3MGPA

Binding of cobalt ions to the nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgpA00
4H9SA 3W99B 3LZ1D 3WTPB 4H9QB 3O62A 3AZKD 3B0DC 3W97B 3TU4A 3AZGC 2AROD 1P3GD 3W98D 3A6NC 3AZFA 2PYOB 3MGRA 1AOIA 4R8PD 3X1UC 2YFWA 1KX5B 4Z5TD 5B2JA 3AZJD 1ZLAB 5B1LC 1P3BD 1TZYB 1P3KC 3REJC 4YM6C 3LELA 5B32D 3X1UD 3UTAC 3WAAA 3NQJA 5GT0B 3KUYD 3AZMB 3UT9A 3LZ0D 1M19D 3RELB 1P3KD 4H9NB 3REJD 4YM6D 3AZHC 5B31A 3UTAD 3AZFB 5CPJB 2IO5B 3AYWA 3MNND 3KWQC 3C1BB 3AZHD 3MGRC 2CV5A 1F66D 5B2JB 1AOIC 5B0ZD 5FUGB 4WU8C 5E5AA 1P3MA 1EQZA 3AZIC 5BNXB 3KWQD 3AV2A 4YS3A 1M1AD 3UT9B 3LELC 4WU8D 3WAAC 4ZBJB 5AVCB 4H9OA 3AZID 1P3IB 1M18C 5DNMA 5B31C 2FJ7C 1P3FC 3MGQC 5GSUA 1M18D 3W96A 5E5AB 1P3MB 1HQ3D 2CV5C 1EQZB 5B31D 4J8WB 4LD9B 3AV2B 2FJ7D 1P3FD 3MGQD 5GT3A 4YS3B 2JSSA 2YFVA 4XUJA 5CHLB 1KX4C 5DNNA 2CV5D 4H9OB 4NFTA 4Z66B 5B24A 3X1VB 4WU9B 3WA9A 4X23B 4J8UC 4AWLB 3AZEB 3UTBD 1S32C 3X1TA 5AV6B 5C3IC 4DRAA 1KX4D 3B6GA 2BYMA 5DNMC 5GSUB 3W96B 4J8UD 3VH5A 1S32D 1P3OB 4G91C 1HTAA 5GT3B 5AV9D 5DNMD 3VH6T 4JJNB 3X1SB 1P3AA 3C1CD 2CWEA 5DNNB 5B0YD 2HUEC 4XUJC 3REHB 2NZDB 3REIB 5AVBB 3B6FC 4XZQA 3X1TB 5B24C 5AV5B 3V9RA 3WA9C 4UUZA 3AZLB 5AY8A 3B6FD 5B1MA 1P34A 3B6GC 3WKJB 1KX3C 5B40B 1P3AB 2HIOB 3WTPA 2RVQD 4H9QA 5KDMA 3B0CW 3AN2B 1KX3D 4NE6A 2F8NA 5BT1C 4KGCD 5JRGA 3AZND 5B2IC 2PYOA 5CPIC 4HGAC 3V9RB 2NQBA 1KX5A 4XZQC 5B2ID 2BYKA 5CPID 1ZLAA 3LJAB 5B33B 5B1MC 1P34C 4ZUXB 3AZMA 3MGSB 4J8VC 5KDMB 1U35D 4KUDB 3RELA 2L5AA 4H9NA 3REKD 2F8NB 3W99C 1P3PC 5JRGB 3WTPC 1P34D 4CAYA 5CPJA 3W97C 2F8NG 4J8VD 2NQBB 3AZKB 3AZGD 3C1BA 2PYOC 3W99D 1P3PD 4Z2MH 1P3GB 3WTPD 5CP6B 3A6ND 2BYKB 5FUGA 4DRBA 3W97D 4R8PB 5BNXA 5GXQB 1ZLAC 1TZYC 4Z5TB 3AZJB 5B1LD 4E45A 1BH9B 5GT0C 1P3BB 3R45A 3AZMC 4H9SC 5AVCA 5B32B 1P3IA 1A7WA 3KUYB 4CAYB 3O62C 1ZLAD 3RELC 1TZYD 3LZ0B 3TU4C 5G49B 1M19B 5GT0D 4WNNB 3AZFC 3AZMD 5CPJC 2IO5C 3O62D 1JFIB 4H9PB 3TU4D 3C1BC 4J8WA 4NE3A 3MNNB 5B2JC 4LD9A 4M6BA 5CPJD 3MGRD 3AZHB 3AZFD 1F66B 1AOID 5B0ZB 3KXBB 3R45B 3C1BD 4Z66A 3UT9C 5B2JD 3X1VA 4WU9A 4X23A 3AZEA 1M1AB 5F99B 4G92B 4ZBJC 4EO5B 3LELD 1BH8A 5AV6A 5AVCC 3WAAD 1ID3A 5AV8A 3UT9D 3AZIB 3AYWC 3VH5T 1P3OA 4WZSB 5E5AC 1P3MC 4CSRB 4JJNA 1BFMA 3AYWD 3X1SA 1EQZC 4J8WC 4LD9C 3AV2C 1HQ3B 4YS3C 3REHA 4KHAB 2NZDA 3REIA 5CPKB 5E5AD 1P3FB 3B0BA 5AVBA 1P3MD 5BS7A 3MGPA 1EQZD 1BH8B 4Z66C 5AV5A 4LD9D 3X1VC 3AV2D 4WU9C 1ID3B 5AV8B 4X23C 4YS3D 4AWLC 3AZEC 3AZLA 3UTBB 5GSUC 4WU9D 3X1VD 1KX4B 3WKJA 3W96C 3AZED 1ULYA 3AFAB 5B40A 1P3OC 2HIOA 5GT3C 5GSUD 3AN2A 4JJNC 4QLCB 3W96D 3X1SC 5AV9B 3MGPB 5DNNC 1P3OD 4J8XA 3REHC 3C1CB 5B0YB 3AV1A 3REIC 5GT3D 2NZDC 5AVBC 4XUJD 1H3OB 5BS7C 3X1TC 3MVDA 5AV5C 5DNND 5B24D 3REHD 3LJAA 5B33A 3AZLC 3WA9D 2NZDD 2HUEB 1N1JB 3X1TD 4ZUXA 3WKJC 3B6GD 3MGSA 3B6FB 4KUDA 3AZLD 5B40C 1P3AC 2HIOC 4J8XB 3AN2C 3LZ1A 3AV1B 1P3LB 3WKJD 3AZKA 3MVDB 1P3AD 5BT1D 1P3GA 4KGCB 5CP6A 3AZNB 3W98A 4R8PA 3VH6W 3VH6A 4E44A 5AY8C 4XZQD 5GXQA 3LJAC 5B33C 4Z5TA 5B2IB 3AZJA 1BH9A 1P3BA 4ZUXC 2LY8A 5B32A 5AY8D 3KUYA 5B1MD 3MGSC 4KUDC 1F1EA 3LZ1B 3LJAD 3LZ0A 5G49A 1U35B 1M19A 5JRGC 4WNNA 3REJA 4YM6A 3REKB 2AROB 3UTAA 3W98B 2NQBC 1JFIA 1Q9CA 4H9PA 3AZKC 1KX5C 2F8ND 4WV4B 5BNVA 3B0DB 5JRGD 3MNNA 5CP6C 3AZGB 1P3GC 2PYOD 3AZHA 1F66A 1P3PB 5B0ZA 3A6NB 2NQBD 4R8PC 1TAFB 3KXBA 1KX5D 5GXQC 3X1UB 4Z5TC 5CP6D 3KWQA 3KSYA 3AZJC 1M1AA 3NQUB 1KU5A 5F99A 1P3BC 5BO0B 4WU8A 5B32G 5B1LB 5B32C 1P3KB 3KUYC 5GXQD 4YM6B 3REJB 3UTAB 3AZIA 3LZ0C 1M19C 3RELD 5BNVB 4CSRA 1M18A 3O62B 3MNNC 3TU4B 1HQ3A 1F66C 4KHAA 3KWQB 5B0ZC 1P3FA 5CPKA 3MGQA 3MGRB 2FJ7A 3KXBC 1AOIB 4WU8B 1P3IC 2YFWB 3WTPE 1M1AC 5F99C 4G92C 4EO5C 3KXBD 3UTBA 3LELB 5AVCD 3WAAB 1P3ID 1KX4A 3NQJB 3AFAA 5F99D 1M18B 4J8UA 2F8NH 5JA4A 1S32A 5B31B 2FJ7B 4QLCA 3MGQB 5AV9A 5B31G 1HQ3C 4J8WD 3AYWB 3C1CA 5B0YA 5CPKC 2CV5B 1H3OA 5AV6C 1ID3C 5AV8C 4Z66D 4X23D 5CPKD 1N1JA 3UTBC 5AV6D 4J8UB 5JA4B 1S32B 5AV8D 1ID3D 3B6FA 5C3IB 3AFAC 3B0CT 5DNMB 1P3LA 4QLCC 4G91B 5AV9C 3AFAD 4JJND 3MGPC 3X1SD 1KX3A 2F8NK 3VH5W 3C1CC 5B0YC 4KGCA 3AZNA 4H9RA 4QLCD 3REID 5AVBD 2YFVB 4XUJB 3MGPD 4Z2MG 5AV5D 5B2IA 1R4VA 1WWSA 5B24B 5CPIA 3WA9B 3B6GB 1U35A 2BYMB 5B40D 1KX3B 3REKA 4J8XC 2AROA 1P3LC 2HIOD 3AV1C 2RVQC 1B6WA 4H9RB 3AN2D 4J8VA 3MVDC 4KGCC 3AZGA 3AZNC 4J8XD 3W99A 1P3PA 1P3LD 3AV1D 3A6NA 5CPIB 4HGAB 4NE5A 1TAFA 3W97A 3MVDD 3X1UA 1WWIA 4XZQB 1B67A 3NQUA 5B33D 5BO0A 4UUZB 5B1LA 1P3KA 4ZUXD 3LZ1C 5AY8B 3MGSD 5B1MB 1U35C 1P34B 4KUDD 1TZYA 4J8VB 3REKC 2AROC 5GT0A 3W98C
