4R8PD

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pD00
1Q9CA 5AVCD 2F8NK 1TZYB 4ZBJC 5B1MD 3C1CD 2L5AA 4YS3D 5DNMC 3O62B 4YM6A 3RELA 3AZJB 5AVCA 2IO5C 5B1MA 5B33D 3C1CA 4J8WB 5B0ZB 4YS3A 3LZ0C 5B24C 2F8NG 5B33A 3AFAD 5AV5B 4CSRA 4H9OA 5AV8D 3W99C 3MVDC 5E5AD 3V9RB 1KX3B 3W97D 5E5AA 2BYKB 3B6GC 5DNMD 3W97A 3B0CW 5BNVB 5B2IB 3MGPD 4DRAA 5DNMA 3R45B 5KDMA 2HUEB 5JA4B 4NE6A 4KUDD 4WNNA 2PYOB 3AZFC 3MGPA 1TAFA 4JJND 3NQJB 4NE5A 4KUDA 3W99D 5GSUB 3MVDD 1S32D 1M1AD 4JJNA 1JFIB 4G92C 3KUYC 2CWEA 3W99A 5F99C 3MVDA 1S32A 1M1AA 1H3OA 5B32G 3WTPC 5GXQA 4UUZA 1P3LB 2NZDC 5AVBD 1B67A 3VH6A 5AV6D 4Z5TC 5AVBA 4LD9B 5AV6A 3AZFD 2CV5D 1P3GC 5B31B 1P3PD 4WU8B 4KHAA 5CPKB 3AZFA 1AOID 2CV5A 3REID 1P3PA 5B0YC 4ZUXC 3LZ0B 3KUYD 5F99D 4Z66D 1AOIA 4CAYA 3WTPD 3REIA 1P3KB 5B1LC 5FUGA 4XUJB 3KUYA 5F99A 4Z66A 2NZDD 3WTPA 4Z5TD 3O62C 3A6ND 4J8WC 4WU9B 3B6GB 1P3GD 4Z5TA 4XZQB 1BH8B 3A6NA 5AY8B 4H9RA 4Z2MG 5JRGC 4ZUXD 3B0CT 2NQBB 4QLCB 5B1LD 1P34B 5G49A 4ZUXA 1ZLAB 1KX3C 4AWLB 5AV9B 3REKD 3KWQB 1TZYD 5B1LA 3AZMB 3AZHB 3REKA 3O62D 3AZJD 1TZYA 3X1VB 3AN2B 4J8WD 5B2IC 5B0ZD 1P3AC 3AZJA 1M18B 2HUEC 2BYMB 1EQZD 4J8WA 5AV5D 5B0ZA 3W96B 4E45A 3AZNC 1EQZA 5AV5A 5GSUC 5B32A 4HGAB 1KX3D 3MNNB 3V9RA 2LY8A 5B2JB 1P3LC 1KX3A 1U35B 2BYKA 2JSSA 1F66A 5B2ID 4J8VB 4LD9C 3LELC 4R8PC 2PYOD 5BNVA 5BS7C 3MGSA 3R45A 5B31C 4WU8C 5CPKC 5GSUD 2PYOA 3W98B 3NQJA 5CPJC 4H9SC 5GSUA 1A7WA 1P3KC 5JRGB 4XUJC 1P3LD 1ID3C 3AFAA 3REJB 4H9QB 4KGCB 1P3LA 3NQUB 5AV8A 5GT3B 4LD9D 3AZGB 4WU9C 1P3OB 4XZQC 4WU8D 3AZLB 4LD9A 5AY8C 5CPKD 2AROC 3WA9C 4WU8A 1P3AB 3LZ0D 5CPKA 2NQBC 5BNXB 5B24D 1BFMA 4QLCC 1P3KD 1P34C 1P3FC 4XUJD 3AZNB 3LZ0A 1ZLAC 4H9SA 3TU4B 4AWLC 3KSYA 5AV9C 3B0DC 5B24A 3X1UC 3KWQC 3AV1C 2HIOB 1P3KA 4XUJA 3AZMC 3AZHC 4J8XC 3X1VC 3MGRB 3LZ1B 3AN2C 4WU9D 3B6GD 5C3IB 3X1SB 4XZQD 1M18C 1HQ3B 5AY8D 4WU9A 2RVQC 3B6GA 3W96C 4XZQA 3LELB 2NQBD 4YM6B 3B6FC 4QLCD 4R8PB 3MGQB 1P34D 4HGAC 1ZLAD 3MNNC 5AV9D 4QLCA 3KWQD 5B2JC 1P3BC 1P34A 1BH9B 1ZLAA 3AZMD 1WWSA 3AZHD 5AV9A 1U35C 5BT1C 3C1BB 3KWQA 5CPJB 2FJ7B 4EO5B 3X1VD 3AN2D 4J8VC 3AZMA 3AZHA 1M18D 3X1VA 3AN2A 3AYWB 1ID3B 2RVQD 3KXBB 3W96D 1M18A 5CP6C 4J8UC 2NZDA 3W97B 5BO0B 3W96A 3W98C 5B40C 3MNND 5B2JD 1P3GA 2AROB 3MGPB 1M19B 3MNNA 5CPIB 1U35D 3WA9B 5BT1D 5B0YD 4DRBA 5B2JA 3REJC 1N1JB 4J8VD 4KGCC 5B31G 5B0YA 1P3FB 4X23C 3X1UB 3B0DB 5GT3C 3AV1B 3AZGC 4J8VA 3UT9B 1H3OB 1P3OC 5GXQB 3AZLC 4H9PB 4J8XB 3W98D 3O62A 1R4VA 3WTPE 1B6WA 3W98A 5JRGD 3TU4C 3REJD 3X1TC 3B6FB 2HIOC 3LJAB 3WAAB 4KGCD 5JRGA 4Z2MH 3REJA 5GT3D 3MGRC 3LZ1C 4H9NB 3AZGD 1AOIB 1P3BB 5C3IC 1P3OD 3X1SC 1KX4C 2YFVB 1HQ3C 3AZLD 3AZGA 4Z66B 1P3OA 3UTAB 1P3AD 3AZLA 3RELC 4YM6C 2F8NB 5B2IA 3MGQC 3C1CC 3AZEB 1P3AA 3AZND 3TU4D 5CP6B 5BNXA 5JA4A 4J8UB 2HIOD 3AZNA 2YFWB 3TU4A 5B40B 3C1BC 2FJ7C 4EO5C 3AV2B 3MGRD 1JFIA 3X1SD 1HQ3D 5CHLB 3MGRA 5DNNB 3AYWC 3KXBC 1HQ3A 1P3IB 3LELD 4X23B 3W97C 4YM6D 1KX5B 3WKJB 4R8PD 3MGQD 3VH5W 3LELA 5B31D 4M6BA 4R8PA 5BS7A 3MGQA 5GT0B 3MGPC 1M19C 3REHB 5CPIC 5B31A 3UTBB 5CPJD 3C1BD 2FJ7D 3AZIB 1EQZB 4KUDC 1BH9A 5B32B 4JJNC 1KU5A 3C1BA 5CPJA 2FJ7A 3AZKB 3AYWD 1ID3D 3X1TB 3KXBD 1S32C 3UT9C 1M1AC 5GXQC 2F8NH 3B0BA 3AYWA 1ID3A 3KXBA 1P3MB 1KX4B 5BO0A 5AVBC 1F66B 5AV6C 2AROD 1M19D 3MGSB 1BH8A 5CPID 3WA9D 5AY8A 3RELB 5AVCB 3LJAC 4WV4B 2AROA 3WAAC 5B1MB 2CV5C 5CPIA 3C1CB 1M19A 3WA9A 1P3FD 4YS3B 1P3PC 2NQBA 3X1UD 3AV1D 1N1JA 3UT9D 1AOIC 5B33B 1P3FA 5GXQD 4CSRB 3REIC 4H9OB 3X1UA 3AV1A 4G91B 4Z66C 4J8XD 3UT9A 1HTAA 3AFAB 3UTAC 4H9PA 5AV8B 4J8XA 5E5AB 3AZEC 3A6NC 2BYMA 4NFTA 3B6FD 3LJAD 3WAAD 4ZBJB 1WWIA 5DNMB 3AV2C 5KDMB 3B6FA 2IO5B 3LJAA 3WAAA 3VH5T 1P3BD 4WNNB 3VH6W 1TAFB 4H9NA 5DNNC 5B24B 1P3BA 4KUDB 2YFVA 3UTAD 4JJNB 1U35A 1P3IC 4E44A 3REKC 1KX5C 3WKJC 2F8ND 1TZYC 3W99B 3MVDB 1S32B 1M1AB 3UTAA 3AZED 4UUZB 5CP6D 3AZJC 4J8UD 2F8NA 3AZEA 5GT0C 5B0ZC 3REHC 5CP6A 3UTBC 5B40D 4J8UA 3AZIC 3AV2D 1EQZC 5AVBB 5AV5C 2YFWA 5B32C 5AV6B 5B40A 3AZKC 3AV2A 5DNND 4KHAB 3AZFB 2CV5B 1P3ID 4NE3A 5DNNA 4X23D 1P3PB 1KX5D 3WKJD 4H9QA 4KGCA 1P3MC 3NQUA 4CAYB 4G92B 1P3IA 3REIB 4X23A 5FUGB 1KX5A 3KUYB 5GT3A 3WKJA 5F99B 1F66C 5GT0D 3WTPB 3MGSC 3REHD 3UTBD 3AZID 2NZDB 2PYOC 5AVCC 5B1MC 5GT0A 1ULYA 5B32D 3REHA 3UTBA 4YS3C 4Z5TB 3AZIA 3AZKD 3A6NB 3X1TD 5B33C 4H9RB 1P3GB 3AZKA 3X1TA 4G91C 2HIOA 3LZ1D 3AFAC 1P3MD 3VH5A 1KX4D 1F1EA 5G49B 5AV8C 4ZUXB 5B0YB 3LZ1A 1F66D 3VH6T 1P3MA 5E5AC 3X1SA 1KX4A 3MGSD 5B1LB 4WZSB 3REKB 3RELD
