4R8PD

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 33
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pD00
1P3BA 4XZQA 3REKB 3C1BB 3AV2A 1TAFA 5AVBA 3KUYB 1H3OA 3UTAA 3VH6T 4X23A 4J8WA 3W96B 4CAYB 1KX3A 3AZJC 1KX5A 5AVBC 1S32D 3AZFD 3C1BD 2NQBD 3X1UD 5AVCD 5F99A 4WNNA 3WA9A 1P3KB 5GT0D 3AFAB 1EQZD 2HUEC 3W96D 1P34C 2HIOA 5B40B 3R45B 3TU4B 5B31G 1F66B 2FJ7D 1S32B 5GXQC 5B2ID 3X1UB 5B40C 3AZNC 1P34A 5B1MC 4WU8C 4KGCB 5CPKC 3LELA 3MVDB 3KUYD 5AV5D 4WU9D 3A6ND 1JFIA 5AV6B 2AROD 5B31D 4WZSB 5GSUC 1M1AA 2NZDC 2BYKA 5BNVB 5E5AB 5CPIA 4X23C 4Z2MG 4J8WC 3REID 2IO5C 4R8PB 4KUDC 4Z2MH 5AVCB 3KXBC 5B0ZC 4QLCD 5G49A 5KDMA 4UUZB 5JRGC 3A6NB 1TZYA 4WU9B 1KX4B 5AV6D 4KUDB 5CP6A 1BH8B 3AYWB 1P3GC 5B24B 1ID3B 5BT1D 3X1TD 3AZGC 4H9NA 3AN2C 1M18D 3B6GC 4YS3D 3AZLD 4Z66C 3LZ0C 5B1MB 5DNND 4H9PA 4WU8B 4H9QB 1N1JB 5B1LD 1P3AD 3MVDC 5AV5B 3AYWD 5B32D 2YFWB 2AROB 5B31B 3MNNC 1AOID 4JJNC 5CP6C 1M18B 3REKD 5GXQB 3AZMD 3WKJD 5C3IC 4H9SA 1P3GA 3REJA 2F8NA 4J8UD 1P3MD 3W97D 1ZLAA 3AZIA 4Z5TA 3AV1A 5B0ZA 3X1VA 4R8PC 4H9SC 3AZFB 3AZJB 4J8UB 2NZDB 3NQUB 3LJAA 1U35C 3C1BC 3UT9A 2NQBC 3X1SB 5B1LB 1U35B 3VH5A 3LZ0A 5GT3A 4H9OB 5B0YA 3AZHD 5GT0C 5B2IB 1EQZC 1F66C 2HIOC 3MGRD 4QLCA 4KGCD 3W99C 5GXQD 3AZMB 4E45A 1P3FB 3X1SD 3NQJA 1P3OB 3AZED 5CPKD 4XUJD 5F99C 5GSUB 5JRGB 3O62A 3A6NC 1KU5A 4WU9C 1M19D 5E5AC 3KWQC 5BO0B 4YM6C 2NZDD 1M1AC 4JJNB 2IO5B 5B2JA 5FUGB 5B32A 3REIC 3AV2C 5CPKB 3RELD 3UTBD 4KUDD 4CSRB 5JRGD 1HTAA 3MGQB 3WKJA 2PYOA 2NQBB 4KHAB 5B24C 1F1EA 5JA4A 4NE5A 1P3LC 5BNXA 1P3IB 5BT1C 5AV9A 3AFAD 3RELB 4J8VB 5CHLB 5CPID 2FJ7B 3AZLC 3AZEB 3W98B 5B1LC 3C1CA 3WTPE 5B32C 5AV8C 1P3ID 1M19B 1KX3C 1KX5C 1P3MB 3W97B 1WWSA 4JJND 5CP6D 3KWQB 5AV8B 5B0YD 3LZ1B 