B33 D;  3A1K A;  1EQZ C;  4G92 B;  5AV6 B;  4JJN C;  4KGC A;  5AV8 A;  3AFA B;  3UT9 B;  1ID3 C;  2BYK A;  3LZ1 B;  3C1C A;  1P3P C;  5BNX A;  3MVD C;  3LZ0 D;  3REL A;  2VQR A;  3REI D;  5CPI B;  1ID3 D;  3AV2 B;  1U35 D;  2ARO D;  3WAA B;  5AV8 C;  4E44 A;  3C1C C;  3C1B A;  1BH8 A;  3MGP B;  3REL C;  5B32 B;  5B31 A;  1R4V A;  1KX3 B;  5G49 B;  3X1V D;  3W98 C;  1Q9C A;  1TZY D;  3AZG C;  1KX5 B;  3EPH A;  5F99 A;  2Y2K A;  5B40 C;  1KX4 B;  4AWL B;  4ZBJ B;  1ZLA A;  1HQ3 B;  4H9N A;  5B40 D;  3MNN D;  5B24 C;  5AV6 D;  3REJ C;  1ZLA C;  2HUE C;  3AFA D;  3UT9 D;  1AOI C;  4QLC B;  4G91 C;  4WU9 B;  1P3A A;  2IO5 B;  4DQY B;  5CPI D;  5BS7 A;  3AV2 D;  5B1L B;  3WAA D;  1P3L B;  3AV1 A;  1M1A C;  4X23 C;  1P3A C;  2FJ7 D;  5B32 D;  1P3G A;  1JFI A;  3W97 A;  5AY8 B;  1KX3 D;  5JA4 B;  3AYW B;  3VH6 A;  4DRA A;  5BT1 D;  3A6N A;  4YM6 A;  3AV1 C;  3AL0 C;  3B6G A;  3AZF A;  1P3G C;  1KX5 D;  1F66 A;  4NFT A;  1P3F A;  3V9R B;  3AZH B;  4Z2M H;  3LEL A;  3REK D;  1KX4 D;  3A6N C;  1P3M B;  4YM6 C;  5B32 G;  3MGQ A;  1M18 C;  5B0Y B;  4XUJ B;  4HGA B;  3B6G C;  1PZR A;  1F66 C;  3X1S A;  5DNN B;  1P3F C;  4H9O B;  3X1T B;  2YFW A;  1T3U A;  4WU8 A;  3MGQ C;  5CPK D;  3AZE A;  4KUD B;  5BO0 B;  3AZI A;  3X1S C;  3B6F B;  4KHA A;  4WU9 D;  2CV5 A;  1P34 A;  3B0D B;  4NE3 A;  3A1I A;  5CP6 B;  2NQB D;  3AZE C;  1M19 B;  3NQJ A;  2HIO D;  3REH D;  3AZN B;  2CV5 D;  3AZI C;  3W96 B;  3AZL A;  4Z66 D;  2CV5 C;  1P3I B;  2Y2I A;  3VH5 A;  3KUY B;  1P34 C;  2PYO B;  3AZM A;  3X1U B;  5AY8 D;  5B2J B;  4J8W B;  2ZY4 A;  3AYW D;  2NZD B;  3AZL C;  5KDM A;  3AN2 C;  4LD9 B;  3AZK D;  1WWI A;  5JRG A;  2BYM A;  2F2A C;  4YS3 B;  3WA9 A;  3AZM C;  1F1E A;  5B2I C;  3UTA B;  4Z5T B;  5AV5 A;  3TU4 D;  1P3K A;  1P3M D;  5AVB C;  2F8N A;  2G5I C;  3KXB B;  3WTP B;  5DNN D;  5AVC A;  3X1T D;  1P3K C;  5GSU C;  3MGR A;  5B33 A;  5GT0 D;  5B1M C;  5AVC C;  5E5A B;  1S32 B;  1EQZ B;  2J8P A;  1N1J B;  4R8P B;  3EPL A;  3MGR C;  4JJN B;  5CP6 D;  5B33 C;  1M19 D;  3REI A;  3KFU G;  3AZN D;  4CSR A;  3W96 D;  1ID3 A;  2ZY2 A;  3MVD B;  1U35 A;  2ARO A;  