chains in the Genus database with same CATH superfamily
1Q9CA 5AVCD 2Y2LA 1TZYB 4ZBJC 5B1MD 2F8NK 3C1CD 2L5AA 4YS3D 5DNMC 3O62B 4YM6A 3RELA 3AZJB 5AVCA 2IO5C 5B1MA 5B33D 3C1CA 4J8WB 5B0ZB 4YS3A 3LZ0C 5B24C 2F8NG 5B33A 3AFAD 5AV5B 4CSRA 4H9OA 5AV8D 3W99C 3MVDC 5E5AD 3V9RB 1KX3B 3W97D 5E5AA 2BYKB 3B6GC 5DNMD 3W97A 4WJ3C 3B0CW 5BNVB 5B2IB 3MGPD 4DRAA 5DNMA 3R45B 5KDMA 2HUEB 5JA4B 4NE6A 4KUDD 4WNNA 2PYOB 3AZFC 3MGPA 1TAFA 4JJND 2ZY5A 3NQJB 4NE5A 4KUDA 3W99D 5GSUB 2W8SA 3MVDD 1S32D 1M1AD 4JJNA 1JFIB 4G92C 3KUYC 2CWEA 3W99A 5F99C 3MVDA 1S32A 1M1AA 1H3OA 5B32G 3WTPC 5GXQA 4UUZA 1P3LB 2NZDC 5AVBD 1B67A 2Y2IA 3VH6A 5AV6D 2DQNC 3H0LC 4Z5TC 5AVBA 4LD9B 2JCHA 5AV6A 3AZFD 2CV5D 1P3GC 5B31B 1P3PD 4WU8B 4KHAA 5CPKB 3AZFA 1AOID 2CV5A 3REID 1P3PA 5B0YC 4ZUXC 3LZ0B 3KUYD 5F99D 4Z66D 1AOIA 4CAYA 3WTPD 3REIA 1P3KB 5B1LC 5FUGA 4XUJB 3KUYA 5F99A 4Z66A 2NZDD 3WTPA 4Z5TD 3O62C 3A6ND 2ZY3A 4J8WC 4WU9B 3B6GB 1P3GD 4Z5TA 4XZQB 1BH8B 3A6NA 5AY8B 4H9RA 4Z2MG 5JRGC 2Y2QA 4ZUXD 3B0CT 2NQBB 4QLCB 5B1LD 1P34B 5G49A 4ZUXA 1ZLAB 1KX3C 4AWLB 5AV9B 3REKD 3KWQB 1TZYD 2JE5A 5B1LA 3AZMB 3AZHB 3REKA 3AL0C 3O62D 3AZJD 1TZYA 3X1VB 3AN2B 4J8WD 5B2IC 5B0ZD 1P3AC 3AZJA 1M18B 2HUEC 2BYMB 1EQZD 4J8WA 5AV5D 5B0ZA 3W96B 4E45A 3AZNC 1EQZA 5AV5A 5GSUC 5B32A 4HGAB 1KX3D 3MNNB 3V9RA 2LY8A 5B2JB 2FFFB 1P3LC 1KX3A 1U35B 2BYKA 2JSSA 1F66A 5B2ID 4J8VB 2Y2OA 4LD9C 3LELC 2XD1A 4R8PC 2PYOD 5BNVA 5BS7C 3MGSA 3R45A 5B31C 4WU8C 5CPKC 5GSUD 2PYOA 3W98B 3NQJA 5CPJC 4H9SC 5GSUA 1A7WA 1P3KC 5JRGB 4XUJC 1P3LD 2J8PA 1ID3C 3AFAA 3REJB 1Z2CB 4H9QB 4KGCB 1P3LA 3NQUB 5AV8A 5GT3B 4LD9D 3AZGB 4WU9C 1P3OB 4XZQC 4WU8D 3AZLB 4LD9A 5AY8C 5CPKD 2AROC 3WA9C 2VQRA 4WU8A 1P3AB 3LZ0D 5CPKA 2NQBC 5BNXB 5B24D 1BFMA 4QLCC 1P3KD 1P34C 1P3FC 3H0MC 4XUJD 3LZ0A 3AZNB 4H9SA 3TU4B 4AWLC 3KSYA 5AV9C 3B0DC 5B24A 3X1UC 3KWQC 3AV1C 2F2AC 2HIOB 2Y2HA 1P3KA 4XUJA 3AZMC 3AZHC 4J8XC 3X1VC 3MGRB 3LZ1B 3AN2C 4WU9D 3B6GD 5C3IB 3X1SB 2Y2KA 4XZQD 1M18C 1HQ3B 5AY8D 4WU9A 2RVQC 3B6GA 3W96C 4XZQA 2G5IC 3LELB 2NQBD 4YM6B 3B6FC 4QLCD 4R8PB 3MGQB 1P34D 4HGAC 1ZLAD 3MNNC 5AV9D 4QLCA 3KWQD 5B2JC 1P3BC 1P34A 1BH9B 1ZLAA 3AZMD 1WWSA 3AZHD 5AV9A 1U35C 5BT1C 3C1BB 3KWQA 5CPJB 2FJ7B 4EO5B 3X1VD 3AN2D 4J8VC 1W2EA 3AZMA 3AZHA 1M18D 3X1VA 3AN2A 3AYWB 1ID3B 2RVQD 3KXBB 3W96D 1M18A 5CP6C 3FDDA 4J8UC 2NZDA 3W97B 5BO0B 2G5HC 3W96A 3W98C 2DF4C 5B40C 3MNND 5B2JD 2BG1A 1P3GA 2AROB 3MGPB 1M19B 3MNNA 5CPIB 1U35D 3WA9B 5BT1D 5B0YD 4DRBA 5B2JA 3REJC 1N1JB 4J8VD 4KGCC 2Y2PA 5B31G 5B0YA 1P3FB 4X23C 3X1UB 3B0DB 5GT3C 3AV1B 3AZGC 4J8VA 3UT9B 1H3OB 1P3OC 5GXQB 2Y2MA 3AZLC 4H9PB 4J8XB 3W98D 3O62A 1R4VA 3WTPE 1B6WA 3W98A 5JRGD 2Y2JA 3TU4C 3REJD 3X1TC 3B6FB 2HIOC 3LJAB 3WAAB 4KGCD 5JRGA 3A1IA 4Z2MH 3REJA 5GT3D 3MGRC 3LZ1C 4H9NB 3AZGD 1AOIB 1P3BB 5C3IC 1P3OD 3X1SC 1KX4C 2YFVB 1HQ3C 3AZLD 3AZGA 4Z66B 1P3OA 3UTAB 1P3AD 3AZLA 3RELC 4YM6C 2F8NB 5B2IA 3MGQC 3C1CC 3AZEB 1P3AA 3AZND 3KFUG 3TU4D 5CP6B 5BNXA 5JA4A 4J8UB 3F6TA 2HIOD 3AZNA 2YFWB 3TU4A 5B40B 3C1BC 2FJ7C 4EO5C 3AV2B 3MGRD 1JFIA 3X1SD 2Y2NA 1HQ3D 5CHLB 3MGRA 5DNNB 3AYWC 3KXBC 2ZY2A 1HQ3A 1P3IB 1T3UA 3LELD 4X23B 3W97C 4YM6D 1KX5B 3WKJB 4R8PD 3MGQD 3VH5W 3LELA 4DQYB 5B31D 4M6BA 4R8PA 5BS7A 3MGQA 5GT0B 3MGPC 1M19C 3REHB 5CPIC 5B31A 3UTBB 5CPJD 3C1BD 2FJ7D 3AZIB 1EQZB 4KUDC 1BH9A 5B32B 4JJNC 1KU5A 3C1BA 5CPJA 2FJ7A 3AZKB 2RIQA 3AYWD 1ID3D 3X1TB 3KXBD 1S32C 3UT9C 1M1AC 5GXQC 2F8NH 3B0BA 3AYWA 3P5JB 1ID3A 3KXBA 3EG5B 1P3MB 1KX4B 5BO0A 5AVBC 1F66B 2XD5A 5AV6C 2AROD 2ZM5A 3MGSB 1M19D 1BH8A 5CPID 3WA9D 5AY8A 3RELB 5AVCB 3LJAC 4WV4B 2AROA 3IP4C 3WAAC 5B1MB 5CPIA 3C1CB 2CV5C 1M19A 1P3FD 3WA9A 4YS3B 1P3PC 2NQBA 3X1UD 3AV1D 1N1JA 3UT9D 1AOIC 5B33B 2UWXA 3EPJA 1P3FA 5GXQD 4CSRB 3REIC 4H9OB 3X1UA 3AV1A 4G91B 4Z66C 4J8XD 3UT9A 1HTAA 3AFAB 3UTAC 4H9PA 5AV8B 4J8XA 2ZY4A 5E5AB 3AZEC 3H0RC 3A6NC 2BYMA 3EPHA 4NFTA 3B6FD 3LJAD 3WAAD 4ZBJB 1WWIA 5DNMB 3AV2C 5KDMB 3B6FA 2IO5B 3LJAA 3WAAA 3VH5T 1P3BD 4WNNB 3VH6W 1TAFB 4H9NA 5DNNC 5B24B 1P3BA 4KUDB 2YFVA 3UTAD 4JJNB 1PZRA 1U35A 1P3IC 4E44A 3REKC 1KX5C 3WKJC 2F8ND 1TZYC 3W99B 3MVDB 1S32B 1M1AB 3UTAA 3AZED 4UUZB 5CP6D 3AZJC 4J8UD 2F8NA 3AZEA 5GT0C 5B0ZC 3REHC 5CP6A 3UTBC 1ZLAC 5B40D 4J8UA 3AZIC 3AV2D 1EQZC 5AVBB 5AV5C 2YFWA 5B32C 5AV6B 5B40A 3EPKA 3AZKC 3AV2A 5DNND 4KHAB 3AZFB 2CV5B 1P3ID 4NE3A 5DNNA 4X23D 1P3PB 1KX5D 3WKJD 4H9QA 4KGCA 1P3MC 3NQUA 4CAYB 4G92B 1P3IA 3REIB 4X23A 2Y2GA 5FUGB 1KX5A 3KUYB 5GT3A 3WKJA 5F99B 1F66C 5GT0D 3WTPB 3MGSC 3REHD 3UTBD 3AZID 2NZDB 2PYOC 5AVCC 5B1MC 5GT0A 1ULYA 5B32D 3EPLA 3REHA 3UTBA 4YS3C 4Z5TB 3AZIA 3AZKD 3A6NB 3X1TD 5B33C 4H9RB 1P3GB 3AZKA 3X1TA 4G91C 2HIOA 3LZ1D 3AFAC 1P3MD 3VH5A 1KX4D 1F1EA 5G49B 5AV8C 4ZUXB 5B0YB 4UPKA 3LZ1A 1F66D 3VH6T 1P3MA 5E5AC 3A1KA 3X1SA 1KX4A 3MGSD 5B1LB 4WZSB 3REKB 3RELD
