5B0YA

Crystal structure of the nucleosome containing histone h3 with the crotonylated lysine 122
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
96
structure length
95
Chain Sequence
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.2
publication title Crystal structure of the nucleosome containing histone H3 with crotonylated lysine 122
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 95
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b0yA00
3AV2D 4X23A 4Z5TD 2CWEA 4H9NB 1F66D 3NQJA 4YM6D 3REKD 3W99C 2NZDC 2CV5D 4H9PA 5CP6B 4H9OB 5B33D 1TAFB 1P3MA 3B6FB 1HQ3B 3AZHD 1KX5C 5E5AB 3C1CC 1M1AD 5AV6C 3W99A 1P3FC 2NZDA 3TU4B 1P3OD 4EO5C 5B1MA 3REIB 4NE3A 3X1VC 3MGSC 5B2IB 1KX5A 3WKJC 3C1CA 4KGCB 4JJND 5AV6A 3AZFD 1P3FA 1S32B 5B24C 3X1VA 3MGSA 4J8UC 2HUEB 5CPIB 3KUYA 1M19C 4KUDD 5B24A 3LJAB 3MGRC 3AZED 4J8UA 3WA9C 4ZBJB 3X1UB 4WNNB 5F99B 3WAAC 5GT0B 4H9QB 1M19A 1ZLAD 4QLCC 5AY8D 5B32D 3MGRA 5DNMC 3WA9A 5BO0B 1P3PB 2YFWB 3MNNB 3WAAA 2RVQC 4R8PC 3UTAB 4QLCA 3O62D 5DNMA 3UTBD 5AV8D 2BYKB 5B2JC 3X1SD 3W97A 5AVCB 3A6ND 5BNXB 3AV2B 5AV9A 3W98C 4NE5A 4R8PA 5DNND 4Z5TB 3RELD 1F66B 4YM6B 2AROD 5B2JA 2CV5B 3MGQC 1B6WA 1P34D 5B33B 3W98A 3AZHB 1BH8B 3UT9C 4NFTA 1M1AB 1P3AC 2IO5C 1EQZD 1P3OB 4H9RA 3MGPC 3X1TC 3VH5T 3AN2C 2BYMB 3UT9A 2F8NK 1P3AA 3AZFB 3AFAD 3AZGC 2PYOD 3MGPA 5JRGD 3X1TA 3AN2A 5CP6C 1U35D 4J8XC 3AZKD 3B6FC 1HQ3C 4H9NA 5E5AC 4HGAB 4KUDB 5CP6A 3TU4C 3AZEB 4J8XA 4H9OA 5GSUD 3REIC 1TAFA 3B6FA 1HQ3A 5B2IC 1F1EA 5E5AA 1ZLAB 4LD9D 3AZMD 4AWLB 5B32B 3TU4A 1S32C 3AZLC 3REIA 4XUJD 4DRBA 5B2IA 2HUEC 5CPIC 4WU8D 4KGCA 3O62B 3AV1D 1KU5A 1TZYB 3UTBB 3REHD 5AV8B 3R45B 3X1SB 3B0DB 3C1BD 1S32A 3LJAC 3A6NB 5CPIA 4ZBJC 5DNNB 3X1UC 3RELB 5F99C 5GT0C 2AROB 1Q9CA 3LJAA 1P34B 3X1UA 1P3PC 4WNNA 5B1LD 5F99A 5GT0A 3MNNC 4H9QA 4WZSB 4CAYB 5B40D 5B32G 3LELC 1EQZB 4ZUXC 3V9RB 4E45A 5BO0A 1P3PA 5AVCC 2YFWA 1P3KD 3MNNA 5B31D 3WTPE 4Z5TC 3LELA 3AFAB 1F66C 4YM6C 5GT3C 2PYOB 5JRGB 2BYKA 1U35B 5AVCA 1P3MC 5BNXA 5B33C 5AV5B 3AZKB 4Z5TA 4E44A 1F66A 4YM6A 5GT3A 1M1AC 2CV5A 4Z2MH 5B1MC 1P3OC 1P3IB 5GSUB 5B33A 5B0YD 1BH8A 4LD9B 1M1AA 3AZID 3AZFC 3VH5A 3AYWD 1P3OA 1AOID 4XUJB 2BYMA 3KUYC 4WU8B 4NE6A 3AZFA 3AV1B 4HGAC 3REHB 3C1BB 4KUDC 4G92B 3AZEC 3B0CT 1ZLAC 3LZ1D 4KUDA 5KDMB 4AWLC 3AZEA 5G49B 3AZND 3W96C 4XZQD 1P3GC 1BH9A 1KX5D 5B1LB 1ZLAA 5AV6D 1A7WA 3O62C 1TZYC 3W97C 3UTBC 5AV8C 3X1SC 3B0DC 3W96A 1P3GA 5AV9C 1P3KB 3A6NC 4G91B 3WKJD 5B31B 4WU9D 5DNNC 4YS3D 3O62A 3KXBD 1TZYA 3UTBA 5AV8A 2AROC 3X1SA 5B24D 3VH6T 1P34C 4J8UD 3A6NA 5DNNA 3REKB 1KX3C 5AVBD 2AROA 1EQZC 3MGRD 1P34A 2F8NH 5B0YB 2F8ND 1KX3A 3WAAD 3AZIB 4CAYA 1N1JB 5BNVB 3AZJD 3WTPC 3AFAC 3AYWB 1EQZA 1AOIB 5JRGC 5BS7C 3V9RA 5FUGB 1U35C 1H3OB 2LY8A 4JJNB 5B31G 2RVQD 5AV5C 3AZKC 4J8VD 1KX4D 3WTPA 3AFAA 5JA4A 5JRGA 5BS7A 5B2JD 1U35A 1P3IC 4CSRB 5GSUC 2FJ7D 5BT1C 5AV5A 4M6BA 3AZKA 4LD9C 2YFVB 3LZ1B 3MGQD 5CHLB 4Z2MG 1P3IA 3AZNB 5GSUA 4XZQB 4KGCC 1KX5B 5AY8B 4WU8C 1P3AD 4LD9A 1WWSA 3AV1C 3REHC 3C1BC 4G92C 3WKJB 4WU8A 4WU9B 5GXQD 4YS3B 3KXBB 3AV1A 1P3BD 3AZGD 4Z66D 3C1BA 3REHA 5CPKD 5CP6D 4J8XD 2NQBD 3VH5W 5B1LC 5AVBB 3LZ0D 1P3LD 1B67A 5KDMA 2HIOD 3NQUB 1ID3D 3MGRB 3KSYA 5G49A 1HTAA 5B2ID 2F8NB 5B1LA 3UTAC 4G91C 3WAAB 3AZJB 2L5AA 3AZLD 3MVDD 3KWQD 4H9SC 4WV4B 3AV2C 5CPJD 1P3KA 3UTAA 4J8WD 2JSSA 3VH6A 3REJD 1M18D 4J8VB 3REKC 1KX4B 2CV5C 4H9SA 3AV2A 2FJ7B 3AZHC 5B0YC 3REKA 3MGQB 3B6GD 3AZHA 5B0ZD 2F8NG 5B0YA 4JJNC 1P3AB 3AZMB 1N1JA 3LELD 3AYWA 4ZUXD 5C3IB 5FUGA 4UUZB 1H3OA 5AVCD 4JJNA 4X23D 1JFIB 5GXQB 1P3BB 3AZGB 5GT3D 3LZ1C 4Z66B 5CPKB 4J8XB 1P3MD 4CSRA 3AZNC 4XZQC 2NQBB 3W99D 3LZ0B 2NZDD 5AY8C 1P3LB 2YFVA 3LZ1A 5B32C 1ULYA 2HIOB 5B1MD 1ID3B 3AZNA 4KHAB 4XZQA 3C1CD 1P3FD 5AY8A 5B40B 4WU9C 5B32A 4YS3C 3KXBC 4DRAA 1R4VA 3AZLB 3MGSD 3X1VD 3MVDB 3KWQB 5CPJB 3WKJA 4J8WB 3KUYD 3RELC 4WU9A 3REJB 4YS3A 3KXBA 1M18B 5AVBC 3R45A 3RELA 1M19D 5AVBA 3AZJC 3B6GB 3NQUA 3WA9D 3W96D 5B0ZB 1P3GD 2F8NA 4QLCD 5DNMD 4J8VC 3AZJA 3LELB 3B0CW 1TZYD 1KX4C 4ZUXB 2PYOC 3W97D 5AV9D 4R8PD 4X23B 2FJ7C 3NQJB 4J8VA 1KX4A 2PYOA 5GT3B 4H9PB 1P3MB 3W98D 2FJ7A 1KX3D 3W99B 2NZDB 3AZMC 3MGQA 5B1MB 5C3IC 4XUJC 3UT9D 3C1CB 3VH6W 5AV6B 1P3FB 1BFMA 3AZMA 5GXQC 1P3BC 3X1TD 3MGPD 4EO5B 3WTPD 4XUJA 4Z66C 3MGSB 3AN2D 3X1VB 4UUZA 5CPKC 5AV5D 3KUYB 1JFIA 2NQBC 5GXQA 1P3BA 3LZ0C 5B24B 3AZGA 1P3LC 4Z66A 2HIOC 4J8UB 5CPKA 1ID3C 1P3ID 3B6FD 1HQ3D 5BT1D 2NQBA 1M19B 5E5AD 1BH9B 3LZ0A 1P3LA 5B40C 3TU4D 2HIOA 3WA9B 3REID 1ID3A 4KHAA 3MVDC 3KWQC 3W96B 1P3KC 5CPJC 1P3GB 5B31C 4KGCD 4QLCB 4J8WC 5B40A 3REJC 1M18C 5DNMB 1S32D 3W97B 3AZLA 3MVDA 3KWQA 5CPJA 5AV9B 5B31A 4R8PB 5CPID 4J8WA 3REJA 1M18A 5B2JB 3LJAD 1WWIA 3B6GC 3W98B 3X1UD 5B0ZC 5F99D 5GT0D 1KX3B 3AZIC 3AYWC 1AOIC 4H9RB 3B6GA 3B0BA 1P3PD 5B0ZA 3MNND 3UT9B 3UTAD 4X23C 3AZIA 2IO5B 5BNVA 1AOIA 3MGPB 3X1TB 3WTPB 5JA4B 4ZUXA 3AN2B
