2NQBA

Drosophila nucleosome structure
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords alpha-satellite DNA
publication title Comparative analysis of nucleosome structures from different species.
rcsb
source organism Homo sapiens
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nqbA00
5GXQB 4M6BA 1M1AB 5AY8C 3REHD 2CV5D 1P3AA 2F8NG 1U35D 1S32C 5F99C 4ZBJB 3UT9B 2HUEC 3X1UB 3A6NC 5B1LC 5JA4A 3AZHB 4LD9A 3KXBA 5AV8B 4Z2MG 5CPIB 4X23B 1KX5D 1TZYD 3AFAD 5GT0B 4H9RB 2AROB 5B33D 3W96C 3WTPB 3RELD 3TU4B 3KWQB 2BYMB 4JJND 3AZFD 1P3FD 3UTAB 3MNNB 4XUJC 1P3OD 5GT3B 4WNNA 1BH9B 3LELA 2NZDA 4CSRB 4J8VD 3AZND 4KGCA 2NQBB 4WU9D 5DNNC 3NQUB 1ZLAA 4Z5TA 5B32A 3AZMA 3B6GD 1TAFB 4R8PC 4Z66C 2HIOD 3AZID 3AZLB 5CPKA 2CV5B 1U35B 5DNMB 2F8ND 4KHAA 5B40A 2CWEA 3B0BA 1ID3C 5BT1D 5B31C 5B32G 5FUGB 1P3AD 4KUDC 5B1MC 5GXQA 1M1AA 1KX5B 1TZYB 4G91C 3X1VB 4LD9D 4G92C 3KXBD 1P3PD 3AZHA 4JJNB 1M19C 3AZFB 3AZEC 3MGPB 1P3FB 5CPIA 1P3OB 4X23A 5AVBB 3W99B 5B2JC 5GT0A 4H9RA 1P3KC 1HQ3A 5AVCD 4E44A 3TU4A 5AV5C 3KWQA 2BYMA 4WU9B 3B6GB 4WU8B 5C3IB 3MNNA 4NE3A 3AZIB 3W98C 3LELD 2NZDD 3B6FC 3AZKC 4KGCD 1BH9A 1ZLAD 2IO5C 4Z5TD 4CSRA 5B32D 3AZMD 2PYOC 3MGSA 2LY8A 5GSUB 2NQBA 1P3AB 2FJ7D 3B0DC 1TAFA 3AZLA 1P3GC 1P3BB 5AV6C 5CPJA 1P3LB 3KUYC 5DNMA 1U35A 4LD9B 3KXBB 1P3PB 1S32A 4HGAB 5GXQD 4G92B 3X1SC 1M1AD 3MGQC 1B67A 5B1LA 1AOIB 4UUZB 3REIC 3C1BC 4QLCC 3AZHD 3X1VA 5AVCB 1WWSA 5CPID 4JJNA 1P3MC 4WV4B 3MGPA 1KX3C 1BFMA 5GT0D 4WNNB 1P3OA 3WA9B 1HQ3D 2NZDB 3W99A 5AVBA 4J8WC 3KWQD 5BNVB 4KGCB 3AYWC 4Z5TB 5B32B 2PYOB 4WU8A 2FJ7B 3AZIA 1KX4C 1M18C 4Z66A 3MGSD 5B0ZC 3C1CC 1ID3A 3VH5W 5GSUA 4ZUXC 3AZLD 5B31A 3LJAC 5CPJD 5DNMD 5AY8D 4XZQC 3AZGC 1P3BA 1ULYA 1P3LA 1S32D 3X1TB 3REKC 5B31G 3A6ND 1P3PA 5B1LD 5B0YC 3MVDC 2YFVB 3AZEA 3X1VD 1AOIA 4UUZA 1HQ3B 4J8UC 3REHC 1EQZC 4E45A 3AV2B 5AVCA 3MGPD 3KSYA 4YS3B 1P3KA 3LZ0C 4CAYA 3W99D 5AVBD 2F8NK 3WA9A 5CHLB 3MGSB 5AV9B 3W98A 5BNVA 3AFAC 1ID3D 3MGRC 3B6FA 3AZKA 5B33C 4WU8D 3AN2C 3REJC 3RELC 5CPJB 2PYOA 2FJ7A 5AY8B 5B24C 4Z66D 5CP6C 5KDMA 1S32B 1F66C 5F99B 1P34C 3VH5A 4J8XC 2HUEB 3A6NB 5GSUD 5AV6A 3UTBC 5B1LB 5B31D 3AZGB 3KUYA 2F8NH 3O62C 4J8VC 1P3BD 4KUDD 3AZNC 1P3LD 4Z2MH 5BNXA 1H3OB 2HIOC 1P3IC 5E5AC 3X1TA 3REIA 3W96B 4QLCA 1M19D 3AZED 1AOID 4H9PA 2YFVA 4XUJB 3AZJC 3AV1C 1P3KD 5JRGC 5B2IC 3AV2A 4YS3A 5DNNB 3AYWA 3WA9D 3VH6A 4Z66B 4R8PB 3W98D 3B6FD 5BS7C 3AZKD 4EO5C 5BO0A 1ID3B 5AV9A 3R45B 5B31B 2PYOD 3WKJC 4KUDB 5B1MB 3W97C 5AY8A 4ZUXA 4WZSB 5AV6D 4H9OB 3LJAA 3KUYD 4G91B 5F99A 3LELC 4DRBA 3A6NA 3AZGA 1JFIB 4DRAA 3LZ1C 3REKA 1M19B 3AZEB 3MGQD 1ZLAC 3AZMC 3WAAC 4NE5A 2YFWB 1R4VA 4YM6C 5CPKC 3X1TD 3REID 1KU5A 5B40C 5B2JB 3C1BD 1H3OA 3MVDA 4QLCD 1P3KB 4J8UA 3W96A 4CAYB 1EQZA 5AV5B 3B0CW 5B2IB 2RVQC 5GXQC 2BYKA 3LZ0A 4XUJA 3W98B 3AV2D 3B6FB 3AZKB 4ZBJC 4YS3D 3UT9C 3X1UC 4AWLC 3AZHC 3AYWD 1A7WA 2IO5B 3V9RB 5AV8C 5KDMB 5DNNA 3MGRA 3AN2A 3REJA 4X23C 3B0DB 4R8PA 1P3GB 5AV9D 5AV6B 1KX4D 5GT0C 3KUYB 2AROC 5B24A 5B0ZD 3WTPC 3R45A 3TU4C 3KWQC 3C1CD 1F66A 3X1SB 3MGQB 4J8XA 3UTBA 5BNXB 4ZUXD 3LJAD 3LZ1B 3UTAC 4KUDA 3O62A 5B1MA 3MNNC 5F99D 3REIB 3WAAB 4XZQD 3AZGD 3C1BB 5GT3C 4H9OA 4QLCB 3VH5T 3REKD 1JFIA 1P3IA 4H9PB 2NQBC 1P3MB 1M19A 1KX3B 3MVDD 3AZLC 2CV5C 2YFWA 1U35C 5DNMC 4J8UD 3W96D 5B2JA 4J8WB 1EQZD 1Q9CA 3AZJA 3AYWB 3AV1A 5JRGA 5AV5A 3LZ0D 4AWLB 5B2IA 4XUJD 4H9SC 4H9NB 1WWIA 3VH6W 5BO0B 1KX5C 1BH8B 1TZYC 1M18B 1KX4B 3X1VC 5B0ZB 5DNND 3MGRD 5BS7A 3C1CB 4JJNC 3AZFC 3V9RA 3AN2D 3REJD 3MGPC 1P3FC 4R8PD 4ZUXB 3LJAB 3VH6T 1P3OC 5B24D 3W99C 5AVBC 4XZQB 5CP6D 1P3GA 3WKJA 3W97A 1F66D 1P34D 3REKB 3NQJB 4J8XD 3UTBD 5B0YB 3O62D 5B1MD 4WU9C 3X1SA 3MGQA 3B6GC 4WU8C 3LZ1A 5C3IC 3MVDB 3AZIC 4J8UB 3WAAA 3C1BA 3REHB 1EQZB 5BT1C 1N1JA 2JSSA 5E5AD 4YM6A 1P3ID 2BYKB 5GSUC 3LZ0B 1P3MA 1P3AC 1KX3A 5B2JD 5G49A 1P3BC 3AZJD 1P3LC 4LD9C 3AV1D 3KXBC 4J8WA 5JRGD 5AV5D 1P3PC 3AFAB 5B2ID 3MGRB 4HGAC 5B33B 3UT9A 3AN2B 3REJB 3X1UA 3RELB 4H9NA 1AOIC 1B6WA 5B24B 5AV8A 5CP6B 1BH8A 1M18A 1KX4A 1F66B 1P34B 5AVCC 3UTBB 4J8XB 5B0ZA 4H9QB 2AROA 3O62B 3C1CA 4J8VB 3WTPA 3WKJD 1P3GD 3AZNB 3W97D 3WA9C 2L5AA 2NZDC 4NE6A 4XZQA 3UTAA 2HIOB 1P3IB 4KGCC 5E5AB 3X1SD 2F8NB 3NQJA 4Z5TC 5B32C 5GT3A 3LZ1D 5B0YA 1F1EA 3WAAD 2FJ7C 1HTAA 4YM6D 3NQUA 5CPKD 3AZJB 3AV1B 5B40D 3REHA 2CV5A 5JRGB 5JA4B 1P3MD 1KX3D 1M1AC 2RVQD 3WTPE 5FUGA 4J8WD 4H9SA 3X1TC 3B0CT 3UT9D 4EO5B 3X1UD 1KX5A 1TZYA 3AFAA 5CPIC 5B33A 5AV8D 3RELA 3WKJB 1M18D 3AZFA 3W97B 1HQ3C 4X23D 1P3FA 5CP6A 2AROD 1P34A 3LELB 3AV2C 3WTPD 4YS3C 3TU4D 4H9QA 1ZLAB 3AZMB 4J8VA 3UTAD 3AZNA 3MNND 1N1JB 4YM6B 4WU9A 5CPKB 3B6GA 4KHAB 5B40B 5GT3D 3MGSC 2HIOA 5AV9C 5B0YD 5E5AA 4NFTA 2F8NA 2NQBD 5G49B 5CPJC
