2NQBA

Drosophila nucleosome structure
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-satellite DNA
publication title Comparative analysis of nucleosome structures from different species.
rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nqbA00
3WA9C 5B0YC 2PYOC 5BT1C 1TAFB 4XUJB 4ZBJC 1S32A 2YFVA 5B31C 4Z66B 1HQ3A 3C1BA 5CPKD 3AZJB 4EO5C 1M1AA 3UTBB 5CP6C 1KX4D 5AV8C 1U35D 5E5AA 5JRGB 3LELA 3WTPB 2AROB 1P3KC 3W96C 4WU9D 1KX3A 3REIA 1P34A 3UT9D 2HIOC 3KWQD 3MGRD 4KHAB 3VH6A 3WAAC 3WA9D 5B0ZA 2CV5C 3X1TC 3AV2B 5BT1D 4YM6A 1ZLAB 5B31D 3B6FA 3TU4B 5CPIB 1S32C 3LZ0B 5CP6D 1TZYA 5AV6A 1HQ3C 3C1BC 5B24D 1F66B 5AV8D 2NZDB 2JSSA 4AWLC 3AZED 3X1VB 1JFIA 3LZ1D 5E5AC 2IO5C 4ZUXB 3AZFB 1P3AA 1P3KD 3LELC 5GT3B 4YS3A 2HIOD 3WTPE 3REHC 1KX3C 3REIC 1P34C 3NQUB 5CPJA 1Q9CA 3AZGA 1P3LA 2CV5D 4J8XB 5BNVA 5B0ZC 4KUDB 4JJNA 2LY8A 4YM6C 1S32D 4G91C 3B6FC 3KXBB 3C1BD 3B0DC 5F99A 1TZYC 5BS7A 5AV6C 3AFAD 1P3GB 5JA4B 4H9NB 1P3AC 4X23D 3REHD 4Z2MG 3REID 4YS3C 3WKJA 1M19A 4HGAB 4UUZA 4G92C 4KGCB 1B6WA 5CPJC 3AZKA 3AZGC 3A6NB 1P3LC 2NQBD 1P3FB 5AV9A 5DNNA 4E44A 4YM6D 4JJNC 2BYMA 3W97B 1P3MB 4WV4B 2FJ7A 5F99C 5BS7C 3MGSA 4H9OB 1P3OD 3VH5A 1WWIA 1KX5B 1P3AD 3REKB 4YS3D 5B33D 5BNXB 3O62B 5AVCD 3WKJC 5CPJD 1M19C 1P3BB 1P3LD 3RELA 5B1LA 4NFTA 5CHLB 3AZKC 3KUYB 5FUGA 5AV9C 5DNNC 5B2JA 3TU4D 3KWQA 5GSUD 1F1EA 1N1JB 5B0YB 3REJA 3AZHB 3X1UA 4J8WA 2PYOB 4ZBJB 2FJ7C 1AOIA 1KU5A 4EO5B 3MGSC 5DNMB 1ULYA 1M18B 4QLCD 5B24A 1M19D 3AZEA 3LZ1A 3W96B 4M6BA 3RELC 2F8NB 5B1LC 3NQJA 3AYWB 4J8UD 3WAAB 3MGQB 1HTAA 5B2JC 3AV1D 3X1TB 3KWQC 4LD9B 3REJC 3X1UC 4J8WC 3MGSD 5BO0A 4R8PA 2YFVB 3MNNB 1HQ3B 1AOIC 4H9RA 1M1AB 4AWLB 3AZLD 4Z5TB 5B40A 4WU8B 5E5AB 3AFAA 5B24C 5B1MB 3LELB 3AZEC 3LZ1C 5G49A 5AV5B 4WNNA 5AVBD 5B1LD 3RELD 5C3IB 4X23A 5GXQD 3REHA 1P34B 5B2JD 4XZQA 3AN2A 1EQZB 3REJD 5B0ZB 1ID3B 1P3PA 4H9QB 3W98A 3X1UD 4J8WD 2NQBA 3LJAD 3VH6W 1H3OB 3AZNB 4J8VD 2HUEC 3B6GB 1BH9A 5GT0B 1AOID 3B6FB 3B0DB 4R8PC 4E45A 4Z66A 1TZYB 5AV6B 3AZJA 4NE3A 3UTBA 5B40C 3AFAC 1P3OA 3W99D 5JRGA 3V9RA 3WTPA 4G92B 3UTAD 4X23C 5B33A 3C1CD 5B2IB 3MVDB 1P3ID 5AVCA 3AZGB 2BYKB 4XZQC 3AN2C 1P3PC 4JJNB 3W98C 2NQBC 1ZLAA 4Z2MH 4R8PD 5AY8B 3TU4A 5GSUA 3AZMB 2L5AA 5B32D 5F99B 4Z66C 5B40D 1F66A 3AZJC 3MGPD 3UTBC 4ZUXA 3AZFA 1P3OC 5JRGC 3X1SB 3WTPC 3WKJB 3AZID 4QLCA 2YFWB 5B33C 4XZQD 3AN2D 3AZKB 5AVCC 1P3PD 5AV9B 5DNNB 3W98D 4XUJD 2BYMB 4J8UA 1ZLAC 3AV1A 4Z66D 3KXBA 3TU4C 5GSUC 3AZJD 2FJ7B 3UTBD 1F66C 4CAYB 1P3GA 5JRGD 4H9NA 5CPKB 4ZUXC 3WTPD 3AZFC 2AROD 3AZLA 4H9PB 1KX4B 3VH5W 1U35B 3VH6T 4QLCC 4NE5A 5AVBA 4WU9B 5FUGB 5GXQA 3UT9B 3AV2D 3KWQB 1ZLAD 3MGRB 3W97A 4J8UC 5CPID 3WA9B 3LZ0D 3AV1C 3KXBC 1F66D 3R45B 2NZDD 3LJAA 3X1VD 3B0CW 5B31B 4J8VA 4H9OA 4ZUXD 3AZFD 1P3GC 5CP6B 2F8NH 4CSRA 1WWSA 5GT3D 3B0BA 5B24B 5AV8B 3AZEB 3AZLC 1A7WA 1BFMA 5B2ID 5BNXA 3LZ1B 4HGAC 1P3KB 3W99A 4J8XD 3NQJB 2HIOB 5AVBC 4KUDD 3UTAA 5GXQC 3C1CA 1P3IA 2CV5B 3KXBD 3W97C 3AZHA 5BO0B 3LJAC 2RVQC 1S32B 4H9RB 5DNMA 1P3GD 4J8VC 3C1BB 4DRBA 5B32A 1M18A 5KDMA 5B32G 3AFAB 3MGPA 2IO5B 5G49B 4KGCD 1BH8A 4X23B 3REHB 3A6ND 3W99C 1KX3B 1P3FD 3REIB 3AZIA 3AYWA 3UTAC 3MGQA 3C1CC 3W97D 1P3IC 1P3MD 2NQBB 3AZHC 4YM6B 1BH9B 2RVQD 4G91B 3VH5T 3MNNA 1TAFA 4XUJA 1KX5D 5DNMC 3REKD 4Z5TA 5B32C 1M18C 4WU8A 1JFIB 3O62D 5B1MA 1P3OB 3KSYA 3MGPC 1P3AB 3V9RB 1P3BD 5AV5A 4YS3B 2AROA 5B33B 3KUYD 5AVCB 3AZIC 3AYWC 5CPJB 3B0CT 4KHAA 1P3LB 4NE6A 3MGQC 1EQZA 5B0YD 1ID3A 4H9QA 3AZHD 2PYOD 4LD9C 5BNVB 3AZNA 1H3OA 3AV2A 3B6GA 5GT0A 5GSUB 5DNMD 3MNNC 4XUJC 5CPIA 3LZ0A 1M18D 1M1AC 4Z5TC 2NZDA 3X1VA 4WU8C 4WZSB 5B1MC 3W96D 5AV5C 2F8ND 5GT3A 4QLCB 5C3IC 3AYWD 2AROC 1M19B 4UUZB 5B2IA 3MVDA 3WAAD 3NQUA 3MGQD 3X1TD 4LD9D 2BYKA 1EQZC 4J8XA 1ID3C 4KUDA 4J8UB 4H9SA 3AZNC 3AV2C 3MNND 3B6GC 5AY8A 3AV1B 2F8NK 1HQ3D 5GT0C 3AZMA 1M1AD 1R4VA 4Z5TD 5CPIC 3LZ0C 4WU8D 5E5AD 3MGSB 5B1MD 2NZDC 3X1VC 2CWEA 3LELD 5JA4A 5AV5D 3AZLB 3X1SA 1KX3D 1P34D 5GT3C 2YFWA 5B2IC 3MVDC 1EQZD 3RELB 5AVBB 4KGCA 5B1LB 5B0ZD 1ID3D 5GXQB 3A6NA 4J8XC 1P3FA 3AZND 3B6GD 5B2JB 3B6FD 5GT0D 4KUDC 4H9SC 5AY8C 1TZYD 5AV6D 3REJB 3X1UB 4J8WB 3AZMC 1P3MA 3LJAB 4J8VB 1AOIB 4CAYA 1KX5A 4CSRB 5CPKA 1B67A 4DRAA 3REKA 4H9PA 3X1SC 1KX4A 1U35A 3MVDD 3O62A 3AZGD 3W99B 1P3BA 4KGCC 4WU9A 4JJND 3UTAB 3UT9A 3KUYA 3A6NC 3C1CB 1P3IB 1P3FC 3MGRA 5AY8D 3AZMD 3WA9A 1N1JA 5F99D 5B0YA 2HUEB 2PYOA 3R45A 1P3MC 4R8PB 5B31A 5B31G 5B32B 1KX5C 5CP6A 3X1SD 5KDMB 5B40B 5CPKC 5AV8A 3MGPB 3REKC 3WKJD 1KX4C 1U35C 1BH8B 3O62C 3AZKD 4WNNB 1P3KA 3W96A 5AV9D 5DNND 1P3BC 2HIOA 3AZIB 2F8NA 4WU9C 2F8NG 3UT9C 3KUYC 3WAAA 4XZQB 3MGRC 3AN2B 2CV5A 3X1TA 1P3PB 4LD9A 3W98B 2FJ7D