chains in the Genus database with same CATH superfamily
4H9SA 3W99B 2J8PA 3LZ1D 3WTPB 4H9QB 3O62A 3AZKD 3B0DC 3W97B 3TU4A 3AZGC 2AROD 1P3GD 3W98D 3A6NC 3AZFA 2PYOB 3MGRA 1AOIA 4R8PD 3X1UC 2YFWA 1KX5B 4Z5TD 5B2JA 3AZJD 1ZLAB 5B1LC 1P3BD 1TZYB 1P3KC 3REJC 4YM6C 3LELA 5B32D 3X1UD 3UTAC 3WAAA 3NQJA 5GT0B 3KUYD 3AZMB 3UT9A 3LZ0D 1M19D 3RELB 1P3KD 4H9NB 3REJD 4YM6D 3AZHC 5B31A 3UTAD 3AZFB 5CPJB 2IO5B 3AYWA 3MNND 3KWQC 3C1BB 3AZHD 3MGRC 2CV5A 3EPLA 1F66D 5B2JB 1AOIC 5B0ZD 5FUGB 4WU8C 5E5AA 1P3MA 1PZRA 1EQZA 3AZIC 5BNXB 3KWQD 3AV2A 4YS3A 1M1AD 3UT9B 3LELC 4WU8D 3WAAC 4ZBJB 5AVCB 4H9OA 3AZID 1P3IB 1M18C 5DNMA 5B31C 2FJ7C 1P3FC 2G5HC 3MGQC 5GSUA 2F2AC 1M18D 1W2EA 3W96A 5E5AB 1P3MB 1HQ3D 2CV5C 1EQZB 5B31D 4J8WB 4LD9B 3AV2B 2FJ7D 1P3FD 3MGQD 5GT3A 4YS3B 2JSSA 2YFVA 4XUJA 5CHLB 1KX4C 5DNNA 2CV5D 4H9OB 2JCHA 4NFTA 4Z66B 5B24A 3X1VB 4WU9B 3WA9A 4X23B 4J8UC 4AWLB 3AZEB 2ZY2A 3UTBD 1S32C 3X1TA 5AV6B 5C3IC 4DRAA 1KX4D 3B6GA 2BYMA 5DNMC 5GSUB 3W96B 4J8UD 3VH5A 1S32D 1P3OB 4G91C 3F6TA 1HTAA 5GT3B 5DNMD 5AV9D 3VH6T 4JJNB 3X1SB 1P3AA 3C1CD 2CWEA 5DNNB 5B0YD 2HUEC 4XUJC 3REHB 2NZDB 3REIB 5AVBB 3B6FC 4XZQA 3X1TB 5B24C 5AV5B 3V9RA 3WA9C 4UUZA 3AZLB 2JE5A 5AY8A 3B6FD 5B1MA 1P34A 3B6GC 3EPJA 3WKJB 1KX3C 5B40B 1P3AB 2HIOB 3WTPA 2RVQD 4H9QA 5KDMA 2ZM5A 3B0CW 3AN2B 1KX3D 4NE6A 2F8NA 5BT1C 4KGCD 3EPHA 5JRGA 3AZND 5B2IC 2PYOA 5CPIC 4HGAC 3V9RB 2NQBA 2RIQA 1KX5A 4XZQC 3A1KA 2ZY3A 5B2ID 2BYKA 5CPID 1ZLAA 3LJAB 5B33B 5B1MC 1P34C 4ZUXB 3AZMA 3MGSB 4J8VC 5KDMB 1U35D 4KUDB 3RELA 2L5AA 4H9NA 3REKD 2F8NB 3W99C 1P3PC 5JRGB 3WTPC 1P34D 4CAYA 5CPJA 3W97C 2F8NG 4J8VD 2NQBB 3AZKB 3AZGD 3C1BA 2PYOC 3W99D 1P3PD 2Y2OA 4Z2MH 1P3GB 3WTPD 5CP6B 3A6ND 2BYKB 5FUGA 4DRBA 3W97D 2XD1A 4R8PB 5BNXA 5GXQB 1ZLAC 1TZYC 4Z5TB 3IP4C 3AZJB 5B1LD 4E45A 1BH9B 5GT0C 1P3BB 3R45A 3AZMC 4H9SC 5AVCA 5B32B 1P3IA 1A7WA 3KUYB 4CAYB 3O62C 1ZLAD 3RELC 1TZYD 2DQNC 3LZ0B 3TU4C 5G49B 1M19B 5GT0D 4WNNB 3AZFC 3AZMD 5CPJC 2IO5C 3O62D 1JFIB 4H9PB 3TU4D 3C1BC 2ZY4A 4J8WA 4NE3A 3MNNB 4UPKA 5B2JC 4LD9A 4M6BA 5CPJD 3MGRD 3AZHB 3AZFD 1F66B 1AOID 5B0ZB 2Y2PA 3KXBB 2W8SA 3R45B 3C1BD 2Y2IA 4Z66A 3UT9C 5B2JD 3X1VA 4WU9A 4X23A 3EPKA 3AZEA 1M1AB 5F99B 4G92B 4ZBJC 4EO5B 3LELD 1BH8A 5AV6A 5AVCC 3WAAD 1ID3A 5AV8A 3UT9D 3AZIB 3AYWC 3VH5T 1P3OA 3H0MC 4WZSB 5E5AC 1P3MC 4CSRB 4JJNA 1BFMA 2Y2NA 3H0RC 3X1SA 3AYWD 4J8WC 1EQZC 4LD9C 3AV2C 1HQ3B 4YS3C 3REHA 4KHAB 2NZDA 3REIA 5CPKB 5E5AD 1P3FB 3B0BA 5AVBA 1P3MD 2Y2GA 5BS7A 3MGPA 1EQZD 1BH8B 5AV5A 4Z66C 4LD9D 3X1VC 3AV2D 4WU9C 3A1IA 5AV8B 4X23C 1ID3B 4YS3D 4AWLC 3AZEC 3AL0C 3AZLA 3UTBB 3P5JB 5GSUC 4WU9D 2Y2KA 3X1VD 1KX4B 3WKJA 3W96C 3AZED 1ULYA 3AFAB 5B40A 1P3OC 2HIOA 3FDDA 5GT3C 5GSUD 3AN2A 4JJNC 4QLCB 3W96D 3X1SC 5AV9B 3MGPB 5DNNC 1P3OD 4J8XA 3REHC 3C1CB 5B0YB 3AV1A 3REIC 5GT3D 2NZDC 5AVBC 4XUJD 1H3OB 5BS7C 3X1TC 3MVDA 5AV5C 5DNND 5B24D 3REHD 3EG5B 5B33A 3LJAA 2ZY5A 3AZLC 3WA9D 2NZDD 2HUEB 1N1JB 1T3UA 3X1TD 4ZUXA 3WKJC 3H0LC 3MGSA 3B6FB 3B6GD 4KUDA 3AZLD 5B40C 1P3AC 4WJ3C 2HIOC 4J8XB 3AN2C 3LZ1A 3AV1B 1P3LB 3WKJD 3AZKA 3MVDB 1P3AD 5BT1D 1P3GA 4KGCB 5CP6A 3AZNB 3W98A 4R8PA 3VH6W 3VH6A 4E44A 5AY8C 4XZQD 5GXQA 3LJAC 5B33C 4Z5TA 5B2IB 3AZJA 1BH9A 1P3BA 4ZUXC 2LY8A 5B32A 5AY8D 3KUYA 5B1MD 3MGSC 4KUDC 1F1EA 3LZ1B 3LJAD 3LZ0A 5G49A 1U35B 1M19A 5JRGC 4WNNA 3REJA 4YM6A 3REKB 2AROB 3UTAA 3W98B 2NQBC 1JFIA 1Q9CA 4H9PA 3AZKC 1KX5C 2F8ND 4WV4B 5BNVA 3B0DB 5JRGD 3MNNA 5CP6C 3AZGB 1P3GC 2PYOD 2BG1A 3AZHA 1F66A 1P3PB 5B0ZA 3A6NB 2NQBD 4R8PC 1TAFB 3KXBA 1KX5D 5GXQC 3X1UB 4Z5TC 2Y2JA 5CP6D 3KWQA 3KSYA 3AZJC 1M1AA 3NQUB 1KU5A 5F99A 1P3BC 5BO0B 5B32G 4WU8A 5B1LB 5B32C 1P3KB 3KUYC 5GXQD 4YM6B 3REJB 3UTAB 3AZIA 3LZ0C 1M19C 3RELD 5BNVB 4CSRA 1M18A 3O62B 3MNNC 3TU4B 1HQ3A 1F66C 4KHAA 3KWQB 5B0ZC 1P3FA 5CPKA 3MGQA 3MGRB 2FJ7A 3KXBC 2DF4C 2Y2HA 1AOIB 2G5IC 4DQYB 4WU8B 1P3IC 2YFWB 3WTPE 1M1AC 5F99C 4G92C 4EO5C 3KXBD 3UTBA 3LELB 5AVCD 3WAAB 1P3ID 1KX4A 3NQJB 3AFAA 5F99D 1M18B 4J8UA 2F8NH 5JA4A 1S32A 5B31B 2FJ7B 4QLCA 3MGQB 5AV9A 5B31G 1HQ3C 4J8WD 3AYWB 3C1CA 5B0YA 5CPKC 2CV5B 1H3OA 1Z2CB 5AV6C 1ID3C 5AV8C 4Z66D 2Y2MA 2VQRA 4X23D 5CPKD 1N1JA 3UTBC 5AV6D 4J8UB 5JA4B 1S32B 5AV8D 1ID3D 3B6FA 5C3IB 3AFAC 3B0CT 5DNMB 1P3LA 2XD5A 4QLCC 4G91B 5AV9C 3AFAD 4JJND 3MGPC 2UWXA 3X1SD 1KX3A 2F8NK 3VH5W 3C1CC 5B0YC 4KGCA 3AZNA 4H9RA 4QLCD 3REID 5AVBD 2YFVB 4XUJB 3MGPD 4Z2MG 5AV5D 5B2IA 1R4VA 1WWSA 5B24B 5CPIA 2Y2LA 3WA9B 3B6GB 1U35A 2BYMB 5B40D 1KX3B 3REKA 4J8XC 2AROA 1P3LC 2HIOD 3AV1C 2RVQC 1B6WA 4H9RB 3AN2D 4J8VA 2Y2QA 3MVDC 4KGCC 3AZGA 3AZNC 4J8XD 3W99A 2FFFB 1P3PA 1P3LD 3AV1D 3A6NA 5CPIB 4HGAB 4NE5A 1TAFA 3W97A 3MVDD 3X1UA 3KFUG 1WWIA 4XZQB 1B67A 3NQUA 5B33D 5BO0A 4UUZB 5B1LA 1P3KA 4ZUXD 3LZ1C 5AY8B 3MGSD 5B1MB 1U35C 1P34B 4KUDD 1TZYA 4J8VB 3REKC 2AROC 5GT0A 3W98C