chains in the Genus database with same CATH superfamily
5GXQB 4M6BA 1M1AB 5AY8C 3REHD 2CV5D 1P3AA 2F8NG 1U35D 1S32C 5F99C 4ZBJB 3UT9B 2HUEC 3X1UB 3A6NC 5B1LC 5JA4A 3AZHB 4LD9A 3KXBA 5AV8B 4Z2MG 5CPIB 2Y2IA 4X23B 1KX5D 1TZYD 3AFAD 5GT0B 4H9RB 4UPKA 2AROB 5B33D 3W96C 3WTPB 3RELD 3TU4B 3KWQB 2BYMB 4JJND 3AZFD 1P3FD 3UTAB 3MNNB 4XUJC 1P3OD 1Z2CB 5GT3B 4WNNA 1BH9B 1W2EA 3LELA 2NZDA 4CSRB 4J8VD 3AZND 4KGCA 2NQBB 4WU9D 5DNNC 3NQUB 1ZLAA 4Z5TA 5B32A 3AZMA 3B6GD 1TAFB 4R8PC 4Z66C 2HIOD 3AZID 3AZLB 5CPKA 2CV5B 1U35B 5DNMB 2F8ND 4KHAA 5B40A 2CWEA 3B0BA 1ID3C 5BT1D 5B31C 5B32G 5FUGB 1P3AD 4KUDC 5B1MC 5GXQA 1M1AA 3EG5B 1KX5B 1TZYB 4G91C 3X1VB 4LD9D 4G92C 3KXBD 3KFUG 1P3PD 3AZHA 4JJNB 1M19C 3AZFB 3AZEC 3MGPB 1P3FB 5CPIA 1P3OB 2ZY2A 4X23A 5AVBB 3W99B 5B2JC 5GT0A 4H9RA 1P3KC 1HQ3A 5AVCD 4E44A 3TU4A 2Y2QA 5AV5C 3KWQA 2BYMA 4WU9B 3B6GB 4WU8B 5C3IB 3MNNA 4NE3A 3AZIB 3W98C 3LELD 2NZDD 3B6FC 3AZKC 4KGCD 1BH9A 1ZLAD 2IO5C 4Z5TD 4CSRA 5B32D 3AZMD 2PYOC 3MGSA 2LY8A 5GSUB 2JE5A 2NQBA 1P3AB 2FJ7D 3B0DC 1TAFA 3AZLA 1P3GC 1P3BB 5AV6C 5CPJA 1P3LB 3KUYC 5DNMA 1U35A 4LD9B 3KXBB 1P3PB 1S32A 4HGAB 5GXQD 2UWXA 4G92B 3X1SC 3MGQC 1M1AD 1B67A 5B1LA 1AOIB 4UUZB 3REIC 1T3UA 3C1BC 4QLCC 3AZHD 2XD1A 3X1VA 5AVCB 1WWSA 5CPID 4JJNA 1P3MC 4WV4B 3MGPA 1KX3C 1BFMA 2XD5A 5GT0D 4WNNB 1P3OA 3WA9B 1HQ3D 2NZDB 3W99A 5AVBA 4J8WC 3KWQD 5BNVB 4KGCB 3AYWC 4Z5TB 5B32B 2PYOB 4WU8A 2FJ7B 3AZIA 2ZY5A 1KX4C 1M18C 4Z66A 3MGSD 5B0ZC 3C1CC 1ID3A 3VH5W 5GSUA 4ZUXC 3AZLD 5B31A 3LJAC 5CPJD 5DNMD 5AY8D 4XZQC 3AZGC 1P3BA 1ULYA 1P3LA 1S32D 3X1TB 3REKC 3EPLA 5B31G 3A6ND 1P3PA 5B1LD 2DQNC 5B0YC 3MVDC 2YFVB 3AZEA 3X1VD 1AOIA 4UUZA 1HQ3B 4J8UC 3REHC 1EQZC 4E45A 3AV2B 5AVCA 2VQRA 3MGPD 3KSYA 4YS3B 1P3KA 3LZ0C 4CAYA 3W99D 5AVBD 2F8NK 3WA9A 5CHLB 3MGSB 5AV9B 3W98A 5BNVA 3AFAC 1ID3D 3MGRC 3B6FA 3AZKA 5B33C 4WU8D 3AN2C 3REJC 3RELC 5CPJB 2PYOA 2FJ7A 5AY8B 5B24C 4Z66D 5CP6C 5KDMA 1S32B 1F66C 5F99B 1P34C 3VH5A 4J8XC 2HUEB 3A6NB 5GSUD 5AV6A 3UTBC 5B1LB 5B31D 3AZGB 3KUYA 2F8NH 3O62C 4J8VC 1P3BD 4KUDD 3AZNC 1P3LD 4Z2MH 5BNXA 2Y2JA 1H3OB 2HIOC 1P3IC 5E5AC 3X1TA 3REIA 3W96B 4QLCA 1M19D 3AZED 1AOID 4H9PA 2YFVA 3A1KA 4XUJB 3AZJC 3AV1C 1P3KD 5JRGC 5B2IC 3AV2A 3A1IA 4YS3A 2W8SA 5DNNB 3AYWA 3WA9D 3VH6A 4Z66B 4R8PB 3W98D 3B6FD 5BS7C 3AZKD 2Y2PA 2ZY4A 4EO5C 5BO0A 1ID3B 5AV9A 3R45B 5B31B 3IP4C 2PYOD 3WKJC 2BG1A 4KUDB 5B1MB 3W97C 5AY8A 2J8PA 4ZUXA 4WZSB 5AV6D 4H9OB 3LJAA 3KUYD 4G91B 5F99A 3LELC 4DRBA 3A6NA 3AZGA 1JFIB 4DRAA 3LZ1C 3REKA 1M19B 3AZEB 3MGQD 1ZLAC 3AZMC 3WAAC 2DF4C 4NE5A 1R4VA 2YFWB 4YM6C 5CPKC 3X1TD 3REID 1KU5A 5B40C 3EPHA 5B2JB 3C1BD 1H3OA 3MVDA 4QLCD 1P3KB 2Y2LA 4J8UA 3W96A 3AL0C 4CAYB 1EQZA 5AV5B 3B0CW 5B2IB 3H0MC 2RVQC 5GXQC 2BYKA 3LZ0A 4XUJA 3W98B 3AV2D 3B6FB 3AZKB 4ZBJC 4YS3D 3UT9C 3X1UC 4AWLC 3AZHC 3AYWD 1A7WA 2IO5B 3V9RB 5AV8C 5KDMB 5DNNA 3MGRA 3AN2A 3REJA 4X23C 3B0DB 4R8PA 1P3GB 5AV9D 5AV6B 1KX4D 5GT0C 3KUYB 2AROC 5B24A 5B0ZD 3WTPC 3R45A 3TU4C 3KWQC 3C1CD 1F66A 3X1SB 3MGQB 4J8XA 3UTBA 5BNXB 4ZUXD 3LJAD 3LZ1B 3UTAC 4KUDA 3H0RC 5B1MA 3MNNC 3O62A 5F99D 3REIB 3WAAB 4XZQD 3AZGD 3C1BB 5GT3C 4H9OA 4QLCB 4WJ3C 3VH5T 2JCHA 3REKD 2Y2KA 1JFIA 1P3IA 4H9PB 2NQBC 1P3MB 1M19A 1KX3B 3MVDD 3P5JB 3AZLC 2YFWA 2CV5C 2FFFB 1U35C 5DNMC 4J8UD 2Y2NA 3W96D 5B2JA 4J8WB 1EQZD 1Q9CA 3AZJA 3AYWB 3AV1A 5JRGA 5AV5A 3LZ0D 4AWLB 5B2IA 4XUJD 4H9SC 4H9NB 1WWIA 3VH6W 2Y2GA 5BO0B 4DQYB 1KX5C 1BH8B 1TZYC 1M18B 1KX4B 3X1VC 5B0ZB 5DNND 3MGRD 5BS7A 3C1CB 4JJNC 3AZFC 3V9RA 3AN2D 3REJD 3MGPC 1P3FC 4R8PD 4ZUXB 3LJAB 2ZY3A 3VH6T 1P3OC 2RIQA 5B24D 3W99C 5AVBC 4XZQB 5CP6D 1P3GA 3WKJA 3W97A 1F66D 1P34D 2Y2OA 3REKB 3NQJB 4J8XD 3UTBD 5B0YB 3O62D 5B1MD 4WU9C 2Y2MA 3X1SA 3MGQA 3B6GC 2Y2HA 4WU8C 3LZ1A 5C3IC 3F6TA 3MVDB 3AZIC 4J8UB 3WAAA 3C1BA 3REHB 1EQZB 5BT1C 1N1JA 2JSSA 5E5AD 4YM6A 1P3ID 2BYKB 5GSUC 3LZ0B 2G5IC 1P3AC 1P3MA 2F2AC 1KX3A 5B2JD 5G49A 1P3BC 3AZJD 1P3LC 4LD9C 3AV1D 3KXBC 4J8WA 3EPJA 5JRGD 5AV5D 1P3PC 3AFAB 5B2ID 3MGRB 4HGAC 5B33B 3UT9A 3AN2B 3REJB 3X1UA 3RELB 4H9NA 1AOIC 1B6WA 5B24B 5AV8A 5CP6B 1BH8A 1M18A 1KX4A 1F66B 1P34B 5AVCC 3UTBB 4J8XB 5B0ZA 4H9QB 