chains in the Genus database with same CATH superfamily
3AV2D 4X23A 4Z5TD 2CWEA 4H9NB 1F66D 3NQJA 4YM6D 3REKD 3W99C 2NZDC 2CV5D 4H9PA 5CP6B 4H9OB 5B33D 1TAFB 1P3MA 3B6FB 1HQ3B 3AZHD 1KX5C 5E5AB 3C1CC 1M1AD 5AV6C 3W99A 1P3FC 2NZDA 3TU4B 1P3OD 4EO5C 5B1MA 3REIB 4NE3A 3X1VC 3MGSC 5B2IB 1KX5A 3WKJC 3C1CA 4KGCB 4JJND 5AV6A 3AZFD 1P3FA 2Y2JA 1S32B 5B24C 3X1VA 3MGSA 4J8UC 2HUEB 5CPIB 3KUYA 1M19C 4KUDD 5B24A 3LJAB 3MGRC 3AZED 4J8UA 3WA9C 4ZBJB 3X1UB 4WNNB 5F99B 3WAAC 5GT0B 4H9QB 1M19A 1ZLAD 4QLCC 5AY8D 5B32D 3MGRA 5DNMC 2BG1A 3WA9A 5BO0B 1P3PB 2YFWB 3MNNB 3WAAA 2RVQC 3A1KA 4R8PC 3UTAB 4QLCA 3O62D 5DNMA 3UTBD 5AV8D 2BYKB 5B2JC 3X1SD 3W97A 5AVCB 3A6ND 5BNXB 3AV2B 5AV9A 3W98C 4NE5A 4R8PA 5DNND 4Z5TB 3RELD 1F66B 4YM6B 3EPJA 2Y2HA 2AROD 5B2JA 2CV5B 3MGQC 1B6WA 1P34D 5B33B 3W98A 3AZHB 1BH8B 3UT9C 2Y2QA 4NFTA 1M1AB 1P3AC 2IO5C 1EQZD 1P3OB 2Y2GA 4H9RA 3MGPC 2ZM5A 3X1TC 2ZY2A 3IP4C 3VH5T 3AN2C 2BYMB 3UT9A 2F8NK 1P3AA 3AZFB 3AFAD 3AZGC 2PYOD 3MGPA 5JRGD 3X1TA 3AN2A 5CP6C 2W8SA 1U35D 4J8XC 3AZKD 3B6FC 1HQ3C 4H9NA 5E5AC 4HGAB 4KUDB 5CP6A 3TU4C 3AZEB 4J8XA 4H9OA 2G5IC 5GSUD 3REIC 1TAFA 3B6FA 1HQ3A 5B2IC 2Y2IA 1F1EA 5E5AA 1ZLAB 4LD9D 3AZMD 4AWLB 5B32B 3TU4A 1S32C 3AZLC 3REIA 4XUJD 4DRBA 5B2IA 2HUEC 5CPIC 2DF4C 4WU8D 4KGCA 3O62B 3AV1D 1KU5A 1TZYB 3UTBB 3REHD 5AV8B 3R45B 3B0DB 3X1SB 3C1BD 1S32A 3LJAC 2RIQA 3A6NB 2ZY3A 5CPIA 4ZBJC 5DNNB 3X1UC 3RELB 5F99C 5GT0C 2AROB 1Q9CA 3A1IA 3LJAA 1P34B 3X1UA 1P3PC 4WNNA 5B1LD 5F99A 5GT0A 3MNNC 4H9QA 4WZSB 4CAYB 5B40D 5B32G 3LELC 1EQZB 4ZUXC 3V9RB 4E45A 5BO0A 1P3PA 5AVCC 2YFWA 1P3KD 3MNNA 5B31D 3WTPE 4Z5TC 3LELA 3AFAB 1F66C 4YM6C 5GT3C 2PYOB 5JRGB 2BYKA 1U35B 5AVCA 1P3MC 5BNXA 5B33C 5AV5B 3AZKB 4Z5TA 4E44A 1F66A 4YM6A 5GT3A 4DQYB 1M1AC 2ZY4A 2CV5A 4Z2MH 5B1MC 1P3OC 1P3IB 5GSUB 5B33A 5B0YD 1BH8A 4LD9B 1M1AA 3AZID 3AZFC 3VH5A 2XD1A 3AYWD 1P3OA 1AOID 2ZY5A 4XUJB 2BYMA 3KUYC 4WU8B 4NE6A 3AZFA 3AV1B 4HGAC 3REHB 3C1BB 4KUDC 4G92B 3AZEC 3B0CT 1ZLAC 3LZ1D 4KUDA 5KDMB 4AWLC 3AZEA 5G49B 3H0RC 3AZND 3W96C 4XZQD 1P3GC 1BH9A 1KX5D 5B1LB 1ZLAA 5AV6D 1A7WA 3O62C 1TZYC 3W97C 3UTBC 5AV8C 3X1SC 3B0DC 3W96A 4WJ3C 1P3GA 5AV9C 1P3KB 3A6NC 4G91B 3WKJD 5B31B 4WU9D 5DNNC 4YS3D 3O62A 3KXBD 1TZYA 3UTBA 5AV8A 2AROC 3X1SA 5B24D 3VH6T 3P5JB 1P34C 4J8UD 3A6NA 5DNNA 3REKB 1KX3C 5AVBD 2XD5A 2AROA 1EQZC 3MGRD 1P34A 2F8NH 2FFFB 5B0YB 2F8ND 1KX3A 3WAAD 3AZIB 2Y2NA 1N1JB 4CAYA 5BNVB 3AZJD 3WTPC 3AFAC 3AYWB 1EQZA 1AOIB 3H0MC 5JRGC 5BS7C 3V9RA 5FUGB 1U35C 1H3OB 2LY8A 4JJNB 5B31G 2RVQD 5AV5C 3AZKC 4J8VD 1KX4D 3WTPA 3AFAA 5JA4A 5JRGA 5BS7A 5B2JD 1U35A 1P3IC 4CSRB 5GSUC 2FJ7D 5BT1C 5AV5A 4M6BA 3AZKA 4LD9C 2YFVB 3LZ1B 3MGQD 5CHLB 4Z2MG 1P3IA 3AZNB 5GSUA 4XZQB 4KGCC 1KX5B 5AY8B 4WU8C 1P3AD 4LD9A 1WWSA 3AV1C 3REHC 3C1BC 4G92C 3WKJB 1W2EA 4WU8A 4WU9B 5GXQD 4YS3B 3KXBB 3AV1A 1P3BD 3AZGD 4Z66D 3C1BA 3REHA 5CPKD 5CP6D 3EPHA 4J8XD 2NQBD 3VH5W 5B1LC 5AVBB 3LZ0D 1P3LD 1B67A 5KDMA 2HIOD 2UWXA 3NQUB 1ID3D 3MGRB 3KSYA 5G49A 1HTAA 2Y2KA 5B2ID 2F8NB 5B1LA 3UTAC 4G91C 3WAAB 3AZJB 2L5AA 3AZLD 3MVDD 3KWQD 4H9SC 4WV4B 3AV2C 5CPJD 1P3KA 3UTAA 4J8WD 2JSSA 3EG5B 3VH6A 3REJD 1M18D 4J8VB 3REKC 1KX4B 2CV5C 2DQNC 4H9SA 3AV2A 2FJ7B 3AZHC 5B0YC 3REKA 3MGQB 3AL0C 3B6GD 3AZHA 5B0ZD 2F8NG 5B0YA 4JJNC 1P3AB 3AZMB 1N1JA 3LELD 3AYWA 4ZUXD 5C3IB 5FUGA 4UUZB 1H3OA 5AVCD 4JJNA 4X23D 1JFIB 5GXQB 1P3BB 3AZGB 5GT3D 3LZ1C 4Z66B 5CPKB 4J8XB 1P3MD 4CSRA 3AZNC 4XZQC 2NQBB 3W99D 3LZ0B 2NZDD 5AY8C 1P3LB 2YFVA 3LZ1A 5B32C 1ULYA 2HIOB 5B1MD 1ID3B 3AZNA 4KHAB 4XZQA 3C1CD 1P3FD 5AY8A 5B40B 4WU9C 2Y2LA 5B32A 4YS3C 3KXBC 4DRAA 1R4VA 3AZLB 3MGSD 3X1VD 3MVDB 3KWQB 2F2AC 5CPJB 3WKJA 4J8WB 3KUYD 3RELC 4WU9A 3REJB 4YS3A 3KXBA 1M18B 5AVBC 3R45A 3RELA 3F6TA 1M19D 5AVBA 3AZJC 3B6GB 3NQUA 3WA9D 3W96D 5B0ZB 1P3GD 2F8NA 4QLCD 2Y2MA 5DNMD 4J8VC 3AZJA 3LELB 3B0CW 1TZYD 1KX4C 4ZUXB 2PYOC 3W97D 4UPKA 5AV9D 4R8PD 3H0LC 4X23B 2FJ7C 2VQRA 3NQJB 4J8VA 1KX4A 2PYOA 5GT3B 4H9PB 1P3MB 3W98D 2FJ7A 1KX3D 3W99B 2NZDB 3AZMC 