chains in the Genus database with same CATH superfamily
3WA9C 5B0YC 2PYOC 1Z2CB 5BT1C 1TAFB 4XUJB 2DQNC 4ZBJC 1S32A 2YFVA 5B31C 4Z66B 1HQ3A 3C1BA 5CPKD 3AZJB 4EO5C 1M1AA 3UTBB 5CP6C 1KX4D 5AV8C 1U35D 5E5AA 2Y2HA 3EPHA 5JRGB 3LELA 3WTPB 2AROB 1P3KC 3W96C 4WU9D 1KX3A 3REIA 1P34A 2Y2GA 3UT9D 2HIOC 3KWQD 3MGRD 4KHAB 3VH6A 3WAAC 3WA9D 2J8PA 5B0ZA 2CV5C 3X1TC 3AV2B 5BT1D 4YM6A 1ZLAB 5B31D 3B6FA 3TU4B 5CPIB 1S32C 3LZ0B 5CP6D 1TZYA 5AV6A 1HQ3C 3C1BC 5B24D 1F66B 5AV8D 2NZDB 2JSSA 4AWLC 3AZED 3X1VB 1JFIA 2DF4C 3LZ1D 5E5AC 2IO5C 4ZUXB 3AZFB 1P3AA 1P3KD 3LELC 5GT3B 4YS3A 2HIOD 3WTPE 3REHC 1KX3C 3REIC 1P34C 3NQUB 5CPJA 1Q9CA 3AZGA 1P3LA 2CV5D 4J8XB 5BNVA 5B0ZC 4KUDB 4JJNA 2LY8A 4YM6C 1S32D 4G91C 3B6FC 3KXBB 3C1BD 3B0DC 3AL0C 5F99A 1TZYC 5BS7A 5AV6C 3AFAD 2Y2QA 1P3GB 5JA4B 3P5JB 2VQRA 4H9NB 1P3AC 4X23D 3REHD 4Z2MG 3REID 4YS3C 3WKJA 1M19A 4HGAB 4UUZA 4G92C 4KGCB 1B6WA 5CPJC 3AZKA 3AZGC 3A6NB 1P3LC 2NQBD 1P3FB 5AV9A 5DNNA 4E44A 4YM6D 4JJNC 2BYMA 3W97B 1P3MB 4WV4B 2FJ7A 4WJ3C 5F99C 5BS7C 3MGSA 4H9OB 1P3OD 3VH5A 1WWIA 1KX5B 1P3AD 3REKB 4YS3D 5B33D 5BNXB 3O62B 5AVCD 3WKJC 5CPJD 1M19C 1P3BB 1P3LD 3RELA 5B1LA 4NFTA 5CHLB 3AZKC 3KUYB 5FUGA 5AV9C 5DNNC 5B2JA 3TU4D 3KWQA 5GSUD 1F1EA 1N1JB 5B0YB 3REJA 3AZHB 3X1UA 4J8WA 2PYOB 4ZBJB 2FJ7C 1AOIA 1KU5A 4EO5B 3MGSC 5DNMB 1ULYA 1M18B 4QLCD 5B24A 1M19D 3AZEA 3LZ1A 3W96B 4M6BA 3RELC 2F8NB 5B1LC 3NQJA 3AYWB 4J8UD 3WAAB 3MGQB 1HTAA 5B2JC 3AV1D 3X1TB 3KWQC 4LD9B 4UPKA 3REJC 2Y2JA 3X1UC 4J8WC 3MGSD 5BO0A 4R8PA 2YFVB 3MNNB 1HQ3B 1AOIC 4H9RA 1M1AB 4AWLB 3AZLD 4Z5TB 5B40A 4WU8B 3FDDA 5E5AB 3AFAA 5B24C 5B1MB 2JCHA 2Y2OA 3LELB 3AZEC 3LZ1C 5G49A 5AV5B 4WNNA 5AVBD 5B1LD 3RELD 5C3IB 2JE5A 5GXQD 4X23A 3REHA 1P34B 5B2JD 2Y2IA 4XZQA 3AN2A 1EQZB 3REJD 5B0ZB 1ID3B 1P3PA 4H9QB 3W98A 3X1UD 4J8WD 2NQBA 3LJAD 3VH6W 1H3OB 3AZNB 4J8VD 2HUEC 3B6GB 1BH9A 5GT0B 1AOID 3B6FB 3B0DB 4R8PC 2FFFB 2RIQA 4E45A 1TZYB 5AV6B 4Z66A 3AZJA 4NE3A 3UTBA 3EPLA 5B40C 1T3UA 3AFAC 1P3OA 3W99D 5JRGA 3V9RA 3WTPA 4G92B 3UTAD 4X23C 5B33A 3C1CD 5B2IB 3MVDB 1P3ID 5AVCA 3AZGB 3H0MC 2BYKB 4XZQC 3AN2C 3KFUG 1P3PC 4JJNB 3A1KA 2Y2LA 3W98C 2NQBC 1ZLAA 4Z2MH 4R8PD 5AY8B 3TU4A 4DQYB 5GSUA 3AZMB 2L5AA 5B32D 5F99B 4Z66C 2W8SA 5B40D 1F66A 1PZRA 3AZJC 3MGPD 3UTBC 4ZUXA 3AZFA 1P3OC 5JRGC 3X1SB 2Y2MA 3H0LC 3WTPC 3AZID 3WKJB 4QLCA 2YFWB 5B33C 4XZQD 3AN2D 3AZKB 5AVCC 3EPKA 1P3PD 5AV9B 5DNNB 3W98D 4XUJD 2BYMB 4J8UA 1ZLAC 3AV1A 4Z66D 3KXBA 3TU4C 5GSUC 3AZJD 2FJ7B 3UTBD 1F66C 4CAYB 1P3GA 2BG1A 2G5IC 5JRGD 4H9NA 5CPKB 4ZUXC 3WTPD 3AZFC 2AROD 3AZLA 4H9PB 1KX4B 3VH5W 1U35B 3VH6T 4QLCC 4NE5A 5AVBA 4WU9B 5FUGB 5GXQA 3UT9B 3AV2D 3KWQB 1ZLAD 3MGRB 3W97A 4J8UC 5CPID 3WA9B 3LZ0D 3AV1C 3KXBC 1F66D 2ZY5A 3R45B 2NZDD 3LJAA 3X1VD 3B0CW 5B31B 4J8VA 4H9OA 4ZUXD 3AZFD 1P3GC 2UWXA 5CP6B 2F8NH 4CSRA 1WWSA 5GT3D 3B0BA 5B24B 5AV8B 3AZEB 3AZLC 1A7WA 1BFMA 5B2ID 5BNXA 3LZ1B 4HGAC 2Y2PA 1P3KB 3W99A 3IP4C 4J8XD 3NQJB 2HIOB 2ZM5A 5AVBC 4KUDD 3UTAA 5GXQC 3C1CA 1P3IA 2XD5A 2CV5B 3KXBD 3W97C 3AZHA 2XD1A 5BO0B 3LJAC 2RVQC 1S32B 4H9RB 5DNMA 1P3GD 4J8VC 3C1BB 4DRBA 5B32A 1M18A 5KDMA 5B32G 3AFAB 3MGPA 2IO5B 5G49B 4KGCD 1BH8A 4X23B 3REHB 3A6ND 3W99C 1KX3B 1P3FD 3REIB 3AZIA 3AYWA 3UTAC 3MGQA 3C1CC 3W97D 1P3IC 1P3MD 2ZY2A 2NQBB 3H0RC 3AZHC 4YM6B 1BH9B 2RVQD 4G91B 3VH5T 3MNNA 1TAFA 4XUJA 1KX5D 2ZY4A 5DNMC 3REKD 2F2AC 4Z5TA 5B32C 1M18C 4WU8A 1JFIB 3O62D 5B1MA 1P3OB 3KSYA 3MGPC 1P3AB 3V9RB 2G5HC 1P3BD 5AV5A 4YS3B 2AROA 5B33B 3KUYD 5AVCB 3AZIC 3AYWC 5CPJB 3B0CT 4KHAA 1P3LB 4NE6A 3MGQC 1EQZA 5B0YD 1ID3A 4H9QA 3AZHD 2PYOD 4LD9C 5BNVB 3AZNA 1H3OA 3AV2A 3B6GA 5GT0A 5GSUB 5DNMD 3MNNC 4XUJC 5CPIA 3LZ0A 1M18D 1M1AC 4Z5TC 2NZDA 3X1VA 4WU8C 4WZSB 5B1MC 3W96D 5AV5C 2F8ND 5GT3A 4QLCB 5C3IC 3AYWD 2AROC 2Y2NA 1M19B 4UUZB 5B2IA 3MVDA 3WAAD 3NQUA 3MGQD 3X1TD 4LD9D 2BYKA 1EQZC 4J8XA 1ID3C 4KUDA 4J8UB 4H9SA 3AZNC 3AV2C 3MNND 3B6GC 5AY8A 3AV1B 2F8NK 1HQ3D 5GT0C 3F6TA 3AZMA 2Y2KA 1M1AD 1R4VA 4Z5TD 5CPIC 3LZ0C 4WU8D 5E5AD 3MGSB 5B1MD 2NZDC 3X1VC 2CWEA 3LELD 5JA4A 5AV5D 3AZLB 3X1SA 1KX3D 1P34D 5GT3C 2YFWA 5B2IC 3MVDC 1EQZD 3RELB 5AVBB 4KGCA 5B1LB 5B0ZD 1ID3D 5GXQB 3A6NA 4J8XC 1P3FA 3AZND 3B6GD 5B2JB 3B6FD 5GT0D 4KUDC 4H9SC 5AY8C 1TZYD 5AV6D 3REJB 3X1UB 4J8WB 3AZMC 1P3MA 3LJAB 4J8VB 1AOIB 4CAYA 1KX5A 3EPJA 4CSRB 5CPKA 2ZY3A 1B67A 4DRAA 3REKA 4H9PA 3X1SC 1KX4A 3EG5B 1U35A 3MVDD 3O62A 3AZGD 3W99B 1P3BA 4KGCC 4WU9A 4JJND 3UTAB 3UT9A 3KUYA 3A6NC 3C1CB 1P3IB 1P3FC 3MGRA 5AY8D 3AZMD 3WA9A 1N1JA 5F99D 5B0YA 2HUEB 2PYOA 3R45A 1P3MC 4R8PB 5B31A 5B31G 5B32B 1KX5C 5CP6A 3X1SD 5KDMB 5B40B 5CPKC 5AV8A 3MGPB 3REKC 3WKJD 3A1IA 1KX4C 1U35C 1BH8B 3O62C 3AZKD 4WNNB 1P3KA 3W96A 5AV9D 5DNND 1P3BC 2HIOA 3AZIB 2F8NA 4WU9C 2F8NG 3UT9C 3KUYC 3WAAA 4XZQB 3MGRC 3AN2B 2CV5A 1W2EA 3X1TA 1P3PB 4LD9A 3W98B 2FJ7D