chains in the Genus database with same CATH topology
1Q9CA 5AVCD 2Y2LA 1TZYB 4ZBJC 5B1MD 2F8NK 3C1CD 2L5AA 4YS3D 5DNMC 3O62B 4YM6A 3RELA 3AZJB 5AVCA 2IO5C 5B1MA 5B33D 3C1CA 4J8WB 5B0ZB 4YS3A 3LZ0C 5B24C 2F8NG 5B33A 3AFAD 5AV5B 4CSRA 4H9OA 5AV8D 3W99C 3MVDC 5E5AD 3V9RB 1KX3B 3W97D 5E5AA 2BYKB 3B6GC 5DNMD 3W97A 4WJ3C 3B0CW 5BNVB 5B2IB 3MGPD 4DRAA 5DNMA 3R45B 5KDMA 2HUEB 5JA4B 4NE6A 4KUDD 4WNNA 2PYOB 3AZFC 3MGPA 1TAFA 4JJND 2ZY5A 3NQJB 4NE5A 4KUDA 3W99D 5GSUB 2W8SA 3MVDD 1S32D 1M1AD 4JJNA 1JFIB 4G92C 3KUYC 2CWEA 3W99A 5F99C 3MVDA 1S32A 1M1AA 1H3OA 5B32G 3WTPC 5GXQA 4UUZA 1P3LB 2NZDC 5AVBD 1B67A 2Y2IA 3VH6A 5AV6D 2DQNC 3H0LC 4Z5TC 5AVBA 4LD9B 2JCHA 5AV6A 3AZFD 2CV5D 1P3GC 5B31B 1P3PD 4WU8B 4KHAA 5CPKB 3AZFA 1AOID 2CV5A 3REID 1P3PA 5B0YC 4ZUXC 3LZ0B 3KUYD 5F99D 4Z66D 1AOIA 4CAYA 3WTPD 3REIA 1P3KB 5B1LC 5FUGA 4XUJB 3KUYA 5F99A 4Z66A 2NZDD 3WTPA 4Z5TD 3O62C 3A6ND 2ZY3A 4J8WC 4WU9B 3B6GB 1P3GD 4Z5TA 4XZQB 1BH8B 3A6NA 5AY8B 4H9RA 4Z2MG 5JRGC 2Y2QA 4ZUXD 3B0CT 2NQBB 4QLCB 5B1LD 1P34B 5G49A 4ZUXA 1ZLAB 1KX3C 4AWLB 5AV9B 3REKD 3KWQB 1TZYD 2JE5A 5B1LA 3AZMB 3AZHB 3REKA 3AL0C 3O62D 3AZJD 1TZYA 3X1VB 3AN2B 4J8WD 5B2IC 5B0ZD 1P3AC 3AZJA 1M18B 2HUEC 2BYMB 1EQZD 4J8WA 5AV5D 5B0ZA 3W96B 4E45A 3AZNC 1EQZA 5AV5A 5GSUC 5B32A 4HGAB 1KX3D 3MNNB 3V9RA 2LY8A 5B2JB 2FFFB 1P3LC 1KX3A 1U35B 2BYKA 2JSSA 1F66A 5B2ID 4J8VB 2Y2OA 4LD9C 3LELC 2XD1A 4R8PC 2PYOD 5BNVA 5BS7C 3MGSA 3R45A 5B31C 4WU8C 5CPKC 5GSUD 2PYOA 3W98B 3NQJA 5CPJC 4H9SC 5GSUA 1A7WA 1P3KC 5JRGB 4XUJC 1P3LD 2J8PA 1ID3C 3AFAA 3REJB 1Z2CB 4H9QB 4KGCB 1P3LA 3NQUB 5AV8A 5GT3B 4LD9D 3AZGB 4WU9C 1P3OB 4XZQC 4WU8D 3AZLB 4LD9A 5AY8C 5CPKD 2AROC 3WA9C 2VQRA 4WU8A 1P3AB 3LZ0D 5CPKA 2NQBC 5BNXB 5B24D 1BFMA 4QLCC 1P3KD 1P34C 1P3FC 3H0MC 4XUJD 3LZ0A 3AZNB 4H9SA 3TU4B 4AWLC 3KSYA 5AV9C 3B0DC 5B24A 3X1UC 3KWQC 3AV1C 2F2AC 2HIOB 2Y2HA 1P3KA 4XUJA 3AZMC 3AZHC 4J8XC 3X1VC 3MGRB 3LZ1B 3AN2C 4WU9D 3B6GD 5C3IB 3X1SB 2Y2KA 4XZQD 1M18C 1HQ3B 5AY8D 4WU9A 2RVQC 3B6GA 3W96C 4XZQA 2G5IC 3LELB 2NQBD 4YM6B 3B6FC 4QLCD 4R8PB 3MGQB 1P34D 4HGAC 1ZLAD 3MNNC 5AV9D 4QLCA 3KWQD 5B2JC 1P3BC 1P34A 1BH9B 1ZLAA 3AZMD 1WWSA 3AZHD 5AV9A 1U35C 5BT1C 3C1BB 3KWQA 5CPJB 2FJ7B 4EO5B 3X1VD 3AN2D 4J8VC 1W2EA 3AZMA 3AZHA 1M18D 3X1VA 3AN2A 3AYWB 1ID3B 2RVQD 3KXBB 3W96D 1M18A 5CP6C 3FDDA 4J8UC 2NZDA 3W97B 5BO0B 2G5HC 3W96A 3W98C 2DF4C 5B40C 3MNND 5B2JD 2BG1A 1P3GA 2AROB 3MGPB 1M19B 3MNNA 5CPIB 1U35D 3WA9B 5BT1D 5B0YD 4DRBA 5B2JA 3REJC 1N1JB 4J8VD 4KGCC 2Y2PA 5B31G 5B0YA 1P3FB 4X23C 3X1UB 3B0DB 5GT3C 3AV1B 3AZGC 4J8VA 3UT9B 1H3OB 1P3OC 5GXQB 2Y2MA 3AZLC 4H9PB 4J8XB 3W98D 3O62A 1R4VA 3WTPE 1B6WA 3W98A 5JRGD 2Y2JA 3TU4C 3REJD 3X1TC 3B6FB 2HIOC 3LJAB 3WAAB 4KGCD 5JRGA 3A1IA 4Z2MH 3REJA 5GT3D 3MGRC 3LZ1C 4H9NB 3AZGD 1AOIB 1P3BB 5C3IC 1P3OD 3X1SC 1KX4C 2YFVB 1HQ3C 3AZLD 3AZGA 4Z66B 1P3OA 3UTAB 1P3AD 3AZLA 3RELC 4YM6C 2F8NB 5B2IA 3MGQC 3C1CC 3AZEB 1P3AA 3AZND 3KFUG 3TU4D 5CP6B 5BNXA 5JA4A 4J8UB 3F6TA 2HIOD 3AZNA 2YFWB 3TU4A 5B40B 3C1BC 2FJ7C 4EO5C 3AV2B 3MGRD 1JFIA 3X1SD 2Y2NA 1HQ3D 5CHLB 3MGRA 5DNNB 3AYWC 3KXBC 2ZY2A 1HQ3A 1P3IB 1T3UA 3LELD 4X23B 3W97C 4YM6D 1KX5B 3WKJB 4R8PD 3MGQD 3VH5W 3LELA 4DQYB 5B31D 4M6BA 4R8PA 5BS7A 3MGQA 5GT0B 3MGPC 1M19C 3REHB 5CPIC 5B31A 3UTBB 5CPJD 3C1BD 2FJ7D 3AZIB 1EQZB 4KUDC 1BH9A 5B32B 4JJNC 1KU5A 3C1BA 5CPJA 2FJ7A 3AZKB 2RIQA 3AYWD 1ID3D 3X1TB 3KXBD 1S32C 3UT9C 1M1AC 5GXQC 2F8NH 3B0BA 3AYWA 3P5JB 1ID3A 3KXBA 3EG5B 1P3MB 1KX4B 5BO0A 5AVBC 1F66B 2XD5A 5AV6C 2AROD 2ZM5A 3MGSB 1M19D 1BH8A 5CPID 3WA9D 5AY8A 3RELB 5AVCB 3LJAC 4WV4B 2AROA 3IP4C 3WAAC 5B1MB 5CPIA 3C1CB 2CV5C 1M19A 1P3FD 3WA9A 4YS3B 1P3PC 2NQBA 3X1UD 3AV1D 1N1JA 3UT9D 1AOIC 5B33B 2UWXA 3EPJA 1P3FA 5GXQD 4CSRB 3REIC 4H9OB 3X1UA 3AV1A 4G91B 4Z66C 4J8XD 3UT9A 1HTAA 3AFAB 3UTAC 4H9PA 5AV8B 4J8XA 2ZY4A 5E5AB 3AZEC 3H0RC 3A6NC 2BYMA 3EPHA 4NFTA 3B6FD 3LJAD 3WAAD 4ZBJB 1WWIA 