3AZHA 3UTBB 1P3MC 3W97C 3W98D 1BFMA 3MGRA 3V9RB 4ZUXB 3AZLA 3WTPD 3AZJD 5AVBD 2JSSA 1S32C 4R8PD 3AZNA 3X1UC 4H9RA 3MGQC 1KX4D 5B33B 1AOIA 1U35D 2BYMA 4XZQB 1P34D 4ZUXD 3VH6A 3C1BA 3AV2B 1B67A 3X1TB 5AVBB 4G91C 1H3OB 1HQ3B 3AZHC 3UTAB 3AN2B 2RVQD 5B1MD 5DNNB 4X23B 3W96A 4J8WB 4WU8D 1A7WA 2HIOD 3MGSD 1KX3B 1KX5B 3KUYC 4XZQD 4XUJB 4YM6B 3VH6W 5CPJD 2F8NK 5F99B 5GSUD 3AZEC 3WA9B 1P3KA 3AFAA 4X23D 4J8WD 1P3BC 3B6FD 2HIOB 3MNNA 3TU4A 3VH5T 4QLCC 1P3LA 3W99A 5B33D 4YM6D 1M1AD 4HGAC 5AV6C 3AZKB 1P34B 2CV5D 5GT3C 3AV2D 3WA9D 3MVDA 4J8XB 3B6FB 3X1TC 3AZGD 4E44A 2LY8A 1JFIB 3AN2D 3B6GA 4DRAA 5AV6A 4YS3C 1M1AB 5BNVA 1ULYA 5E5AA 3REIA 5AY8C 5CPIB 1P3PA 3TU4C 3AYWC 5B2JC 4LD9B 4R8PA 5CPJB 5KDMB 4UUZA 3O62C 5DNMA 4NE3A 3A6NA 4AWLC 4WU9A 1P3FD 3REKC 3KXBA 4KUDA 5CP6B 3REJC 3AYWA 1P3OD 5AV8D 1ID3A 1P3IC 4H9NB 4G92B 4YS3A 3MGPA 5GT0A 1EQZA 5B0YC 2F8ND 5B1MA 4WU8A 3W98C 1N1JA 5AV5A 4Z66A 2AROA 5B31A 4J8XC 5BS7A 4NFTA 5GXQA 3MGQD 1KX4C 1P3GB 2F8NB 4Z5TD 3X1VC 3AZIB 3AV1D 1BH9A 4ZUXC 3UTAD 3MGRC 3W99D 4J8VD 3MGSB 5DNMC 2CWEA 3AZFA 3AZJA 3REHA 2NZDA 4XUJC 5F99D 5AY8B 5B1LA 3C1CC 1M19C 3KWQD 3B0CT 3LELC 5GT3B 4H9OA 5B0YB 3LZ1D 2PYOD 1P3BD 3B6FC 3AZKD 3RELC 3VH5W 5AV9C 2CV5B 3AZMA 3WTPB 1P3FA 5B33C 1P3AA 3NQJB 2YFVB 3AZGB 3AZID 2CV5C 1P3KC 3WAAA 1P3OA 5GT3D 3WA9C 1P3BB 3AFAC 3REKA 1TAFB 1TZYC 5JRGA 3O62B 3KUYA 5CPIC 4LD9D 5BO0A 5B2JB 5AY8D 1HQ3D 4EO5C 4CAYA 4CSRA 1KX3D 1KX5D 3O62D 3WAAC 2PYOB 3LJAD 5JA4B 4WNNB 3UT9D 1P3OC 5BNXB 2F8NH 5AV9B 3RELA 5B40A 3R45A 3WTPC 1F66A 1S32A 3X1UA 3W98A 3C1CB 4KGCA 2HUEB 3LELB 1M19A 4J8XD 3W97A 1P3MA 3REHC 3KWQA 5AV8A 3UTBA 2BYKB 2RVQC 3W96C 3AV1C 4ZBJC 3V9RA 4ZUXA 3UTAC 3MGSC 2FJ7C 4XZQC 5AVCA 3AZNB 4J8VC 5G49B 1TZYB 1KX4A 