2AROA 3O62B 3C1CA 4J8VB 3WTPA 3WKJD 1P3GD 3AZNB 3W97D 3WA9C 2L5AA 2NZDC 4NE6A 4XZQA 3UTAA 2HIOB 1P3IB 4KGCC 5E5AB 3X1SD 2F8NB 3NQJA 4Z5TC 5B32C 5GT3A 3LZ1D 5B0YA 1F1EA 2G5HC 3WAAD 2FJ7C 1HTAA 4YM6D 3NQUA 5CPKD 3AZJB 3AV1B 5B40D 3REHA 2CV5A 5JRGB 5JA4B 1P3MD 3H0LC 1KX3D 1M1AC 2RVQD 3WTPE 5FUGA 4J8WD 4H9SA 3X1TC 3B0CT 3UT9D 4EO5B 3X1UD 1KX5A 1TZYA 3AFAA 5CPIC 2ZM5A 5B33A 3FDDA 5AV8D 3RELA 3WKJB 1M18D 3AZFA 3W97B 1PZRA 1HQ3C 4X23D 1P3FA 3EPKA 5CP6A 2AROD 1P34A 3LELB 3AV2C 3WTPD 4YS3C 3TU4D 4H9QA 1ZLAB 3AZMB 4J8VA 3UTAD 3AZNA 3MNND 1N1JB 4YM6B 4WU9A 5CPKB 3B6GA 4KHAB 5B40B 5GT3D 3MGSC 2HIOA 5AV9C 5B0YD 5E5AA 4NFTA 2F8NA 2NQBD 5G49B 5CPJC
chains in the Genus database with same CATH topology
5GXQB 4M6BA 1M1AB 5AY8C 3REHD 2CV5D 1P3AA 2F8NG 1U35D 1S32C 5F99C 4ZBJB 3UT9B 2HUEC 3X1UB 3A6NC 5B1LC 5JA4A 3AZHB 4LD9A 3KXBA 5AV8B 4Z2MG 5CPIB 2Y2IA 4X23B 1KX5D 1TZYD 3AFAD 5GT0B 4H9RB 4UPKA 2AROB 5B33D 3W96C 3WTPB 3RELD 3TU4B 3KWQB 2BYMB 4JJND 3AZFD 1P3FD 3UTAB 3MNNB 4XUJC 1P3OD 1Z2CB 5GT3B 4WNNA 1BH9B 1W2EA 3LELA 2NZDA 4CSRB 4J8VD 3AZND 4KGCA 2NQBB 4WU9D 5DNNC 3NQUB 1ZLAA 4Z5TA 5B32A 3AZMA 3B6GD 1TAFB 4R8PC 4Z66C 2HIOD 3AZID 3AZLB 5CPKA 2CV5B 1U35B 5DNMB 2F8ND 4KHAA 5B40A 2CWEA 3B0BA 1ID3C 5BT1D 5B31C 5B32G 5FUGB 1P3AD 4KUDC 5B1MC 5GXQA 1M1AA 3EG5B 1KX5B 1TZYB 4G91C 3X1VB 4LD9D 4G92C 3KXBD 3KFUG 1P3PD 3AZHA 4JJNB 1M19C 3AZFB 3AZEC 3MGPB 1P3FB 5CPIA 1P3OB 2ZY2A 4X23A 5AVBB 3W99B 5B2JC 5GT0A 4H9RA 1P3KC 1HQ3A 5AVCD 4E44A 3TU4A 2Y2QA 5AV5C 3KWQA 2BYMA 4WU9B 3B6GB 4WU8B 5C3IB 3MNNA 4NE3A 3AZIB 3W98C 3LELD 2NZDD 3B6FC 3AZKC 4KGCD 1BH9A 1ZLAD 2IO5C 4Z5TD 4CSRA 5B32D 3AZMD 2PYOC 3MGSA 2LY8A 5GSUB 2JE5A 2NQBA 1P3AB 2FJ7D 3B0DC 1TAFA 3AZLA 1P3GC 1P3BB 5AV6C 5CPJA 1P3LB 3KUYC 5DNMA 1U35A 4LD9B 3KXBB 1P3PB 1S32A 4HGAB 5GXQD 2UWXA 4G92B 3X1SC 3MGQC 1M1AD 1B67A 5B1LA 1AOIB 4UUZB 3REIC 1T3UA 3C1BC 4QLCC 3AZHD 2XD1A 3X1VA 5AVCB 1WWSA 5CPID 4JJNA 1P3MC 4WV4B 3MGPA 1KX3C 1BFMA 2XD5A 5GT0D 4WNNB 1P3OA 3WA9B 1HQ3D 2NZDB 3W99A 5AVBA 4J8WC 3KWQD 5BNVB 4KGCB 3AYWC 4Z5TB 5B32B 2PYOB 4WU8A 2FJ7B 3AZIA 2ZY5A 1KX4C 1M18C 4Z66A 3MGSD 5B0ZC 3C1CC 1ID3A 3VH5W 5GSUA 4ZUXC 3AZLD 5B31A 3LJAC 5CPJD 5DNMD 5AY8D 4XZQC 3AZGC 1P3BA 1ULYA 1P3LA 1S32D 3X1TB 3REKC 3EPLA 5B31G 3A6ND 1P3PA 5B1LD 2DQNC 5B0YC 3MVDC 2YFVB 3AZEA 3X1VD 1AOIA 4UUZA 1HQ3B 4J8UC 3REHC 1EQZC 4E45A 3AV2B 5AVCA 2VQRA 3MGPD 3KSYA 4YS3B 1P3KA 3LZ0C 4CAYA 3W99D 5AVBD 2F8NK 3WA9A 5CHLB 3MGSB 5AV9B 3W98A 5BNVA 3AFAC 1ID3D 3MGRC 3B6FA 3AZKA 5B33C 4WU8D 3AN2C 3REJC 3RELC 5CPJB 2PYOA 2FJ7A 5AY8B 5B24C 4Z66D 5CP6C 5KDMA 1S32B 1F66C 5F99B 1P34C 3VH5A 4J8XC 2HUEB 3A6NB 5GSUD 5AV6A 3UTBC 5B1LB 5B31D 3AZGB 3KUYA 2F8NH 3O62C 4J8VC 1P3BD 4KUDD 3AZNC 1P3LD 4Z2MH 5BNXA 2Y2JA 1H3OB 2HIOC 1P3IC 5E5AC 3X1TA 3REIA 3W96B 4QLCA 1M19D 3AZED 1AOID 4H9PA 2YFVA 3A1KA 4XUJB 3AZJC 3AV1C 1P3KD 5JRGC 5B2IC 3AV2A 3A1IA 4YS3A 2W8SA 5DNNB 3AYWA 3WA9D 3VH6A 4Z66B 4R8PB 3W98D 3B6FD 5BS7C 3AZKD 2Y2PA 2ZY4A 4EO5C 5BO0A 1ID3B 5AV9A 3R45B 5B31B 3IP4C 2PYOD 3WKJC 2BG1A 4KUDB 5B1MB 3W97C 5AY8A 2J8PA 4ZUXA 4WZSB 5AV6D 4H9OB 3LJAA 3KUYD 4G91B 5F99A 3LELC 4DRBA 3A6NA 3AZGA 1JFIB 4DRAA 3LZ1C 3REKA 1M19B 3AZEB 3MGQD 1ZLAC 3AZMC 3WAAC 2DF4C 4NE5A 1R4VA 2YFWB 4YM6C 5CPKC 3X1TD 3REID 1KU5A 5B40C 3EPHA 5B2JB 3C1BD 1H3OA 3MVDA 4QLCD 1P3KB 2Y2LA 4J8UA 3W96A 3AL0C 4CAYB 1EQZA 5AV5B 3B0CW 5B2IB 3H0MC 2RVQC 5GXQC 2BYKA 3LZ0A 4XUJA 3W98B 3AV2D 3B6FB 3AZKB 4ZBJC 4YS3D 3UT9C 3X1UC 4AWLC 3AZHC 3AYWD 1A7WA 2IO5B 3V9RB 5AV8C 5KDMB 5DNNA 3MGRA 3AN2A 3REJA 4X23C 3B0DB 4R8PA 1P3GB 5AV9D 5AV6B 1KX4D 5GT0C 3KUYB 2AROC 5B24A 5B0ZD 3WTPC 3R45A 3TU4C 3KWQC 3C1CD 1F66A 3X1SB 3MGQB 4J8XA 3UTBA 5BNXB 4ZUXD 3LJAD 3LZ1B 3UTAC 4KUDA 3H0RC 5B1MA 3MNNC 3O62A 5F99D 3REIB 3WAAB 4XZQD 3AZGD 3C1BB 5GT3C 4H9OA 4QLCB 4WJ3C 3VH5T 2JCHA 3REKD 2Y2KA 1JFIA 1P3IA 4H9PB 2NQBC 1P3MB 1M19A 1KX3B 3MVDD 3P5JB 3AZLC 2YFWA 2CV5C 2FFFB 1U35C 5DNMC 4J8UD 2Y2NA 3W96D 5B2JA 4J8WB 1EQZD 1Q9CA 3AZJA 3AYWB 3AV1A 5JRGA 5AV5A 3LZ0D 4AWLB 5B2IA 4XUJD 4H9SC 4H9NB 1WWIA 3VH6W 2Y2GA 5BO0B 4DQYB 1KX5C 1BH8B 1TZYC 1M18B 1KX4B 3X1VC 5B0ZB 5DNND 3MGRD 5BS7A 3C1CB 4JJNC 3AZFC 3V9RA 3AN2D 3REJD 3MGPC 1P3FC 4R8PD 4ZUXB 3LJAB 2ZY3A 3VH6T 1P3OC 2RIQA 5B24D 3W99C 5AVBC 4XZQB 5CP6D 1P3GA 3WKJA 3W97A 1F66D 1P34D 2Y2OA 3REKB 3NQJB 4J8XD 3UTBD 5B0YB 3O62D 5B1MD 4WU9C 2Y2MA 3X1SA 3MGQA 3B6GC 2Y2HA 4WU8C 3LZ1A 5C3IC 3F6TA 