5DNMB 3AV2C 5KDMB 3B6FA 2IO5B 3LJAA 3WAAA 3VH5T 1P3BD 4WNNB 3VH6W 1TAFB 4H9NA 5DNNC 5B24B 1P3BA 4KUDB 2YFVA 3UTAD 4JJNB 1PZRA 1U35A 1P3IC 4E44A 3REKC 1KX5C 3WKJC 2F8ND 1TZYC 3W99B 3MVDB 1S32B 1M1AB 3UTAA 3AZED 4UUZB 5CP6D 3AZJC 4J8UD 2F8NA 3AZEA 5GT0C 5B0ZC 3REHC 5CP6A 3UTBC 1ZLAC 5B40D 4J8UA 3AZIC 3AV2D 1EQZC 5AVBB 5AV5C 2YFWA 5B32C 5AV6B 5B40A 3EPKA 3AZKC 3AV2A 5DNND 4KHAB 3AZFB 2CV5B 1P3ID 4NE3A 5DNNA 4X23D 1P3PB 1KX5D 3WKJD 4H9QA 4KGCA 1P3MC 3NQUA 4CAYB 4G92B 1P3IA 3REIB 4X23A 2Y2GA 5FUGB 1KX5A 3KUYB 5GT3A 3WKJA 5F99B 1F66C 5GT0D 3WTPB 3MGSC 3REHD 3UTBD 3AZID 2NZDB 2PYOC 5AVCC 5B1MC 5GT0A 1ULYA 5B32D 3EPLA 3REHA 3UTBA 4YS3C 4Z5TB 3AZIA 3AZKD 3A6NB 3X1TD 5B33C 4H9RB 1P3GB 3AZKA 3X1TA 4G91C 2HIOA 3LZ1D 3AFAC 1P3MD 3VH5A 1KX4D 1F1EA 5G49B 5AV8C 4ZUXB 5B0YB 4UPKA 3LZ1A 1F66D 3VH6T 1P3MA 5E5AC 3A1KA 3X1SA 1KX4A 3MGSD 5B1LB 4WZSB 3REKB 3RELD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9C A;  5AVC D;  2F8N K;  1TZY B;  4ZBJ C;  5B1M D;  3C1C D;  2L5A A;  4YS3 D;  5DNM C;  3O62 B;  4YM6 A;  3REL A;  3AZJ B;  5AVC A;  2IO5 C;  5B1M A;  5B33 D;  3C1C A;  4J8W B;  5B0Z B;  4YS3 A;  3LZ0 C;  5B24 C;  2F8N G;  5B33 A;  3AFA D;  5AV5 B;  4CSR A;  4H9O A;  5AV8 D;  3W99 C;  3MVD C;  5E5A D;  3V9R B;  1KX3 B;  3W97 D;  5E5A A;  2BYK B;  3B6G C;  5DNM D;  3W97 A;  3B0C W;  5BNV B;  5B2I B;  3MGP D;  4DRA A;  5DNM A;  3R45 B;  5KDM A;  2HUE B;  5JA4 B;  4NE6 A;  4KUD D;  4WNN A;  2PYO B;  3AZF C;  3MGP A;  1TAF A;  4JJN D;  3NQJ B;  4NE5 A;  4KUD A;  3W99 D;  5GSU B;  3MVD D;  1S32 D;  1M1A D;  4JJN A;  1JFI B;  4G92 C;  3KUY C;  2CWE A;  3W99 A;  5F99 C;  3MVD A;  1S32 A;  1M1A A;  1H3O A;  5B32 G;  3WTP C;  5GXQ A;  4UUZ A;  1P3L B;  2NZD C;  5AVB D;  1B67 A;  3VH6 A;  5AV6 D;  4Z5T C;  5AVB A;  4LD9 B;  5AV6 A;  3AZF D;  2CV5 D;  1P3G C;  5B31 B;  1P3P D;  4WU8 B;  4KHA A;  5CPK B;  3AZF A;  1AOI D;  2CV5 A;  3REI D;  1P3P A;  5B0Y C;  4ZUX C;  3LZ0 B;  3KUY D;  5F99 D;  4Z66 D;  1AOI A;  4CAY A;  3WTP D;  3REI A;  1P3K B;  5B1L C;  5FUG A;  4XUJ B;  3KUY A;  5F99 A;  4Z66 A;  2NZD D;  3WTP A;  4Z5T D;  3O62 C;  3A6N D;  4J8W C;  4WU9 B;  3B6G B;  1P3G D;  4Z5T A;  4XZQ B;  1BH8 B;  3A6N A;  5AY8 B;  4H9R A;  4Z2M G;  5JRG C;  4ZUX D;  3B0C T;  2NQB B;  4QLC B;  5B1L D;  1P34 B;  5G49 A;  4ZUX A;  1ZLA B;  1KX3 C;  4AWL B;  5AV9 B;  3REK D;  3KWQ B;  1TZY D;  5B1L A;  3AZM B;  3AZH B;  3REK A;  3O62 D;  3AZJ D;  1TZY A;  3X1V B;  3AN2 B;  4J8W D;  5B2I C;  5B0Z D;  1P3A C;  3AZJ A;  1M18 B;  2HUE C;  2BYM B;  1EQZ D;  4J8W A;  5AV5 D;  5B0Z A;  3W96 B;  4E45 A;  3AZN C;  1EQZ A;  5AV5 A;  5GSU C;  5B32 A;  4HGA B;  1KX3 D;  3MNN B;  3V9R A;  2LY8 A;  5B2J B;  1P3L C;  1KX3 A;  1U35 B;  2BYK A;  2JSS A;  1F66 A;  5B2I D;  4J8V B;  4LD9 C;  3LEL C;  4R8P C;  2PYO D;  5BNV A;  5BS7 C;  3MGS A;  3R45 A;  5B31 C;  4WU8 C;  5CPK C;  5GSU D;  2PYO A;  3W98 B;  3NQJ A;  5CPJ C;  4H9S C;  5GSU A;  1A7W A;  1P3K C;  5JRG B;  4XUJ C;  1P3L D;  1ID3 C;  3AFA A;  3REJ B;  4H9Q B;  4KGC B;  1P3L A;  3NQU B;  5AV8 A;  5GT3 B;  4LD9 D;  3AZG B;  4WU9 C;  1P3O B;  4XZQ C;  4WU8 D;  3AZL B;  4LD9 A;  5AY8 C;  5CPK D;  2ARO C;  3WA9 C;  4WU8 A;  1P3A B;  3LZ0 D;  5CPK A;  2NQB C;  5BNX B;  5B24 D;  1BFM A;  4QLC C;  1P3K D;  1P34 C;  1P3F C;  4XUJ D;  3AZN B;  3LZ0 A;  1ZLA C;  4H9S A;  3TU4 B;  4AWL C;  3KSY A;  5AV9 C;  3B0D C;  5B24 A;  3X1U C;  3KWQ C;  3AV1 C;  2HIO B;  1P3K A;  4XUJ A;  3AZM C;  3AZH C;  4J8X C;  3X1V C;  3MGR B;  3LZ1 B;  3AN2 C;  4WU9 D;  3B6G D;  5C3I B;  3X1S B;  4XZQ D;  1M18 C;  1HQ3 B;  5AY8 D;  4WU9 A;  2RVQ C;  3B6G A;  3W96 C;  4XZQ A;  3LEL B;  2NQB D;  4YM6 B;  3B6F C;  4QLC D;  4R8P B;  3MGQ B;  1P34 D;  4HGA C;  1ZLA D;  3MNN C;  5AV9 D;  4QLC A;  3KWQ D;  5B2J C;  1P3B C;  1P34 A;  1BH9 B;  1ZLA A;  3AZM D;  1WWS A;  3AZH D;  5AV9 A;  1U35 C;  5BT1 C;  3C1B B;  3KWQ A;  5CPJ B;  2FJ7 B;  4EO5 B;  3X1V D;  3AN2 D;  4J8V C;  3AZM A;  3AZH A;  1M18 D;  3X1V A;  3AN2 A;  3AYW B;  1ID3 B;  2RVQ D;  3KXB B;  3W96 D;  1M18 A;  5CP6 C;  4J8U C;  2NZD A;  3W97 B;  5BO0 B;  3W96 A;  3W98 C;  5B40 C;  3MNN D;  5B2J D;  1P3G A;  2ARO B;  3MGP B;  1M19 B;  3MNN A;  5CPI B;  1U35 D;  3WA9 B;  5BT1 D;  5B0Y D;  4DRB A;  5B2J A;  3REJ C;  1N1J B;  4J8V D;  4KGC C;  5B31 G;  5B0Y A;  1P3F