4H9RB 1P3PC 5CPJC 5BS7C 1BH8A 5B33A 1WWIA 5C3IB 5B24A 2BYMB 4WV4B 5AV5C 3X1TA 3C1CD 2AROC 5B31C 3LELD 1HQ3A 3B0BA 4H9PB 4NE6A 4H9QA 3LZ1C 3AN2A 5DNNA 1ZLAD 2YFWA 3MGPC 5B0ZD 4XUJA 4YM6A 1M18A 3KSYA 1ID3C 1P3KD 3REJB 1P3GD 1B6WA 3B0CW 1ZLAB 3TU4D 4Z5TB 5B2JD 3MNNB 1TZYD 3AV1B 5B0ZB 3X1VB 1M18C 3B6GD 1P3LB 3W99B 4LD9C 5B32G 3LZ0D 5DNNC 1P3FC 3AZKA 1HQ3C 3MVDD 3REJD 4J8UA 3NQUA 3LJAB 4J8XA 1Q9CA 3B6FA 3MNND 3B0DB 3UT9B 3WAAD 3X1SA 3B6GB 3LJAC 1U35A 3LZ0B 4J8UC 3B0DC 3UT9C 5B2IA 3REIB 1P3PB 4EO5B 4LD9A 4QLCB 2F8NG 5CPJA 3AZFC 4G92C 5DNMB 5AVCC 3KXBB 4ZBJB 4Z5TC 3X1VD 3REHD 4AWLB 5GSUA 4YS3B 3MGPB 5GT0B 5B2IC 1EQZB 5DNMD 4JJNA 5B40D 3AZND 5FUGA 1F66D 5B32B 5CPKA 4Z66B 4KGCC 3X1SC 3MGQA 2NQBA 1P3PD 3WKJB 4KHAA 2PYOC 1P3IA 1BH9B 4HGAB 3AZKC 2L5AA 5AV9D 4J8VA 3KXBD 1R4VA 4M6BA 2FJ7A 5E5AD 3MGSA 3AZEA 3AZIC 1ZLAC 3REHB 3UTBC 3MGPD 5AY8A 4G91B 5B24D 1ID3D 3LZ1A 3AZHB 4Z66D 1P3LD 1P3AC 3MGRB 3AZLB 2CV5A 4DRBA 3WTPA 1AOIC 1P3AB 2YFVA 3AZGA 3AZMC 3WKJC 3WAAB 1AOIB
chains in the Genus database with same CATH superfamily
2ZY2A 1P3BA 4XZQA 3REKB 3C1BB 3AV2A 1TAFA 2ZY5A 1T3UA 5AVBA 3KUYB 1H3OA 3UTAA 3VH6T 4X23A 4J8WA 3W96B 4CAYB 1KX3A 3AZJC 1KX5A 5AVBC 1S32D 3AZFD 3C1BD 2NQBD 3X1UD 5AVCD 5F99A 4WNNA 3WA9A 1P3KB 5GT0D 3AFAB 1EQZD 2HUEC 3W96D 1P34C 2HIOA 5B40B 3R45B 3TU4B 5B31G 1F66B 2FJ7D 1S32B 5GXQC 5B2ID 3X1UB 2BG1A 5B40C 3AZNC 1P34A 5B1MC 4WU8C 4KGCB 4UPKA 3EG5B 5CPKC 3LELA 3MVDB 3KUYD 2ZY3A 2DQNC 5AV5D 4WU9D 3A6ND 1JFIA 1PZRA 5AV6B 2AROD 5B31D 4WZSB 5GSUC 1M1AA 2NZDC 2BYKA 2Y2IA 2Y2NA 5E5AB 5BNVB 5CPIA 4X23C 4Z2MG 4J8WC 3REID 2IO5C 4R8PB 4KUDC 4Z2MH 5AVCB 3KXBC 5B0ZC 4QLCD 5G49A 5KDMA 4UUZB 5JRGC 3A6NB 1TZYA 4WU9B 1KX4B 3EPHA 5AV6D 4KUDB 5CP6A 1BH8B 