3MVDB 3AZIC 4J8UB 3WAAA 3C1BA 3REHB 1EQZB 5BT1C 1N1JA 2JSSA 5E5AD 4YM6A 1P3ID 2BYKB 5GSUC 3LZ0B 2G5IC 1P3AC 1P3MA 2F2AC 1KX3A 5B2JD 5G49A 1P3BC 3AZJD 1P3LC 4LD9C 3AV1D 3KXBC 4J8WA 3EPJA 5JRGD 5AV5D 1P3PC 3AFAB 5B2ID 3MGRB 4HGAC 5B33B 3UT9A 3AN2B 3REJB 3X1UA 3RELB 4H9NA 1AOIC 1B6WA 5B24B 5AV8A 5CP6B 1BH8A 1M18A 1KX4A 1F66B 1P34B 5AVCC 3UTBB 4J8XB 5B0ZA 4H9QB 2AROA 3O62B 3C1CA 4J8VB 3WTPA 3WKJD 1P3GD 3AZNB 3W97D 3WA9C 2L5AA 2NZDC 4NE6A 4XZQA 3UTAA 2HIOB 1P3IB 4KGCC 5E5AB 3X1SD 2F8NB 3NQJA 4Z5TC 5B32C 5GT3A 3LZ1D 5B0YA 1F1EA 2G5HC 3WAAD 2FJ7C 1HTAA 4YM6D 3NQUA 5CPKD 3AZJB 3AV1B 5B40D 3REHA 2CV5A 5JRGB 5JA4B 1P3MD 3H0LC 1KX3D 1M1AC 2RVQD 3WTPE 5FUGA 4J8WD 4H9SA 3X1TC 3B0CT 3UT9D 4EO5B 3X1UD 1KX5A 1TZYA 3AFAA 5CPIC 2ZM5A 5B33A 3FDDA 5AV8D 3RELA 3WKJB 1M18D 3AZFA 3W97B 1PZRA 1HQ3C 4X23D 1P3FA 3EPKA 5CP6A 2AROD 1P34A 3LELB 3AV2C 3WTPD 4YS3C 3TU4D 4H9QA 1ZLAB 3AZMB 4J8VA 3UTAD 3AZNA 3MNND 1N1JB 4YM6B 4WU9A 5CPKB 3B6GA 4KHAB 5B40B 5GT3D 3MGSC 2HIOA 5AV9C 5B0YD 5E5AA 4NFTA 2F8NA 2NQBD 5G49B 5CPJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GXQ B;  4M6B A;  1M1A B;  5AY8 C;  3REH D;  2CV5 D;  1P3A A;  2F8N G;  1U35 D;  1S32 C;  5F99 C;  4ZBJ B;  3UT9 B;  2HUE C;  3X1U B;  3A6N C;  5B1L C;  5JA4 A;  3AZH B;  4LD9 A;  3KXB A;  5AV8 B;  4Z2M G;  5CPI B;  4X23 B;  1KX5 D;  1TZY D;  3AFA D;  5GT0 B;  4H9R B;  2ARO B;  5B33 D;  3W96 C;  3WTP B;  3REL D;  3TU4 B;  3KWQ B;  2BYM B;  4JJN D;  3AZF D;  1P3F D;  3UTA B;  3MNN B;  4XUJ C;  1P3O D;  5GT3 B;  4WNN A;  1BH9 B;  3LEL A;  2NZD A;  4CSR B;  4J8V D;  3AZN D;  4KGC A;  2NQB B;  4WU9 D;  5DNN C;  3NQU B;  1ZLA A;  4Z5T A;  5B32 A;  3AZM A;  3B6G D;  1TAF B;  4R8P C;  4Z66 C;  2HIO D;  3AZI D;  3AZL B;  5CPK A;  2CV5 B;  1U35 B;  5DNM B;  2F8N D;  4KHA A;  5B40 A;  2CWE A;  3B0B A;  1ID3 C;  5BT1 D;  5B31 C;  5B32 G;  5FUG B;  1P3A D;  4KUD C;  5B1M C;  5GXQ A;  1M1A A;  1KX5 B;  1TZY B;  4G91 C;  3X1V B;  4LD9 D;  4G92 C;  3KXB D;  1P3P D;  3AZH A;  4JJN B;  1M19 C;  3AZF B;  3AZE C;  3MGP B;  1P3F B;  5CPI A;  1P3O B;  4X23 A;  5AVB B;  3W99 B;  5B2J C;  5GT0 A;  4H9R A;  1P3K C;  1HQ3 A;  5AVC D;  4E44 A;  3TU4 A;  5AV5 C;  3KWQ A;  2BYM A;  4WU9 B;  3B6G B;  4WU8 B;  5C3I B;  3MNN A;  4NE3 A;  3AZI B;  3W98 C;  3LEL D;  2NZD D;  3B6F C;  3AZK C;  4KGC D;  1BH9 A;  1ZLA D;  2IO5 C;  4Z5T D;  4CSR A;  5B32 D;  3AZM D;  2PYO C;  3MGS A;  2LY8 A;  5GSU B;  2NQB A;  1P3A B;  2FJ7 D;  3B0D C;  1TAF A;  3AZL A;  1P3G C;  1P3B B;  5AV6 C;  5CPJ A;  1P3L B;  3KUY C;  5DNM A;  1U35 A;  4LD9 B;  3KXB B;  1P3P B;  1S32 A;  4HGA B;  5GXQ D;  4G92 B;  3X1S C;  1M1A D;  3MGQ C;  1B67 A;  5B1L A;  1AOI B;  4UUZ B;  3REI C;  3C1B C;  4QLC C;  3AZH D;  3X1V A;  5AVC B;  1WWS A;  5CPI D;  4JJN A;  1P3M C;  4WV4 B;  3MGP A;  1KX3 C;  1BFM A;  5GT0 D;  4WNN B;  1P3O A;  3WA9 B;  1HQ3 D;  2NZD B;  3W99 A;  5AVB A;  4J8W C;  3KWQ D;  5BNV B;  4KGC B;  3AYW C;  4Z5T B;  5B32 B;  2PYO B;  4WU8 A;  2FJ7 B;  3AZI A;  1KX4 C;  1M18 C;  4Z66 A;  3MGS D;  5B0Z C;  3C1C C;  1ID3 A;  3VH5 W;  5GSU A;  4ZUX C;  3AZL D;  5B31 A;  3LJA C;  5CPJ D;  5DNM D;  5AY8 D;  4XZQ C;  3AZG C;  1P3B A;  1ULY A;  1P3L A;  1S32 D;  3X1T B;  3REK C;  5B31 G;  3A6N D;  1P3P A;  5B1L D;  5B0Y C;  3MVD C;  2YFV B;  3AZE A;  3X1V D;  1AOI A;  4UUZ A;  1HQ3 B;  4J8U C;  3REH C;  1EQZ C;  4E45 A;  3AV2 B;  5AVC A;  3MGP D;  3KSY A;  4YS3 B;  1P3K A;  3LZ0 C;  4CAY A;  3W99 D;  5AVB D;  2F8N K;  3WA9 A;  5CHL B;  3MGS B;  5AV9 B;  3W98 A;  5BNV A;  3AFA C;  1ID3 D;  3MGR C;  3B6F A;  3AZK A;  5B33 C;  4WU8 D;  3AN2 C;  3REJ C;  3REL C;  5CPJ B;  2PYO A;  2FJ7 A;  5AY8 B;  5B24 C;  4Z66 D;  5CP6 C;  5KDM A;  1S32 B;  1F66 C;  5F99 B;  1P34 C;  3VH5 A;  4J8X C;  2HUE B;  3A6N B;  5GSU D;  5AV6 A;  3UTB C;  5B1L B;  5B31 D;  3AZG B;  3KUY A;  2F8N H;  3O62 C;  4J8V C;  1P3B D;  4KUD D;  3AZN C;  1P3L D;  4Z2M H;  5BNX A;  1H3O B;  2HIO C;  1P3I C;  5E5A C;  3X1T A;  3REI A;  3W96 B;  4QLC A;  1M19 D;  3AZE D;  1AOI D;  4H9P A;  2YFV A;  4XUJ B;  3AZJ C;  3AV1 C;  1P3K D;  5JRG C;  5B2I C;  3AV2 A;  4YS3 A;  5DNN B;  3AYW A;  3WA9 D;  3VH6 A;  4Z66 B;  4R8P B;  3W98 D;  3B6F D;  5BS7 C;  3AZK D;  4EO5 C;  5BO0 A;  1ID3 B;  5AV9 A;  3R45 B;  5B31 B;  2PYO D;  3WKJ C;  4KUD B;  5B1M B;  3W97 C;  5AY8 A;  4ZUX A;  4WZS B;  5AV6 D;  4H9O