B;  4X23 C;  3X1U B;  3B0D B;  5GT3 C;  3AV1 B;  3AZG C;  4J8V A;  3UT9 B;  1H3O B;  1P3O C;  5GXQ B;  3AZL C;  4H9P B;  4J8X B;  3W98 D;  3O62 A;  1R4V A;  3WTP E;  1B6W A;  3W98 A;  5JRG D;  3TU4 C;  3REJ D;  3X1T C;  3B6F B;  2HIO C;  3LJA B;  3WAA B;  4KGC D;  5JRG A;  4Z2M H;  3REJ A;  5GT3 D;  3MGR C;  3LZ1 C;  4H9N B;  3AZG D;  1AOI B;  1P3B B;  5C3I C;  1P3O D;  3X1S C;  1KX4 C;  2YFV B;  1HQ3 C;  3AZL D;  3AZG A;  4Z66 B;  1P3O A;  3UTA B;  1P3A D;  3AZL A;  3REL C;  4YM6 C;  2F8N B;  5B2I A;  3MGQ C;  3C1C C;  3AZE B;  1P3A A;  3AZN D;  3TU4 D;  5CP6 B;  5BNX A;  5JA4 A;  4J8U B;  2HIO D;  3AZN A;  2YFW B;  3TU4 A;  5B40 B;  3C1B C;  2FJ7 C;  4EO5 C;  3AV2 B;  3MGR D;  1JFI A;  3X1S D;  1HQ3 D;  5CHL B;  3MGR A;  5DNN B;  3AYW C;  3KXB C;  1HQ3 A;  1P3I B;  3LEL D;  4X23 B;  3W97 C;  4YM6 D;  1KX5 B;  3WKJ B;  4R8P D;  3MGQ D;  3VH5 W;  3LEL A;  5B31 D;  4M6B A;  4R8P A;  5BS7 A;  3MGQ A;  5GT0 B;  3MGP C;  1M19 C;  3REH B;  5CPI C;  5B31 A;  3UTB B;  5CPJ D;  3C1B D;  2FJ7 D;  3AZI B;  1EQZ B;  4KUD C;  1BH9 A;  5B32 B;  4JJN C;  1KU5 A;  3C1B A;  5CPJ A;  2FJ7 A;  3AZK B;  3AYW D;  1ID3 D;  3X1T B;  3KXB D;  1S32 C;  3UT9 C;  1M1A C;  5GXQ C;  2F8N H;  3B0B A;  3AYW A;  1ID3 A;  3KXB A;  1P3M B;  1KX4 B;  5BO0 A;  5AVB C;  1F66 B;  5AV6 C;  2ARO D;  1M19 D;  3MGS B;  1BH8 A;  5CPI D;  3WA9 D;  5AY8 A;  3REL B;  5AVC B;  3LJA C;  4WV4 B;  2ARO A;  3WAA C;  5B1M B;  2CV5 C;  5CPI A;  3C1C B;  1M19 A;  3WA9 A;  1P3F D;  4YS3 B;  1P3P C;  2NQB A;  3X1U D;  3AV1 D;  1N1J A;  3UT9 D;  1AOI C;  5B33 B;  1P3F A;  5GXQ D;  4CSR B;  3REI C;  4H9O B;  3X1U A;  3AV1 A;  4G91 B;  4Z66 C;  4J8X D;  3UT9 A;  1HTA A;  3AFA B;  3UTA C;  4H9P A;  5AV8 B;  4J8X A;  5E5A B;  3AZE C;  3A6N C;  2BYM A;  4NFT A;  3B6F D;  3LJA D;  3WAA D;  4ZBJ B;  1WWI A;  5DNM B;  3AV2 C;  5KDM B;  3B6F A;  2IO5 B;  3LJA A;  3WAA A;  3VH5 T;  1P3B D;  4WNN B;  3VH6 W;  1TAF B;  4H9N A;  5DNN C;  5B24 B;  1P3B A;  4KUD B;  2YFV A;  3UTA D;  4JJN B;  1U35 A;  1P3I C;  4E44 A;  3REK C;  1KX5 C;  3WKJ C;  2F8N D;  1TZY C;  3W99 B;  3MVD B;  1S32 B;  1M1A B;  3UTA A;  3AZE D;  4UUZ B;  5CP6 D;  3AZJ C;  4J8U D;  2F8N A;  3AZE A;  5GT0 C;  5B0Z C;  3REH C;  5CP6 A;  3UTB C;  5B40 D;  4J8U A;  3AZI C;  3AV2 D;  1EQZ C;  5AVB B;  5AV5 C;  2YFW A;  5B32 C;  5AV6 B;  5B40 A;  3AZK C;  3AV2 A;  5DNN D;  4KHA B;  3AZF B;  2CV5 B;  1P3I D;  4NE3 A;  5DNN A;  4X23 D;  1P3P B;  1KX5 D;  3WKJ D;  4H9Q A;  4KGC A;  1P3M C;  3NQU A;  4CAY B;  4G92 B;  1P3I A;  3REI B;  4X23 A;  5FUG B;  1KX5 A;  3KUY B;  5GT3 A;  3WKJ A;  5F99 B;  1F66 C;  5GT0 D;  3WTP B;  3MGS C;  3REH D;  3UTB D;  3AZI D;  2NZD B;  2PYO C;  5AVC C;  5B1M C;  5GT0 A;  1ULY A;  5B32 D;  3REH A;  3UTB A;  4YS3 C;  4Z5T B;  3AZI A;  3AZK D;  3A6N B;  3X1T D;  5B33 C;  4H9R B;  1P3G B;  3AZK A;  3X1T A;  4G91 C;  2HIO A;  3LZ1 D;  3AFA C;  1P3M D;  3VH5 A;  1KX4 D;  1F1E A;  5G49 B;  5AV8 C;  4ZUX B;  5B0Y B;  3LZ1 A;  1F66 D;  3VH6 T;  1P3M A;  5E5A C;  3X1S A;  1KX4 A;  3MGS D;  5B1L B;  4WZS B;  3REK B;  3REL D; 
#chains in the Genus database with same CATH topology
 1Q9C A;  5AVC D;  2Y2L A;  1TZY B;  4ZBJ C;  5B1M D;  2F8N K;  3C1C D;  2L5A A;  4YS3 D;  5DNM C;  3O62 B;  4YM6 A;  3REL A;  3AZJ B;  5AVC A;  2IO5 C;  5B1M A;  5B33 D;  3C1C A;  4J8W B;  5B0Z B;  4YS3 A;  3LZ0 C;  5B24 C;  2F8N G;  5B33 A;  3AFA D;  5AV5 B;  4CSR A;  4H9O A;  5AV8 D;  3W99 C;  3MVD C;  5E5A D;  3V9R B;  1KX3 B;  3W97 D;  5E5A A;  2BYK B;  3B6G C;  5DNM D;  3W97 A;  4WJ3 C;  3B0C W;  5BNV B;  5B2I B;  3MGP D;  4DRA A;  5DNM A;  3R45 B;  5KDM A;  2HUE B;  5JA4 B;  4NE6 A;  4KUD D;  4WNN A;  2PYO B;  3AZF C;  3MGP A;  1TAF A;  4JJN D;  2ZY5 A;  3NQJ B;  4NE5 A;  4KUD A;  3W99 D;  5GSU B;  2W8S A;  3MVD D;  1S32 D;  1M1A D;  4JJN A;  1JFI B;  4G92 C;  3KUY C;  2CWE A;  3W99 A;  5F99 C;  3MVD A;  1S32 A;  1M1A A;  1H3O A;  5B32 G;  3WTP C;  5GXQ A;  4UUZ A;  1P3L B;  2NZD C;  5AVB D;  1B67 A;  2Y2I A;  3VH6 A;  5AV6 D;  2DQN C;  3H0L C;  4Z5T C;  5AVB A;  4LD9 B;  2JCH A;  5AV6 A;  3AZF D;  2CV5 D;  1P3G C;  5B31 B;  1P3P D;  4WU8 B;  4KHA A;  5CPK B;  3AZF A;  1AOI D;  2CV5 A;  3REI D;  1P3P A;  5B0Y C;  4ZUX C;  3LZ0 B;  3KUY D;  5F99 D;  4Z66 D;  1AOI A;  4CAY A;  3WTP D;  3REI A;  