3AYWB 1P3GC 5B24B 1ID3B 5BT1D 3X1TD 3AZGC 4H9NA 3AN2C 1M18D 3B6GC 4YS3D 3AZLD 4Z66C 3LZ0C 5B1MB 5DNND 4H9PA 4WU8B 4H9QB 1N1JB 5B1LD 1P3AD 3MVDC 5AV5B 3AYWD 5B32D 2YFWB 3H0LC 2AROB 5B31B 3MNNC 1AOID 4JJNC 5CP6C 1M18B 3REKD 5GXQB 3AZMD 3WKJD 5C3IC 4H9SA 1P3GA 3REJA 2F8NA 4J8UD 1P3MD 3W97D 3AL0C 1ZLAA 3AZIA 4Z5TA 3AV1A 5B0ZA 3X1VA 4R8PC 4H9SC 3AZFB 3AZJB 4J8UB 2NZDB 3NQUB 3LJAA 1U35C 3C1BC 3UT9A 2NQBC 3X1SB 5B1LB 1U35B 3VH5A 3LZ0A 5GT3A 4H9OB 5B0YA 3AZHD 5GT0C 5B2IB 1EQZC 1F66C 2HIOC 2UWXA 3MGRD 4QLCA 4KGCD 3W99C 5GXQD 3AZMB 4E45A 3EPLA 1P3FB 3X1SD 4DQYB 3NQJA 2ZM5A 2JCHA 1P3OB 3AZED 5CPKD 4XUJD 5F99C 5GSUB 5JRGB 3O62A 3A6NC 1KU5A 4WU9C 1M19D 5E5AC 3KWQC 5BO0B 2Y2QA 4YM6C 1M1AC 4JJNB 2NZDD 2IO5B 5B2JA 5FUGB 5B32A 3REIC 3AV2C 5CPKB 3RELD 3UTBD 4KUDD 4CSRB 5JRGD 1HTAA 3MGQB 3WKJA 2PYOA 2NQBB 4KHAB 5B24C 1F1EA 5JA4A 4NE5A 1P3LC 5BNXA 1P3IB 5BT1C 5AV9A 3AFAD 2XD5A 3RELB 4J8VB 5CHLB 5CPID 2FJ7B 3AZLC 3AZEB 3W98B 5B1LC 3C1CA 3WTPE 5B32C 5AV8C 1P3ID 1M19B 1KX3C 1KX5C 2RIQA 1P3MB 1WWSA 4JJND 3W97B 5CP6D 3KWQB 2F2AC 5AV8B 5B0YD 3LZ1B 3AZHA 3UTBB 1P3MC 3W97C 3W98D 1BFMA 3MGRA 3V9RB 4ZUXB 3AZLA 3WTPD 3AZJD 5AVBD 2JSSA 1S32C 4R8PD 3AZNA 3X1UC 4H9RA 3MGQC 1KX4D 5B33B 3EPKA 1AOIA 1U35D 2BYMA 4XZQB 1P34D 4ZUXD 3VH6A 3C1BA 3AV2B 1B67A 3X1TB 5AVBB 2Y2JA 3P5JB 4G91C 1H3OB 1HQ3B 3AZHC 3UTAB 2J8PA 2RVQD 5DNNB 5B1MD 3W96A 4X23B 4J8WB 3AN2B 4WU8D 1A7WA 2HIOD 3MGSD 1KX3B 1KX5B 3KUYC 4XZQD 4XUJB 4YM6B 3VH6W 5CPJD 2F8NK 5F99B 5GSUD 3AZEC 3WA9B 1P3KA 3AFAA 4X23D 4J8WD 1P3BC 3B6FD 2HIOB 3MNNA 3TU4A 3VH5T 4QLCC 1P3LA 3W99A 5B33D 4YM6D 1M1AD 4HGAC 5AV6C 3AZKB 1P34B 2CV5D 5GT3C 3AV2D 3WA9D 3MVDA 4J8XB 2VQRA 3B6FB 3X1TC 3AZGD 4E44A 2LY8A 1JFIB 3AN2D 3B6GA 4DRAA 5AV6A 4YS3C 