B;  3LJA A;  3KUY D;  4G91 B;  5F99 A;  3LEL C;  4DRB A;  3A6N A;  3AZG A;  1JFI B;  4DRA A;  3LZ1 C;  3REK A;  1M19 B;  3AZE B;  3MGQ D;  1ZLA C;  3AZM C;  3WAA C;  4NE5 A;  2YFW B;  1R4V A;  4YM6 C;  5CPK C;  3X1T D;  3REI D;  1KU5 A;  5B40 C;  5B2J B;  3C1B D;  1H3O A;  3MVD A;  4QLC D;  1P3K B;  4J8U A;  3W96 A;  4CAY B;  1EQZ A;  5AV5 B;  3B0C W;  5B2I B;  2RVQ C;  5GXQ C;  2BYK A;  3LZ0 A;  4XUJ A;  3W98 B;  3AV2 D;  3B6F B;  3AZK B;  4ZBJ C;  4YS3 D;  3UT9 C;  3X1U C;  4AWL C;  3AZH C;  3AYW D;  1A7W A;  2IO5 B;  3V9R B;  5AV8 C;  5KDM B;  5DNN A;  3MGR A;  3AN2 A;  3REJ A;  4X23 C;  3B0D B;  4R8P A;  1P3G B;  5AV9 D;  5AV6 B;  1KX4 D;  5GT0 C;  3KUY B;  2ARO C;  5B24 A;  5B0Z D;  3WTP C;  3R45 A;  3TU4 C;  3KWQ C;  3C1C D;  1F66 A;  3X1S B;  3MGQ B;  4J8X A;  3UTB A;  5BNX B;  4ZUX D;  3LJA D;  3LZ1 B;  3UTA C;  4KUD A;  3O62 A;  5B1M A;  3MNN C;  5F99 D;  3REI B;  3WAA B;  4XZQ D;  3AZG D;  3C1B B;  5GT3 C;  4H9O A;  4QLC B;  3VH5 T;  3REK D;  1JFI A;  1P3I A;  4H9P B;  2NQB C;  1P3M B;  1M19 A;  1KX3 B;  3MVD D;  3AZL C;  2CV5 C;  2YFW A;  1U35 C;  5DNM C;  4J8U D;  3W96 D;  5B2J A;  4J8W B;  1EQZ D;  1Q9C A;  3AZJ A;  3AYW B;  3AV1 A;  5JRG A;  5AV5 A;  3LZ0 D;  4AWL B;  5B2I A;  4XUJ D;  4H9S C;  4H9N B;  1WWI A;  3VH6 W;  5BO0 B;  1KX5 C;  1BH8 B;  1TZY C;  1M18 B;  1KX4 B;  3X1V C;  5B0Z B;  5DNN D;  3MGR D;  5BS7 A;  3C1C B;  4JJN C;  3AZF C;  3V9R A;  3AN2 D;  3REJ D;  3MGP C;  1P3F C;  4R8P D;  4ZUX B;  3LJA B;  3VH6 T;  1P3O C;  5B24 D;  3W99 C;  5AVB C;  4XZQ B;  5CP6 D;  1P3G A;  3WKJ A;  3W97 A;  1F66 D;  1P34 D;  3REK B;  3NQJ B;  4J8X D;  3UTB D;  5B0Y B;  3O62 D;  5B1M D;  4WU9 C;  3X1S A;  3MGQ A;  3B6G C;  4WU8 C;  3LZ1 A;  5C3I C;  3MVD B;  3AZI C;  4J8U B;  3WAA A;  3C1B A;  3REH B;  1EQZ B;  5BT1 C;  1N1J A;  2JSS A;  5E5A D;  4YM6 A;  1P3I D;  2BYK B;  5GSU C;  3LZ0 B;  1P3M A;  1P3A C;  1KX3 A;  5B2J D;  5G49 A;  1P3B C;  3AZJ D;  1P3L C;  4LD9 C;  3AV1 D;  3KXB C;  4J8W A;  5JRG D;  5AV5 D;  1P3P C;  3AFA B;  5B2I D;  3MGR B;  4HGA C;  5B33 B;  3UT9 A;  3AN2 B;  3REJ B;  3X1U A;  3REL B;  4H9N A;  1AOI C;  1B6W A;  5B24 B;  5AV8 A;  5CP6 B;  1BH8 A;  1M18 A;  1KX4 A;  1F66 B;  1P34 B;  5AVC C;  3UTB B;  4J8X B;  5B0Z A;  4H9Q B;  2ARO A;  3O62 B;  3C1C A;  4J8V B;  3WTP A;  3WKJ D;  1P3G D;  3AZN B;  3W97 D;  3WA9 C;  2L5A A;  2NZD C;  4NE6 A;  4XZQ A;  3UTA A;  2HIO B;  1P3I B;  4KGC C;  5E5A B;  3X1S D;  2F8N B;  3NQJ A;  4Z5T C;  5B32 C;  5GT3 A;  3LZ1 D;  5B0Y A;  1F1E A;  3WAA D;  2FJ7 C;  1HTA A;  4YM6 D;  3NQU A;  5CPK D;  3AZJ B;  3AV1 B;  5B40 D;  3REH A;  2CV5 A;  5JRG B;  5JA4 B;  1P3M D;  1KX3 D;  1M1A C;  2RVQ D;  3WTP E;  5FUG A;  4J8W D;  4H9S A;  3X1T C;  3B0C T;  3UT9 D;  4EO5 B;  3X1U D;  1KX5 A;  1TZY A;  3AFA A;  5CPI C;  5B33 A;  5AV8 D;  3REL A;  3WKJ B;  1M18 D;  3AZF A;  3W97 B;  1HQ3 C;  4X23 D;  1P3F A;  5CP6 A;  2ARO D;  1P34 A;  3LEL B;  3AV2 C;  3WTP D;  4YS3 C;  3TU4 D;  4H9Q A;  1ZLA B;  3AZM B;  4J8V A;  3UTA D;  3AZN A;  3MNN D;  1N1J B;  4YM6 B;  4WU9 A;  5CPK B;  3B6G A;  4KHA B;  5B40 B;  5GT3 D;  3MGS C;  2HIO A;  5AV9 C;  5B0Y D;  5E5A A;  4NFT A;  2F8N A;  2NQB D;  5G49 B;  5CPJ C; 
#chains in the Genus database with same CATH topology
 5GXQ B;  4M6B A;  1M1A B;  5AY8 C;  3REH D;  2CV5 D;  1P3A A;  2F8N G;  1U35 D;  1S32 C;  5F99 C;  4ZBJ B;  3UT9 B;  2HUE C;  3X1U B;  3A6N C;  5B1L C;  5JA4 A;  3AZH B;  4LD9 A;  3KXB A;  5AV8 B;  4Z2M G;  5CPI B;  2Y2I A;  4X23 B;  1KX5 D;  1TZY D;  3AFA D;  5GT0 B;  4H9R B;  4UPK A;  2ARO B;  5B33 D;  3W96 C;  3WTP B;  3REL D;  3TU4 B;  3KWQ B;  2BYM B;  4JJN D;  3AZF D;  1P3F D;  3UTA B;  3MNN B;  4XUJ C;  1P3O D;  1Z2C B;  5GT3 B;  4WNN A;  1BH9 B;  1W2E A;  3LEL A;  2NZD A;  4CSR B;  4J8V D;  3AZN D;  4KGC A;  2NQB B;  4WU9 D;  5DNN C;  3NQU B;  1ZLA A;  4Z5T A;  5B32 A;  3AZM A;  3B6G D;  1TAF B;  4R8P C;  4Z66 C;  2HIO D;  3AZI D;  3AZL B;  5CPK A;  2CV5 B;  1U35 B;  5DNM B;  2F8N D;  4KHA A;  5B40 A;  2CWE A;  3B0B A;  1ID3 C;  5BT1 D;  5B31 C;  5B32 G;  5FUG B;  1P3A D;  4KUD C;  5B1M C;  5GXQ A;  1M1A A;  3EG5 B;  1KX5 B;  1TZY B;  4G91 C;  3X1V B;  4LD9 D;  4G92 C;  3KXB D;  3KFU G;  1P3P D;  3AZH A;  4JJN B;  1M19 C;  3AZF B;  3AZE C;  3MGP B;  1P3F B;  5CPI A;  1P3O B;  2ZY2 A;  4X23 A;  5AVB B;  