chains in the Genus database with same CATH topology
3WA9C 5B0YC 2PYOC 1Z2CB 5BT1C 1TAFB 4XUJB 2DQNC 4ZBJC 1S32A 2YFVA 5B31C 4Z66B 1HQ3A 3C1BA 5CPKD 3AZJB 4EO5C 1M1AA 3UTBB 5CP6C 1KX4D 5AV8C 1U35D 5E5AA 2Y2HA 3EPHA 5JRGB 3LELA 3WTPB 2AROB 1P3KC 3W96C 4WU9D 1KX3A 3REIA 1P34A 2Y2GA 3UT9D 2HIOC 3KWQD 3MGRD 4KHAB 3VH6A 3WAAC 3WA9D 2J8PA 5B0ZA 2CV5C 3X1TC 3AV2B 5BT1D 4YM6A 1ZLAB 5B31D 3B6FA 3TU4B 5CPIB 1S32C 3LZ0B 5CP6D 1TZYA 5AV6A 1HQ3C 3C1BC 5B24D 1F66B 5AV8D 2NZDB 2JSSA 4AWLC 3AZED 3X1VB 1JFIA 2DF4C 3LZ1D 5E5AC 2IO5C 4ZUXB 3AZFB 1P3AA 1P3KD 3LELC 5GT3B 4YS3A 2HIOD 3WTPE 3REHC 1KX3C 3REIC 1P34C 3NQUB 5CPJA 1Q9CA 3AZGA 1P3LA 2CV5D 4J8XB 5BNVA 5B0ZC 4KUDB 4JJNA 2LY8A 4YM6C 1S32D 4G91C 3B6FC 3KXBB 3C1BD 3B0DC 3AL0C 5F99A 1TZYC 5BS7A 5AV6C 3AFAD 2Y2QA 1P3GB 5JA4B 3P5JB 2VQRA 4H9NB 1P3AC 4X23D 3REHD 4Z2MG 3REID 4YS3C 3WKJA 1M19A 4HGAB 4UUZA 4G92C 4KGCB 1B6WA 5CPJC 3AZKA 3AZGC 3A6NB 1P3LC 2NQBD 1P3FB 5AV9A 5DNNA 4E44A 4YM6D 4JJNC 2BYMA 3W97B 1P3MB 4WV4B 2FJ7A 4WJ3C 5F99C 5BS7C 3MGSA 4H9OB 1P3OD 3VH5A 1WWIA 1KX5B 1P3AD 3REKB 4YS3D 5B33D 5BNXB 3O62B 5AVCD 3WKJC 5CPJD 1M19C 1P3BB 1P3LD 3RELA 5B1LA 4NFTA 5CHLB 3AZKC 3KUYB 5FUGA 5AV9C 5DNNC 5B2JA 3TU4D 3KWQA 5GSUD 1F1EA 1N1JB 5B0YB 3REJA 3AZHB 3X1UA 4J8WA 2PYOB 4ZBJB 2FJ7C 1AOIA 1KU5A 4EO5B 3MGSC 5DNMB 1ULYA 1M18B 4QLCD 5B24A 1M19D 3AZEA 3LZ1A 3W96B 4M6BA 3RELC 2F8NB 5B1LC 3NQJA 3AYWB 4J8UD 3WAAB 3MGQB 1HTAA 5B2JC 3AV1D 3X1TB 3KWQC 4LD9B 4UPKA 3REJC 2Y2JA 3X1UC 4J8WC 3MGSD 5BO0A 4R8PA 2YFVB 3MNNB 1HQ3B 1AOIC 4H9RA 1M1AB 4AWLB 3AZLD 4Z5TB 5B40A 4WU8B 3FDDA 5E5AB 3AFAA 5B24C 5B1MB 2JCHA 2Y2OA 3LELB 3AZEC 3LZ1C 5G49A 5AV5B 4WNNA 5AVBD 5B1LD 3RELD 5C3IB 2JE5A 5GXQD 4X23A 3REHA 1P34B 5B2JD 2Y2IA 4XZQA 3AN2A 1EQZB 3REJD 5B0ZB 1ID3B 1P3PA 4H9QB 3W98A 3X1UD 4J8WD 2NQBA 3LJAD 3VH6W 1H3OB 3AZNB 4J8VD 2HUEC 3B6GB 1BH9A 5GT0B 1AOID 3B6FB 3B0DB 4R8PC 2FFFB 2RIQA 4E45A 1TZYB 5AV6B 4Z66A 3AZJA 4NE3A 3UTBA 3EPLA 5B40C 1T3UA 3AFAC 1P3OA 3W99D 5JRGA 3V9RA 3WTPA 4G92B 3UTAD 4X23C 5B33A 3C1CD 5B2IB 3MVDB 1P3ID 5AVCA 3AZGB 3H0MC 2BYKB 4XZQC 3AN2C 3KFUG 1P3PC 4JJNB 3A1KA 2Y2LA 3W98C 2NQBC 1ZLAA 4Z2MH 4R8PD 5AY8B 3TU4A 4DQYB 5GSUA 3AZMB 2L5AA 5B32D 5F99B 4Z66C 2W8SA 5B40D 1F66A 1PZRA 3AZJC 3MGPD 3UTBC 4ZUXA 3AZFA 1P3OC 5JRGC 3X1SB 2Y2MA 3H0LC 3WTPC 3AZID 3WKJB 4QLCA 2YFWB 5B33C 4XZQD 3AN2D 3AZKB 5AVCC 3EPKA 1P3PD 5AV9B 5DNNB 3W98D 4XUJD 2BYMB 4J8UA 1ZLAC 3AV1A 4Z66D 3KXBA 3TU4C 5GSUC 3AZJD 2FJ7B 3UTBD 1F66C 4CAYB 1P3GA 2BG1A 2G5IC 5JRGD 4H9NA 5CPKB 4ZUXC 3WTPD 3AZFC 2AROD 3AZLA 4H9PB 1KX4B 3VH5W 1U35B 3VH6T 4QLCC 4NE5A 5AVBA 4WU9B 5FUGB 5GXQA 3UT9B 3AV2D 3KWQB 1ZLAD 3MGRB 3W97A 4J8UC 5CPID 3WA9B 3LZ0D 3AV1C 3KXBC 1F66D 2ZY5A 3R45B 2NZDD 3LJAA 3X1VD 3B0CW 5B31B 4J8VA 4H9OA 4ZUXD 3AZFD 1P3GC 2UWXA 5CP6B 2F8NH 4CSRA 1WWSA 5GT3D 3B0BA 5B24B 5AV8B 3AZEB 3AZLC 1A7WA 1BFMA 5B2ID 5BNXA 3LZ1B 4HGAC 2Y2PA 1P3KB 3W99A 3IP4C 4J8XD 3NQJB 2HIOB 2ZM5A 5AVBC 4KUDD 3UTAA 5GXQC 3C1CA 1P3IA 2XD5A 2CV5B 3KXBD 3W97C 3AZHA 2XD1A 5BO0B 3LJAC 2RVQC 1S32B 4H9RB 5DNMA 1P3GD 4J8VC 3C1BB 4DRBA 5B32A 1M18A 5KDMA 5B32G 3AFAB 3MGPA 2IO5B 5G49B 4KGCD 1BH8A 4X23B 3REHB 3A6ND 3W99C 1KX3B 1P3FD 3REIB 3AZIA 3AYWA 3UTAC 3MGQA 3C1CC 3W97D 1P3IC 1P3MD 2ZY2A 2NQBB 3H0RC 3AZHC 4YM6B 1BH9B 2RVQD 4G91B 3VH5T 3MNNA 1TAFA 4XUJA 1KX5D 2ZY4A 5DNMC 3REKD 2F2AC 4Z5TA 5B32C 1M18C 4WU8A 1JFIB 3O62D 5B1MA 1P3OB 3KSYA 3MGPC 1P3AB 3V9RB 2G5HC 1P3BD 5AV5A 4YS3B 2AROA 5B33B 3KUYD 5AVCB 3AZIC 3AYWC 5CPJB 3B0CT 4KHAA 1P3LB 4NE6A 3MGQC 1EQZA 5B0YD 1ID3A 4H9QA 3AZHD 2PYOD 4LD9C 5BNVB 3AZNA 1H3OA 3AV2A 3B6GA 5GT0A 5GSUB 5DNMD 3MNNC 4XUJC 5CPIA 3LZ0A 1M18D 1M1AC 4Z5TC 2NZDA 3X1VA 4WU8C 4WZSB 5B1MC 3W96D 5AV5C 2F8ND 5GT3A 4QLCB 5C3IC 3AYWD 2AROC 2Y2NA 1M19B 4UUZB 