1M1AB 5BNVA 1ULYA 5E5AA 3REIA 5AY8C 5CPIB 1P3PA 3TU4C 3AYWC 5B2JC 4LD9B 4R8PA 5CPJB 5KDMB 4UUZA 3O62C 5DNMA 4NE3A 3A6NA 4AWLC 4WU9A 1P3FD 3REKC 3KXBA 4KUDA 5CP6B 3REJC 3AYWA 1P3OD 5AV8D 1ID3A 1P3IC 4H9NB 4G92B 4YS3A 3MGPA 5GT0A 1EQZA 5B0YC 2F8ND 5B1MA 4WU8A 3W98C 1N1JA 3A1KA 5AV5A 4Z66A 2AROA 5B31A 4J8XC 5BS7A 4NFTA 5GXQA 3MGQD 1KX4C 1P3GB 2F8NB 2FFFB 4Z5TD 3X1VC 3AZIB 3AV1D 1BH9A 4ZUXC 3UTAD 3MGRC 3W99D 4J8VD 3MGSB 5DNMC 2CWEA 3AZFA 3AZJA 3REHA 2NZDA 4XUJC 5F99D 5AY8B 3A1IA 5B1LA 3C1CC 4WJ3C 1M19C 3KWQD 3B0CT 3LELC 5GT3B 5B0YB 4H9OA 3LZ1D 2Y2LA 2PYOD 1P3BD 3B6FC 3AZKD 3RELC 3VH5W 5AV9C 2CV5B 3AZMA 3WTPB 1P3FA 5B33C 1P3AA 3NQJB 2YFVB 3AZGB 3AZID 2XD1A 2CV5C 1P3KC 3WAAA 1P3OA 5GT3D 3WA9C 1P3BB 3AFAC 3REKA 1TAFB 1TZYC 5JRGA 3O62B 3KUYA 5CPIC 4LD9D 5BO0A 5B2JB 2Y2KA 5AY8D 1HQ3D 4EO5C 4CAYA 4CSRA 1KX3D 1KX5D 3O62D 3WAAC 2PYOB 3LJAD 5JA4B 2G5HC 4WNNB 3UT9D 1P3OC 5BNXB 2F8NH 2Y2HA 5AV9B 3RELA 5B40A 3R45A 3WTPC 1F66A 1S32A 3X1UA 3W98A 3C1CB 4KGCA 2HUEB 3LELB 1M19A 4J8XD 3W97A 1P3MA 3REHC 3EPJA 3KWQA 3H0MC 5AV8A 3UTBA 2BYKB 2RVQC 3W96C 3AV1C 4ZBJC 3V9RA 4ZUXA 3UTAC 3MGSC 2W8SA 2FJ7C 4XZQC 5AVCA 3AZNB 4J8VC 5G49B 1TZYB 2G5IC 1KX4A 4H9RB 1P3PC 5CPJC 5BS7C 1BH8A 3KFUG 5B33A 3IP4C 1WWIA 5C3IB 5B24A 2BYMB 4WV4B 5AV5C 3X1TA 3C1CD 2AROC 5B31C 3LELD 1HQ3A 3B0BA 4H9PB 4NE6A 4H9QA 3LZ1C 3AN2A 5DNNA 1ZLAD 2YFWA 3MGPC 5B0ZD 4XUJA 4YM6A 1M18A 3KSYA 1ID3C 1P3KD 3REJB 1P3GD 1B6WA 3B0CW 1ZLAB 3TU4D 4Z5TB 5B2JD 3MNNB 1TZYD 3AV1B 5B0ZB 3X1VB 1M18C 3B6GD 1P3LB 2ZY4A 3W99B 4LD9C 5B32G 3LZ0D 5DNNC 1P3FC 3AZKA 1HQ3C 3MVDD 3REJD 4J8UA 3NQUA 3LJAB 4J8XA 1Q9CA 3B6FA 3MNND 3B0DB 3UT9B 2JE5A 3WAAD 3X1SA 2DF4C 3H0RC 3B6GB 3LJAC 1U35A 3LZ0B 4J8UC 2Y2GA 3B0DC 5B2IA 3REIB 