chains in the Genus database with same CATH topology
4H9SA 3W99B 2J8PA 3LZ1D 3WTPB 4H9QB 3O62A 3AZKD 3B0DC 3W97B 3TU4A 3AZGC 2AROD 1P3GD 3W98D 3A6NC 3AZFA 2PYOB 3MGRA 1AOIA 4R8PD 3X1UC 2YFWA 1KX5B 4Z5TD 5B2JA 3AZJD 1ZLAB 5B1LC 1P3BD 1TZYB 1P3KC 3REJC 4YM6C 3LELA 5B32D 3X1UD 3UTAC 3WAAA 3NQJA 5GT0B 3KUYD 3AZMB 3UT9A 3LZ0D 1M19D 3RELB 1P3KD 4H9NB 3REJD 4YM6D 3AZHC 5B31A 3UTAD 3AZFB 5CPJB 2IO5B 3AYWA 3MNND 3KWQC 3C1BB 3AZHD 3MGRC 2CV5A 3EPLA 1F66D 5B2JB 1AOIC 5B0ZD 5FUGB 4WU8C 5E5AA 1P3MA 1PZRA 1EQZA 3AZIC 5BNXB 3KWQD 3AV2A 4YS3A 1M1AD 3UT9B 3LELC 4WU8D 3WAAC 4ZBJB 5AVCB 4H9OA 3AZID 1P3IB 1M18C 5DNMA 5B31C 2FJ7C 1P3FC 2G5HC 3MGQC 5GSUA 2F2AC 1M18D 1W2EA 3W96A 5E5AB 1P3MB 1HQ3D 2CV5C 1EQZB 5B31D 4J8WB 4LD9B 3AV2B 2FJ7D 1P3FD 3MGQD 5GT3A 4YS3B 2JSSA 2YFVA 4XUJA 5CHLB 1KX4C 5DNNA 2CV5D 4H9OB 2JCHA 4NFTA 4Z66B 5B24A 3X1VB 4WU9B 3WA9A 4X23B 4J8UC 4AWLB 3AZEB 2ZY2A 3UTBD 1S32C 3X1TA 5AV6B 5C3IC 4DRAA 1KX4D 3B6GA 2BYMA 5DNMC 5GSUB 3W96B 4J8UD 3VH5A 1S32D 1P3OB 4G91C 3F6TA 1HTAA 5GT3B 5DNMD 5AV9D 3VH6T 4JJNB 3X1SB 1P3AA 3C1CD 2CWEA 5DNNB 5B0YD 2HUEC 4XUJC 3REHB 2NZDB 3REIB 5AVBB 3B6FC 4XZQA 3X1TB 5B24C 5AV5B 3V9RA 3WA9C 4UUZA 3AZLB 2JE5A 5AY8A 3B6FD 5B1MA 1P34A 3B6GC 3EPJA 3WKJB 1KX3C 5B40B 1P3AB 2HIOB 3WTPA 2RVQD 4H9QA 5KDMA 2ZM5A 3B0CW 3AN2B 1KX3D 4NE6A 2F8NA 5BT1C 4KGCD 3EPHA 5JRGA 3AZND 5B2IC 2PYOA 5CPIC 4HGAC 3V9RB 2NQBA 2RIQA 1KX5A 4XZQC 3A1KA 2ZY3A 5B2ID 2BYKA 5CPID 1ZLAA 3LJAB 5B33B 5B1MC 1P34C 4ZUXB 3AZMA 3MGSB 4J8VC 5KDMB 1U35D 4KUDB 3RELA 2L5AA 4H9NA 3REKD 2F8NB 3W99C 1P3PC 5JRGB 3WTPC 1P34D 4CAYA 5CPJA 3W97C 2F8NG 4J8VD 2NQBB 3AZKB 3AZGD 3C1BA 2PYOC 3W99D 1P3PD 2Y2OA 4Z2MH 1P3GB 3WTPD 5CP6B 3A6ND 2BYKB 5FUGA 4DRBA 3W97D 2XD1A 4R8PB 5BNXA 5GXQB 1ZLAC 1TZYC 4Z5TB 3IP4C 3AZJB 5B1LD 4E45A 1BH9B 5GT0C 1P3BB 3R45A 3AZMC 4H9SC 5AVCA 5B32B 1P3IA 1A7WA 3KUYB 4CAYB 3O62C 1ZLAD 3RELC 1TZYD 2DQNC 3LZ0B 3TU4C 5G49B 1M19B 5GT0D 4WNNB 3AZFC 3AZMD 5CPJC 2IO5C 3O62D 1JFIB 4H9PB 3TU4D 3C1BC 2ZY4A 4J8WA 4NE3A 3MNNB 4UPKA 5B2JC 4LD9A 4M6BA 5CPJD 3MGRD 3AZHB 3AZFD 1F66B 1AOID 5B0ZB 2Y2PA 3KXBB 2W8SA 3R45B 3C1BD 2Y2IA 4Z66A 3UT9C 5B2JD 3X1VA 4WU9A 4X23A 3EPKA 3AZEA 1M1AB 5F99B 4G92B 4ZBJC 4EO5B 3LELD 1BH8A 5AV6A 5AVCC 3WAAD 1ID3A 5AV8A 3UT9D 3AZIB 3AYWC 3VH5T 1P3OA 3H0MC 4WZSB 5E5AC 1P3MC 4CSRB 4JJNA 1BFMA 2Y2NA 3H0RC 3X1SA 3AYWD 4J8WC 1EQZC 4LD9C 3AV2C 1HQ3B 4YS3C 3REHA 4KHAB 2NZDA 3REIA 5CPKB 5E5AD 1P3FB 3B0BA 5AVBA 1P3MD 2Y2GA 5BS7A 3MGPA 1EQZD 1BH8B 5AV5A 4Z66C 4LD9D 3X1VC 3AV2D 4WU9C 3A1IA 5AV8B 4X23C 1ID3B 4YS3D 4AWLC 3AZEC 3AL0C 3AZLA 3UTBB 3P5JB 5GSUC 4WU9D 2Y2KA 3X1VD 1KX4B 3WKJA 3W96C 3AZED 1ULYA 3AFAB 5B40A 1P3OC 2HIOA 3FDDA 5GT3C 5GSUD 3AN2A 4JJNC 4QLCB 3W96D 3X1SC 5AV9B 3MGPB 5DNNC 1P3OD 4J8XA 3REHC 3C1CB 5B0YB 3AV1A 3REIC 5GT3D 2NZDC 5AVBC 4XUJD 1H3OB 5BS7C 3X1TC 3MVDA 5AV5C 5DNND 5B24D 3REHD 3EG5B 5B33A 3LJAA 2ZY5A 3AZLC 3WA9D 2NZDD 2HUEB 1N1JB 1T3UA 3X1TD 4ZUXA 3WKJC 3H0LC 3MGSA 3B6FB 3B6GD 4KUDA 3AZLD 5B40C 1P3AC 4WJ3C 2HIOC 4J8XB 3AN2C 3LZ1A 3AV1B 1P3LB 3WKJD 3AZKA 3MVDB 1P3AD 5BT1D 1P3GA 4KGCB 5CP6A 3AZNB 3W98A 4R8PA 3VH6W 3VH6A 4E44A 5AY8C 4XZQD 5GXQA 3LJAC 5B33C 4Z5TA 5B2IB 3AZJA 1BH9A 1P3BA 4ZUXC 2LY8A 5B32A 5AY8D 3KUYA 5B1MD 3MGSC 4KUDC 1F1EA 3LZ1B 3LJAD 3LZ0A 5G49A 1U35B 1M19A 5JRGC 4WNNA 3REJA 4YM6A 3REKB 2AROB 3UTAA 3W98B 2NQBC 1JFIA 1Q9CA 4H9PA 3AZKC 1KX5C 2F8ND 4WV4B 5BNVA 3B0DB 5JRGD 3MNNA 5CP6C 3AZGB 1P3GC 2PYOD 2BG1A 3AZHA 1F66A 1P3PB 5B0ZA 3A6NB 2NQBD 4R8PC 1TAFB 3KXBA 1KX5D 5GXQC 3X1UB 4Z5TC 2Y2JA 5CP6D 3KWQA 3KSYA 3AZJC 1M1AA 3NQUB 1KU5A 5F99A 1P3BC 5BO0B 5B32G 4WU8A 5B1LB 5B32C 1P3KB 3KUYC 5GXQD 4YM6B 3REJB 3UTAB 3AZIA 3LZ0C 1M19C 3RELD 5BNVB 4CSRA 1M18A 3O62B 3MNNC 3TU4B 1HQ3A 1F66C 4KHAA 3KWQB 5B0ZC 1P3FA 5CPKA 3MGQA 3MGRB 2FJ7A 3KXBC 2DF4C 2Y2HA 1AOIB 2G5IC 4DQYB 4WU8B 1P3IC 2YFWB 3WTPE 1M1AC 5F99C 