3W99 B;  5B2J C;  5GT0 A;  4H9R A;  1P3K C;  1HQ3 A;  5AVC D;  4E44 A;  3TU4 A;  2Y2Q A;  5AV5 C;  3KWQ A;  2BYM A;  4WU9 B;  3B6G B;  4WU8 B;  5C3I B;  3MNN A;  4NE3 A;  3AZI B;  3W98 C;  3LEL D;  2NZD D;  3B6F C;  3AZK C;  4KGC D;  1BH9 A;  1ZLA D;  2IO5 C;  4Z5T D;  4CSR A;  5B32 D;  3AZM D;  2PYO C;  3MGS A;  2LY8 A;  5GSU B;  2JE5 A;  2NQB A;  1P3A B;  2FJ7 D;  3B0D C;  1TAF A;  3AZL A;  1P3G C;  1P3B B;  5AV6 C;  5CPJ A;  1P3L B;  3KUY C;  5DNM A;  1U35 A;  4LD9 B;  3KXB B;  1P3P B;  1S32 A;  4HGA B;  5GXQ D;  2UWX A;  4G92 B;  3X1S C;  3MGQ C;  1M1A D;  1B67 A;  5B1L A;  1AOI B;  4UUZ B;  3REI C;  1T3U A;  3C1B C;  4QLC C;  3AZH D;  2XD1 A;  3X1V A;  5AVC B;  1WWS A;  5CPI D;  4JJN A;  1P3M C;  4WV4 B;  3MGP A;  1KX3 C;  1BFM A;  2XD5 A;  5GT0 D;  4WNN B;  1P3O A;  3WA9 B;  1HQ3 D;  2NZD B;  3W99 A;  5AVB A;  4J8W C;  3KWQ D;  5BNV B;  4KGC B;  3AYW C;  4Z5T B;  5B32 B;  2PYO B;  4WU8 A;  2FJ7 B;  3AZI A;  2ZY5 A;  1KX4 C;  1M18 C;  4Z66 A;  3MGS D;  5B0Z C;  3C1C C;  1ID3 A;  3VH5 W;  5GSU A;  4ZUX C;  3AZL D;  5B31 A;  3LJA C;  5CPJ D;  5DNM D;  5AY8 D;  4XZQ C;  3AZG C;  1P3B A;  1ULY A;  1P3L A;  1S32 D;  3X1T B;  3REK C;  3EPL A;  5B31 G;  3A6N D;  1P3P A;  5B1L D;  2DQN C;  5B0Y C;  3MVD C;  2YFV B;  3AZE A;  3X1V D;  1AOI A;  4UUZ A;  1HQ3 B;  4J8U C;  3REH C;  1EQZ C;  4E45 A;  3AV2 B;  5AVC A;  2VQR A;  3MGP D;  3KSY A;  4YS3 B;  1P3K A;  3LZ0 C;  4CAY A;  3W99 D;  5AVB D;  2F8N K;  3WA9 A;  5CHL B;  3MGS B;  5AV9 B;  3W98 A;  5BNV A;  3AFA C;  1ID3 D;  3MGR C;  3B6F A;  3AZK A;  5B33 C;  4WU8 D;  3AN2 C;  3REJ C;  3REL C;  5CPJ B;  2PYO A;  2FJ7 A;  5AY8 B;  5B24 C;  4Z66 D;  5CP6 C;  5KDM A;  1S32 B;  1F66 C;  5F99 B;  1P34 C;  3VH5 A;  4J8X C;  2HUE B;  3A6N B;  5GSU D;  5AV6 A;  3UTB C;  5B1L B;  5B31 D;  3AZG B;  3KUY A;  2F8N H;  3O62 C;  4J8V C;  1P3B D;  4KUD D;  3AZN C;  1P3L D;  4Z2M H;  5BNX A;  2Y2J A;  1H3O B;  2HIO C;  1P3I C;  5E5A C;  3X1T A;  3REI A;  3W96 B;  4QLC A;  1M19 D;  3AZE D;  1AOI D;  4H9P A;  2YFV A;  3A1K A;  4XUJ B;  3AZJ C;  3AV1 C;  1P3K D;  5JRG C;  5B2I C;  3AV2 A;  3A1I A;  4YS3 A;  2W8S A;  5DNN B;  3AYW A;  3WA9 D;  3VH6 A;  4Z66 B;  4R8P B;  3W98 D;  3B6F D;  5BS7 C;  3AZK D;  2Y2P A;  2ZY4 A;  4EO5 C;  5BO0 A;  1ID3 B;  5AV9 A;  3R45 B;  5B31 B;  3IP4 C;  2PYO D;  3WKJ C;  2BG1 A;  4KUD B;  5B1M B;  3W97 C;  5AY8 A;  2J8P A;  4ZUX A;  4WZS B;  5AV6 D;  4H9O B;  3LJA A;  3KUY D;  4G91 B;  5F99 A;  3LEL C;  4DRB A;  3A6N A;  3AZG A;  1JFI B;  4DRA A;  3LZ1 C;  3REK A;  1M19 B;  3AZE B;  3MGQ D;  1ZLA C;  3AZM C;  3WAA C;  2DF4 C;  4NE5 A;  1R4V A;  2YFW B;  4YM6 C;  5CPK C;  3X1T D;  3REI D;  1KU5 A;  5B40 C;  3EPH A;  5B2J B;  3C1B D;  1H3O A;  3MVD A;  4QLC D;  1P3K B;  2Y2L A;  4J8U A;  3W96 A;  3AL0 C;  4CAY B;  1EQZ A;  5AV5 B;  3B0C W;  5B2I B;  3H0M C;  2RVQ C;  5GXQ C;  2BYK A;  3LZ0 A;  4XUJ A;  3W98 B;  3AV2 D;  3B6F B;  3AZK B;  4ZBJ C;  4YS3 D;  3UT9 C;  3X1U C;  4AWL C;  3AZH C;  3AYW D;  1A7W A;  2IO5 B;  3V9R B;  5AV8 C;  5KDM B;  5DNN A;  3MGR A;  3AN2 A;  3REJ A;  4X23 C;  3B0D B;  4R8P A;  1P3G B;  5AV9 D;  5AV6 B;  1KX4 D;  5GT0 C;  3KUY B;  2ARO C;  5B24 A;  5B0Z D;  3WTP C;  3R45 A;  3TU4 C;  3KWQ C;  3C1C D;  1F66 A;  3X1S B;  3MGQ B;  4J8X A;  3UTB A;  5BNX B;  4ZUX D;  3LJA D;  3LZ1 B;  3UTA C;  4KUD A;  3H0R C;  5B1M A;  3MNN C;  3O62 A;  5F99 D;  3REI B;  3WAA B;  4XZQ D;  3AZG D;  3C1B B;  5GT3 C;  4H9O A;  4QLC B;  4WJ3 C;  3VH5 T;  2JCH A;  3REK D;  2Y2K A;  1JFI A;  1P3I A;  4H9P B;  2NQB C;  1P3M B;  1M19 A;  1KX3 B;  3MVD D;  3P5J B;  3AZL C;  2YFW A;  2CV5 C;  2FFF B;  1U35 C;  5DNM C;  4J8U D;  2Y2N A;  3W96 D;  5B2J A;  4J8W B;  1EQZ D;  1Q9C A;  3AZJ A;  3AYW B;  3AV1 A;  5JRG A;  5AV5 A;  3LZ0 D;  4AWL B;  5B2I A;  4XUJ D;  4H9S C;  4H9N B;  1WWI A;  3VH6 W;  2Y2G A;  5BO0 B;  4DQY B;  1KX5 C;  1BH8 B;  1TZY C;  1M18 B;  1KX4 B;  3X1V C;  5B0Z B;  5DNN D;  3MGR D;  5BS7 A;  3C1C B;  4JJN C;  3AZF C;  3V9R A;  3AN2 D;  3REJ D;  3MGP C;  1P3F C;  4R8P D;  4ZUX B;  3LJA B;  2ZY3 A;  3VH6 T;  1P3O C;  2RIQ A;  5B24 D;  3W99 C;  5AVB C;  4XZQ B;  5CP6 D;  1P3G A;  3WKJ A;  3W97 A;  1F66 D;  1P34 D;  2Y2O A;  3REK B;  3NQJ B;  4J8X D;  3UTB D;  5B0Y B;  3O62 D;  5B1M D;  4WU9 C;  2Y2M A;  3X1S A;  3MGQ A;  3B6G C;  2Y2H A;  4WU8 C;  