3UT9C 1P3PB 4EO5B 2Y2MA 4LD9A 4QLCB 2F8NG 5CPJA 3AZFC 4G92C 5DNMB 2Y2PA 3FDDA 5AVCC 3KXBB 4ZBJB 4Z5TC 3X1VD 3REHD 4AWLB 5GSUA 4YS3B 3MGPB 5GT0B 5B2IC 1EQZB 5DNMD 4JJNA 5B40D 3AZND 5FUGA 1F66D 5B32B 5CPKA 4Z66B 4KGCC 3X1SC 3MGQA 2NQBA 1P3PD 3WKJB 4KHAA 2PYOC 1P3IA 1BH9B 4HGAB 3AZKC 2L5AA 5AV9D 4J8VA 3KXBD 1R4VA 4M6BA 2FJ7A 5E5AD 3MGSA 3AZEA 3AZIC 1ZLAC 3REHB 3UTBC 3MGPD 5AY8A 4G91B 5B24D 1ID3D 3LZ1A 3AZHB 3F6TA 4Z66D 1P3LD 1P3AC 3MGRB 3AZLB 2Y2OA 2CV5A 4DRBA 1W2EA 3WTPA 1AOIC 1P3AB 2YFVA 1Z2CB 3AZGA 3AZMC 3WKJC 3WAAB 1AOIB
chains in the Genus database with same CATH topology
2ZY2A 1P3BA 4XZQA 3REKB 3C1BB 3AV2A 1TAFA 2ZY5A 1T3UA 5AVBA 3KUYB 1H3OA 3UTAA 3VH6T 4X23A 4J8WA 3W96B 4CAYB 1KX3A 3AZJC 1KX5A 5AVBC 1S32D 3AZFD 3C1BD 2NQBD 3X1UD 5AVCD 5F99A 4WNNA 3WA9A 1P3KB 5GT0D 3AFAB 1EQZD 2HUEC 3W96D 1P34C 2HIOA 5B40B 3R45B 3TU4B 5B31G 1F66B 2FJ7D 1S32B 5GXQC 5B2ID 3X1UB 2BG1A 5B40C 3AZNC 1P34A 5B1MC 4WU8C 4KGCB 4UPKA 3EG5B 5CPKC 3LELA 3MVDB 3KUYD 2ZY3A 2DQNC 5AV5D 4WU9D 3A6ND 1JFIA 1PZRA 5AV6B 2AROD 5B31D 4WZSB 5GSUC 1M1AA 2NZDC 2BYKA 2Y2IA 2Y2NA 5E5AB 5BNVB 5CPIA 4X23C 4Z2MG 4J8WC 3REID 2IO5C 4R8PB 4KUDC 4Z2MH 5AVCB 3KXBC 5B0ZC 4QLCD 5G49A 5KDMA 4UUZB 5JRGC 3A6NB 1TZYA 4WU9B 1KX4B 3EPHA 5AV6D 4KUDB 5CP6A 1BH8B 3AYWB 1P3GC 5B24B 1ID3B 5BT1D 3X1TD 3AZGC 4H9NA 3AN2C 1M18D 3B6GC 4YS3D 3AZLD 4Z66C 3LZ0C 5B1MB 5DNND 4H9PA 4WU8B 4H9QB 1N1JB 5B1LD 1P3AD 3MVDC 5AV5B 3AYWD 5B32D 2YFWB 3H0LC 2AROB 5B31B 3MNNC 1AOID 4JJNC 5CP6C 1M18B 3REKD 5GXQB 3AZMD 3WKJD 5C3IC 4H9SA 1P3GA 3REJA 2F8NA 4J8UD 1P3MD 3W97D 3AL0C 1ZLAA 3AZIA 4Z5TA 3AV1A 5B0ZA 3X1VA 4R8PC 4H9SC 3AZFB 3AZJB 4J8UB 2NZDB 3NQUB 3LJAA 1U35C 3C1BC 3UT9A 2NQBC 3X1SB 5B1LB 1U35B 3VH5A 3LZ0A 5GT3A 