4G92C 4EO5C 3KXBD 3UTBA 3LELB 5AVCD 3WAAB 1P3ID 1KX4A 3NQJB 3AFAA 5F99D 1M18B 4J8UA 2F8NH 5JA4A 1S32A 5B31B 2FJ7B 4QLCA 3MGQB 5AV9A 5B31G 1HQ3C 4J8WD 3AYWB 3C1CA 5B0YA 5CPKC 2CV5B 1H3OA 1Z2CB 5AV6C 1ID3C 5AV8C 4Z66D 2Y2MA 2VQRA 4X23D 5CPKD 1N1JA 3UTBC 5AV6D 4J8UB 5JA4B 1S32B 5AV8D 1ID3D 3B6FA 5C3IB 3AFAC 3B0CT 5DNMB 1P3LA 2XD5A 4QLCC 4G91B 5AV9C 3AFAD 4JJND 3MGPC 2UWXA 3X1SD 1KX3A 2F8NK 3VH5W 3C1CC 5B0YC 4KGCA 3AZNA 4H9RA 4QLCD 3REID 5AVBD 2YFVB 4XUJB 3MGPD 4Z2MG 5AV5D 5B2IA 1R4VA 1WWSA 5B24B 5CPIA 2Y2LA 3WA9B 3B6GB 1U35A 2BYMB 5B40D 1KX3B 3REKA 4J8XC 2AROA 1P3LC 2HIOD 3AV1C 2RVQC 1B6WA 4H9RB 3AN2D 4J8VA 2Y2QA 3MVDC 4KGCC 3AZGA 3AZNC 4J8XD 3W99A 2FFFB 1P3PA 1P3LD 3AV1D 3A6NA 5CPIB 4HGAB 4NE5A 1TAFA 3W97A 3MVDD 3X1UA 3KFUG 1WWIA 4XZQB 1B67A 3NQUA 5B33D 5BO0A 4UUZB 5B1LA 1P3KA 4ZUXD 3LZ1C 5AY8B 3MGSD 5B1MB 1U35C 1P34B 4KUDD 1TZYA 4J8VB 3REKC 2AROC 5GT0A 3W98C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9S A;  3W99 B;  3LZ1 D;  3WTP B;  4H9Q B;  3O62 A;  3AZK D;  3B0D C;  3W97 B;  3TU4 A;  3AZG C;  2ARO D;  1P3G D;  3W98 D;  3A6N C;  3AZF A;  2PYO B;  3MGR A;  1AOI A;  4R8P D;  3X1U C;  2YFW A;  1KX5 B;  4Z5T D;  5B2J A;  3AZJ D;  1ZLA B;  5B1L C;  1P3B D;  1TZY B;  1P3K C;  3REJ C;  4YM6 C;  3LEL A;  5B32 D;  3X1U D;  3UTA C;  3WAA A;  3NQJ A;  5GT0 B;  3KUY D;  3AZM B;  3UT9 A;  3LZ0 D;  1M19 D;  3REL B;  1P3K D;  4H9N B;  3REJ D;  4YM6 D;  3AZH C;  5B31 A;  3UTA D;  3AZF B;  5CPJ B;  2IO5 B;  3AYW A;  3MNN D;  3KWQ C;  3C1B B;  3AZH D;  3MGR C;  2CV5 A;  1F66 D;  5B2J B;  1AOI C;  5B0Z D;  5FUG B;  4WU8 C;  5E5A A;  1P3M A;  1EQZ A;  3AZI C;  5BNX B;  3KWQ D;  3AV2 A;  4YS3 A;  1M1A D;  3UT9 B;  3LEL C;  4WU8 D;  3WAA C;  4ZBJ B;  5AVC B;  4H9O A;  3AZI D;  1P3I B;  1M18 C;  5DNM A;  5B31 C;  2FJ7 C;  1P3F C;  3MGQ C;  5GSU A;  1M18 D;  3W96 A;  5E5A B;  1P3M B;  1HQ3 D;  2CV5 C;  1EQZ B;  5B31 D;  4J8W B;  4LD9 B;  3AV2 B;  2FJ7 D;  1P3F D;  3MGQ D;  5GT3 A;  4YS3 B;  2JSS A;  2YFV A;  4XUJ A;  5CHL B;  1KX4 C;  5DNN A;  2CV5 D;  4H9O B;  4NFT A;  4Z66 B;  5B24 A;  3X1V B;  4WU9 B;  3WA9 A;  4X23 B;  4J8U C;  4AWL B;  3AZE B;  3UTB D;  1S32 C;  3X1T A;  5AV6 B;  5C3I C;  4DRA A;  1KX4 D;  3B6G A;  2BYM A;  5DNM C;  5GSU B;  3W96 B;  4J8U D;  3VH5 A;  1S32 D;  1P3O B;  4G91 C;  1HTA A;  5GT3 B;  5AV9 D;  5DNM D;  3VH6 T;  4JJN B;  3X1S B;  1P3A A;  3C1C D;  2CWE A;  5DNN B;  5B0Y D;  2HUE C;  4XUJ C;  3REH B;  2NZD B;  3REI B;  5AVB B;  3B6F C;  4XZQ A;  3X1T B;  5B24 C;  5AV5 B;  3V9R A;  3WA9 C;  4UUZ A;  3AZL B;  5AY8 A;  3B6F D;  5B1M A;  1P34 A;  3B6G C;  3WKJ B;  1KX3 C;  5B40 B;  1P3A B;  2HIO B;  3WTP A;  2RVQ D;  4H9Q A;  5KDM A;  3B0C W;  3AN2 B;  1KX3 D;  4NE6 A;  2F8N A;  5BT1 C;  4KGC D;  5JRG A;  3AZN D;  5B2I C;  2PYO A;  5CPI C;  4HGA C;  3V9R B;  2NQB A;  1KX5 A;  4XZQ C;  5B2I D;  2BYK A;  5CPI D;  1ZLA A;  3LJA B;  5B33 B;  5B1M C;  1P34 C;  4ZUX B;  3AZM A;  3MGS B;  4J8V C;  5KDM B;  1U35 D;  4KUD B;  3REL A;  2L5A A;  4H9N A;  3REK D;  2F8N B;  3W99 C;  1P3P C;  5JRG B;  3WTP C;  1P34 D;  4CAY A;  5CPJ A;  3W97 C;  2F8N G;  4J8V D;  2NQB B;  3AZK B;  3AZG D;  3C1B A;  2PYO C;  3W99 D;  1P3P D;  4Z2M H;  1P3G B;  3WTP D;  5CP6 B;  3A6N D;  2BYK B;  5FUG A;  4DRB A;  3W97 D;  4R8P B;  5BNX A;  5GXQ B;  1ZLA C;  1TZY C;  4Z5T B;  3AZJ B;  5B1L D;  4E45 A;  1BH9 B;  5GT0 C;  1P3B B;  3R45 A;  3AZM C;  4H9S C;  5AVC A;  5B32 B;  1P3I A;  1A7W A;  3KUY B;  4CAY B;  3O62 C;  1ZLA D;  3REL C;  1TZY D;  3LZ0 B;  3TU4 C;  5G49 B;  1M19 B;  5GT0 D;  4WNN B;  3AZF C;  3AZM D;  5CPJ C;  2IO5 C;  3O62 D;  1JFI B;  4H9P B;  3TU4 D;  3C1B C;  4J8W A;  4NE3 A;  3MNN B;  5B2J C;  4LD9 A;  4M6B A;  5CPJ D;  3MGR D;  3AZH B;  3AZF D;  1F66 B;  1AOI D;  5B0Z B;  3KXB B;  3R45 B;  3C1B D;  4Z66 A;  3UT9 C;  5B2J D;  3X1V A;  4WU9 A;  4X23 A;  3AZE A;  1M1A B;  5F99 B;  4G92 B;  4ZBJ C;  4EO5 B;  3LEL D;  1BH8 A;  5AV6 A;  5AVC C;  3WAA D;  1ID3 A;  5AV8 A;  3UT9 D;  3AZI B;  3AYW C;  3VH5 T;  1P3O A;  4WZS B;  5E5A C;  1P3M C;  4CSR B;  4JJN A;  1BFM A;  3AYW D;  3X1S A;  1EQZ C;  4J8W C;  4LD9 C;  3AV2 C;  1HQ3 B;  4YS3 C;  3REH A;  4KHA B;  2NZD A;  3REI A;  5CPK B;  5E5A D;  1P3F B;  3B0B A;  5AVB A;  1P3M D;  5BS7 A;  3MGP A;  1EQZ D;  1BH8 B;  4Z66 C;  5AV5 A;  4LD9 D;  3X1V