3MGQA 5B1MB 5C3IC 4XUJC 3UT9D 3C1CB 3VH6W 5AV6B 1P3FB 1BFMA 3AZMA 5GXQC 1P3BC 3X1TD 3MGPD 4EO5B 3WTPD 4XUJA 4Z66C 3MGSB 3AN2D 3X1VB 4UUZA 5CPKC 5AV5D 3KUYB 1JFIA 2NQBC 5GXQA 1P3BA 3LZ0C 5B24B 3AZGA 1P3LC 4Z66A 2HIOC 4J8UB 5CPKA 1ID3C 1P3ID 3B6FD 1HQ3D 5BT1D 2NQBA 1M19B 5E5AD 1BH9B 3LZ0A 1P3LA 1T3UA 1PZRA 5B40C 2J8PA 3TU4D 2HIOA 3WA9B 3REID 1ID3A 4KHAA 3MVDC 3KWQC 3EPLA 1P3KC 3W96B 5CPJC 1P3GB 5B31C 4KGCD 4QLCB 4J8WC 5B40A 2Y2OA 3REJC 1M18C 5DNMB 1S32D 2Y2PA 3W97B 1Z2CB 3AZLA 3MVDA 3KWQA 5CPJA 5AV9B 5B31A 4R8PB 5CPID 4J8WA 3FDDA 3REJA 1M18A 5B2JB 3LJAD 1WWIA 3B6GC 3W98B 3X1UD 5B0ZC 5F99D 5GT0D 3KFUG 1KX3B 3AZIC 2JE5A 3AYWC 1AOIC 4H9RB 3B6GA 3B0BA 1P3PD 5B0ZA 3MNND 3EPKA 3UT9B 3UTAD 4X23C 3AZIA 2IO5B 5BNVA 1AOIA 2JCHA 3MGPB 3WTPB 3X1TB 5JA4B 2G5HC 4ZUXA 3AN2B
chains in the Genus database with same CATH topology
3AV2D 4X23A 4Z5TD 2CWEA 4H9NB 1F66D 3NQJA 4YM6D 3REKD 3W99C 2NZDC 2CV5D 4H9PA 5CP6B 4H9OB 5B33D 1TAFB 1P3MA 3B6FB 1HQ3B 3AZHD 1KX5C 5E5AB 3C1CC 1M1AD 5AV6C 3W99A 1P3FC 2NZDA 3TU4B 1P3OD 4EO5C 5B1MA 3REIB 4NE3A 3X1VC 3MGSC 5B2IB 1KX5A 3WKJC 3C1CA 4KGCB 4JJND 5AV6A 3AZFD 1P3FA 2Y2JA 1S32B 5B24C 3X1VA 3MGSA 4J8UC 2HUEB 5CPIB 3KUYA 1M19C 4KUDD 5B24A 3LJAB 3MGRC 3AZED 4J8UA 3WA9C 4ZBJB 3X1UB 4WNNB 5F99B 3WAAC 5GT0B 4H9QB 1M19A 1ZLAD 4QLCC 5AY8D 5B32D 3MGRA 5DNMC 2BG1A 3WA9A 5BO0B 1P3PB 2YFWB 3MNNB 3WAAA 2RVQC 3A1KA 4R8PC 3UTAB 4QLCA 3O62D 5DNMA 3UTBD 5AV8D 2BYKB 5B2JC 3X1SD 3W97A 5AVCB 3A6ND 5BNXB 3AV2B 5AV9A 3W98C 4NE5A 4R8PA 5DNND 4Z5TB 3RELD 1F66B 4YM6B 3EPJA 2Y2HA 2AROD 5B2JA 2CV5B 3MGQC 1B6WA 1P34D 5B33B 3W98A 3AZHB 1BH8B 3UT9C 2Y2QA 4NFTA 1M1AB 1P3AC 2IO5C 1EQZD 1P3OB 2Y2GA 4H9RA 3MGPC 2ZM5A 3X1TC 2ZY2A 3IP4C 3VH5T 3AN2C 2BYMB 3UT9A 2F8NK 1P3AA 3AZFB 3AFAD 3AZGC 2PYOD 3MGPA 5JRGD 3X1TA 3AN2A 5CP6C 2W8SA 1U35D 4J8XC 3AZKD 3B6FC 1HQ3C 4H9NA 5E5AC 4HGAB 4KUDB 5CP6A 3TU4C 3AZEB 4J8XA 4H9OA 2G5IC 5GSUD 3REIC 1TAFA 3B6FA 1HQ3A 5B2IC 2Y2IA 1F1EA 5E5AA 1ZLAB 4LD9D 3AZMD 4AWLB 5B32B 3TU4A 1S32C 3AZLC 3REIA 4XUJD 4DRBA 5B2IA 2HUEC 5CPIC 2DF4C 4WU8D 4KGCA 3O62B 3AV1D 1KU5A 1TZYB 3UTBB 3REHD 5AV8B 3R45B 3B0DB 3X1SB 3C1BD 1S32A 3LJAC 2RIQA 3A6NB 2ZY3A 5CPIA 4ZBJC 5DNNB 3X1UC 3RELB 5F99C 5GT0C 2AROB 1Q9CA 3A1IA 3LJAA 1P34B 3X1UA 1P3PC 4WNNA 5B1LD 5F99A 5GT0A 3MNNC 4H9QA 4WZSB 4CAYB 5B40D 5B32G 3LELC 1EQZB 4ZUXC 3V9RB 4E45A 5BO0A 1P3PA 5AVCC 2YFWA 1P3KD 3MNNA 5B31D 3WTPE 4Z5TC 3LELA 3AFAB 1F66C 4YM6C 5GT3C 2PYOB 5JRGB 2BYKA 1U35B 5AVCA 1P3MC 5BNXA 5B33C 5AV5B 3AZKB 4Z5TA 4E44A 1F66A 4YM6A 5GT3A 4DQYB 1M1AC 2ZY4A 2CV5A 4Z2MH 5B1MC 1P3OC 1P3IB 5GSUB 5B33A 5B0YD 1BH8A 4LD9B 1M1AA 3AZID 3AZFC 3VH5A 2XD1A 3AYWD 1P3OA 1AOID 2ZY5A 4XUJB 2BYMA 3KUYC 4WU8B 4NE6A 3AZFA 3AV1B 4HGAC 3REHB 3C1BB 4KUDC 4G92B 3AZEC 3B0CT 1ZLAC 3LZ1D 4KUDA 5KDMB 4AWLC 3AZEA 5G49B 3H0RC 3AZND 3W96C 4XZQD 1P3GC 1BH9A 1KX5D 5B1LB 1ZLAA 5AV6D 1A7WA 3O62C 1TZYC 3W97C 3UTBC 5AV8C 3X1SC 3B0DC 3W96A 4WJ3C 1P3GA 5AV9C 1P3KB 3A6NC 4G91B 3WKJD 5B31B 4WU9D 5DNNC 4YS3D 3O62A 3KXBD 1TZYA 3UTBA 5AV8A 2AROC 3X1SA 5B24D 3VH6T 3P5JB 1P34C 4J8UD 3A6NA 5DNNA 3REKB 1KX3C 5AVBD 2XD5A 2AROA 1EQZC 3MGRD 1P34A 2F8NH 2FFFB 5B0YB 2F8ND 1KX3A 3WAAD 3AZIB 2Y2NA 1N1JB 4CAYA 5BNVB 3AZJD 3WTPC 3AFAC 3AYWB 1EQZA 1AOIB 3H0MC 5JRGC 5BS7C 3V9RA 5FUGB 1U35C 1H3OB 2LY8A 4JJNB 5B31G 2RVQD 5AV5C 3AZKC 4J8VD 1KX4D 3WTPA 3AFAA 5JA4A 5JRGA 5BS7A 5B2JD 1U35A 1P3IC 4CSRB 5GSUC 2FJ7D 5BT1C 5AV5A 4M6BA 3AZKA 4LD9C 2YFVB 3LZ1B 3MGQD 5CHLB 4Z2MG 1P3IA 3AZNB 5GSUA 4XZQB 4KGCC 1KX5B 5AY8B 4WU8C 1P3AD 4LD9A 1WWSA 3AV1C 3REHC 3C1BC 4G92C 3WKJB 1W2EA 4WU8A 4WU9B 5GXQD 4YS3B 3KXBB 3AV1A 1P3BD 3AZGD 4Z66D 3C1BA 3REHA 5CPKD 5CP6D 3EPHA 4J8XD 2NQBD 3VH5W 5B1LC 5AVBB 3LZ0D 1P3LD 1B67A 5KDMA 2HIOD 2UWXA 3NQUB 1ID3D 3MGRB 3KSYA 5G49A 1HTAA 2Y2KA 5B2ID 2F8NB 5B1LA 3UTAC 4G91C 3WAAB 3AZJB 2L5AA 3AZLD 3MVDD 3KWQD 4H9SC 4WV4B 3AV2C 5CPJD 1P3KA 3UTAA 4J8WD 2JSSA 3EG5B 3VH6A 3REJD 1M18D 4J8VB 3REKC 1KX4B 2CV5C 2DQNC 4H9SA 3AV2A 2FJ7B 3AZHC 5B0YC 3REKA 3MGQB 3AL0C 3B6GD 3AZHA 5B0ZD 2F8NG 5B0YA 4JJNC 1P3AB 3AZMB 1N1JA 3LELD 3AYWA 4ZUXD 5C3IB 5FUGA 4UUZB 1H3OA 5AVCD 4JJNA 4X23D 1JFIB 5GXQB 1P3BB 3AZGB 5GT3D 3LZ1C 4Z66B 5CPKB 4J8XB 1P3MD 4CSRA 3AZNC 4XZQC 2NQBB 3W99D 3LZ0B 2NZDD 5AY8C 1P3LB 2YFVA 3LZ1A 5B32C 1ULYA 2HIOB 5B1MD 1ID3B 3AZNA 4KHAB 4XZQA 3C1CD 1P3FD 5AY8A 5B40B 4WU9C 2Y2LA 5B32A 4YS3C 3KXBC 4DRAA 1R4VA 3AZLB 3MGSD 3X1VD 3MVDB 3KWQB 2F2AC 