5DNM B;  5FUG A;  3VH6 T;  1BH9 A;  4J8V D;  1P3I D;  1P3P A;  3KUY D;  1P3B B;  3R45 A;  4KGC B;  5AV8 B;  3LZ0 C;  2YFV A;  1W2E A;  3REI C;  5B2J D;  2BYK B;  3C1C B;  5BNX B;  1U35 C;  2ARO C;  5GXQ D;  2F8N H;  4CAY A;  4YS3 D;  3MGS D;  1TZY A;  4Z5T D;  3C1B B;  3W98 A;  5B31 B;  3AZG A;  3X1V C;  3KXB D;  3LJA B;  2RIQ A;  1TZY C;  4J8U B;  1H3O A;  5B40 A;  3AZJ D;  4NE5 A;  1A7W A;  4EO5 C;  5F99 B;  1S32 D;  5E5A D;  5CPJ D;  3UT9 A;  5C3I C;  4R8P D;  3MNN C;  5B24 A;  3KSY A;  3VH5 T;  4H9N B;  3REJ A;  4ZUX D;  4G92 C;  5CPI A;  5AV6 C;  3W99 D;  4WJ3 C;  5DNM D;  1AOI A;  4XZQ D;  3WAA A;  3AFA C;  3UT9 C;  1WWS A;  1P3B D;  3B0B A;  4KGC D;  5GT3 B;  5CPI C;  4UUZ B;  2FJ7 A;  3AV2 C;  3WAA C;  1P3A B;  1KX3 A;  3LZ1 D;  4H9Q B;  1M1A A;  4X23 A;  3KWQ B;  4WNN A;  2FJ7 C;  5B32 C;  3AV1 B;  3C1B D;  1KX3 C;  5B31 D;  1P3G B;  3MGP D;  3REK A;  1JFI B;  5BT1 C;  3W97 B;  3LJA D;  4J8U D;  2FFF B;  4YM6 B;  1TAF A;  1KX5 C;  4WV4 B;  1M18 A;  3AZF B;  3B6G B;  3REK C;  1KX4 C;  2ZY5 A;  5F99 D;  5CPK A;  1P3F B;  3LEL B;  3MGQ B;  5B31 G;  5B0Z B;  3VH6 W;  2CWE A;  3X1S B;  5CPK C;  1HQ3 D;  3UTB B;  2NQB A;  2YFW B;  2Y2G A;  2HIO A;  4WU8 B;  3REH A;  1B67 A;  3AZE B;  4Z66 A;  4WU9 C;  5GT3 D;  3AZI B;  4KHA B;  2CV5 B;  2NQB C;  3H0M C;  2HIO C;  4QLC D;  3REH C;  5JA4 A;  1P34 B;  3AYW A;  2JSS A;  4Z66 C;  3NQJ B;  3KWQ D;  3AZK A;  4Z2M G;  5B1L D;  3AZL B;  2Y2N A;  4H9S A;  1P3L D;  5AY8 C;  3AN2 A;  3V9R A;  3AYW C;  3TU4 A;  2Y2O A;  3AZK C;  3P5J B;  5KDM B;  5B2I A;  4H9S C;  5JRG B;  3O62 B;  4UPK A;  3X1T A;  3WA9 B;  3TU4 C;  5AVB A;  1P3M C;  3WKJ B;  2DQN C;  3FDD A;  3NQU A;  5BNV B;  4XUJ C;  5AV5 B;  3VH5 W;  5BO0 A;  3AZH D;  5B0Z D;  5GT0 A;  5GSU A;  5DNN C;  3X1T C;  2F8N B;  1P3O B;  5B0Y D;  2XD1 A;  4XUJ D;  5AVC B;  5AV9 B;  3UTB D;  5CP6 A;  1M19 A;  4KUD C;  5B1M A;  3EPJ A;  3MGR B;  4WU8 D;  5GT0 C;  5B33 B;  4J8V A;  4KUD D;  4DRB A;  3B0D C;  2G5H C;  2LY8 A;  5CP6 C;  1M19 C;  4J8X B;  5B2J A;  3AZN C;  3B6F D;  3W96 C;  4J8V C;  3REI B;  5GXQ A;  1P3I C;  2JCH A;  4CSR B;  3LZ0 