C;  3AV2 D;  4WU9 C;  1ID3 B;  5AV8 B;  4X23 C;  4YS3 D;  4AWL C;  3AZE C;  3AZL A;  3UTB B;  5GSU C;  4WU9 D;  3X1V D;  1KX4 B;  3WKJ A;  3W96 C;  3AZE D;  1ULY A;  3AFA B;  5B40 A;  1P3O C;  2HIO A;  5GT3 C;  5GSU D;  3AN2 A;  4JJN C;  4QLC B;  3W96 D;  3X1S C;  5AV9 B;  3MGP B;  5DNN C;  1P3O D;  4J8X A;  3REH C;  3C1C B;  5B0Y B;  3AV1 A;  3REI C;  5GT3 D;  2NZD C;  5AVB C;  4XUJ D;  1H3O B;  5BS7 C;  3X1T C;  3MVD A;  5AV5 C;  5DNN D;  5B24 D;  3REH D;  3LJA A;  5B33 A;  3AZL C;  3WA9 D;  2NZD D;  2HUE B;  1N1J B;  3X1T D;  4ZUX A;  3WKJ C;  3B6G D;  3MGS A;  3B6F B;  4KUD A;  3AZL D;  5B40 C;  1P3A C;  2HIO C;  4J8X B;  3AN2 C;  3LZ1 A;  3AV1 B;  1P3L B;  3WKJ D;  3AZK A;  3MVD B;  1P3A D;  5BT1 D;  1P3G A;  4KGC B;  5CP6 A;  3AZN B;  3W98 A;  4R8P A;  3VH6 W;  3VH6 A;  4E44 A;  5AY8 C;  4XZQ D;  5GXQ A;  3LJA C;  5B33 C;  4Z5T A;  5B2I B;  3AZJ A;  1BH9 A;  1P3B A;  4ZUX C;  2LY8 A;  5B32 A;  5AY8 D;  3KUY A;  5B1M D;  3MGS C;  4KUD C;  1F1E A;  3LZ1 B;  3LJA D;  3LZ0 A;  5G49 A;  1U35 B;  1M19 A;  5JRG C;  4WNN A;  3REJ A;  4YM6 A;  3REK B;  2ARO B;  3UTA A;  3W98 B;  2NQB C;  1JFI A;  1Q9C A;  4H9P A;  3AZK C;  1KX5 C;  2F8N D;  4WV4 B;  5BNV A;  3B0D B;  5JRG D;  3MNN A;  5CP6 C;  3AZG B;  1P3G C;  2PYO D;  3AZH A;  1F66 A;  1P3P B;  5B0Z A;  3A6N B;  2NQB D;  4R8P C;  1TAF B;  3KXB A;  1KX5 D;  5GXQ C;  3X1U B;  4Z5T C;  5CP6 D;  3KWQ A;  3KSY A;  3AZJ C;  1M1A A;  3NQU B;  1KU5 A;  5F99 A;  1P3B C;  5BO0 B;  4WU8 A;  5B32 G;  5B1L B;  5B32 C;  1P3K B;  3KUY C;  5GXQ D;  4YM6 B;  3REJ B;  3UTA B;  3AZI A;  3LZ0 C;  1M19 C;  3REL D;  5BNV B;  4CSR A;  1M18 A;  3O62 B;  3MNN C;  3TU4 B;  1HQ3 A;  1F66 C;  4KHA A;  3KWQ B;  5B0Z C;  1P3F A;  5CPK A;  3MGQ A;  3MGR B;  2FJ7 A;  3KXB C;  1AOI B;  4WU8 B;  1P3I C;  2YFW B;  3WTP E;  1M1A C;  5F99 C;  4G92 C;  4EO5 C;  3KXB D;  3UTB A;  3LEL B;  5AVC D;  3WAA B;  1P3I D;  1KX4 A;  3NQJ B;  3AFA A;  5F99 D;  1M18 B;  4J8U A;  2F8N H;  5JA4 A;  1S32 A;  5B31 B;  2FJ7 B;  4QLC A;  3MGQ B;  5AV9 A;  5B31 G;  1HQ3 C;  4J8W D;  3AYW B;  3C1C A;  5B0Y A;  5CPK C;  2CV5 B;  1H3O A;  5AV6 C;  1ID3 C;  5AV8 C;  4Z66 D;  4X23 D;  5CPK D;  1N1J A;  3UTB C;  5AV6 D;  4J8U B;  5JA4 B;  1S32 B;  5AV8 D;  1ID3 D;  3B6F A;  5C3I B;  3AFA C;  3B0C T;  5DNM B;  1P3L A;  4QLC C;  4G91 B;  5AV9 C;  3AFA D;  4JJN D;  3MGP C;  3X1S D;  1KX3 A;  2F8N K;  3VH5 W;  3C1C C;  5B0Y C;  4KGC A;  3AZN A;  4H9R A;  4QLC D;  3REI D;  5AVB D;  2YFV B;  4XUJ B;  3MGP D;  4Z2M G;  5AV5 D;  5B2I A;  1R4V A;  1WWS A;  5B24 B;  5CPI A;  3WA9 B;  3B6G B;  1U35 A;  2BYM B;  5B40 D;  1KX3 B;  3REK A;  4J8X C;  2ARO A;  1P3L C;  2HIO D;  3AV1 C;  2RVQ C;  1B6W A;  4H9R B;  3AN2 D;  4J8V A;  3MVD C;  4KGC C;  3AZG A;  3AZN C;  4J8X D;  3W99 A;  1P3P A;  1P3L D;  3AV1 D;  3A6N A;  5CPI B;  4HGA B;  4NE5 A;  1TAF A;  3W97 A;  3MVD D;  3X1U A;  1WWI A;  4XZQ B;  1B67 A;  3NQU A;  5B33 D;  5BO0 A;  4UUZ B;  5B1L A;  1P3K A;  4ZUX D;  3LZ1 C;  5AY8 B;  3MGS D;  5B1M B;  1U35 C;  1P34 B;  4KUD D;  1TZY A;  4J8V B;  3REK C;  2ARO C;  5GT0 A;  3W98 C; 
#chains in the Genus database with same CATH topology
 4H9S A;  3W99 B;  2J8P A;  3LZ1 D;  3WTP B;  4H9Q B;  3O62 A;  3AZK D;  3B0D C;  3W97 B;  3TU4 A;  3AZG C;  2ARO D;  1P3G D;  3W98 D;  3A6N C;  3AZF A;  2PYO B;  3MGR A;  1AOI A;  4R8P D;  3X1U C;  2YFW A;  1KX5 B;  4Z5T D;  5B2J A;  3AZJ D;  1ZLA B;  5B1L C;  1P3B D;  1TZY B;  1P3K C;  3REJ C;  4YM6 C;  3LEL A;  5B32 D;  3X1U D;  3UTA C;  3WAA A;  3NQJ A;  5GT0 B;  3KUY D;  3AZM B;  3UT9 A;  3LZ0 D;  1M19 D;  3REL B;  1P3K D;  4H9N B;  3REJ D;  4YM6 D;  3AZH C;  5B31 A;  3UTA D;  3AZF B;  5CPJ B;  2IO5 B;  3AYW A;  3MNN D;  3KWQ C;  3C1B B;  3AZH D;  3MGR C;  2CV5 A;  3EPL A;  1F66 D;  5B2J B;  1AOI C;  5B0Z D;  5FUG B;  4WU8 C;  5E5A A;  1P3M A;  1PZR A;  1EQZ A;  3AZI C;  5BNX B;  3KWQ D;  3AV2 A;  4YS3 A;  1M1A D;  3UT9 B;  3LEL C;  4WU8 D;  3WAA C;  4ZBJ B;  5AVC B;  4H9O A;  3AZI D;  1P3I B;  1M18 C;  5DNM A;  5B31 C;  2FJ7 C;  1P3F C;  2G5H C;  3MGQ C;  5GSU A;  2F2A C;  1M18 D;  1W2E A;  3W96 A;  5E5A B;  1P3M B;  1HQ3 D;  2CV5 C;  1EQZ B;  5B31 D;  4J8W B;  4LD9 B;  3AV2 B;  2FJ7 D;  1P3F D;  3MGQ D;  5GT3 A;  4YS3 B;  2JSS A;  2YFV A;  4XUJ A;  5CHL B;  1KX4 C;  5DNN A;  2CV5 