5B2IA 3MVDA 3WAAD 3NQUA 3MGQD 3X1TD 4LD9D 2BYKA 1EQZC 4J8XA 1ID3C 4KUDA 4J8UB 4H9SA 3AZNC 3AV2C 3MNND 3B6GC 5AY8A 3AV1B 2F8NK 1HQ3D 5GT0C 3F6TA 3AZMA 2Y2KA 1M1AD 1R4VA 4Z5TD 5CPIC 3LZ0C 4WU8D 5E5AD 3MGSB 5B1MD 2NZDC 3X1VC 2CWEA 3LELD 5JA4A 5AV5D 3AZLB 3X1SA 1KX3D 1P34D 5GT3C 2YFWA 5B2IC 3MVDC 1EQZD 3RELB 5AVBB 4KGCA 5B1LB 5B0ZD 1ID3D 5GXQB 3A6NA 4J8XC 1P3FA 3AZND 3B6GD 5B2JB 3B6FD 5GT0D 4KUDC 4H9SC 5AY8C 1TZYD 5AV6D 3REJB 3X1UB 4J8WB 3AZMC 1P3MA 3LJAB 4J8VB 1AOIB 4CAYA 1KX5A 3EPJA 4CSRB 5CPKA 2ZY3A 1B67A 4DRAA 3REKA 4H9PA 3X1SC 1KX4A 3EG5B 1U35A 3MVDD 3O62A 3AZGD 3W99B 1P3BA 4KGCC 4WU9A 4JJND 3UTAB 3UT9A 3KUYA 3A6NC 3C1CB 1P3IB 1P3FC 3MGRA 5AY8D 3AZMD 3WA9A 1N1JA 5F99D 5B0YA 2HUEB 2PYOA 3R45A 1P3MC 4R8PB 5B31A 5B31G 5B32B 1KX5C 5CP6A 3X1SD 5KDMB 5B40B 5CPKC 5AV8A 3MGPB 3REKC 3WKJD 3A1IA 1KX4C 1U35C 1BH8B 3O62C 3AZKD 4WNNB 1P3KA 3W96A 5AV9D 5DNND 1P3BC 2HIOA 3AZIB 2F8NA 4WU9C 2F8NG 3UT9C 3KUYC 3WAAA 4XZQB 3MGRC 3AN2B 2CV5A 1W2EA 3X1TA 1P3PB 4LD9A 3W98B 2FJ7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WA9 C;  5B0Y C;  2PYO C;  5BT1 C;  1TAF B;  4XUJ B;  4ZBJ C;  1S32 A;  2YFV A;  5B31 C;  4Z66 B;  1HQ3 A;  3C1B A;  5CPK D;  3AZJ B;  4EO5 C;  1M1A A;  3UTB B;  5CP6 C;  1KX4 D;  5AV8 C;  1U35 D;  5E5A A;  5JRG B;  3LEL A;  3WTP B;  2ARO B;  1P3K C;  3W96 C;  4WU9 D;  1KX3 A;  3REI A;  1P34 A;  3UT9 D;  2HIO C;  3KWQ D;  3MGR D;  4KHA B;  3VH6 A;  3WAA C;  3WA9 D;  5B0Z A;  2CV5 C;  3X1T C;  3AV2 B;  5BT1 D;  4YM6 A;  1ZLA B;  5B31 D;  3B6F A;  3TU4 B;  5CPI B;  1S32 C;  3LZ0 B;  5CP6 D;  1TZY A;  5AV6 A;  1HQ3 C;  3C1B C;  5B24 D;  1F66 B;  5AV8 D;  2NZD B;  2JSS A;  4AWL C;  3AZE D;  3X1V B;  1JFI A;  3LZ1 D;  5E5A C;  2IO5 C;  4ZUX B;  3AZF B;  1P3A A;  1P3K D;  3LEL C;  5GT3 B;  4YS3 A;  2HIO D;  3WTP E;  3REH C;  1KX3 C;  3REI C;  1P34 C;  3NQU B;  5CPJ A;  1Q9C A;  3AZG A;  1P3L A;  2CV5 D;  4J8X B;  5BNV A;  5B0Z C;  4KUD B;  4JJN A;  2LY8 A;  4YM6 C;  1S32 D;  4G91 C;  3B6F C;  3KXB B;  3C1B D;  3B0D C;  5F99 A;  1TZY C;  5BS7 A;  5AV6 C;  3AFA D;  1P3G B;  5JA4 B;  4H9N B;  1P3A C;  4X23 D;  3REH D;  4Z2M G;  3REI D;  4YS3 C;  3WKJ A;  1M19 A;  4HGA B;  4UUZ A;  4G92 C;  4KGC B;  1B6W A;  5CPJ C;  3AZK A;  3AZG C;  3A6N B;  1P3L C;  2NQB D;  1P3F B;  5AV9 A;  5DNN A;  4E44 A;  4YM6 D;  4JJN C;  2BYM A;  3W97 B;  1P3M B;  4WV4 B;  2FJ7 A;  5F99 C;  5BS7 C;  3MGS A;  4H9O B;  1P3O D;  3VH5 A;  1WWI A;  1KX5 B;  1P3A D;  3REK B;  4YS3 D;  5B33 D;  5BNX B;  3O62 B;  5AVC D;  3WKJ C;  5CPJ D;  1M19 C;  1P3B B;  1P3L D;  3REL A;  5B1L A;  4NFT A;  5CHL B;  3AZK C;  3KUY B;  5FUG A;  5AV9 C;  5DNN C;  5B2J A;  3TU4 D;  3KWQ A;  5GSU D;  1F1E A;  1N1J B;  5B0Y B;  3REJ A;  3AZH B;  3X1U A;  4J8W A;  2PYO B;  4ZBJ B;  2FJ7 C;  1AOI A;  1KU5 A;  4EO5 B;  3MGS C;  5DNM B;  1ULY A;  1M18 B;  4QLC D;  5B24 A;  1M19 D;  3AZE A;  3LZ1 A;  3W96 B;  4M6B A;  3REL C;  2F8N B;  5B1L C;  3NQJ A;  3AYW B;  4J8U D;  3WAA B;  3MGQ B;  1HTA A;  5B2J C;  3AV1 D;  3X1T B;  3KWQ C;  4LD9 B;  3REJ C;  3X1U C;  4J8W C;  3MGS D;  5BO0 A;  4R8P A;  2YFV B;  3MNN B;  1HQ3 B;  1AOI C;  4H9R A;  1M1A B;  4AWL B;  3AZL D;  4Z5T B;  5B40 A;  4WU8 B;  5E5A B;  3AFA A;  5B24 C;  5B1M B;  3LEL B;  3AZE C;  3LZ1 C;  5G49 A;  5AV5 B;  4WNN A;  5AVB D;  5B1L D;  3REL D;  5C3I B;  4X23 A;  5GXQ D;  3REH A;  1P34 B;  5B2J D;  4XZQ A;  3AN2 A;  1EQZ B;  3REJ D;  5B0Z B;  1ID3 B;  1P3P A;  4H9Q B;  3W98 A;  3X1U D;  4J8W D;  2NQB A;  3LJA D;  3VH6 W;  1H3O B;  3AZN B;  4J8V D;  2HUE C;  3B6G B;  1BH9 A;  5GT0 B;  1AOI D;  3B6F B;  3B0D B;  4R8P C;  4E45 A;  4Z66 A;  1TZY B;  5AV6 B;  3AZJ A;  4NE3 A;  3UTB A;  5B40 C;  3AFA C;  1P3O A;  3W99 D;  5JRG A;  3V9R A;  3WTP A;  4G92 B;  3UTA D;  4X23 C;  5B33 A;  3C1C D;  5B2I B;  3MVD B;  1P3I D;  5AVC A;  3AZG B;  2BYK B;  4XZQ C;  3AN2 C;  1P3P C;  4JJN B;  3W98 C;  2NQB C;  1ZLA A;  4Z2M H;  4R8P D;  5AY8 B;  3TU4 A;  5GSU A;  3AZM B;  2L5A A;  5B32 D;  5F99 B;  4Z66 C;  5B40 D;  1F66 A;  3AZJ C;  3MGP D;  3UTB C;  4ZUX A;  3AZF A;  1P3O C;  5JRG C;  3X1S B;  3WTP C;  3WKJ B;  3AZI D;  4QLC A;  2YFW B;  5B33 C;  4XZQ D;  3AN2 D;  3AZK B;  5AVC C;  1P3P D;  5AV9 B;  5DNN B;  3W98 D;  4XUJ D;  2BYM B;  4J8U A;  1ZLA C;  3AV1 A;  4Z66 D;  3KXB A;  3TU4 C;  5GSU C;  3AZJ D;  2FJ7 B;  3UTB D;  1F66 