5CPJB 3WKJA 4J8WB 3KUYD 3RELC 4WU9A 3REJB 4YS3A 3KXBA 1M18B 5AVBC 3R45A 3RELA 3F6TA 1M19D 5AVBA 3AZJC 3B6GB 3NQUA 3WA9D 3W96D 5B0ZB 1P3GD 2F8NA 4QLCD 2Y2MA 5DNMD 4J8VC 3AZJA 3LELB 3B0CW 1TZYD 1KX4C 4ZUXB 2PYOC 3W97D 4UPKA 5AV9D 4R8PD 3H0LC 4X23B 2FJ7C 2VQRA 3NQJB 4J8VA 1KX4A 2PYOA 5GT3B 4H9PB 1P3MB 3W98D 2FJ7A 1KX3D 3W99B 2NZDB 3AZMC 3MGQA 5B1MB 5C3IC 4XUJC 3UT9D 3C1CB 3VH6W 5AV6B 1P3FB 1BFMA 3AZMA 5GXQC 1P3BC 3X1TD 3MGPD 4EO5B 3WTPD 4XUJA 4Z66C 3MGSB 3AN2D 3X1VB 4UUZA 5CPKC 5AV5D 3KUYB 1JFIA 2NQBC 5GXQA 1P3BA 3LZ0C 5B24B 3AZGA 1P3LC 4Z66A 2HIOC 4J8UB 5CPKA 1ID3C 1P3ID 3B6FD 1HQ3D 5BT1D 2NQBA 1M19B 5E5AD 1BH9B 3LZ0A 1P3LA 1T3UA 1PZRA 5B40C 2J8PA 3TU4D 2HIOA 3WA9B 3REID 1ID3A 4KHAA 3MVDC 3KWQC 3EPLA 1P3KC 3W96B 5CPJC 1P3GB 5B31C 4KGCD 4QLCB 4J8WC 5B40A 2Y2OA 3REJC 1M18C 5DNMB 1S32D 2Y2PA 3W97B 1Z2CB 3AZLA 3MVDA 3KWQA 5CPJA 5AV9B 5B31A 4R8PB 5CPID 4J8WA 3FDDA 3REJA 1M18A 5B2JB 3LJAD 1WWIA 3B6GC 3W98B 3X1UD 5B0ZC 5F99D 5GT0D 3KFUG 1KX3B 3AZIC 2JE5A 3AYWC 1AOIC 4H9RB 3B6GA 3B0BA 1P3PD 5B0ZA 3MNND 3EPKA 3UT9B 3UTAD 4X23C 3AZIA 2IO5B 5BNVA 1AOIA 2JCHA 3MGPB 3WTPB 3X1TB 5JA4B 2G5HC 4ZUXA 3AN2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV2 D;  4X23 A;  4Z5T D;  2CWE A;  4H9N B;  1F66 D;  3NQJ A;  4YM6 D;  3REK D;  3W99 C;  2NZD C;  2CV5 D;  4H9P A;  5CP6 B;  4H9O B;  5B33 D;  1TAF B;  1P3M A;  3B6F B;  1HQ3 B;  3AZH D;  1KX5 C;  5E5A B;  3C1C C;  1M1A D;  5AV6 C;  3W99 A;  1P3F C;  2NZD A;  3TU4 B;  1P3O D;  4EO5 C;  5B1M A;  3REI B;  4NE3 A;  3X1V C;  3MGS C;  5B2I B;  1KX5 A;  3WKJ C;  3C1C A;  4KGC B;  4JJN D;  5AV6 A;  3AZF D;  1P3F A;  1S32 B;  5B24 C;  3X1V A;  3MGS A;  4J8U C;  2HUE B;  5CPI B;  3KUY A;  1M19 C;  4KUD D;  5B24 A;  3LJA B;  3MGR C;  3AZE D;  4J8U A;  3WA9 C;  4ZBJ B;  3X1U B;  4WNN B;  5F99 B;  3WAA C;  5GT0 B;  4H9Q B;  1M19 A;  1ZLA D;  4QLC C;  5AY8 D;  5B32 D;  3MGR A;  5DNM C;  3WA9 A;  5BO0 B;  1P3P B;  2YFW B;  3MNN B;  3WAA A;  2RVQ C;  4R8P C;  3UTA B;  4QLC A;  3O62 D;  5DNM A;  3UTB D;  5AV8 D;  2BYK B;  5B2J C;  3X1S D;  3W97 A;  5AVC B;  3A6N D;  5BNX B;  3AV2 B;  5AV9 A;  3W98 C;  4NE5 A;  4R8P A;  5DNN D;  4Z5T B;  3REL D;  1F66 B;  4YM6 B;  2ARO D;  5B2J A;  2CV5 B;  3MGQ C;  1B6W A;  1P34 D;  5B33 B;  3W98 A;  3AZH B;  1BH8 B;  3UT9 C;  4NFT A;  1M1A B;  1P3A C;  2IO5 C;  1EQZ D;  1P3O B;  4H9R A;  3MGP C;  3X1T C;  3VH5 T;  3AN2 C;  2BYM B;  3UT9 A;  2F8N K;  1P3A A;  3AZF B;  3AFA D;  3AZG C;  2PYO D;  3MGP A;  5JRG D;  3X1T A;  3AN2 A;  5CP6 C;  1U35 D;  4J8X C;  3AZK D;  3B6F C;  1HQ3 C;  4H9N A;  5E5A C;  4HGA B;  4KUD B;  5CP6 A;  3TU4 C;  3AZE B;  4J8X A;  4H9O A;  5GSU D;  3REI C;  1TAF A;  3B6F A;  1HQ3 A;  5B2I C;  1F1E A;  5E5A A;  1ZLA B;  4LD9 D;  3AZM D;  4AWL B;  5B32 B;  3TU4 A;  1S32 C;  3AZL C;  3REI A;  4XUJ D;  4DRB A;  5B2I A;  2HUE C;  5CPI C;  4WU8 D;  4KGC A;  3O62 B;  3AV1 D;  1KU5 A;  1TZY B;  3UTB B;  3REH D;  5AV8 B;  3R45 B;  3X1S B;  3B0D B;  3C1B D;  1S32 A;  3LJA C;  3A6N B;  5CPI A;  4ZBJ C;  5DNN B;  3X1U C;  3REL B;  5F99 C;  5GT0 C;  2ARO B;  1Q9C A;  3LJA A;  1P34 B;  3X1U A;  1P3P C;  4WNN A;  5B1L D;  5F99 A;  5GT0 A;  3MNN C;  4H9Q A;  4WZS B;  4CAY B;  5B40 D;  5B32 G;  3LEL C;  1EQZ B;  4ZUX C;  3V9R B;  4E45 A;  5BO0 A;  1P3P A;  5AVC C;  2YFW A;  1P3K D;  3MNN A;  5B31 D;  3WTP E;  4Z5T C;  3LEL A;  3AFA B;  1F66 C;  4YM6 C;  5GT3 C;  2PYO B;  5JRG B;  2BYK A;  1U35 B;  5AVC A;  1P3M C;  5BNX A;  5B33 C;  5AV5 B;  3AZK B;  4Z5T A;  4E44 A;  1F66 A;  4YM6 A;  5GT3 A;  1M1A C;  2CV5 A;  4Z2M H;  5B1M C;  1P3O C;  1P3I B;  5GSU B;  5B33 A;  5B0Y D;  1BH8 A;  4LD9 B;  1M1A A;  3AZI D;  3AZF C;  3VH5 A;  3AYW D;  1P3O A;  1AOI D;  4XUJ B;  2BYM A;  3KUY C;  4WU8 B;  4NE6 A;  3AZF A;  3AV1 B;  4HGA C;  3REH B;  3C1B B;  4KUD C;  4G92 B;  3AZE C;  3B0C T;  1ZLA C;  3LZ1 D;  4KUD A;  5KDM B;  4AWL C;  3AZE A;  5G49 B;  3AZN D;  3W96 C;  4XZQ D;  1P3G C;  1BH9 A;  1KX5 D;  5B1L B;  1ZLA A;  5AV6 D;  1A7W A;  3O62 C;  1TZY C;  3W97 C;  3UTB C;  5AV8 C;  3X1S C;  3B0D C;  3W96 A;  1P3G A;  5AV9 C;  1P3K B;  3A6N C;  4G91 B;  3WKJ D;  5B31 B;  4WU9 D;  5DNN C;  4YS3 D;  3O62 A;  3KXB D;  1TZY A;  3UTB A;  5AV8 A;  2ARO C;  3X1S A;  5B24 D;  3VH6 T;  1P34 C;  4J8U D;  3A6N A;  5DNN A;  3REK B;  1KX3 C;  5AVB D;  2ARO A;  1EQZ C;  3MGR D;  1P34 A;  2F8N H;  5B0Y B;  