4H9OB 5B0YA 3AZHD 5GT0C 5B2IB 1EQZC 1F66C 2HIOC 2UWXA 3MGRD 4QLCA 4KGCD 3W99C 5GXQD 3AZMB 4E45A 3EPLA 1P3FB 3X1SD 4DQYB 3NQJA 2ZM5A 2JCHA 1P3OB 3AZED 5CPKD 4XUJD 5F99C 5GSUB 5JRGB 3O62A 3A6NC 1KU5A 4WU9C 1M19D 5E5AC 3KWQC 5BO0B 2Y2QA 4YM6C 1M1AC 4JJNB 2NZDD 2IO5B 5B2JA 5FUGB 5B32A 3REIC 3AV2C 5CPKB 3RELD 3UTBD 4KUDD 4CSRB 5JRGD 1HTAA 3MGQB 3WKJA 2PYOA 2NQBB 4KHAB 5B24C 1F1EA 5JA4A 4NE5A 1P3LC 5BNXA 1P3IB 5BT1C 5AV9A 3AFAD 2XD5A 3RELB 4J8VB 5CHLB 5CPID 2FJ7B 3AZLC 3AZEB 3W98B 5B1LC 3C1CA 3WTPE 5B32C 5AV8C 1P3ID 1M19B 1KX3C 1KX5C 2RIQA 1P3MB 1WWSA 4JJND 3W97B 5CP6D 3KWQB 2F2AC 5AV8B 5B0YD 3LZ1B 3AZHA 3UTBB 1P3MC 3W97C 3W98D 1BFMA 3MGRA 3V9RB 4ZUXB 3AZLA 3WTPD 3AZJD 5AVBD 2JSSA 1S32C 4R8PD 3AZNA 3X1UC 4H9RA 3MGQC 1KX4D 5B33B 3EPKA 1AOIA 1U35D 2BYMA 4XZQB 1P34D 4ZUXD 3VH6A 3C1BA 3AV2B 1B67A 3X1TB 5AVBB 2Y2JA 3P5JB 4G91C 1H3OB 1HQ3B 3AZHC 3UTAB 2J8PA 2RVQD 5DNNB 5B1MD 3W96A 4X23B 4J8WB 3AN2B 4WU8D 1A7WA 2HIOD 3MGSD 1KX3B 1KX5B 3KUYC 4XZQD 4XUJB 4YM6B 3VH6W 5CPJD 2F8NK 5F99B 5GSUD 3AZEC 3WA9B 1P3KA 3AFAA 4X23D 4J8WD 1P3BC 3B6FD 2HIOB 3MNNA 3TU4A 3VH5T 4QLCC 1P3LA 3W99A 5B33D 4YM6D 1M1AD 4HGAC 5AV6C 3AZKB 1P34B 2CV5D 5GT3C 3AV2D 3WA9D 3MVDA 4J8XB 2VQRA 3B6FB 3X1TC 3AZGD 4E44A 2LY8A 1JFIB 3AN2D 3B6GA 4DRAA 5AV6A 4YS3C 1M1AB 5BNVA 1ULYA 5E5AA 3REIA 5AY8C 5CPIB 1P3PA 3TU4C 3AYWC 5B2JC 4LD9B 4R8PA 5CPJB 5KDMB 4UUZA 3O62C 5DNMA 4NE3A 3A6NA 4AWLC 4WU9A 1P3FD 3REKC 3KXBA 4KUDA 5CP6B 3REJC 3AYWA 1P3OD 5AV8D 1ID3A 1P3IC 4H9NB 4G92B 4YS3A 3MGPA 5GT0A 1EQZA 5B0YC 2F8ND 5B1MA 4WU8A 3W98C 1N1JA 3A1KA 5AV5A 4Z66A 2AROA 5B31A 4J8XC 5BS7A 4NFTA 5GXQA 3MGQD 1KX4C 1P3GB 2F8NB 2FFFB 4Z5TD 3X1VC 3AZIB 3AV1D 1BH9A 4ZUXC 3UTAD 3MGRC 3W99D 4J8VD 3MGSB 5DNMC 2CWEA 3AZFA 