C;  4CAY B;  1P3G A;  5JRG D;  4H9N A;  5CPK B;  4ZUX C;  3WTP D;  3AZF C;  2ARO D;  3AZL A;  4H9P B;  1KX4 B;  3VH5 W;  1U35 B;  3VH6 T;  4QLC C;  4NE5 A;  5AVB A;  4WU9 B;  5FUG B;  5GXQ A;  3UT9 B;  3AV2 D;  3KWQ B;  1ZLA D;  3MGR B;  3W97 A;  4J8U C;  5CPI D;  3WA9 B;  3LZ0 D;  3AV1 C;  3KXB C;  1F66 D;  3R45 B;  2NZD D;  3LJA A;  3X1V D;  3B0C W;  5B31 B;  4J8V A;  4H9O A;  4ZUX D;  3AZF D;  1P3G C;  5CP6 B;  2F8N H;  4CSR A;  1WWS A;  5GT3 D;  3B0B A;  5B24 B;  5AV8 B;  3AZE B;  3AZL C;  1A7W A;  1BFM A;  5B2I D;  5BNX A;  3LZ1 B;  4HGA C;  1P3K B;  3W99 A;  4J8X D;  3NQJ B;  2HIO B;  5AVB C;  4KUD D;  3UTA A;  5GXQ C;  3C1C A;  1P3I A;  2CV5 B;  3KXB D;  3W97 C;  3AZH A;  5BO0 B;  3LJA C;  2RVQ C;  1S32 B;  4H9R B;  5DNM A;  1P3G D;  4J8V C;  3C1B B;  4DRB A;  5B32 A;  1M18 A;  5KDM A;  5B32 G;  3AFA B;  3MGP A;  2IO5 B;  5G49 B;  4KGC D;  1BH8 A;  4X23 B;  3REH B;  3A6N D;  3W99 C;  1KX3 B;  1P3F D;  3REI B;  3AZI A;  3AYW A;  3UTA C;  3MGQ A;  3C1C C;  3W97 D;  1P3I C;  1P3M D;  2NQB B;  3AZH C;  4YM6 B;  1BH9 B;  2RVQ D;  4G91 B;  3VH5 T;  3MNN A;  1TAF A;  4XUJ A;  1KX5 D;  5DNM C;  3REK D;  4Z5T A;  5B32 C;  1M18 C;  4WU8 A;  1JFI B;  3O62 D;  5B1M A;  1P3O B;  3KSY A;  3MGP C;  1P3A B;  3V9R B;  1P3B D;  5AV5 A;  4YS3 B;  2ARO A;  5B33 B;  3KUY D;  5AVC B;  3AZI C;  3AYW C;  5CPJ B;  3B0C T;  4KHA A;  1P3L B;  4NE6 A;  3MGQ C;  1EQZ A;  5B0Y D;  1ID3 A;  4H9Q A;  3AZH D;  2PYO D;  4LD9 C;  5BNV B;  3AZN A;  1H3O A;  3AV2 A;  3B6G A;  5GT0 A;  5GSU B;  5DNM D;  3MNN C;  4XUJ C;  5CPI A;  3LZ0 A;  1M18 D;  1M1A C;  4Z5T C;  2NZD A;  3X1V A;  4WU8 C;  4WZS B;  5B1M C;  3W96 D;  5AV5 C;  2F8N D;  5GT3 A;  4QLC B;  5C3I C;  3AYW D;  2ARO C;  1M19 B;  4UUZ B;  5B2I A;  3MVD A;  3WAA D;  3NQU A;  3MGQ D;  3X1T D;  4LD9 D;  2BYK A;  1EQZ C;  4J8X A;  1ID3 C;  4KUD A;  4J8U B;  4H9S A;  3AZN C;  3AV2 C;  3MNN D;  3B6G C;  5AY8 A;  3AV1 B;  2F8N K;  1HQ3 D;  5GT0 C;  3AZM A;  1M1A D;  1R4V A;  4Z5T D;  5CPI C;  3LZ0 C;  4WU8 D;  5E5A D;  3MGS B;  5B1M D;  2NZD C;  3X1V C;  2CWE A;  3LEL D;  5JA4 A;  5AV5 D;  3AZL B;  3X1S A;  1KX3 D;  1P34 D;  5GT3 C;  2YFW A;  5B2I C;  3MVD C;  1EQZ D;  3REL B;  5AVB B;  4KGC A;  5B1L B;  5B0Z D;  1ID3 D;  5GXQ B;  3A6N A;  4J8X C;  1P3F A;  3AZN D;  3B6G D;  5B2J B;  3B6F D;  5GT0 D;  4KUD C;  4H9S C;  5AY8 C;  1TZY D;  5AV6 D;  3REJ B;  3X1U B;  4J8W B;  3AZM C;  1P3M A;  3LJA B;  4J8V B;  1AOI B;  4CAY A;  1KX5 A;  4CSR B;  5CPK A;  1B67 A;  4DRA A;  3REK A;  4H9P A;  3X1S C;  1KX4 A;  1U35 A;  3MVD D;  3O62 A;  3AZG D;  3W99 B;  1P3B A;  4KGC C;  4WU9 A;  4JJN D;  3UTA B;  3UT9 A;  3KUY A;  3A6N C;  3C1C B;  1P3I B;  1P3F C;  3MGR A;  5AY8 D;  3AZM D;  3WA9 A;  1N1J A;  5F99 D;  5B0Y A;  2HUE B;  2PYO A;  3R45 A;  1P3M C;  4R8P B;  5B31 A;  5B31 G;  5B32 B;  1KX5 C;  5CP6 A;  3X1S D;  5KDM B;  5B40 B;  5CPK C;  5AV8 A;  3MGP B;  3REK C;  3WKJ D;  1KX4 C;  1U35 C;  1BH8 B;  3O62 C;  3AZK D;  4WNN B;  1P3K A;  3W96 A;  5AV9 D;  5DNN D;  1P3B C;  2HIO A;  3AZI B;  2F8N A;  4WU9 C;  2F8N G;  3UT9 C;  3KUY C;  3WAA A;  4XZQ B;  3MGR C;  3AN2 B;  2CV5 A;  3X1T A;  1P3P B;  4LD9 A;  3W98 B;  2FJ7 D; 
#chains in the Genus database with same CATH topology
 3WA9 C;  5B0Y C;  2PYO C;  1Z2C B;  5BT1 C;  1TAF B;  4XUJ B;  2DQN C;  4ZBJ C;  1S32 A;  2YFV A;  5B31 C;  4Z66 B;  1HQ3 A;  3C1B A;  5CPK D;  3AZJ B;  4EO5 C;  1M1A A;  3UTB B;  5CP6 C;  1KX4 D;  5AV8 C;  1U35 D;  5E5A A;  2Y2H A;  3EPH A;  5JRG B;  3LEL A;  3WTP B;  2ARO B;  1P3K C;  3W96 C;  4WU9 D;  1KX3 A;  3REI A;  1P34 A;  2Y2G A;  3UT9 D;  2HIO C;  3KWQ D;  3MGR D;  4KHA B;  3VH6 A;  3WAA C;  3WA9 D;  2J8P A;  5B0Z A;  2CV5 C;  3X1T C;  3AV2 B;  5BT1 D;  4YM6 A;  1ZLA B;  5B31 D;  3B6F A;  3TU4 B;  5CPI B;  1S32 C;  3LZ0 B;  5CP6 D;  1TZY A;  5AV6 A;  1HQ3 C;  3C1B C;  5B24 D;  1F66 B;  5AV8 D;  2NZD B;  2JSS A;  4AWL C;  3AZE D;  3X1V B;  1JFI A;  2DF4 C;  3LZ1 D;  5E5A C;  2IO5 C;  4ZUX B;  3AZF B;  1P3A A;  1P3K D;  3LEL C;  5GT3 B;  4YS3 A;  2HIO D;  3WTP E;  3REH C;  1KX3 C;  3REI C;  1P34 C;  3NQU B;  5CPJ A;  1Q9C A;  3AZG A;  1P3L A;  2CV5 D;  4J8X B;  5BNV A;  5B0Z C;  4KUD B;  4JJN A;  2LY8 A;  4YM6 C;  1S32 D;  4G91 C;  3B6F C;  3KXB B;  3C1B D;  3B0D C;  3AL0 C;  5F99 A;  1TZY C;  5BS7 A;  5AV6 C;  3AFA D;  