D;  4H9O B;  2JCH A;  4NFT A;  4Z66 B;  5B24 A;  3X1V B;  4WU9 B;  3WA9 A;  4X23 B;  4J8U C;  4AWL B;  3AZE B;  2ZY2 A;  3UTB D;  1S32 C;  3X1T A;  5AV6 B;  5C3I C;  4DRA A;  1KX4 D;  3B6G A;  2BYM A;  5DNM C;  5GSU B;  3W96 B;  4J8U D;  3VH5 A;  1S32 D;  1P3O B;  4G91 C;  3F6T A;  1HTA A;  5GT3 B;  5DNM D;  5AV9 D;  3VH6 T;  4JJN B;  3X1S B;  1P3A A;  3C1C D;  2CWE A;  5DNN B;  5B0Y D;  2HUE C;  4XUJ C;  3REH B;  2NZD B;  3REI B;  5AVB B;  3B6F C;  4XZQ A;  3X1T B;  5B24 C;  5AV5 B;  3V9R A;  3WA9 C;  4UUZ A;  3AZL B;  2JE5 A;  5AY8 A;  3B6F D;  5B1M A;  1P34 A;  3B6G C;  3EPJ A;  3WKJ B;  1KX3 C;  5B40 B;  1P3A B;  2HIO B;  3WTP A;  2RVQ D;  4H9Q A;  5KDM A;  2ZM5 A;  3B0C W;  3AN2 B;  1KX3 D;  4NE6 A;  2F8N A;  5BT1 C;  4KGC D;  3EPH A;  5JRG A;  3AZN D;  5B2I C;  2PYO A;  5CPI C;  4HGA C;  3V9R B;  2NQB A;  2RIQ A;  1KX5 A;  4XZQ C;  3A1K A;  2ZY3 A;  5B2I D;  2BYK A;  5CPI D;  1ZLA A;  3LJA B;  5B33 B;  5B1M C;  1P34 C;  4ZUX B;  3AZM A;  3MGS B;  4J8V C;  5KDM B;  1U35 D;  4KUD B;  3REL A;  2L5A A;  4H9N A;  3REK D;  2F8N B;  3W99 C;  1P3P C;  5JRG B;  3WTP C;  1P34 D;  4CAY A;  5CPJ A;  3W97 C;  2F8N G;  4J8V D;  2NQB B;  3AZK B;  3AZG D;  3C1B A;  2PYO C;  3W99 D;  1P3P D;  2Y2O A;  4Z2M H;  1P3G B;  3WTP D;  5CP6 B;  3A6N D;  2BYK B;  5FUG A;  4DRB A;  3W97 D;  2XD1 A;  4R8P B;  5BNX A;  5GXQ B;  1ZLA C;  1TZY C;  4Z5T B;  3IP4 C;  3AZJ B;  5B1L D;  4E45 A;  1BH9 B;  5GT0 C;  1P3B B;  3R45 A;  3AZM C;  4H9S C;  5AVC A;  5B32 B;  1P3I A;  1A7W A;  3KUY B;  4CAY B;  3O62 C;  1ZLA D;  3REL C;  1TZY D;  2DQN C;  3LZ0 B;  3TU4 C;  5G49 B;  1M19 B;  5GT0 D;  4WNN B;  3AZF C;  3AZM D;  5CPJ C;  2IO5 C;  3O62 D;  1JFI B;  4H9P B;  3TU4 D;  3C1B C;  2ZY4 A;  4J8W A;  4NE3 A;  3MNN B;  4UPK A;  5B2J C;  4LD9 A;  4M6B A;  5CPJ D;  3MGR D;  3AZH B;  3AZF D;  1F66 B;  1AOI D;  5B0Z B;  2Y2P A;  3KXB B;  2W8S A;  3R45 B;  3C1B D;  2Y2I A;  4Z66 A;  3UT9 C;  5B2J D;  3X1V A;  4WU9 A;  4X23 A;  3EPK A;  3AZE A;  1M1A B;  5F99 B;  4G92 B;  4ZBJ C;  4EO5 B;  3LEL D;  1BH8 A;  5AV6 A;  5AVC C;  3WAA D;  1ID3 A;  5AV8 A;  3UT9 D;  3AZI B;  3AYW C;  3VH5 T;  1P3O A;  3H0M C;  4WZS B;  5E5A C;  1P3M C;  4CSR B;  4JJN A;  1BFM A;  2Y2N A;  3H0R C;  3X1S A;  3AYW D;  4J8W C;  1EQZ C;  4LD9 C;  3AV2 C;  1HQ3 B;  4YS3 C;  3REH A;  4KHA B;  2NZD A;  3REI A;  5CPK B;  5E5A D;  1P3F B;  3B0B A;  5AVB A;  1P3M D;  2Y2G A;  5BS7 A;  3MGP A;  1EQZ D;  1BH8 B;  5AV5 A;  4Z66 C;  4LD9 D;  3X1V C;  3AV2 D;  4WU9 C;  3A1I A;  5AV8 B;  4X23 C;  1ID3 B;  4YS3 D;  4AWL C;  3AZE C;  3AL0 C;  3AZL A;  3UTB B;  3P5J B;  5GSU C;  4WU9 D;  2Y2K A;  3X1V D;  1KX4 B;  3WKJ A;  3W96 C;  3AZE D;  1ULY A;  3AFA B;  5B40 A;  1P3O C;  2HIO A;  3FDD A;  5GT3 C;  5GSU D;  3AN2 A;  4JJN C;  4QLC B;  3W96 D;  3X1S C;  5AV9 B;  3MGP B;  5DNN C;  1P3O D;  4J8X A;  3REH C;  3C1C B;  5B0Y B;  3AV1 A;  3REI C;  5GT3 D;  2NZD C;  5AVB C;  4XUJ D;  1H3O B;  5BS7 C;  3X1T C;  3MVD A;  5AV5 C;  5DNN D;  5B24 D;  3REH D;  3EG5 B;  5B33 A;  3LJA A;  2ZY5 A;  3AZL C;  3WA9 D;  2NZD D;  2HUE B;  1N1J B;  1T3U A;  3X1T D;  4ZUX A;  3WKJ C;  3H0L C;  3MGS A;  3B6F B;  3B6G D;  4KUD A;  3AZL D;  5B40 C;  1P3A C;  4WJ3 C;  2HIO C;  4J8X B;  3AN2 C;  3LZ1 A;  3AV1 B;  1P3L B;  3WKJ D;  3AZK A;  3MVD B;  1P3A D;  5BT1 D;  1P3G A;  4KGC B;  5CP6 A;  3AZN B;  3W98 A;  4R8P A;  3VH6 W;  3VH6 A;  4E44 A;  5AY8 C;  4XZQ D;  5GXQ A;  3LJA C;  5B33 C;  4Z5T A;  5B2I B;  3AZJ A;  1BH9 A;  1P3B A;  4ZUX C;  2LY8 A;  5B32 A;  5AY8 D;  3KUY A;  5B1M D;  3MGS C;  4KUD C;  1F1E A;  3LZ1 B;  3LJA D;  3LZ0 A;  5G49 A;  1U35 B;  1M19 A;  5JRG C;  4WNN A;  3REJ A;  4YM6 A;  3REK B;  2ARO B;  3UTA A;  3W98 B;  2NQB C;  1JFI A;  1Q9C A;  4H9P A;  3AZK C;  1KX5 C;  2F8N D;  4WV4 B;  5BNV A;  3B0D B;  5JRG D;  3MNN A;  5CP6 C;  3AZG B;  1P3G C;  2PYO D;  2BG1 A;  3AZH A;  1F66 A;  1P3P B;  5B0Z A;  3A6N B;  2NQB D;  4R8P C;  1TAF B;  3KXB A;  1KX5 D;  5GXQ C;  3X1U B;  4Z5T C;  2Y2J A;  5CP6 D;  3KWQ A;  3KSY A;  3AZJ C;  1M1A A;  3NQU B;  1KU5 A;  5F99 A;  1P3B C;  5BO0 B;  5B32 G;  4WU8 A;  5B1L B;  5B32 C;  1P3K B;  3KUY C;  5GXQ D;  4YM6 B;  3REJ B;  3UTA B;  3AZI A;  3LZ0 C;  1M19 C;  3REL D;  5BNV B;  4CSR A;  1M18 A;  3O62 B;  3MNN C;  3TU4 B;  1HQ3 A;  1F66 C;  4KHA