A;  3KUY C;  1ID3 B;  1U35 B;  5FUG B;  1BH9 B;  3H0R C;  3MGS A;  1P3P B;  5B2J C;  4Z5T A;  3R45 B;  2YFV B;  4H9P A;  2PYO D;  5GXQ C;  3X1U D;  4YS3 C;  3KXB A;  4J8W D;  3MGS C;  5JRG D;  3O62 D;  4CAY B;  2NZD D;  3UTA C;  3WA9 D;  3REL B;  3H0L C;  4Z5T C;  2RVQ D;  4LD9 D;  1TZY B;  3WKJ D;  3X1V A;  3AZJ A;  5AV5 D;  3KXB C;  3UTA D;  2XD5 A;  3W98 B;  4H9R A;  5E5A A;  1BH8 B;  1P3O D;  5CPJ A;  3AZG B;  2F8N D;  5AV9 D;  3AZJ C;  3WTP D;  1H3O B;  4ZUX A;  5B40 B;  1HTA A;  3W99 A;  1S32 C;  5E5A C;  2F8N K;  5DNM A;  3MNN A;  4XZQ A;  5CPJ C;  1KU5 A;  4M6B A;  4R8P C;  1P3B A;  5AV6 A;  4J8X D;  4ZUX C;  2F8N G;  2DF4 C;  1EQZ D;  3W99 C;  5B24 B;  3AFA A;  3REJ B;  5DNM C;  4JJN D;  4XZQ C;  3LZ1 A;  1ZLA B;  2HUE B;  1P3B C;  1AOI B;  4KGC C;  2ZM5 A;  1P3P D;  4G91 B;  3MVD D;  3AV2 A;  2Y2J A;  4E45 A;  3LZ1 C;  2FJ7 B;  5AV8 D;  3MGP A;  3C1C D;  3LJA A;  5B32 A;  1M1A B;  4J8U A;  2W8S A;  4X23 B;  3REL D;  3C1B C;  5G49 A;  4WNN B;  2Y2P A;  4NE6 A;  5B31 C;  3MGP C;  3B0C T;  3LJA C;  3EPK A;  3W98 D;  3F6T A;  4J8U C;  1KX5 A;  3REK B;  3AZG D;  2L5A A;  1KX4 A;  2Y2H A;  1TAF B;  5F99 C;  1HQ3 A;  3A6N B;  1M18 B;  1ULY A;  3WTP E;  5CPK B;  1F66 B;  4AWL C;  5GT3 A;  4ZBJ C;  4UUZ A;  1BFM A;  1HQ3 C;  5B24 D;  3REJ D;  4QLC A;  1ZLA D;  4H9Q A;  4WU9 A;  2NQB B;  1AOI D;  2HIO B;  5GT3 C;  3KWQ A;  3REH B;  5B1L A;  4Z66 B;  1P3L A;  4WZS B;  4QLC C;  5BS7 C;  3EG5 B;  2IO5 C;  3KWQ C;  1M1A D;  4X23 D;  5B1L C;  5AY8 A;  1P3A D;  2Y2M A;  1P3L C;  3AZK B;  3W97 C;  3AN2 B;  3AV1 D;  3TU4 B;  3AZH A;  5B0Z A;  3AZM B;  1P3G D;  1P3M A;  3W97 D;  3AZF C;  5B2I B;  5B0Y A;  4XUJ A;  3A6N D;  3UTB A;  4YM6 D;  3LEL C;  1M18 D;  5AVB B;  5DNN A;  2BYM B;  4H9O A;  3AZH C;  3B6G D;  5B0Z C;  3AZF D;  3NQU B;  1F66 D;  1P3F D;  5B0Y C;  3LEL D;  1P3K B;  5GT0 B;  4HGA C;  2UWX A;  5GSU B;  4KUD A;  3UTB C;  3MGQ D;  4WU8 C;  3B6F A;  2Y2L A;  3X1S D;  5B1M B;  2ZY3 A;  3AZN A;  4J8V B;  3W96 A;  3AZE D;  3B6F C;  1P3I A;  3AZI D;  3KUY A;  2PYO A;  1Z2C B;  3X1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...