2Y2Q A;  1P3G B;  5JA4 B;  3P5J B;  2VQR A;  4H9N B;  1P3A C;  4X23 D;  3REH D;  4Z2M G;  3REI D;  4YS3 C;  3WKJ A;  1M19 A;  4HGA B;  4UUZ A;  4G92 C;  4KGC B;  1B6W A;  5CPJ C;  3AZK A;  3AZG C;  3A6N B;  1P3L C;  2NQB D;  1P3F B;  5AV9 A;  5DNN A;  4E44 A;  4YM6 D;  4JJN C;  2BYM A;  3W97 B;  1P3M B;  4WV4 B;  2FJ7 A;  4WJ3 C;  5F99 C;  5BS7 C;  3MGS A;  4H9O B;  1P3O D;  3VH5 A;  1WWI A;  1KX5 B;  1P3A D;  3REK B;  4YS3 D;  5B33 D;  5BNX B;  3O62 B;  5AVC D;  3WKJ C;  5CPJ D;  1M19 C;  1P3B B;  1P3L D;  3REL A;  5B1L A;  4NFT A;  5CHL B;  3AZK C;  3KUY B;  5FUG A;  5AV9 C;  5DNN C;  5B2J A;  3TU4 D;  3KWQ A;  5GSU D;  1F1E A;  1N1J B;  5B0Y B;  3REJ A;  3AZH B;  3X1U A;  4J8W A;  2PYO B;  4ZBJ B;  2FJ7 C;  1AOI A;  1KU5 A;  4EO5 B;  3MGS C;  5DNM B;  1ULY A;  1M18 B;  4QLC D;  5B24 A;  1M19 D;  3AZE A;  3LZ1 A;  3W96 B;  4M6B A;  3REL C;  2F8N B;  5B1L C;  3NQJ A;  3AYW B;  4J8U D;  3WAA B;  3MGQ B;  1HTA A;  5B2J C;  3AV1 D;  3X1T B;  3KWQ C;  4LD9 B;  4UPK A;  3REJ C;  2Y2J A;  3X1U C;  4J8W C;  3MGS D;  5BO0 A;  4R8P A;  2YFV B;  3MNN B;  1HQ3 B;  1AOI C;  4H9R A;  1M1A B;  4AWL B;  3AZL D;  4Z5T B;  5B40 A;  4WU8 B;  3FDD A;  5E5A B;  3AFA A;  5B24 C;  5B1M B;  2JCH A;  2Y2O A;  3LEL B;  3AZE C;  3LZ1 C;  5G49 A;  5AV5 B;  4WNN A;  5AVB D;  5B1L D;  3REL D;  5C3I B;  2JE5 A;  5GXQ D;  4X23 A;  3REH A;  1P34 B;  5B2J D;  2Y2I A;  4XZQ A;  3AN2 A;  1EQZ B;  3REJ D;  5B0Z B;  1ID3 B;  1P3P A;  4H9Q B;  3W98 A;  3X1U D;  4J8W D;  2NQB A;  3LJA D;  3VH6 W;  1H3O B;  3AZN B;  4J8V D;  2HUE C;  3B6G B;  1BH9 A;  5GT0 B;  1AOI D;  3B6F B;  3B0D B;  4R8P C;  2FFF B;  2RIQ A;  4E45 A;  1TZY B;  5AV6 B;  4Z66 A;  3AZJ A;  4NE3 A;  3UTB A;  3EPL A;  5B40 C;  1T3U A;  3AFA C;  1P3O A;  3W99 D;  5JRG A;  3V9R A;  3WTP A;  4G92 B;  3UTA D;  4X23 C;  5B33 A;  3C1C D;  5B2I B;  3MVD B;  1P3I D;  5AVC A;  3AZG B;  3H0M C;  2BYK B;  4XZQ C;  3AN2 C;  3KFU G;  1P3P C;  4JJN B;  3A1K A;  2Y2L A;  3W98 C;  2NQB C;  1ZLA A;  4Z2M H;  4R8P D;  5AY8 B;  3TU4 A;  4DQY B;  5GSU A;  3AZM B;  2L5A A;  5B32 D;  5F99 B;  4Z66 C;  2W8S A;  5B40 D;  1F66 A;  1PZR A;  3AZJ C;  3MGP D;  3UTB C;  4ZUX A;  3AZF A;  1P3O C;  5JRG C;  3X1S B;  2Y2M A;  3H0L C;  3WTP C;  3AZI D;  3WKJ B;  4QLC A;  2YFW B;  5B33 C;  4XZQ D;  3AN2 D;  3AZK B;  5AVC C;  3EPK A;  1P3P D;  5AV9 B;  5DNN B;  3W98 D;  4XUJ D;  2BYM B;  4J8U A;  1ZLA C;  3AV1 A;  4Z66 D;  3KXB A;  3TU4 C;  5GSU C;  3AZJ D;  2FJ7 B;  3UTB D;  1F66 C;  4CAY B;  1P3G A;  2BG1 A;  2G5I C;  5JRG D;  4H9N A;  5CPK B;  4ZUX C;  3WTP D;  3AZF C;  2ARO D;  3AZL A;  4H9P B;  1KX4 B;  3VH5 W;  1U35 B;  3VH6 T;  4QLC C;  4NE5 A;  5AVB A;  4WU9 B;  5FUG B;  5GXQ A;  3UT9 B;  3AV2 D;  3KWQ B;  1ZLA D;  3MGR B;  3W97 A;  4J8U C;  5CPI D;  3WA9 B;  3LZ0 D;  3AV1 C;  3KXB C;  1F66 D;  2ZY5 A;  3R45 B;  2NZD D;  3LJA A;  3X1V D;  3B0C W;  5B31 B;  4J8V A;  4H9O A;  4ZUX D;  3AZF D;  1P3G C;  2UWX A;  5CP6 B;  2F8N H;  4CSR A;  1WWS A;  5GT3 D;  3B0B A;  5B24 B;  5AV8 B;  3AZE B;  3AZL C;  1A7W A;  1BFM A;  5B2I D;  5BNX A;  3LZ1 B;  4HGA C;  2Y2P A;  1P3K B;  3W99 A;  3IP4 C;  4J8X D;  3NQJ B;  2HIO B;  2ZM5 A;  5AVB C;  4KUD D;  3UTA A;  5GXQ C;  3C1C A;  1P3I A;  2XD5 A;  2CV5 B;  3KXB D;  3W97 C;  3AZH A;  2XD1 A;  5BO0 B;  3LJA C;  2RVQ C;  1S32 B;  4H9R B;  5DNM A;  1P3G D;  4J8V C;  3C1B B;  4DRB A;  5B32 A;  1M18 A;  5KDM A;  5B32 G;  3AFA B;  3MGP A;  2IO5 B;  5G49 B;  4KGC D;  1BH8 A;  4X23 B;  3REH B;  3A6N D;  3W99 C;  1KX3 B;  1P3F D;  3REI B;  3AZI A;  3AYW A;  3UTA C;  3MGQ A;  3C1C C;  3W97 D;  1P3I C;  1P3M D;  2ZY2 A;  2NQB B;  3H0R C;  3AZH C;  4YM6 B;  1BH9 B;  2RVQ D;  4G91 B;  3VH5 T;  3MNN A;  1TAF A;  4XUJ A;  1KX5 D;  2ZY4 A;  5DNM C;  3REK D;  2F2A C;  4Z5T A;  5B32 C;  1M18 C;  4WU8 A;  1JFI B;  3O62 D;  5B1M A;  1P3O B;  3KSY A;  3MGP C;  1P3A B;  3V9R B;  2G5H C;  1P3B D;  5AV5 A;  4YS3 B;  2ARO A;  5B33 B;  3KUY D;  5AVC B;  3AZI C;  3AYW C;  5CPJ B;  3B0C T;  4KHA A;  1P3L B;  4NE6 A;  3MGQ C;  1EQZ A;  5B0Y D;  1ID3 A;  4H9Q A;  3AZH D;  2PYO D;  4LD9 C;  5BNV B;  3AZN A;  1H3O A;  3AV2 A;  3B6G A;  5GT0 A;  5GSU B;  5DNM D;  3MNN C;  4XUJ C;  5CPI A;  3LZ0 A;  1M18 D;  1M1A C;  4Z5T C;  2NZD A;  3X1V A;  4WU8 C;  4WZS B;  5B1M C;  3W96 D;  5AV5 C;  2F8N D;  5GT3 A;  