3LZ1 A;  5C3I C;  3F6T A;  3MVD B;  3AZI C;  4J8U B;  3WAA A;  3C1B A;  3REH B;  1EQZ B;  5BT1 C;  1N1J A;  2JSS A;  5E5A D;  4YM6 A;  1P3I D;  2BYK B;  5GSU C;  3LZ0 B;  2G5I C;  1P3A C;  1P3M A;  2F2A C;  1KX3 A;  5B2J D;  5G49 A;  1P3B C;  3AZJ D;  1P3L C;  4LD9 C;  3AV1 D;  3KXB C;  4J8W A;  3EPJ A;  5JRG D;  5AV5 D;  1P3P C;  3AFA B;  5B2I D;  3MGR B;  4HGA C;  5B33 B;  3UT9 A;  3AN2 B;  3REJ B;  3X1U A;  3REL B;  4H9N A;  1AOI C;  1B6W A;  5B24 B;  5AV8 A;  5CP6 B;  1BH8 A;  1M18 A;  1KX4 A;  1F66 B;  1P34 B;  5AVC C;  3UTB B;  4J8X B;  5B0Z A;  4H9Q B;  2ARO A;  3O62 B;  3C1C A;  4J8V B;  3WTP A;  3WKJ D;  1P3G D;  3AZN B;  3W97 D;  3WA9 C;  2L5A A;  2NZD C;  4NE6 A;  4XZQ A;  3UTA A;  2HIO B;  1P3I B;  4KGC C;  5E5A B;  3X1S D;  2F8N B;  3NQJ A;  4Z5T C;  5B32 C;  5GT3 A;  3LZ1 D;  5B0Y A;  1F1E A;  2G5H C;  3WAA D;  2FJ7 C;  1HTA A;  4YM6 D;  3NQU A;  5CPK D;  3AZJ B;  3AV1 B;  5B40 D;  3REH A;  2CV5 A;  5JRG B;  5JA4 B;  1P3M D;  3H0L C;  1KX3 D;  1M1A C;  2RVQ D;  3WTP E;  5FUG A;  4J8W D;  4H9S A;  3X1T C;  3B0C T;  3UT9 D;  4EO5 B;  3X1U D;  1KX5 A;  1TZY A;  3AFA A;  5CPI C;  2ZM5 A;  5B33 A;  3FDD A;  5AV8 D;  3REL A;  3WKJ B;  1M18 D;  3AZF A;  3W97 B;  1PZR A;  1HQ3 C;  4X23 D;  1P3F A;  3EPK A;  5CP6 A;  2ARO D;  1P34 A;  3LEL B;  3AV2 C;  3WTP D;  4YS3 C;  3TU4 D;  4H9Q A;  1ZLA B;  3AZM B;  4J8V A;  3UTA D;  3AZN A;  3MNN D;  1N1J B;  4YM6 B;  4WU9 A;  5CPK B;  3B6G A;  4KHA B;  5B40 B;  5GT3 D;  3MGS C;  2HIO A;  5AV9 C;  5B0Y D;  5E5A A;  4NFT A;  2F8N A;  2NQB D;  5G49 B;  5CPJ C; 
#chains in the Genus database with same CATH homology
 5GXQ B;  4M6B A;  1M1A B;  5AY8 C;  3REH D;  2CV5 D;  1P3A A;  2F8N G;  1U35 D;  1S32 C;  5F99 C;  4ZBJ B;  3UT9 B;  2HUE C;  3X1U B;  3A6N C;  5B1L C;  5JA4 A;  3AZH B;  4LD9 A;  3KXB A;  5AV8 B;  4Z2M G;  5CPI B;  2Y2I A;  4X23 B;  1KX5 D;  1TZY D;  3AFA D;  5GT0 B;  4H9R B;  4UPK A;  2ARO B;  5B33 D;  3W96 C;  3WTP B;  3REL D;  3TU4 B;  3KWQ B;  2BYM B;  4JJN D;  3AZF D;  1P3F D;  3UTA B;  3MNN B;  4XUJ C;  1P3O D;  1Z2C B;  5GT3 B;  4WNN A;  1BH9 B;  1W2E A;  3LEL A;  2NZD A;  4CSR B;  4J8V D;  3AZN D;  4KGC A;  2NQB B;  4WU9 D;  5DNN C;  3NQU B;  1ZLA A;  4Z5T A;  5B32 A;  3AZM A;  3B6G D;  1TAF B;  4R8P C;  4Z66 C;  2HIO D;  3AZI D;  3AZL B;  5CPK A;  2CV5 B;  1U35 B;  5DNM B;  2F8N D;  4KHA A;  5B40 A;  2CWE A;  3B0B A;  1ID3 C;  5BT1 D;  5B31 C;  5B32 G;  5FUG B;  1P3A D;  4KUD C;  5B1M C;  5GXQ A;  1M1A A;  3EG5 B;  1KX5 B;  1TZY B;  4G91 C;  3X1V B;  4LD9 D;  4G92 C;  3KXB D;  3KFU G;  1P3P D;  3AZH A;  4JJN B;  1M19 C;  3AZF B;  3AZE C;  3MGP B;  1P3F B;  5CPI A;  1P3O B;  2ZY2 A;  4X23 A;  5AVB B;  3W99 B;  5B2J C;  5GT0 A;  4H9R A;  1P3K C;  1HQ3 A;  5AVC D;  4E44 A;  3TU4 A;  2Y2Q A;  5AV5 C;  3KWQ A;  2BYM A;  4WU9 B;  3B6G B;  4WU8 B;  5C3I B;  3MNN A;  4NE3 A;  3AZI B;  3W98 C;  3LEL D;  2NZD D;  3B6F C;  3AZK C;  4KGC D;  1BH9 A;  1ZLA D;  2IO5 C;  4Z5T D;  4CSR A;  5B32 D;  3AZM D;  2PYO C;  3MGS A;  2LY8 A;  5GSU B;  2JE5 A;  2NQB A;  1P3A B;  2FJ7 D;  3B0D C;  1TAF A;  3AZL A;  1P3G C;  1P3B B;  5AV6 C;  5CPJ A;  1P3L B;  3KUY C;  5DNM A;  1U35 A;  4LD9 B;  3KXB B;  1P3P B;  1S32 A;  4HGA B;  5GXQ D;  2UWX A;  4G92 B;  3X1S C;  3MGQ C;  1M1A D;  1B67 A;  5B1L A;  1AOI B;  4UUZ B;  3REI C;  1T3U A;  3C1B C;  4QLC C;  3AZH D;  2XD1 A;  3X1V A;  5AVC B;  1WWS A;  5CPI D;  4JJN A;  1P3M C;  4WV4 B;  3MGP A;  1KX3 C;  1BFM A;  2XD5 A;  5GT0 D;  4WNN B;  1P3O A;  3WA9 B;  1HQ3 D;  2NZD B;  3W99 A;  5AVB A;  4J8W C;  3KWQ D;  5BNV B;  4KGC B;  3AYW C;  4Z5T B;  5B32 B;  2PYO B;  4WU8 A;  2FJ7 B;  3AZI A;  2ZY5 A;  1KX4 C;  1M18 C;  4Z66 A;  3MGS D;  5B0Z C;  3C1C C;  1ID3 A;  3VH5 W;  5GSU A;  4ZUX C;  3AZL D;  5B31 A;  3LJA C;  5CPJ D;  5DNM D;  5AY8 D;  4XZQ C;  3AZG C;  1P3B A;  1ULY A;  1P3L A;  1S32 D;  3X1T B;  3REK C;  3EPL A;  5B31 G;  3A6N D;  1P3P A;  5B1L D;  2DQN C;  5B0Y C;  3MVD C;  2YFV B;  3AZE A;  3X1V D;  1AOI A;  4UUZ A;  1HQ3 B;  4J8U C;  3REH C;  1EQZ C;  4E45 A;  3AV2 B;  5AVC A;  2VQR A;  3MGP D;  3KSY A;  4YS3 B;  1P3K A;  3LZ0 C;  4CAY A;  3W99 D;  5AVB D;  2F8N K;  3WA9 A;  5CHL B;  3MGS B;  5AV9 B;  3W98 A;  5BNV A;  3AFA C;  1ID3 D;  3MGR C;  3B6F A;  3AZK A;  5B33 C;  4WU8 D;  3AN2 C;  3REJ C;  3REL C;  5CPJ B;  2PYO