1P3K B;  5B1L C;  5FUG A;  4XUJ B;  3KUY A;  5F99 A;  4Z66 A;  2NZD D;  3WTP A;  4Z5T D;  3O62 C;  3A6N D;  2ZY3 A;  4J8W C;  4WU9 B;  3B6G B;  1P3G D;  4Z5T A;  4XZQ B;  1BH8 B;  3A6N A;  5AY8 B;  4H9R A;  4Z2M G;  5JRG C;  2Y2Q A;  4ZUX D;  3B0C T;  2NQB B;  4QLC B;  5B1L D;  1P34 B;  5G49 A;  4ZUX A;  1ZLA B;  1KX3 C;  4AWL B;  5AV9 B;  3REK D;  3KWQ B;  1TZY D;  2JE5 A;  5B1L A;  3AZM B;  3AZH B;  3REK A;  3AL0 C;  3O62 D;  3AZJ D;  1TZY A;  3X1V B;  3AN2 B;  4J8W D;  5B2I C;  5B0Z D;  1P3A C;  3AZJ A;  1M18 B;  2HUE C;  2BYM B;  1EQZ D;  4J8W A;  5AV5 D;  5B0Z A;  3W96 B;  4E45 A;  3AZN C;  1EQZ A;  5AV5 A;  5GSU C;  5B32 A;  4HGA B;  1KX3 D;  3MNN B;  3V9R A;  2LY8 A;  5B2J B;  2FFF B;  1P3L C;  1KX3 A;  1U35 B;  2BYK A;  2JSS A;  1F66 A;  5B2I D;  4J8V B;  2Y2O A;  4LD9 C;  3LEL C;  2XD1 A;  4R8P C;  2PYO D;  5BNV A;  5BS7 C;  3MGS A;  3R45 A;  5B31 C;  4WU8 C;  5CPK C;  5GSU D;  2PYO A;  3W98 B;  3NQJ A;  5CPJ C;  4H9S C;  5GSU A;  1A7W A;  1P3K C;  5JRG B;  4XUJ C;  1P3L D;  2J8P A;  1ID3 C;  3AFA A;  3REJ B;  1Z2C B;  4H9Q B;  4KGC B;  1P3L A;  3NQU B;  5AV8 A;  5GT3 B;  4LD9 D;  3AZG B;  4WU9 C;  1P3O B;  4XZQ C;  4WU8 D;  3AZL B;  4LD9 A;  5AY8 C;  5CPK D;  2ARO C;  3WA9 C;  2VQR A;  4WU8 A;  1P3A B;  3LZ0 D;  5CPK A;  2NQB C;  5BNX B;  5B24 D;  1BFM A;  4QLC C;  1P3K D;  1P34 C;  1P3F C;  3H0M C;  4XUJ D;  3LZ0 A;  3AZN B;  4H9S A;  3TU4 B;  4AWL C;  3KSY A;  5AV9 C;  3B0D C;  5B24 A;  3X1U C;  3KWQ C;  3AV1 C;  2F2A C;  2HIO B;  2Y2H A;  1P3K A;  4XUJ A;  3AZM C;  3AZH C;  4J8X C;  3X1V C;  3MGR B;  3LZ1 B;  3AN2 C;  4WU9 D;  3B6G D;  5C3I B;  3X1S B;  2Y2K A;  4XZQ D;  1M18 C;  1HQ3 B;  5AY8 D;  4WU9 A;  2RVQ C;  3B6G A;  3W96 C;  4XZQ A;  2G5I C;  3LEL B;  2NQB D;  4YM6 B;  3B6F C;  4QLC D;  4R8P B;  3MGQ B;  1P34 D;  4HGA C;  1ZLA D;  3MNN C;  5AV9 D;  4QLC A;  3KWQ D;  5B2J C;  1P3B C;  1P34 A;  1BH9 B;  1ZLA A;  3AZM D;  1WWS A;  3AZH D;  5AV9 A;  1U35 C;  5BT1 C;  3C1B B;  3KWQ A;  5CPJ B;  2FJ7 B;  4EO5 B;  3X1V D;  3AN2 D;  4J8V C;  1W2E A;  3AZM A;  3AZH A;  1M18 D;  3X1V A;  3AN2 A;  3AYW B;  1ID3 B;  2RVQ D;  3KXB B;  3W96 D;  1M18 A;  5CP6 C;  3FDD A;  4J8U C;  2NZD A;  3W97 B;  5BO0 B;  2G5H C;  3W96 A;  3W98 C;  2DF4 C;  5B40 C;  3MNN D;  5B2J D;  2BG1 A;  1P3G A;  2ARO B;  3MGP B;  1M19 B;  3MNN A;  5CPI B;  1U35 D;  3WA9 B;  5BT1 D;  5B0Y D;  4DRB A;  5B2J A;  3REJ C;  1N1J B;  4J8V D;  4KGC C;  2Y2P A;  5B31 G;  5B0Y A;  1P3F B;  4X23 C;  3X1U B;  3B0D B;  5GT3 C;  3AV1 B;  3AZG C;  4J8V A;  3UT9 B;  1H3O B;  1P3O C;  5GXQ B;  2Y2M A;  3AZL C;  4H9P B;  4J8X B;  3W98 D;  3O62 A;  1R4V A;  3WTP E;  1B6W A;  3W98 A;  5JRG D;  2Y2J A;  3TU4 C;  3REJ D;  3X1T C;  3B6F B;  2HIO C;  3LJA B;  3WAA B;  4KGC D;  5JRG A;  3A1I A;  4Z2M H;  3REJ A;  5GT3 D;  3MGR C;  3LZ1 C;  4H9N B;  3AZG D;  1AOI B;  1P3B B;  5C3I C;  1P3O D;  3X1S C;  1KX4 C;  2YFV B;  1HQ3 C;  3AZL D;  3AZG A;  4Z66 B;  1P3O A;  3UTA B;  1P3A D;  3AZL A;  3REL C;  4YM6 C;  2F8N B;  5B2I A;  3MGQ C;  3C1C C;  3AZE B;  1P3A A;  3AZN D;  3KFU G;  3TU4 D;  5CP6 B;  5BNX A;  5JA4 A;  4J8U B;  3F6T A;  2HIO D;  3AZN A;  2YFW B;  3TU4 A;  5B40 B;  3C1B C;  2FJ7 C;  4EO5 C;  3AV2 B;  3MGR D;  1JFI A;  3X1S D;  2Y2N A;  1HQ3 D;  5CHL B;  3MGR A;  5DNN B;  3AYW C;  3KXB C;  2ZY2 A;  1HQ3 A;  1P3I B;  1T3U A;  3LEL D;  4X23 B;  3W97 C;  4YM6 D;  1KX5 B;  3WKJ B;  4R8P D;  3MGQ D;  3VH5 W;  3LEL A;  4DQY B;  5B31 D;  4M6B A;  4R8P A;  5BS7 A;  3MGQ A;  5GT0 B;  3MGP C;  1M19 C;  3REH B;  5CPI C;  5B31 A;  3UTB B;  5CPJ D;  3C1B D;  2FJ7 D;  3AZI B;  1EQZ B;  4KUD C;  1BH9 A;  5B32 B;  4JJN C;  1KU5 A;  3C1B A;  5CPJ A;  2FJ7 A;  3AZK B;  2RIQ A;  3AYW D;  1ID3 D;  3X1T B;  3KXB D;  1S32 C;  3UT9 C;  1M1A C;  5GXQ C;  2F8N H;  3B0B A;  3AYW A;  3P5J B;  1ID3 A;  3KXB A;  3EG5 B;  1P3M B;  1KX4 B;  5BO0 A;  5AVB C;  1F66 B;  2XD5 A;  5AV6 C;  2ARO D;  2ZM5 A;  3MGS B;  1M19 D;  1BH8 A;  5CPI D;  3WA9 D;  5AY8 A;  3REL B;  5AVC B;  3LJA C;  4WV4 B;  2ARO A;  3IP4 C;  3WAA C;  5B1M B;  5CPI A;  3C1C B;  2CV5 C;  1M19 A;  1P3F D;  3WA9 A;  4YS3 B;  1P3P C;  2NQB A;  3X1U D;  3AV1 D;  1N1J A;  3UT9 D;  1AOI C;  5B33 B;  2UWX A;  3EPJ A;  1P3F A;  5GXQ D;  4CSR B;  3REI C;  4H9O B;  3X1U A;  3AV1 A;  4G91 B;  4Z66 