4QLC B;  5C3I C;  3AYW D;  2ARO C;  2Y2N A;  1M19 B;  4UUZ B;  5B2I A;  3MVD A;  3WAA D;  3NQU A;  3MGQ D;  3X1T D;  4LD9 D;  2BYK A;  1EQZ C;  4J8X A;  1ID3 C;  4KUD A;  4J8U B;  4H9S A;  3AZN C;  3AV2 C;  3MNN D;  3B6G C;  5AY8 A;  3AV1 B;  2F8N K;  1HQ3 D;  5GT0 C;  3F6T A;  3AZM A;  2Y2K A;  1M1A D;  1R4V A;  4Z5T D;  5CPI C;  3LZ0 C;  4WU8 D;  5E5A D;  3MGS B;  5B1M D;  2NZD C;  3X1V C;  2CWE A;  3LEL D;  5JA4 A;  5AV5 D;  3AZL B;  3X1S A;  1KX3 D;  1P34 D;  5GT3 C;  2YFW A;  5B2I C;  3MVD C;  1EQZ D;  3REL B;  5AVB B;  4KGC A;  5B1L B;  5B0Z D;  1ID3 D;  5GXQ B;  3A6N A;  4J8X C;  1P3F A;  3AZN D;  3B6G D;  5B2J B;  3B6F D;  5GT0 D;  4KUD C;  4H9S C;  5AY8 C;  1TZY D;  5AV6 D;  3REJ B;  3X1U B;  4J8W B;  3AZM C;  1P3M A;  3LJA B;  4J8V B;  1AOI B;  4CAY A;  1KX5 A;  3EPJ A;  4CSR B;  5CPK A;  2ZY3 A;  1B67 A;  4DRA A;  3REK A;  4H9P A;  3X1S C;  1KX4 A;  3EG5 B;  1U35 A;  3MVD D;  3O62 A;  3AZG D;  3W99 B;  1P3B A;  4KGC C;  4WU9 A;  4JJN D;  3UTA B;  3UT9 A;  3KUY A;  3A6N C;  3C1C B;  1P3I B;  1P3F C;  3MGR A;  5AY8 D;  3AZM D;  3WA9 A;  1N1J A;  5F99 D;  5B0Y A;  2HUE B;  2PYO A;  3R45 A;  1P3M C;  4R8P B;  5B31 A;  5B31 G;  5B32 B;  1KX5 C;  5CP6 A;  3X1S D;  5KDM B;  5B40 B;  5CPK C;  5AV8 A;  3MGP B;  3REK C;  3WKJ D;  3A1I A;  1KX4 C;  1U35 C;  1BH8 B;  3O62 C;  3AZK D;  4WNN B;  1P3K A;  3W96 A;  5AV9 D;  5DNN D;  1P3B C;  2HIO A;  3AZI B;  2F8N A;  4WU9 C;  2F8N G;  3UT9 C;  3KUY C;  3WAA A;  4XZQ B;  3MGR C;  3AN2 B;  2CV5 A;  1W2E A;  3X1T A;  1P3P B;  4LD9 A;  3W98 B;  2FJ7 D; 
#chains in the Genus database with same CATH homology
 3WA9 C;  5B0Y C;  2PYO C;  1Z2C B;  5BT1 C;  1TAF B;  4XUJ B;  2DQN C;  4ZBJ C;  1S32 A;  2YFV A;  5B31 C;  4Z66 B;  1HQ3 A;  3C1B A;  5CPK D;  3AZJ B;  4EO5 C;  1M1A A;  3UTB B;  5CP6 C;  1KX4 D;  5AV8 C;  1U35 D;  5E5A A;  2Y2H A;  3EPH A;  5JRG B;  3LEL A;  3WTP B;  2ARO B;  1P3K C;  3W96 C;  4WU9 D;  1KX3 A;  3REI A;  1P34 A;  2Y2G A;  3UT9 D;  2HIO C;  3KWQ D;  3MGR D;  4KHA B;  3VH6 A;  3WAA C;  3WA9 D;  2J8P A;  5B0Z A;  2CV5 C;  3X1T C;  3AV2 B;  5BT1 D;  4YM6 A;  1ZLA B;  5B31 D;  3B6F A;  3TU4 B;  5CPI B;  1S32 C;  3LZ0 B;  5CP6 D;  1TZY A;  5AV6 A;  1HQ3 C;  3C1B C;  5B24 D;  1F66 B;  5AV8 D;  2NZD B;  2JSS A;  4AWL C;  3AZE D;  3X1V B;  1JFI A;  2DF4 C;  3LZ1 D;  5E5A C;  2IO5 C;  4ZUX B;  3AZF B;  1P3A A;  1P3K D;  3LEL C;  5GT3 B;  4YS3 A;  2HIO D;  3WTP E;  3REH C;  1KX3 C;  3REI C;  1P34 C;  3NQU B;  5CPJ A;  1Q9C A;  3AZG A;  1P3L A;  2CV5 D;  4J8X B;  5BNV A;  5B0Z C;  4KUD B;  4JJN A;  2LY8 A;  4YM6 C;  1S32 D;  4G91 C;  3B6F C;  3KXB B;  3C1B D;  3B0D C;  3AL0 C;  5F99 A;  1TZY C;  5BS7 A;  5AV6 C;  3AFA D;  2Y2Q A;  1P3G B;  5JA4 B;  3P5J B;  2VQR A;  4H9N B;  1P3A C;  4X23 D;  3REH D;  4Z2M G;  3REI D;  4YS3 C;  3WKJ A;  1M19 A;  4HGA B;  4UUZ A;  4G92 C;  4KGC B;  1B6W A;  5CPJ C;  3AZK A;  3AZG C;  3A6N B;  1P3L C;  2NQB D;  1P3F B;  5AV9 A;  5DNN A;  4E44 A;  4YM6 D;  4JJN C;  2BYM A;  3W97 B;  1P3M B;  4WV4 B;  2FJ7 A;  4WJ3 C;  5F99 C;  5BS7 C;  3MGS A;  4H9O B;  1P3O D;  3VH5 A;  1WWI A;  1KX5 B;  1P3A D;  3REK B;  4YS3 D;  5B33 D;  5BNX B;  3O62 B;  5AVC D;  3WKJ C;  5CPJ D;  1M19 C;  1P3B B;  1P3L D;  3REL A;  5B1L A;  4NFT A;  5CHL B;  3AZK C;  3KUY B;  5FUG A;  5AV9 C;  5DNN C;  5B2J A;  3TU4 D;  3KWQ A;  5GSU D;  1F1E A;  1N1J B;  5B0Y B;  3REJ A;  3AZH B;  3X1U A;  4J8W A;  2PYO B;  4ZBJ B;  2FJ7 C;  1AOI A;  1KU5 A;  4EO5 B;  3MGS C;  5DNM B;  1ULY A;  1M18 B;  4QLC D;  5B24 A;  1M19 D;  3AZE A;  3LZ1 A;  3W96 B;  4M6B A;  3REL C;  2F8N B;  5B1L C;  3NQJ A;  3AYW B;  4J8U D;  3WAA B;  3MGQ B;  1HTA A;  5B2J C;  3AV1 D;  3X1T B;  3KWQ C;  4LD9 B;  4UPK A;  3REJ C;  2Y2J A;  3X1U C;  4J8W C;  3MGS D;  5BO0 A;  4R8P A;  2YFV B;  3MNN B;  1HQ3 B;  1AOI C;  4H9R A;  1M1A B;  4AWL B;  3AZL D;  4Z5T B;  5B40 A;  4WU8 B;  3FDD A;  5E5A B;  3AFA A;  5B24 C;  5B1M B;  2JCH A;  2Y2O A;  3LEL B;  3AZE C;  3LZ1 C;  5G49 A;  5AV5 B;  4WNN A;  5AVB D;  5B1L D;  3REL D;  5C3I B;  2JE5 A;  5GXQ D;  4X23 A;  3REH A;  1P34 B;  5B2J D;  2Y2I A;  4XZQ A;  3AN2 A;  1EQZ B;  3REJ D;  5B0Z B;  1ID3 B;  1P3P A;  4H9Q B;  3W98 A;  3X1U D;  4J8W D;  2NQB A;  3LJA D;  3VH6 W;  1H3O B;  3AZN B;  4J8V D;  2HUE C;  3B6G B;  1BH9 A;  5GT0 B;  1AOI D;  3B6F B;  3B0D