2F8N D;  1KX3 A;  3WAA D;  3AZI B;  4CAY A;  1N1J B;  5BNV B;  3AZJ D;  3WTP C;  3AFA C;  3AYW B;  1EQZ A;  1AOI B;  5JRG C;  5BS7 C;  3V9R A;  5FUG B;  1U35 C;  1H3O B;  2LY8 A;  4JJN B;  5B31 G;  2RVQ D;  5AV5 C;  3AZK C;  4J8V D;  1KX4 D;  3WTP A;  3AFA A;  5JA4 A;  5JRG A;  5BS7 A;  5B2J D;  1U35 A;  1P3I C;  4CSR B;  5GSU C;  2FJ7 D;  5BT1 C;  5AV5 A;  4M6B A;  3AZK A;  4LD9 C;  2YFV B;  3LZ1 B;  3MGQ D;  5CHL B;  4Z2M G;  1P3I A;  3AZN B;  5GSU A;  4XZQ B;  4KGC C;  1KX5 B;  5AY8 B;  4WU8 C;  1P3A D;  4LD9 A;  1WWS A;  3AV1 C;  3REH C;  3C1B C;  4G92 C;  3WKJ B;  4WU8 A;  4WU9 B;  5GXQ D;  4YS3 B;  3KXB B;  3AV1 A;  1P3B D;  3AZG D;  4Z66 D;  3C1B A;  3REH A;  5CPK D;  5CP6 D;  4J8X D;  2NQB D;  3VH5 W;  5B1L C;  5AVB B;  3LZ0 D;  1P3L D;  1B67 A;  5KDM A;  2HIO D;  3NQU B;  1ID3 D;  3MGR B;  3KSY A;  5G49 A;  1HTA A;  5B2I D;  2F8N B;  5B1L A;  3UTA C;  4G91 C;  3WAA B;  3AZJ B;  2L5A A;  3AZL D;  3MVD D;  3KWQ D;  4H9S C;  4WV4 B;  3AV2 C;  5CPJ D;  1P3K A;  3UTA A;  4J8W D;  2JSS A;  3VH6 A;  3REJ D;  1M18 D;  4J8V B;  3REK C;  1KX4 B;  2CV5 C;  4H9S A;  3AV2 A;  2FJ7 B;  3AZH C;  5B0Y C;  3REK A;  3MGQ B;  3B6G D;  3AZH A;  5B0Z D;  2F8N G;  5B0Y A;  4JJN C;  1P3A B;  3AZM B;  1N1J A;  3LEL D;  3AYW A;  4ZUX D;  5C3I B;  5FUG A;  4UUZ B;  1H3O A;  5AVC D;  4JJN A;  4X23 D;  1JFI B;  5GXQ B;  1P3B B;  3AZG B;  5GT3 D;  3LZ1 C;  4Z66 B;  5CPK B;  4J8X B;  1P3M D;  4CSR A;  3AZN C;  4XZQ C;  2NQB B;  3W99 D;  3LZ0 B;  2NZD D;  5AY8 C;  1P3L B;  2YFV A;  3LZ1 A;  5B32 C;  1ULY A;  2HIO B;  5B1M D;  1ID3 B;  3AZN A;  4KHA B;  4XZQ A;  3C1C D;  1P3F D;  5AY8 A;  5B40 B;  4WU9 C;  5B32 A;  4YS3 C;  3KXB C;  4DRA A;  1R4V A;  3AZL B;  3MGS D;  3X1V D;  3MVD B;  3KWQ B;  5CPJ B;  3WKJ A;  4J8W B;  3KUY D;  3REL C;  4WU9 A;  3REJ B;  4YS3 A;  3KXB A;  1M18 B;  5AVB C;  3R45 A;  3REL A;  1M19 D;  5AVB A;  3AZJ C;  3B6G B;  3NQU A;  3WA9 D;  3W96 D;  5B0Z B;  1P3G D;  2F8N A;  4QLC D;  5DNM D;  4J8V C;  3AZJ A;  3LEL B;  3B0C W;  1TZY D;  1KX4 C;  4ZUX B;  2PYO C;  3W97 D;  5AV9 D;  4R8P D;  4X23 B;  2FJ7 C;  3NQJ B;  4J8V A;  1KX4 A;  2PYO A;  5GT3 B;  4H9P B;  1P3M B;  3W98 D;  2FJ7 A;  1KX3 D;  3W99 B;  2NZD B;  3AZM C;  3MGQ A;  5B1M B;  5C3I C;  4XUJ C;  3UT9 D;  3C1C B;  3VH6 W;  5AV6 B;  1P3F B;  1BFM A;  3AZM A;  5GXQ C;  1P3B C;  3X1T D;  3MGP D;  4EO5 B;  3WTP D;  4XUJ A;  4Z66 C;  3MGS B;  3AN2 D;  3X1V B;  4UUZ A;  5CPK C;  5AV5 D;  3KUY B;  1JFI A;  2NQB C;  5GXQ A;  1P3B A;  3LZ0 C;  5B24 B;  3AZG A;  1P3L C;  4Z66 A;  2HIO C;  4J8U B;  5CPK A;  1ID3 C;  1P3I D;  3B6F D;  1HQ3 D;  5BT1 D;  2NQB A;  1M19 B;  5E5A D;  1BH9 B;  3LZ0 A;  1P3L A;  5B40 C;  3TU4 D;  2HIO A;  3WA9 B;  3REI D;  1ID3 A;  4KHA A;  3MVD C;  3KWQ C;  3W96 B;  1P3K C;  5CPJ C;  1P3G B;  5B31 C;  4KGC D;  4QLC B;  4J8W C;  5B40 A;  3REJ C;  1M18 C;  5DNM B;  1S32 D;  3W97 B;  3AZL A;  3MVD A;  3KWQ A;  5CPJ A;  5AV9 B;  5B31 A;  4R8P B;  5CPI D;  4J8W A;  3REJ A;  1M18 A;  5B2J B;  3LJA D;  1WWI A;  3B6G C;  3W98 B;  3X1U D;  5B0Z C;  5F99 D;  5GT0 D;  1KX3 B;  3AZI C;  3AYW C;  1AOI C;  4H9R B;  3B6G A;  3B0B A;  1P3P D;  5B0Z A;  3MNN D;  3UT9 B;  3UTA D;  4X23 C;  3AZI A;  2IO5 B;  5BNV A;  1AOI A;  3MGP B;  3X1T B;  3WTP B;  5JA4 B;  4ZUX A;  3AN2 B; 
#chains in the Genus database with same CATH topology
 3AV2 D;  4X23 A;  4Z5T D;  2CWE A;  4H9N B;  1F66 D;  3NQJ A;  4YM6 D;  3REK D;  3W99 C;  2NZD C;  2CV5 D;  4H9P A;  5CP6 B;  4H9O B;  5B33 D;  1TAF B;  1P3M A;  3B6F B;  1HQ3 B;  3AZH D;  1KX5 C;  5E5A B;  3C1C C;  1M1A D;  5AV6 C;  3W99 A;  1P3F C;  2NZD A;  3TU4 B;  1P3O D;  4EO5 C;  5B1M A;  3REI B;  4NE3 A;  3X1V C;  3MGS C;  5B2I B;  1KX5 A;  3WKJ C;  3C1C A;  4KGC B;  4JJN D;  5AV6 A;  3AZF D;  1P3F A;  2Y2J A;  1S32 B;  5B24 C;  3X1V A;  3MGS A;  4J8U C;  2HUE B;  5CPI B;  3KUY A;  1M19 C;  4KUD D;  5B24 A;  3LJA B;  3MGR C;  3AZE D;  4J8U A;  3WA9 C;  4ZBJ B;  3X1U B;  4WNN B;  5F99 B;  3WAA C;  5GT0 B;  4H9Q B;  1M19 A;  1ZLA D;  4QLC C;  5AY8 D;  5B32 D;  3MGR A;  5DNM C;  2BG1 A;  3WA9 A;  5BO0 B;  1P3P B;  2YFW B;  3MNN B;  3WAA A;  2RVQ C;  3A1K A;  4R8P C;  3UTA B;  4QLC A;  3O62 D;  5DNM A;  3UTB D;  5AV8 D;  2BYK B;  5B2J C;  3X1S D;  3W97 A;  5AVC B;  3A6N D;  5BNX B;  3AV2 B;  5AV9 A;  3W98 C;  4NE5 A;  4R8P A;  5DNN D;  4Z5T B;  