C;  4J8X D;  3UT9 A;  1HTA A;  3AFA B;  3UTA C;  4H9P A;  5AV8 B;  4J8X A;  2ZY4 A;  5E5A B;  3AZE C;  3H0R C;  3A6N C;  2BYM A;  3EPH A;  4NFT A;  3B6F D;  3LJA D;  3WAA D;  4ZBJ B;  1WWI A;  5DNM B;  3AV2 C;  5KDM B;  3B6F A;  2IO5 B;  3LJA A;  3WAA A;  3VH5 T;  1P3B D;  4WNN B;  3VH6 W;  1TAF B;  4H9N A;  5DNN C;  5B24 B;  1P3B A;  4KUD B;  2YFV A;  3UTA D;  4JJN B;  1PZR A;  1U35 A;  1P3I C;  4E44 A;  3REK C;  1KX5 C;  3WKJ C;  2F8N D;  1TZY C;  3W99 B;  3MVD B;  1S32 B;  1M1A B;  3UTA A;  3AZE D;  4UUZ B;  5CP6 D;  3AZJ C;  4J8U D;  2F8N A;  3AZE A;  5GT0 C;  5B0Z C;  3REH C;  5CP6 A;  3UTB C;  1ZLA C;  5B40 D;  4J8U A;  3AZI C;  3AV2 D;  1EQZ C;  5AVB B;  5AV5 C;  2YFW A;  5B32 C;  5AV6 B;  5B40 A;  3EPK A;  3AZK C;  3AV2 A;  5DNN D;  4KHA B;  3AZF B;  2CV5 B;  1P3I D;  4NE3 A;  5DNN A;  4X23 D;  1P3P B;  1KX5 D;  3WKJ D;  4H9Q A;  4KGC A;  1P3M C;  3NQU A;  4CAY B;  4G92 B;  1P3I A;  3REI B;  4X23 A;  2Y2G A;  5FUG B;  1KX5 A;  3KUY B;  5GT3 A;  3WKJ A;  5F99 B;  1F66 C;  5GT0 D;  3WTP B;  3MGS C;  3REH D;  3UTB D;  3AZI D;  2NZD B;  2PYO C;  5AVC C;  5B1M C;  5GT0 A;  1ULY A;  5B32 D;  3EPL A;  3REH A;  3UTB A;  4YS3 C;  4Z5T B;  3AZI A;  3AZK D;  3A6N B;  3X1T D;  5B33 C;  4H9R B;  1P3G B;  3AZK A;  3X1T A;  4G91 C;  2HIO A;  3LZ1 D;  3AFA C;  1P3M D;  3VH5 A;  1KX4 D;  1F1E A;  5G49 B;  5AV8 C;  4ZUX B;  5B0Y B;  4UPK A;  3LZ1 A;  1F66 D;  3VH6 T;  1P3M A;  5E5A C;  3A1K A;  3X1S A;  1KX4 A;  3MGS D;  5B1L B;  4WZS B;  3REK B;  3REL D; 
#chains in the Genus database with same CATH homology
 1Q9C A;  5AVC D;  2Y2L A;  1TZY B;  4ZBJ C;  5B1M D;  2F8N K;  3C1C D;  2L5A A;  4YS3 D;  5DNM C;  3O62 B;  4YM6 A;  3REL A;  3AZJ B;  5AVC A;  2IO5 C;  5B1M A;  5B33 D;  3C1C A;  4J8W B;  5B0Z B;  4YS3 A;  3LZ0 C;  5B24 C;  2F8N G;  5B33 A;  3AFA D;  5AV5 B;  4CSR A;  4H9O A;  5AV8 D;  3W99 C;  3MVD C;  5E5A D;  3V9R B;  1KX3 B;  3W97 D;  5E5A A;  2BYK B;  3B6G C;  5DNM D;  3W97 A;  4WJ3 C;  3B0C W;  5BNV B;  5B2I B;  3MGP D;  4DRA A;  5DNM A;  3R45 B;  5KDM A;  2HUE B;  5JA4 B;  4NE6 A;  4KUD D;  4WNN A;  2PYO B;  3AZF C;  3MGP A;  1TAF A;  4JJN D;  2ZY5 A;  3NQJ B;  4NE5 A;  4KUD A;  3W99 D;  5GSU B;  2W8S A;  3MVD D;  1S32 D;  1M1A D;  4JJN A;  1JFI B;  4G92 C;  3KUY C;  2CWE A;  3W99 A;  5F99 C;  3MVD A;  1S32 A;  1M1A A;  1H3O A;  5B32 G;  3WTP C;  5GXQ A;  4UUZ A;  1P3L B;  2NZD C;  5AVB D;  1B67 A;  2Y2I A;  3VH6 A;  5AV6 D;  2DQN C;  3H0L C;  4Z5T C;  5AVB A;  4LD9 B;  2JCH A;  5AV6 A;  3AZF D;  2CV5 D;  1P3G C;  5B31 B;  1P3P D;  4WU8 B;  4KHA A;  5CPK B;  3AZF A;  1AOI D;  2CV5 A;  3REI D;  1P3P A;  5B0Y C;  4ZUX C;  3LZ0 B;  3KUY D;  5F99 D;  4Z66 D;  1AOI A;  4CAY A;  3WTP D;  3REI A;  1P3K B;  5B1L C;  5FUG A;  4XUJ B;  3KUY A;  5F99 A;  4Z66 A;  2NZD D;  3WTP A;  4Z5T D;  3O62 C;  3A6N D;  2ZY3 A;  4J8W C;  4WU9 B;  3B6G B;  1P3G D;  4Z5T A;  4XZQ B;  1BH8 B;  3A6N A;  5AY8 B;  4H9R A;  4Z2M G;  5JRG C;  2Y2Q A;  4ZUX D;  3B0C T;  2NQB B;  4QLC B;  5B1L D;  1P34 B;  5G49 A;  4ZUX A;  1ZLA B;  1KX3 C;  4AWL B;  5AV9 B;  3REK D;  3KWQ B;  1TZY D;  2JE5 A;  5B1L A;  3AZM B;  3AZH B;  3REK A;  3AL0 C;  3O62 D;  3AZJ D;  1TZY A;  3X1V B;  3AN2 B;  4J8W D;  5B2I C;  5B0Z D;  1P3A C;  3AZJ A;  1M18 B;  2HUE C;  2BYM B;  1EQZ D;  4J8W A;  5AV5 D;  5B0Z A;  3W96 B;  4E45 A;  3AZN C;  1EQZ A;  5AV5 A;  5GSU C;  5B32 A;  4HGA B;  1KX3 D;  3MNN B;  3V9R A;  2LY8 A;  5B2J B;  2FFF B;  1P3L C;  1KX3 A;  1U35 B;  2BYK A;  2JSS A;  1F66 A;  5B2I D;  4J8V B;  2Y2O A;  4LD9 C;  3LEL C;  2XD1 A;  4R8P C;  2PYO D;  5BNV A;  5BS7 C;  3MGS A;  3R45 A;  5B31 C;  4WU8 C;  5CPK C;  5GSU D;  2PYO A;  3W98 B;  3NQJ A;  5CPJ C;  4H9S C;  5GSU A;  1A7W A;  1P3K C;  5JRG B;  4XUJ C;  1P3L D;  2J8P A;  1ID3 C;  3AFA A;  3REJ B;  1Z2C B;  4H9Q B;  4KGC B;  1P3L A;  3NQU B;  5AV8 A;  5GT3 B;  4LD9 D;  3AZG B;  4WU9 C;  1P3O B;  4XZQ C;  4WU8 D;  3AZL B;  4LD9 A;  5AY8 C;  5CPK D;  2ARO C;  3WA9 C;  2VQR A;  4WU8 A;  1P3A B;  3LZ0 D;  5CPK A;  2NQB C;  5BNX B;  5B24 D;  1BFM A;  4QLC C;  1P3K D;  1P34 C;  1P3F C;  3H0M C;  4XUJ D;  3LZ0 A;  3AZN B;  4H9S A;  3TU4 B;  4AWL C;  3KSY A;  5AV9 C;  3B0D C;  5B24 A;  3X1U C;  3KWQ C;  3AV1 C;  2F2A C;  2HIO B;  2Y2H A;  1P3K A;  4XUJ A;  3AZM C;  3AZH C;  4J8X C;  