A;  3KWQ B;  5B0Z C;  1P3F A;  5CPK A;  3MGQ A;  3MGR B;  2FJ7 A;  3KXB C;  2DF4 C;  2Y2H A;  1AOI B;  2G5I C;  4DQY B;  4WU8 B;  1P3I C;  2YFW B;  3WTP E;  1M1A C;  5F99 C;  4G92 C;  4EO5 C;  3KXB D;  3UTB A;  3LEL B;  5AVC D;  3WAA B;  1P3I D;  1KX4 A;  3NQJ B;  3AFA A;  5F99 D;  1M18 B;  4J8U A;  2F8N H;  5JA4 A;  1S32 A;  5B31 B;  2FJ7 B;  4QLC A;  3MGQ B;  5AV9 A;  5B31 G;  1HQ3 C;  4J8W D;  3AYW B;  3C1C A;  5B0Y A;  5CPK C;  2CV5 B;  1H3O A;  1Z2C B;  5AV6 C;  1ID3 C;  5AV8 C;  4Z66 D;  2Y2M A;  2VQR A;  4X23 D;  5CPK D;  1N1J A;  3UTB C;  5AV6 D;  4J8U B;  5JA4 B;  1S32 B;  5AV8 D;  1ID3 D;  3B6F A;  5C3I B;  3AFA C;  3B0C T;  5DNM B;  1P3L A;  2XD5 A;  4QLC C;  4G91 B;  5AV9 C;  3AFA D;  4JJN D;  3MGP C;  2UWX A;  3X1S D;  1KX3 A;  2F8N K;  3VH5 W;  3C1C C;  5B0Y C;  4KGC A;  3AZN A;  4H9R A;  4QLC D;  3REI D;  5AVB D;  2YFV B;  4XUJ B;  3MGP D;  4Z2M G;  5AV5 D;  5B2I A;  1R4V A;  1WWS A;  5B24 B;  5CPI A;  2Y2L A;  3WA9 B;  3B6G B;  1U35 A;  2BYM B;  5B40 D;  1KX3 B;  3REK A;  4J8X C;  2ARO A;  1P3L C;  2HIO D;  3AV1 C;  2RVQ C;  1B6W A;  4H9R B;  3AN2 D;  4J8V A;  2Y2Q A;  3MVD C;  4KGC C;  3AZG A;  3AZN C;  4J8X D;  3W99 A;  2FFF B;  1P3P A;  1P3L D;  3AV1 D;  3A6N A;  5CPI B;  4HGA B;  4NE5 A;  1TAF A;  3W97 A;  3MVD D;  3X1U A;  3KFU G;  1WWI A;  4XZQ B;  1B67 A;  3NQU A;  5B33 D;  5BO0 A;  4UUZ B;  5B1L A;  1P3K A;  4ZUX D;  3LZ1 C;  5AY8 B;  3MGS D;  5B1M B;  1U35 C;  1P34 B;  4KUD D;  1TZY A;  4J8V B;  3REK C;  2ARO C;  5GT0 A;  3W98 C; 
#chains in the Genus database with same CATH homology
 4H9S A;  3W99 B;  2J8P A;  3LZ1 D;  3WTP B;  4H9Q B;  3O62 A;  3AZK D;  3B0D C;  3W97 B;  3TU4 A;  3AZG C;  2ARO D;  1P3G D;  3W98 D;  3A6N C;  3AZF A;  2PYO B;  3MGR A;  1AOI A;  4R8P D;  3X1U C;  2YFW A;  1KX5 B;  4Z5T D;  5B2J A;  3AZJ D;  1ZLA B;  5B1L C;  1P3B D;  1TZY B;  1P3K C;  3REJ C;  4YM6 C;  3LEL A;  5B32 D;  3X1U D;  3UTA C;  3WAA A;  3NQJ A;  5GT0 B;  3KUY D;  3AZM B;  3UT9 A;  3LZ0 D;  1M19 D;  3REL B;  1P3K D;  4H9N B;  3REJ D;  4YM6 D;  3AZH C;  5B31 A;  3UTA D;  3AZF B;  5CPJ B;  2IO5 B;  3AYW A;  3MNN D;  3KWQ C;  3C1B B;  3AZH D;  3MGR C;  2CV5 A;  3EPL A;  1F66 D;  5B2J B;  1AOI C;  5B0Z D;  5FUG B;  4WU8 C;  5E5A A;  1P3M A;  1PZR A;  1EQZ A;  3AZI C;  5BNX B;  3KWQ D;  3AV2 A;  4YS3 A;  1M1A D;  3UT9 B;  3LEL C;  4WU8 D;  3WAA C;  4ZBJ B;  5AVC B;  4H9O A;  3AZI D;  1P3I B;  1M18 C;  5DNM A;  5B31 C;  2FJ7 C;  1P3F C;  2G5H C;  3MGQ C;  5GSU A;  2F2A C;  1M18 D;  1W2E A;  3W96 A;  5E5A B;  1P3M B;  1HQ3 D;  2CV5 C;  1EQZ B;  5B31 D;  4J8W B;  4LD9 B;  3AV2 B;  2FJ7 D;  1P3F D;  3MGQ D;  5GT3 A;  4YS3 B;  2JSS A;  2YFV A;  4XUJ A;  5CHL B;  1KX4 C;  5DNN A;  2CV5 D;  4H9O B;  2JCH A;  4NFT A;  4Z66 B;  5B24 A;  3X1V B;  4WU9 B;  3WA9 A;  4X23 B;  4J8U C;  4AWL B;  3AZE B;  2ZY2 A;  3UTB D;  1S32 C;  3X1T A;  5AV6 B;  5C3I C;  4DRA A;  1KX4 D;  3B6G A;  2BYM A;  5DNM C;  5GSU B;  3W96 B;  4J8U D;  3VH5 A;  1S32 D;  1P3O B;  4G91 C;  3F6T A;  1HTA A;  5GT3 B;  5DNM D;  5AV9 D;  3VH6 T;  4JJN B;  3X1S B;  1P3A A;  3C1C D;  2CWE A;  5DNN B;  5B0Y D;  2HUE C;  4XUJ C;  3REH B;  2NZD B;  3REI B;  5AVB B;  3B6F C;  4XZQ A;  3X1T B;  5B24 C;  5AV5 B;  3V9R A;  3WA9 C;  4UUZ A;  3AZL B;  2JE5 A;  5AY8 A;  3B6F D;  5B1M A;  1P34 A;  3B6G C;  3EPJ A;  3WKJ B;  1KX3 C;  5B40 B;  1P3A B;  2HIO B;  3WTP A;  2RVQ D;  4H9Q A;  5KDM A;  2ZM5 A;  3B0C W;  3AN2 B;  1KX3 D;  4NE6 A;  2F8N A;  5BT1 C;  4KGC D;  3EPH A;  5JRG A;  3AZN D;  5B2I C;  2PYO A;  5CPI C;  4HGA C;  3V9R B;  2NQB A;  2RIQ A;  1KX5 A;  4XZQ C;  3A1K A;  2ZY3 A;  5B2I D;  2BYK A;  5CPI D;  1ZLA A;  3LJA B;  5B33 B;  5B1M C;  1P34 C;  4ZUX B;  3AZM A;  3MGS B;  4J8V C;  5KDM B;  1U35 D;  4KUD B;  3REL A;  2L5A A;  4H9N A;  3REK D;  2F8N B;  3W99 C;  1P3P C;  5JRG B;  3WTP C;  1P34 D;  4CAY A;  5CPJ A;  3W97 C;  2F8N G;  4J8V D;  2NQB B;  3AZK B;  3AZG D;  3C1B A;  2PYO C;  3W99 D;  1P3P D;  2Y2O A;  4Z2M H;  1P3G B;  3WTP D;  5CP6 B;  3A6N D;  2BYK B;  5FUG A;  4DRB A;  3W97 D;  2XD1 A;  4R8P B;  5BNX A;  5GXQ B;  1ZLA C;  1TZY C;  4Z5T B;  3IP4 C;  3AZJ B;  5B1L D;  4E45 A;  1BH9 B;  5GT0 C;  1P3B B;  3R45 A;  3AZM C;  4H9S C;  5AVC A;  5B32 B;  1P3I A;  1A7W A;  3KUY B;  4CAY B;  3O62 C;  1ZLA D;  3REL C;  1TZY