3REL D;  1F66 B;  4YM6 B;  3EPJ A;  2Y2H A;  2ARO D;  5B2J A;  2CV5 B;  3MGQ C;  1B6W A;  1P34 D;  5B33 B;  3W98 A;  3AZH B;  1BH8 B;  3UT9 C;  2Y2Q A;  4NFT A;  1M1A B;  1P3A C;  2IO5 C;  1EQZ D;  1P3O B;  2Y2G A;  4H9R A;  3MGP C;  2ZM5 A;  3X1T C;  2ZY2 A;  3IP4 C;  3VH5 T;  3AN2 C;  2BYM B;  3UT9 A;  2F8N K;  1P3A A;  3AZF B;  3AFA D;  3AZG C;  2PYO D;  3MGP A;  5JRG D;  3X1T A;  3AN2 A;  5CP6 C;  2W8S A;  1U35 D;  4J8X C;  3AZK D;  3B6F C;  1HQ3 C;  4H9N A;  5E5A C;  4HGA B;  4KUD B;  5CP6 A;  3TU4 C;  3AZE B;  4J8X A;  4H9O A;  2G5I C;  5GSU D;  3REI C;  1TAF A;  3B6F A;  1HQ3 A;  5B2I C;  2Y2I A;  1F1E A;  5E5A A;  1ZLA B;  4LD9 D;  3AZM D;  4AWL B;  5B32 B;  3TU4 A;  1S32 C;  3AZL C;  3REI A;  4XUJ D;  4DRB A;  5B2I A;  2HUE C;  5CPI C;  2DF4 C;  4WU8 D;  4KGC A;  3O62 B;  3AV1 D;  1KU5 A;  1TZY B;  3UTB B;  3REH D;  5AV8 B;  3R45 B;  3B0D B;  3X1S B;  3C1B D;  1S32 A;  3LJA C;  2RIQ A;  3A6N B;  2ZY3 A;  5CPI A;  4ZBJ C;  5DNN B;  3X1U C;  3REL B;  5F99 C;  5GT0 C;  2ARO B;  1Q9C A;  3A1I A;  3LJA A;  1P34 B;  3X1U A;  1P3P C;  4WNN A;  5B1L D;  5F99 A;  5GT0 A;  3MNN C;  4H9Q A;  4WZS B;  4CAY B;  5B40 D;  5B32 G;  3LEL C;  1EQZ B;  4ZUX C;  3V9R B;  4E45 A;  5BO0 A;  1P3P A;  5AVC C;  2YFW A;  1P3K D;  3MNN A;  5B31 D;  3WTP E;  4Z5T C;  3LEL A;  3AFA B;  1F66 C;  4YM6 C;  5GT3 C;  2PYO B;  5JRG B;  2BYK A;  1U35 B;  5AVC A;  1P3M C;  5BNX A;  5B33 C;  5AV5 B;  3AZK B;  4Z5T A;  4E44 A;  1F66 A;  4YM6 A;  5GT3 A;  4DQY B;  1M1A C;  2ZY4 A;  2CV5 A;  4Z2M H;  5B1M C;  1P3O C;  1P3I B;  5GSU B;  5B33 A;  5B0Y D;  1BH8 A;  4LD9 B;  1M1A A;  3AZI D;  3AZF C;  3VH5 A;  2XD1 A;  3AYW D;  1P3O A;  1AOI D;  2ZY5 A;  4XUJ B;  2BYM A;  3KUY C;  4WU8 B;  4NE6 A;  3AZF A;  3AV1 B;  4HGA C;  3REH B;  3C1B B;  4KUD C;  4G92 B;  3AZE C;  3B0C T;  1ZLA C;  3LZ1 D;  4KUD A;  5KDM B;  4AWL C;  3AZE A;  5G49 B;  3H0R C;  3AZN D;  3W96 C;  4XZQ D;  1P3G C;  1BH9 A;  1KX5 D;  5B1L B;  1ZLA A;  5AV6 D;  1A7W A;  3O62 C;  1TZY C;  3W97 C;  3UTB C;  5AV8 C;  3X1S C;  3B0D C;  3W96 A;  4WJ3 C;  1P3G A;  5AV9 C;  1P3K B;  3A6N C;  4G91 B;  3WKJ D;  5B31 B;  4WU9 D;  5DNN C;  4YS3 D;  3O62 A;  3KXB D;  1TZY A;  3UTB A;  5AV8 A;  2ARO C;  3X1S A;  5B24 D;  3VH6 T;  3P5J B;  1P34 C;  4J8U D;  3A6N A;  5DNN A;  3REK B;  1KX3 C;  5AVB D;  2XD5 A;  2ARO A;  1EQZ C;  3MGR D;  1P34 A;  2F8N H;  2FFF B;  5B0Y B;  2F8N D;  1KX3 A;  3WAA D;  3AZI B;  2Y2N A;  1N1J B;  4CAY A;  5BNV B;  3AZJ D;  3WTP C;  3AFA C;  3AYW B;  1EQZ A;  1AOI B;  3H0M C;  5JRG C;  5BS7 C;  3V9R A;  5FUG B;  1U35 C;  1H3O B;  2LY8 A;  4JJN B;  5B31 G;  2RVQ D;  5AV5 C;  3AZK C;  4J8V D;  1KX4 D;  3WTP A;  3AFA A;  5JA4 A;  5JRG A;  5BS7 A;  5B2J D;  1U35 A;  1P3I C;  4CSR B;  5GSU C;  2FJ7 D;  5BT1 C;  5AV5 A;  4M6B A;  3AZK A;  4LD9 C;  2YFV B;  3LZ1 B;  3MGQ D;  5CHL B;  4Z2M G;  1P3I A;  3AZN B;  5GSU A;  4XZQ B;  4KGC C;  1KX5 B;  5AY8 B;  4WU8 C;  1P3A D;  4LD9 A;  1WWS A;  3AV1 C;  3REH C;  3C1B C;  4G92 C;  3WKJ B;  1W2E A;  4WU8 A;  4WU9 B;  5GXQ D;  4YS3 B;  3KXB B;  3AV1 A;  1P3B D;  3AZG D;  4Z66 D;  3C1B A;  3REH A;  5CPK D;  5CP6 D;  3EPH A;  4J8X D;  2NQB D;  3VH5 W;  5B1L C;  5AVB B;  3LZ0 D;  1P3L D;  1B67 A;  5KDM A;  2HIO D;  2UWX A;  3NQU B;  1ID3 D;  3MGR B;  3KSY A;  5G49 A;  1HTA A;  2Y2K A;  5B2I D;  2F8N B;  5B1L A;  3UTA C;  4G91 C;  3WAA B;  3AZJ B;  2L5A A;  3AZL D;  3MVD D;  3KWQ D;  4H9S C;  4WV4 B;  3AV2 C;  5CPJ D;  1P3K A;  3UTA A;  4J8W D;  2JSS A;  3EG5 B;  3VH6 A;  3REJ D;  1M18 D;  4J8V B;  3REK C;  1KX4 B;  2CV5 C;  2DQN C;  4H9S A;  3AV2 A;  2FJ7 B;  3AZH C;  5B0Y C;  3REK A;  3MGQ B;  3AL0 C;  3B6G D;  3AZH A;  5B0Z D;  2F8N G;  5B0Y A;  4JJN C;  1P3A B;  3AZM B;  1N1J A;  3LEL D;  3AYW A;  4ZUX D;  5C3I B;  5FUG A;  4UUZ B;  1H3O A;  5AVC D;  4JJN A;  4X23 D;  1JFI B;  5GXQ B;  1P3B B;  3AZG B;  5GT3 D;  3LZ1 C;  4Z66 B;  5CPK B;  4J8X B;  1P3M D;  4CSR A;  3AZN C;  4XZQ C;  2NQB B;  3W99 D;  3LZ0 B;  2NZD D;  5AY8 C;  1P3L B;  2YFV A;  3LZ1 A;  5B32 C;  1ULY A;  2HIO B;  5B1M D;  1ID3 B;  3AZN A;  4KHA B;  4XZQ A;  3C1C D;  1P3F D;  5AY8 A;  5B40 B;  4WU9 C;  2Y2L A;  5B32 A;  4YS3 C;  3KXB C;  4DRA A;  1R4V A;  3AZL B;  3MGS D;  3X1V D;  3MVD B;  3KWQ B;  2F2A C;  5CPJ B;  3WKJ A;  4J8W B;  3KUY D;  3REL C;  4WU9 A;  3REJ B;  4YS3 A;  3KXB A;  1M18 