A;  2FJ7 A;  5AY8 B;  5B24 C;  4Z66 D;  5CP6 C;  5KDM A;  1S32 B;  1F66 C;  5F99 B;  1P34 C;  3VH5 A;  4J8X C;  2HUE B;  3A6N B;  5GSU D;  5AV6 A;  3UTB C;  5B1L B;  5B31 D;  3AZG B;  3KUY A;  2F8N H;  3O62 C;  4J8V C;  1P3B D;  4KUD D;  3AZN C;  1P3L D;  4Z2M H;  5BNX A;  2Y2J A;  1H3O B;  2HIO C;  1P3I C;  5E5A C;  3X1T A;  3REI A;  3W96 B;  4QLC A;  1M19 D;  3AZE D;  1AOI D;  4H9P A;  2YFV A;  3A1K A;  4XUJ B;  3AZJ C;  3AV1 C;  1P3K D;  5JRG C;  5B2I C;  3AV2 A;  3A1I A;  4YS3 A;  2W8S A;  5DNN B;  3AYW A;  3WA9 D;  3VH6 A;  4Z66 B;  4R8P B;  3W98 D;  3B6F D;  5BS7 C;  3AZK D;  2Y2P A;  2ZY4 A;  4EO5 C;  5BO0 A;  1ID3 B;  5AV9 A;  3R45 B;  5B31 B;  3IP4 C;  2PYO D;  3WKJ C;  2BG1 A;  4KUD B;  5B1M B;  3W97 C;  5AY8 A;  2J8P A;  4ZUX A;  4WZS B;  5AV6 D;  4H9O B;  3LJA A;  3KUY D;  4G91 B;  5F99 A;  3LEL C;  4DRB A;  3A6N A;  3AZG A;  1JFI B;  4DRA A;  3LZ1 C;  3REK A;  1M19 B;  3AZE B;  3MGQ D;  1ZLA C;  3AZM C;  3WAA C;  2DF4 C;  4NE5 A;  1R4V A;  2YFW B;  4YM6 C;  5CPK C;  3X1T D;  3REI D;  1KU5 A;  5B40 C;  3EPH A;  5B2J B;  3C1B D;  1H3O A;  3MVD A;  4QLC D;  1P3K B;  2Y2L A;  4J8U A;  3W96 A;  3AL0 C;  4CAY B;  1EQZ A;  5AV5 B;  3B0C W;  5B2I B;  3H0M C;  2RVQ C;  5GXQ C;  2BYK A;  3LZ0 A;  4XUJ A;  3W98 B;  3AV2 D;  3B6F B;  3AZK B;  4ZBJ C;  4YS3 D;  3UT9 C;  3X1U C;  4AWL C;  3AZH C;  3AYW D;  1A7W A;  2IO5 B;  3V9R B;  5AV8 C;  5KDM B;  5DNN A;  3MGR A;  3AN2 A;  3REJ A;  4X23 C;  3B0D B;  4R8P A;  1P3G B;  5AV9 D;  5AV6 B;  1KX4 D;  5GT0 C;  3KUY B;  2ARO C;  5B24 A;  5B0Z D;  3WTP C;  3R45 A;  3TU4 C;  3KWQ C;  3C1C D;  1F66 A;  3X1S B;  3MGQ B;  4J8X A;  3UTB A;  5BNX B;  4ZUX D;  3LJA D;  3LZ1 B;  3UTA C;  4KUD A;  3H0R C;  5B1M A;  3MNN C;  3O62 A;  5F99 D;  3REI B;  3WAA B;  4XZQ D;  3AZG D;  3C1B B;  5GT3 C;  4H9O A;  4QLC B;  4WJ3 C;  3VH5 T;  2JCH A;  3REK D;  2Y2K A;  1JFI A;  1P3I A;  4H9P B;  2NQB C;  1P3M B;  1M19 A;  1KX3 B;  3MVD D;  3P5J B;  3AZL C;  2YFW A;  2CV5 C;  2FFF B;  1U35 C;  5DNM C;  4J8U D;  2Y2N A;  3W96 D;  5B2J A;  4J8W B;  1EQZ D;  1Q9C A;  3AZJ A;  3AYW B;  3AV1 A;  5JRG A;  5AV5 A;  3LZ0 D;  4AWL B;  5B2I A;  4XUJ D;  4H9S C;  4H9N B;  1WWI A;  3VH6 W;  2Y2G A;  5BO0 B;  4DQY B;  1KX5 C;  1BH8 B;  1TZY C;  1M18 B;  1KX4 B;  3X1V C;  5B0Z B;  5DNN D;  3MGR D;  5BS7 A;  3C1C B;  4JJN C;  3AZF C;  3V9R A;  3AN2 D;  3REJ D;  3MGP C;  1P3F C;  4R8P D;  4ZUX B;  3LJA B;  2ZY3 A;  3VH6 T;  1P3O C;  2RIQ A;  5B24 D;  3W99 C;  5AVB C;  4XZQ B;  5CP6 D;  1P3G A;  3WKJ A;  3W97 A;  1F66 D;  1P34 D;  2Y2O A;  3REK B;  3NQJ B;  4J8X D;  3UTB D;  5B0Y B;  3O62 D;  5B1M D;  4WU9 C;  2Y2M A;  3X1S A;  3MGQ A;  3B6G C;  2Y2H A;  4WU8 C;  3LZ1 A;  5C3I C;  3F6T A;  3MVD B;  3AZI C;  4J8U B;  3WAA A;  3C1B A;  3REH B;  1EQZ B;  5BT1 C;  1N1J A;  2JSS A;  5E5A D;  4YM6 A;  1P3I D;  2BYK B;  5GSU C;  3LZ0 B;  2G5I C;  1P3A C;  1P3M A;  2F2A C;  1KX3 A;  5B2J D;  5G49 A;  1P3B C;  3AZJ D;  1P3L C;  4LD9 C;  3AV1 D;  3KXB C;  4J8W A;  3EPJ A;  5JRG D;  5AV5 D;  1P3P C;  3AFA B;  5B2I D;  3MGR B;  4HGA C;  5B33 B;  3UT9 A;  3AN2 B;  3REJ B;  3X1U A;  3REL B;  4H9N A;  1AOI C;  1B6W A;  5B24 B;  5AV8 A;  5CP6 B;  1BH8 A;  1M18 A;  1KX4 A;  1F66 B;  1P34 B;  5AVC C;  3UTB B;  4J8X B;  5B0Z A;  4H9Q B;  2ARO A;  3O62 B;  3C1C A;  4J8V B;  3WTP A;  3WKJ D;  1P3G D;  3AZN B;  3W97 D;  3WA9 C;  2L5A A;  2NZD C;  4NE6 A;  4XZQ A;  3UTA A;  2HIO B;  1P3I B;  4KGC C;  5E5A B;  3X1S D;  2F8N B;  3NQJ A;  4Z5T C;  5B32 C;  5GT3 A;  3LZ1 D;  5B0Y A;  1F1E A;  2G5H C;  3WAA D;  2FJ7 C;  1HTA A;  4YM6 D;  3NQU A;  5CPK D;  3AZJ B;  3AV1 B;  5B40 D;  3REH A;  2CV5 A;  5JRG B;  5JA4 B;  1P3M D;  3H0L C;  1KX3 D;  1M1A C;  2RVQ D;  3WTP E;  5FUG A;  4J8W D;  4H9S A;  3X1T C;  3B0C T;  3UT9 D;  4EO5 B;  3X1U D;  1KX5 A;  1TZY A;  3AFA A;  5CPI C;  2ZM5 A;  5B33 A;  3FDD A;  5AV8 D;  3REL A;  3WKJ B;  1M18 D;  3AZF A;  3W97 B;  1PZR A;  1HQ3 C;  4X23 D;  1P3F A;  3EPK A;  5CP6 A;  2ARO D;  1P34 A;  3LEL B;  3AV2 C;  3WTP D;  4YS3 C;  3TU4 D;  4H9Q A;  1ZLA B;  3AZM B;  4J8V A;  3UTA D;  3AZN A;  3MNN D;  1N1J B;  4YM6 B;  4WU9 A;  5CPK B;  3B6G A;  4KHA B;  5B40 B;  5GT3 D;  3MGS C;  2HIO A;  5AV9 C;  5B0Y D;  5E5A A;  4NFT A;  2F8N A;  2NQB D;  5G49 B;  5CPJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...