B;  4R8P C;  2FFF B;  2RIQ A;  4E45 A;  1TZY B;  5AV6 B;  4Z66 A;  3AZJ A;  4NE3 A;  3UTB A;  3EPL A;  5B40 C;  1T3U A;  3AFA C;  1P3O A;  3W99 D;  5JRG A;  3V9R A;  3WTP A;  4G92 B;  3UTA D;  4X23 C;  5B33 A;  3C1C D;  5B2I B;  3MVD B;  1P3I D;  5AVC A;  3AZG B;  3H0M C;  2BYK B;  4XZQ C;  3AN2 C;  3KFU G;  1P3P C;  4JJN B;  3A1K A;  2Y2L A;  3W98 C;  2NQB C;  1ZLA A;  4Z2M H;  4R8P D;  5AY8 B;  3TU4 A;  4DQY B;  5GSU A;  3AZM B;  2L5A A;  5B32 D;  5F99 B;  4Z66 C;  2W8S A;  5B40 D;  1F66 A;  1PZR A;  3AZJ C;  3MGP D;  3UTB C;  4ZUX A;  3AZF A;  1P3O C;  5JRG C;  3X1S B;  2Y2M A;  3H0L C;  3WTP C;  3AZI D;  3WKJ B;  4QLC A;  2YFW B;  5B33 C;  4XZQ D;  3AN2 D;  3AZK B;  5AVC C;  3EPK A;  1P3P D;  5AV9 B;  5DNN B;  3W98 D;  4XUJ D;  2BYM B;  4J8U A;  1ZLA C;  3AV1 A;  4Z66 D;  3KXB A;  3TU4 C;  5GSU C;  3AZJ D;  2FJ7 B;  3UTB D;  1F66 C;  4CAY B;  1P3G A;  2BG1 A;  2G5I C;  5JRG D;  4H9N A;  5CPK B;  4ZUX C;  3WTP D;  3AZF C;  2ARO D;  3AZL A;  4H9P B;  1KX4 B;  3VH5 W;  1U35 B;  3VH6 T;  4QLC C;  4NE5 A;  5AVB A;  4WU9 B;  5FUG B;  5GXQ A;  3UT9 B;  3AV2 D;  3KWQ B;  1ZLA D;  3MGR B;  3W97 A;  4J8U C;  5CPI D;  3WA9 B;  3LZ0 D;  3AV1 C;  3KXB C;  1F66 D;  2ZY5 A;  3R45 B;  2NZD D;  3LJA A;  3X1V D;  3B0C W;  5B31 B;  4J8V A;  4H9O A;  4ZUX D;  3AZF D;  1P3G C;  2UWX A;  5CP6 B;  2F8N H;  4CSR A;  1WWS A;  5GT3 D;  3B0B A;  5B24 B;  5AV8 B;  3AZE B;  3AZL C;  1A7W A;  1BFM A;  5B2I D;  5BNX A;  3LZ1 B;  4HGA C;  2Y2P A;  1P3K B;  3W99 A;  3IP4 C;  4J8X D;  3NQJ B;  2HIO B;  2ZM5 A;  5AVB C;  4KUD D;  3UTA A;  5GXQ C;  3C1C A;  1P3I A;  2XD5 A;  2CV5 B;  3KXB D;  3W97 C;  3AZH A;  2XD1 A;  5BO0 B;  3LJA C;  2RVQ C;  1S32 B;  4H9R B;  5DNM A;  1P3G D;  4J8V C;  3C1B B;  4DRB A;  5B32 A;  1M18 A;  5KDM A;  5B32 G;  3AFA B;  3MGP A;  2IO5 B;  5G49 B;  4KGC D;  1BH8 A;  4X23 B;  3REH B;  3A6N D;  3W99 C;  1KX3 B;  1P3F D;  3REI B;  3AZI A;  3AYW A;  3UTA C;  3MGQ A;  3C1C C;  3W97 D;  1P3I C;  1P3M D;  2ZY2 A;  2NQB B;  3H0R C;  3AZH C;  4YM6 B;  1BH9 B;  2RVQ D;  4G91 B;  3VH5 T;  3MNN A;  1TAF A;  4XUJ A;  1KX5 D;  2ZY4 A;  5DNM C;  3REK D;  2F2A C;  4Z5T A;  5B32 C;  1M18 C;  4WU8 A;  1JFI B;  3O62 D;  5B1M A;  1P3O B;  3KSY A;  3MGP C;  1P3A B;  3V9R B;  2G5H C;  1P3B D;  5AV5 A;  4YS3 B;  2ARO A;  5B33 B;  3KUY D;  5AVC B;  3AZI C;  3AYW C;  5CPJ B;  3B0C T;  4KHA A;  1P3L B;  4NE6 A;  3MGQ C;  1EQZ A;  5B0Y D;  1ID3 A;  4H9Q A;  3AZH D;  2PYO D;  4LD9 C;  5BNV B;  3AZN A;  1H3O A;  3AV2 A;  3B6G A;  5GT0 A;  5GSU B;  5DNM D;  3MNN C;  4XUJ C;  5CPI A;  3LZ0 A;  1M18 D;  1M1A C;  4Z5T C;  2NZD A;  3X1V A;  4WU8 C;  4WZS B;  5B1M C;  3W96 D;  5AV5 C;  2F8N D;  5GT3 A;  4QLC B;  5C3I C;  3AYW D;  2ARO C;  2Y2N A;  1M19 B;  4UUZ B;  5B2I A;  3MVD A;  3WAA D;  3NQU A;  3MGQ D;  3X1T D;  4LD9 D;  2BYK A;  1EQZ C;  4J8X A;  1ID3 C;  4KUD A;  4J8U B;  4H9S A;  3AZN C;  3AV2 C;  3MNN D;  3B6G C;  5AY8 A;  3AV1 B;  2F8N K;  1HQ3 D;  5GT0 C;  3F6T A;  3AZM A;  2Y2K A;  1M1A D;  1R4V A;  4Z5T D;  5CPI C;  3LZ0 C;  4WU8 D;  5E5A D;  3MGS B;  5B1M D;  2NZD C;  3X1V C;  2CWE A;  3LEL D;  5JA4 A;  5AV5 D;  3AZL B;  3X1S A;  1KX3 D;  1P34 D;  5GT3 C;  2YFW A;  5B2I C;  3MVD C;  1EQZ D;  3REL B;  5AVB B;  4KGC A;  5B1L B;  5B0Z D;  1ID3 D;  5GXQ B;  3A6N A;  4J8X C;  1P3F A;  3AZN D;  3B6G D;  5B2J B;  3B6F D;  5GT0 D;  4KUD C;  4H9S C;  5AY8 C;  1TZY D;  5AV6 D;  3REJ B;  3X1U B;  4J8W B;  3AZM C;  1P3M A;  3LJA B;  4J8V B;  1AOI B;  4CAY A;  1KX5 A;  3EPJ A;  4CSR B;  5CPK A;  2ZY3 A;  1B67 A;  4DRA A;  3REK A;  4H9P A;  3X1S C;  1KX4 A;  3EG5 B;  1U35 A;  3MVD D;  3O62 A;  3AZG D;  3W99 B;  1P3B A;  4KGC C;  4WU9 A;  4JJN D;  3UTA B;  3UT9 A;  3KUY A;  3A6N C;  3C1C B;  1P3I B;  1P3F C;  3MGR A;  5AY8 D;  3AZM D;  3WA9 A;  1N1J A;  5F99 D;  5B0Y A;  2HUE B;  2PYO A;  3R45 A;  1P3M C;  4R8P B;  5B31 A;  5B31 G;  5B32 B;  1KX5 C;  5CP6 A;  3X1S D;  5KDM B;  5B40 B;  5CPK C;  5AV8 A;  3MGP B;  3REK C;  3WKJ D;  3A1I A;  1KX4 C;  1U35 C;  1BH8 B;  3O62 C;  3AZK D;  4WNN B;  1P3K A;  3W96 A;  5AV9 D;  5DNN D;  1P3B C;  2HIO A;  3AZI B;  2F8N A;  4WU9 C;  2F8N G;  3UT9 C;  3KUY C;  3WAA A;  4XZQ B;  3MGR C;  3AN2 B;  2CV5 A;  1W2E A;  3X1T A;  1P3P B;  4LD9 A;  3W98 B;  2FJ7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...