B;  5AVB C;  3R45 A;  3REL A;  3F6T A;  1M19 D;  5AVB A;  3AZJ C;  3B6G B;  3NQU A;  3WA9 D;  3W96 D;  5B0Z B;  1P3G D;  2F8N A;  4QLC D;  2Y2M A;  5DNM D;  4J8V C;  3AZJ A;  3LEL B;  3B0C W;  1TZY D;  1KX4 C;  4ZUX B;  2PYO C;  3W97 D;  4UPK A;  5AV9 D;  4R8P D;  3H0L C;  4X23 B;  2FJ7 C;  2VQR A;  3NQJ B;  4J8V A;  1KX4 A;  2PYO A;  5GT3 B;  4H9P B;  1P3M B;  3W98 D;  2FJ7 A;  1KX3 D;  3W99 B;  2NZD B;  3AZM C;  3MGQ A;  5B1M B;  5C3I C;  4XUJ C;  3UT9 D;  3C1C B;  3VH6 W;  5AV6 B;  1P3F B;  1BFM A;  3AZM A;  5GXQ C;  1P3B C;  3X1T D;  3MGP D;  4EO5 B;  3WTP D;  4XUJ A;  4Z66 C;  3MGS B;  3AN2 D;  3X1V B;  4UUZ A;  5CPK C;  5AV5 D;  3KUY B;  1JFI A;  2NQB C;  5GXQ A;  1P3B A;  3LZ0 C;  5B24 B;  3AZG A;  1P3L C;  4Z66 A;  2HIO C;  4J8U B;  5CPK A;  1ID3 C;  1P3I D;  3B6F D;  1HQ3 D;  5BT1 D;  2NQB A;  1M19 B;  5E5A D;  1BH9 B;  3LZ0 A;  1P3L A;  1T3U A;  1PZR A;  5B40 C;  2J8P A;  3TU4 D;  2HIO A;  3WA9 B;  3REI D;  1ID3 A;  4KHA A;  3MVD C;  3KWQ C;  3EPL A;  1P3K C;  3W96 B;  5CPJ C;  1P3G B;  5B31 C;  4KGC D;  4QLC B;  4J8W C;  5B40 A;  2Y2O A;  3REJ C;  1M18 C;  5DNM B;  1S32 D;  2Y2P A;  3W97 B;  1Z2C B;  3AZL A;  3MVD A;  3KWQ A;  5CPJ A;  5AV9 B;  5B31 A;  4R8P B;  5CPI D;  4J8W A;  3FDD A;  3REJ A;  1M18 A;  5B2J B;  3LJA D;  1WWI A;  3B6G C;  3W98 B;  3X1U D;  5B0Z C;  5F99 D;  5GT0 D;  3KFU G;  1KX3 B;  3AZI C;  2JE5 A;  3AYW C;  1AOI C;  4H9R B;  3B6G A;  3B0B A;  1P3P D;  5B0Z A;  3MNN D;  3EPK A;  3UT9 B;  3UTA D;  4X23 C;  3AZI A;  2IO5 B;  5BNV A;  1AOI A;  2JCH A;  3MGP B;  3WTP B;  3X1T B;  5JA4 B;  2G5H C;  4ZUX A;  3AN2 B; 
#chains in the Genus database with same CATH homology
 3AV2 D;  4X23 A;  4Z5T D;  2CWE A;  4H9N B;  1F66 D;  3NQJ A;  4YM6 D;  3REK D;  3W99 C;  2NZD C;  2CV5 D;  4H9P A;  5CP6 B;  4H9O B;  5B33 D;  1TAF B;  1P3M A;  3B6F B;  1HQ3 B;  3AZH D;  1KX5 C;  5E5A B;  3C1C C;  1M1A D;  5AV6 C;  3W99 A;  1P3F C;  2NZD A;  3TU4 B;  1P3O D;  4EO5 C;  5B1M A;  3REI B;  4NE3 A;  3X1V C;  3MGS C;  5B2I B;  1KX5 A;  3WKJ C;  3C1C A;  4KGC B;  4JJN D;  5AV6 A;  3AZF D;  1P3F A;  2Y2J A;  1S32 B;  5B24 C;  3X1V A;  3MGS A;  4J8U C;  2HUE B;  5CPI B;  3KUY A;  1M19 C;  4KUD D;  5B24 A;  3LJA B;  3MGR C;  3AZE D;  4J8U A;  3WA9 C;  4ZBJ B;  3X1U B;  4WNN B;  5F99 B;  3WAA C;  5GT0 B;  4H9Q B;  1M19 A;  1ZLA D;  4QLC C;  5AY8 D;  5B32 D;  3MGR A;  5DNM C;  2BG1 A;  3WA9 A;  5BO0 B;  1P3P B;  2YFW B;  3MNN B;  3WAA A;  2RVQ C;  3A1K A;  4R8P C;  3UTA B;  4QLC A;  3O62 D;  5DNM A;  3UTB D;  5AV8 D;  2BYK B;  5B2J C;  3X1S D;  3W97 A;  5AVC B;  3A6N D;  5BNX B;  3AV2 B;  5AV9 A;  3W98 C;  4NE5 A;  4R8P A;  5DNN D;  4Z5T B;  3REL D;  1F66 B;  4YM6 B;  3EPJ A;  2Y2H A;  2ARO D;  5B2J A;  2CV5 B;  3MGQ C;  1B6W A;  1P34 D;  5B33 B;  3W98 A;  3AZH B;  1BH8 B;  3UT9 C;  2Y2Q A;  4NFT A;  1M1A B;  1P3A C;  2IO5 C;  1EQZ D;  1P3O B;  2Y2G A;  4H9R A;  3MGP C;  2ZM5 A;  3X1T C;  2ZY2 A;  3IP4 C;  3VH5 T;  3AN2 C;  2BYM B;  3UT9 A;  2F8N K;  1P3A A;  3AZF B;  3AFA D;  3AZG C;  2PYO D;  3MGP A;  5JRG D;  3X1T A;  3AN2 A;  5CP6 C;  2W8S A;  1U35 D;  4J8X C;  3AZK D;  3B6F C;  1HQ3 C;  4H9N A;  5E5A C;  4HGA B;  4KUD B;  5CP6 A;  3TU4 C;  3AZE B;  4J8X A;  4H9O A;  2G5I C;  5GSU D;  3REI C;  1TAF A;  3B6F A;  1HQ3 A;  5B2I C;  2Y2I A;  1F1E A;  5E5A A;  1ZLA B;  4LD9 D;  3AZM D;  4AWL B;  5B32 B;  3TU4 A;  1S32 C;  3AZL C;  3REI A;  4XUJ D;  4DRB A;  5B2I A;  2HUE C;  5CPI C;  2DF4 C;  4WU8 D;  4KGC A;  3O62 B;  3AV1 D;  1KU5 A;  1TZY B;  3UTB B;  3REH D;  5AV8 B;  3R45 B;  3B0D B;  3X1S B;  3C1B D;  1S32 A;  3LJA C;  2RIQ A;  3A6N B;  2ZY3 A;  5CPI A;  4ZBJ C;  5DNN B;  3X1U C;  3REL B;  5F99 C;  5GT0 C;  2ARO B;  1Q9C A;  3A1I A;  3LJA A;  1P34 B;  3X1U A;  1P3P C;  4WNN A;  5B1L D;  5F99 A;  5GT0 A;  3MNN C;  4H9Q A;  4WZS B;  4CAY B;  5B40 D;  5B32 G;  3LEL C;  1EQZ B;  4ZUX C;  3V9R B;  4E45 A;  5BO0 A;  1P3P A;  5AVC C;  2YFW A;  1P3K D;  3MNN A;  5B31 D;  3WTP E;  4Z5T C;  3LEL A;  3AFA B;  1F66 C;  4YM6 C;  5GT3 C;  2PYO B;  5JRG B;  2BYK A;  1U35 B;  5AVC A;  1P3M C;  5BNX A;  5B33 C;  5AV5 B;  3AZK B;  4Z5T A;  4E44 A;  1F66 A;  4YM6 A;  5GT3 A;  4DQY B;  1M1A C;  2ZY4 A;  2CV5 A;  4Z2M H;  5B1M C;  1P3O C;  1P3I B;  5GSU B;  5B33 A;  5B0Y D;  1BH8 A;  4LD9 B;  1M1A A;  3AZI D;  3AZF C;  3VH5 A;  2XD1 A;  3AYW D;  1P3O