3X1V C;  3MGR B;  3LZ1 B;  3AN2 C;  4WU9 D;  3B6G D;  5C3I B;  3X1S B;  2Y2K A;  4XZQ D;  1M18 C;  1HQ3 B;  5AY8 D;  4WU9 A;  2RVQ C;  3B6G A;  3W96 C;  4XZQ A;  2G5I C;  3LEL B;  2NQB D;  4YM6 B;  3B6F C;  4QLC D;  4R8P B;  3MGQ B;  1P34 D;  4HGA C;  1ZLA D;  3MNN C;  5AV9 D;  4QLC A;  3KWQ D;  5B2J C;  1P3B C;  1P34 A;  1BH9 B;  1ZLA A;  3AZM D;  1WWS A;  3AZH D;  5AV9 A;  1U35 C;  5BT1 C;  3C1B B;  3KWQ A;  5CPJ B;  2FJ7 B;  4EO5 B;  3X1V D;  3AN2 D;  4J8V C;  1W2E A;  3AZM A;  3AZH A;  1M18 D;  3X1V A;  3AN2 A;  3AYW B;  1ID3 B;  2RVQ D;  3KXB B;  3W96 D;  1M18 A;  5CP6 C;  3FDD A;  4J8U C;  2NZD A;  3W97 B;  5BO0 B;  2G5H C;  3W96 A;  3W98 C;  2DF4 C;  5B40 C;  3MNN D;  5B2J D;  2BG1 A;  1P3G A;  2ARO B;  3MGP B;  1M19 B;  3MNN A;  5CPI B;  1U35 D;  3WA9 B;  5BT1 D;  5B0Y D;  4DRB A;  5B2J A;  3REJ C;  1N1J B;  4J8V D;  4KGC C;  2Y2P A;  5B31 G;  5B0Y A;  1P3F B;  4X23 C;  3X1U B;  3B0D B;  5GT3 C;  3AV1 B;  3AZG C;  4J8V A;  3UT9 B;  1H3O B;  1P3O C;  5GXQ B;  2Y2M A;  3AZL C;  4H9P B;  4J8X B;  3W98 D;  3O62 A;  1R4V A;  3WTP E;  1B6W A;  3W98 A;  5JRG D;  2Y2J A;  3TU4 C;  3REJ D;  3X1T C;  3B6F B;  2HIO C;  3LJA B;  3WAA B;  4KGC D;  5JRG A;  3A1I A;  4Z2M H;  3REJ A;  5GT3 D;  3MGR C;  3LZ1 C;  4H9N B;  3AZG D;  1AOI B;  1P3B B;  5C3I C;  1P3O D;  3X1S C;  1KX4 C;  2YFV B;  1HQ3 C;  3AZL D;  3AZG A;  4Z66 B;  1P3O A;  3UTA B;  1P3A D;  3AZL A;  3REL C;  4YM6 C;  2F8N B;  5B2I A;  3MGQ C;  3C1C C;  3AZE B;  1P3A A;  3AZN D;  3KFU G;  3TU4 D;  5CP6 B;  5BNX A;  5JA4 A;  4J8U B;  3F6T A;  2HIO D;  3AZN A;  2YFW B;  3TU4 A;  5B40 B;  3C1B C;  2FJ7 C;  4EO5 C;  3AV2 B;  3MGR D;  1JFI A;  3X1S D;  2Y2N A;  1HQ3 D;  5CHL B;  3MGR A;  5DNN B;  3AYW C;  3KXB C;  2ZY2 A;  1HQ3 A;  1P3I B;  1T3U A;  3LEL D;  4X23 B;  3W97 C;  4YM6 D;  1KX5 B;  3WKJ B;  4R8P D;  3MGQ D;  3VH5 W;  3LEL A;  4DQY B;  5B31 D;  4M6B A;  4R8P A;  5BS7 A;  3MGQ A;  5GT0 B;  3MGP C;  1M19 C;  3REH B;  5CPI C;  5B31 A;  3UTB B;  5CPJ D;  3C1B D;  2FJ7 D;  3AZI B;  1EQZ B;  4KUD C;  1BH9 A;  5B32 B;  4JJN C;  1KU5 A;  3C1B A;  5CPJ A;  2FJ7 A;  3AZK B;  2RIQ A;  3AYW D;  1ID3 D;  3X1T B;  3KXB D;  1S32 C;  3UT9 C;  1M1A C;  5GXQ C;  2F8N H;  3B0B A;  3AYW A;  3P5J B;  1ID3 A;  3KXB A;  3EG5 B;  1P3M B;  1KX4 B;  5BO0 A;  5AVB C;  1F66 B;  2XD5 A;  5AV6 C;  2ARO D;  2ZM5 A;  3MGS B;  1M19 D;  1BH8 A;  5CPI D;  3WA9 D;  5AY8 A;  3REL B;  5AVC B;  3LJA C;  4WV4 B;  2ARO A;  3IP4 C;  3WAA C;  5B1M B;  5CPI A;  3C1C B;  2CV5 C;  1M19 A;  1P3F D;  3WA9 A;  4YS3 B;  1P3P C;  2NQB A;  3X1U D;  3AV1 D;  1N1J A;  3UT9 D;  1AOI C;  5B33 B;  2UWX A;  3EPJ A;  1P3F A;  5GXQ D;  4CSR B;  3REI C;  4H9O B;  3X1U A;  3AV1 A;  4G91 B;  4Z66 C;  4J8X D;  3UT9 A;  1HTA A;  3AFA B;  3UTA C;  4H9P A;  5AV8 B;  4J8X A;  2ZY4 A;  5E5A B;  3AZE C;  3H0R C;  3A6N C;  2BYM A;  3EPH A;  4NFT A;  3B6F D;  3LJA D;  3WAA D;  4ZBJ B;  1WWI A;  5DNM B;  3AV2 C;  5KDM B;  3B6F A;  2IO5 B;  3LJA A;  3WAA A;  3VH5 T;  1P3B D;  4WNN B;  3VH6 W;  1TAF B;  4H9N A;  5DNN C;  5B24 B;  1P3B A;  4KUD B;  2YFV A;  3UTA D;  4JJN B;  1PZR A;  1U35 A;  1P3I C;  4E44 A;  3REK C;  1KX5 C;  3WKJ C;  2F8N D;  1TZY C;  3W99 B;  3MVD B;  1S32 B;  1M1A B;  3UTA A;  3AZE D;  4UUZ B;  5CP6 D;  3AZJ C;  4J8U D;  2F8N A;  3AZE A;  5GT0 C;  5B0Z C;  3REH C;  5CP6 A;  3UTB C;  1ZLA C;  5B40 D;  4J8U A;  3AZI C;  3AV2 D;  1EQZ C;  5AVB B;  5AV5 C;  2YFW A;  5B32 C;  5AV6 B;  5B40 A;  3EPK A;  3AZK C;  3AV2 A;  5DNN D;  4KHA B;  3AZF B;  2CV5 B;  1P3I D;  4NE3 A;  5DNN A;  4X23 D;  1P3P B;  1KX5 D;  3WKJ D;  4H9Q A;  4KGC A;  1P3M C;  3NQU A;  4CAY B;  4G92 B;  1P3I A;  3REI B;  4X23 A;  2Y2G A;  5FUG B;  1KX5 A;  3KUY B;  5GT3 A;  3WKJ A;  5F99 B;  1F66 C;  5GT0 D;  3WTP B;  3MGS C;  3REH D;  3UTB D;  3AZI D;  2NZD B;  2PYO C;  5AVC C;  5B1M C;  5GT0 A;  1ULY A;  5B32 D;  3EPL A;  3REH A;  3UTB A;  4YS3 C;  4Z5T B;  3AZI A;  3AZK D;  3A6N B;  3X1T D;  5B33 C;  4H9R B;  1P3G B;  3AZK A;  3X1T A;  4G91 C;  2HIO A;  3LZ1 D;  3AFA C;  1P3M D;  3VH5 A;  1KX4 D;  1F1E A;  5G49 B;  5AV8 C;  4ZUX B;  5B0Y B;  4UPK A;  3LZ1 A;  1F66 D;  3VH6 T;  1P3M A;  5E5A C;  3A1K A;  3X1S A;  1KX4 A;  3MGS D;  5B1L B;  4WZS B;  3REK B;  3REL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...