D;  2DQN C;  3LZ0 B;  3TU4 C;  5G49 B;  1M19 B;  5GT0 D;  4WNN B;  3AZF C;  3AZM D;  5CPJ C;  2IO5 C;  3O62 D;  1JFI B;  4H9P B;  3TU4 D;  3C1B C;  2ZY4 A;  4J8W A;  4NE3 A;  3MNN B;  4UPK A;  5B2J C;  4LD9 A;  4M6B A;  5CPJ D;  3MGR D;  3AZH B;  3AZF D;  1F66 B;  1AOI D;  5B0Z B;  2Y2P A;  3KXB B;  2W8S A;  3R45 B;  3C1B D;  2Y2I A;  4Z66 A;  3UT9 C;  5B2J D;  3X1V A;  4WU9 A;  4X23 A;  3EPK A;  3AZE A;  1M1A B;  5F99 B;  4G92 B;  4ZBJ C;  4EO5 B;  3LEL D;  1BH8 A;  5AV6 A;  5AVC C;  3WAA D;  1ID3 A;  5AV8 A;  3UT9 D;  3AZI B;  3AYW C;  3VH5 T;  1P3O A;  3H0M C;  4WZS B;  5E5A C;  1P3M C;  4CSR B;  4JJN A;  1BFM A;  2Y2N A;  3H0R C;  3X1S A;  3AYW D;  4J8W C;  1EQZ C;  4LD9 C;  3AV2 C;  1HQ3 B;  4YS3 C;  3REH A;  4KHA B;  2NZD A;  3REI A;  5CPK B;  5E5A D;  1P3F B;  3B0B A;  5AVB A;  1P3M D;  2Y2G A;  5BS7 A;  3MGP A;  1EQZ D;  1BH8 B;  5AV5 A;  4Z66 C;  4LD9 D;  3X1V C;  3AV2 D;  4WU9 C;  3A1I A;  5AV8 B;  4X23 C;  1ID3 B;  4YS3 D;  4AWL C;  3AZE C;  3AL0 C;  3AZL A;  3UTB B;  3P5J B;  5GSU C;  4WU9 D;  2Y2K A;  3X1V D;  1KX4 B;  3WKJ A;  3W96 C;  3AZE D;  1ULY A;  3AFA B;  5B40 A;  1P3O C;  2HIO A;  3FDD A;  5GT3 C;  5GSU D;  3AN2 A;  4JJN C;  4QLC B;  3W96 D;  3X1S C;  5AV9 B;  3MGP B;  5DNN C;  1P3O D;  4J8X A;  3REH C;  3C1C B;  5B0Y B;  3AV1 A;  3REI C;  5GT3 D;  2NZD C;  5AVB C;  4XUJ D;  1H3O B;  5BS7 C;  3X1T C;  3MVD A;  5AV5 C;  5DNN D;  5B24 D;  3REH D;  3EG5 B;  5B33 A;  3LJA A;  2ZY5 A;  3AZL C;  3WA9 D;  2NZD D;  2HUE B;  1N1J B;  1T3U A;  3X1T D;  4ZUX A;  3WKJ C;  3H0L C;  3MGS A;  3B6F B;  3B6G D;  4KUD A;  3AZL D;  5B40 C;  1P3A C;  4WJ3 C;  2HIO C;  4J8X B;  3AN2 C;  3LZ1 A;  3AV1 B;  1P3L B;  3WKJ D;  3AZK A;  3MVD B;  1P3A D;  5BT1 D;  1P3G A;  4KGC B;  5CP6 A;  3AZN B;  3W98 A;  4R8P A;  3VH6 W;  3VH6 A;  4E44 A;  5AY8 C;  4XZQ D;  5GXQ A;  3LJA C;  5B33 C;  4Z5T A;  5B2I B;  3AZJ A;  1BH9 A;  1P3B A;  4ZUX C;  2LY8 A;  5B32 A;  5AY8 D;  3KUY A;  5B1M D;  3MGS C;  4KUD C;  1F1E A;  3LZ1 B;  3LJA D;  3LZ0 A;  5G49 A;  1U35 B;  1M19 A;  5JRG C;  4WNN A;  3REJ A;  4YM6 A;  3REK B;  2ARO B;  3UTA A;  3W98 B;  2NQB C;  1JFI A;  1Q9C A;  4H9P A;  3AZK C;  1KX5 C;  2F8N D;  4WV4 B;  5BNV A;  3B0D B;  5JRG D;  3MNN A;  5CP6 C;  3AZG B;  1P3G C;  2PYO D;  2BG1 A;  3AZH A;  1F66 A;  1P3P B;  5B0Z A;  3A6N B;  2NQB D;  4R8P C;  1TAF B;  3KXB A;  1KX5 D;  5GXQ C;  3X1U B;  4Z5T C;  2Y2J A;  5CP6 D;  3KWQ A;  3KSY A;  3AZJ C;  1M1A A;  3NQU B;  1KU5 A;  5F99 A;  1P3B C;  5BO0 B;  5B32 G;  4WU8 A;  5B1L B;  5B32 C;  1P3K B;  3KUY C;  5GXQ D;  4YM6 B;  3REJ B;  3UTA B;  3AZI A;  3LZ0 C;  1M19 C;  3REL D;  5BNV B;  4CSR A;  1M18 A;  3O62 B;  3MNN C;  3TU4 B;  1HQ3 A;  1F66 C;  4KHA A;  3KWQ B;  5B0Z C;  1P3F A;  5CPK A;  3MGQ A;  3MGR B;  2FJ7 A;  3KXB C;  2DF4 C;  2Y2H A;  1AOI B;  2G5I C;  4DQY B;  4WU8 B;  1P3I C;  2YFW B;  3WTP E;  1M1A C;  5F99 C;  4G92 C;  4EO5 C;  3KXB D;  3UTB A;  3LEL B;  5AVC D;  3WAA B;  1P3I D;  1KX4 A;  3NQJ B;  3AFA A;  5F99 D;  1M18 B;  4J8U A;  2F8N H;  5JA4 A;  1S32 A;  5B31 B;  2FJ7 B;  4QLC A;  3MGQ B;  5AV9 A;  5B31 G;  1HQ3 C;  4J8W D;  3AYW B;  3C1C A;  5B0Y A;  5CPK C;  2CV5 B;  1H3O A;  1Z2C B;  5AV6 C;  1ID3 C;  5AV8 C;  4Z66 D;  2Y2M A;  2VQR A;  4X23 D;  5CPK D;  1N1J A;  3UTB C;  5AV6 D;  4J8U B;  5JA4 B;  1S32 B;  5AV8 D;  1ID3 D;  3B6F A;  5C3I B;  3AFA C;  3B0C T;  5DNM B;  1P3L A;  2XD5 A;  4QLC C;  4G91 B;  5AV9 C;  3AFA D;  4JJN D;  3MGP C;  2UWX A;  3X1S D;  1KX3 A;  2F8N K;  3VH5 W;  3C1C C;  5B0Y C;  4KGC A;  3AZN A;  4H9R A;  4QLC D;  3REI D;  5AVB D;  2YFV B;  4XUJ B;  3MGP D;  4Z2M G;  5AV5 D;  5B2I A;  1R4V A;  1WWS A;  5B24 B;  5CPI A;  2Y2L A;  3WA9 B;  3B6G B;  1U35 A;  2BYM B;  5B40 D;  1KX3 B;  3REK A;  4J8X C;  2ARO A;  1P3L C;  2HIO D;  3AV1 C;  2RVQ C;  1B6W A;  4H9R B;  3AN2 D;  4J8V A;  2Y2Q A;  3MVD C;  4KGC C;  3AZG A;  3AZN C;  4J8X D;  3W99 A;  2FFF B;  1P3P A;  1P3L D;  3AV1 D;  3A6N A;  5CPI B;  4HGA B;  4NE5 A;  1TAF A;  3W97 A;  3MVD D;  3X1U A;  3KFU G;  1WWI A;  4XZQ B;  1B67 A;  3NQU A;  5B33 D;  5BO0 A;  4UUZ B;  5B1L A;  1P3K A;  4ZUX D;  3LZ1 C;  5AY8 B;  3MGS D;  5B1M B;  1U35 C;  1P34 B;  4KUD D;  1TZY A;  4J8V B;  3REK C;  2ARO C;  5GT0 A;  3W98 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...