A;  1AOI D;  2ZY5 A;  4XUJ B;  2BYM A;  3KUY C;  4WU8 B;  4NE6 A;  3AZF A;  3AV1 B;  4HGA C;  3REH B;  3C1B B;  4KUD C;  4G92 B;  3AZE C;  3B0C T;  1ZLA C;  3LZ1 D;  4KUD A;  5KDM B;  4AWL C;  3AZE A;  5G49 B;  3H0R C;  3AZN D;  3W96 C;  4XZQ D;  1P3G C;  1BH9 A;  1KX5 D;  5B1L B;  1ZLA A;  5AV6 D;  1A7W A;  3O62 C;  1TZY C;  3W97 C;  3UTB C;  5AV8 C;  3X1S C;  3B0D C;  3W96 A;  4WJ3 C;  1P3G A;  5AV9 C;  1P3K B;  3A6N C;  4G91 B;  3WKJ D;  5B31 B;  4WU9 D;  5DNN C;  4YS3 D;  3O62 A;  3KXB D;  1TZY A;  3UTB A;  5AV8 A;  2ARO C;  3X1S A;  5B24 D;  3VH6 T;  3P5J B;  1P34 C;  4J8U D;  3A6N A;  5DNN A;  3REK B;  1KX3 C;  5AVB D;  2XD5 A;  2ARO A;  1EQZ C;  3MGR D;  1P34 A;  2F8N H;  2FFF B;  5B0Y B;  2F8N D;  1KX3 A;  3WAA D;  3AZI B;  2Y2N A;  1N1J B;  4CAY A;  5BNV B;  3AZJ D;  3WTP C;  3AFA C;  3AYW B;  1EQZ A;  1AOI B;  3H0M C;  5JRG C;  5BS7 C;  3V9R A;  5FUG B;  1U35 C;  1H3O B;  2LY8 A;  4JJN B;  5B31 G;  2RVQ D;  5AV5 C;  3AZK C;  4J8V D;  1KX4 D;  3WTP A;  3AFA A;  5JA4 A;  5JRG A;  5BS7 A;  5B2J D;  1U35 A;  1P3I C;  4CSR B;  5GSU C;  2FJ7 D;  5BT1 C;  5AV5 A;  4M6B A;  3AZK A;  4LD9 C;  2YFV B;  3LZ1 B;  3MGQ D;  5CHL B;  4Z2M G;  1P3I A;  3AZN B;  5GSU A;  4XZQ B;  4KGC C;  1KX5 B;  5AY8 B;  4WU8 C;  1P3A D;  4LD9 A;  1WWS A;  3AV1 C;  3REH C;  3C1B C;  4G92 C;  3WKJ B;  1W2E A;  4WU8 A;  4WU9 B;  5GXQ D;  4YS3 B;  3KXB B;  3AV1 A;  1P3B D;  3AZG D;  4Z66 D;  3C1B A;  3REH A;  5CPK D;  5CP6 D;  3EPH A;  4J8X D;  2NQB D;  3VH5 W;  5B1L C;  5AVB B;  3LZ0 D;  1P3L D;  1B67 A;  5KDM A;  2HIO D;  2UWX A;  3NQU B;  1ID3 D;  3MGR B;  3KSY A;  5G49 A;  1HTA A;  2Y2K A;  5B2I D;  2F8N B;  5B1L A;  3UTA C;  4G91 C;  3WAA B;  3AZJ B;  2L5A A;  3AZL D;  3MVD D;  3KWQ D;  4H9S C;  4WV4 B;  3AV2 C;  5CPJ D;  1P3K A;  3UTA A;  4J8W D;  2JSS A;  3EG5 B;  3VH6 A;  3REJ D;  1M18 D;  4J8V B;  3REK C;  1KX4 B;  2CV5 C;  2DQN C;  4H9S A;  3AV2 A;  2FJ7 B;  3AZH C;  5B0Y C;  3REK A;  3MGQ B;  3AL0 C;  3B6G D;  3AZH A;  5B0Z D;  2F8N G;  5B0Y A;  4JJN C;  1P3A B;  3AZM B;  1N1J A;  3LEL D;  3AYW A;  4ZUX D;  5C3I B;  5FUG A;  4UUZ B;  1H3O A;  5AVC D;  4JJN A;  4X23 D;  1JFI B;  5GXQ B;  1P3B B;  3AZG B;  5GT3 D;  3LZ1 C;  4Z66 B;  5CPK B;  4J8X B;  1P3M D;  4CSR A;  3AZN C;  4XZQ C;  2NQB B;  3W99 D;  3LZ0 B;  2NZD D;  5AY8 C;  1P3L B;  2YFV A;  3LZ1 A;  5B32 C;  1ULY A;  2HIO B;  5B1M D;  1ID3 B;  3AZN A;  4KHA B;  4XZQ A;  3C1C D;  1P3F D;  5AY8 A;  5B40 B;  4WU9 C;  2Y2L A;  5B32 A;  4YS3 C;  3KXB C;  4DRA A;  1R4V A;  3AZL B;  3MGS D;  3X1V D;  3MVD B;  3KWQ B;  2F2A C;  5CPJ B;  3WKJ A;  4J8W B;  3KUY D;  3REL C;  4WU9 A;  3REJ B;  4YS3 A;  3KXB A;  1M18 B;  5AVB C;  3R45 A;  3REL A;  3F6T A;  1M19 D;  5AVB A;  3AZJ C;  3B6G B;  3NQU A;  3WA9 D;  3W96 D;  5B0Z B;  1P3G D;  2F8N A;  4QLC D;  2Y2M A;  5DNM D;  4J8V C;  3AZJ A;  3LEL B;  3B0C W;  1TZY D;  1KX4 C;  4ZUX B;  2PYO C;  3W97 D;  4UPK A;  5AV9 D;  4R8P D;  3H0L C;  4X23 B;  2FJ7 C;  2VQR A;  3NQJ B;  4J8V A;  1KX4 A;  2PYO A;  5GT3 B;  4H9P B;  1P3M B;  3W98 D;  2FJ7 A;  1KX3 D;  3W99 B;  2NZD B;  3AZM C;  3MGQ A;  5B1M B;  5C3I C;  4XUJ C;  3UT9 D;  3C1C B;  3VH6 W;  5AV6 B;  1P3F B;  1BFM A;  3AZM A;  5GXQ C;  1P3B C;  3X1T D;  3MGP D;  4EO5 B;  3WTP D;  4XUJ A;  4Z66 C;  3MGS B;  3AN2 D;  3X1V B;  4UUZ A;  5CPK C;  5AV5 D;  3KUY B;  1JFI A;  2NQB C;  5GXQ A;  1P3B A;  3LZ0 C;  5B24 B;  3AZG A;  1P3L C;  4Z66 A;  2HIO C;  4J8U B;  5CPK A;  1ID3 C;  1P3I D;  3B6F D;  1HQ3 D;  5BT1 D;  2NQB A;  1M19 B;  5E5A D;  1BH9 B;  3LZ0 A;  1P3L A;  1T3U A;  1PZR A;  5B40 C;  2J8P A;  3TU4 D;  2HIO A;  3WA9 B;  3REI D;  1ID3 A;  4KHA A;  3MVD C;  3KWQ C;  3EPL A;  1P3K C;  3W96 B;  5CPJ C;  1P3G B;  5B31 C;  4KGC D;  4QLC B;  4J8W C;  5B40 A;  2Y2O A;  3REJ C;  1M18 C;  5DNM B;  1S32 D;  2Y2P A;  3W97 B;  1Z2C B;  3AZL A;  3MVD A;  3KWQ A;  5CPJ A;  5AV9 B;  5B31 A;  4R8P B;  5CPI D;  4J8W A;  3FDD A;  3REJ A;  1M18 A;  5B2J B;  3LJA D;  1WWI A;  3B6G C;  3W98 B;  3X1U D;  5B0Z C;  5F99 D;  5GT0 D;  3KFU G;  1KX3 B;  3AZI C;  2JE5 A;  3AYW C;  1AOI C;  4H9R B;  3B6G A;  3B0B A;  1P3P D;  5B0Z A;  3MNN D;  3EPK A;  3UT9 B;  3UTA D;  4X23 C;  3AZI A;  2IO5 B;  5BNV A;  1AOI A;  2JCH A;  3MGP B;  3WTP B;  3X1T B;  5JA4 B;  2G5H C;  4ZUX A;  3AN2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...