3AZJA 3REHA 2NZDA 4XUJC 5F99D 5AY8B 3A1IA 5B1LA 3C1CC 4WJ3C 1M19C 3KWQD 3B0CT 3LELC 5GT3B 5B0YB 4H9OA 3LZ1D 2Y2LA 2PYOD 1P3BD 3B6FC 3AZKD 3RELC 3VH5W 5AV9C 2CV5B 3AZMA 3WTPB 1P3FA 5B33C 1P3AA 3NQJB 2YFVB 3AZGB 3AZID 2XD1A 2CV5C 1P3KC 3WAAA 1P3OA 5GT3D 3WA9C 1P3BB 3AFAC 3REKA 1TAFB 1TZYC 5JRGA 3O62B 3KUYA 5CPIC 4LD9D 5BO0A 5B2JB 2Y2KA 5AY8D 1HQ3D 4EO5C 4CAYA 4CSRA 1KX3D 1KX5D 3O62D 3WAAC 2PYOB 3LJAD 5JA4B 2G5HC 4WNNB 3UT9D 1P3OC 5BNXB 2F8NH 2Y2HA 5AV9B 3RELA 5B40A 3R45A 3WTPC 1F66A 1S32A 3X1UA 3W98A 3C1CB 4KGCA 2HUEB 3LELB 1M19A 4J8XD 3W97A 1P3MA 3REHC 3EPJA 3KWQA 3H0MC 5AV8A 3UTBA 2BYKB 2RVQC 3W96C 3AV1C 4ZBJC 3V9RA 4ZUXA 3UTAC 3MGSC 2W8SA 2FJ7C 4XZQC 5AVCA 3AZNB 4J8VC 5G49B 1TZYB 2G5IC 1KX4A 4H9RB 1P3PC 5CPJC 5BS7C 1BH8A 3KFUG 5B33A 3IP4C 1WWIA 5C3IB 5B24A 2BYMB 4WV4B 5AV5C 3X1TA 3C1CD 2AROC 5B31C 3LELD 1HQ3A 3B0BA 4H9PB 4NE6A 4H9QA 3LZ1C 3AN2A 5DNNA 1ZLAD 2YFWA 3MGPC 5B0ZD 4XUJA 4YM6A 1M18A 3KSYA 1ID3C 1P3KD 3REJB 1P3GD 1B6WA 3B0CW 1ZLAB 3TU4D 4Z5TB 5B2JD 3MNNB 1TZYD 3AV1B 5B0ZB 3X1VB 1M18C 3B6GD 1P3LB 2ZY4A 3W99B 4LD9C 5B32G 3LZ0D 5DNNC 1P3FC 3AZKA 1HQ3C 3MVDD 3REJD 4J8UA 3NQUA 3LJAB 4J8XA 1Q9CA 3B6FA 3MNND 3B0DB 3UT9B 2JE5A 3WAAD 3X1SA 2DF4C 3H0RC 3B6GB 3LJAC 1U35A 3LZ0B 4J8UC 2Y2GA 3B0DC 5B2IA 3REIB 3UT9C 1P3PB 4EO5B 2Y2MA 4LD9A 4QLCB 2F8NG 5CPJA 3AZFC 4G92C 5DNMB 2Y2PA 3FDDA 5AVCC 3KXBB 4ZBJB 4Z5TC 3X1VD 3REHD 4AWLB 5GSUA 4YS3B 3MGPB 5GT0B 5B2IC 1EQZB 5DNMD 4JJNA 5B40D 3AZND 5FUGA 1F66D 5B32B 5CPKA 4Z66B 4KGCC 3X1SC 3MGQA 2NQBA 1P3PD 3WKJB 4KHAA 2PYOC 1P3IA 1BH9B 4HGAB 3AZKC 2L5AA 5AV9D 4J8VA 3KXBD 1R4VA 4M6BA 2FJ7A 5E5AD 3MGSA 3AZEA 3AZIC 1ZLAC 3REHB 3UTBC 3MGPD 5AY8A 4G91B 5B24D 1ID3D 3LZ1A 3AZHB 3F6TA 4Z66D 1P3LD 1P3AC 3MGRB 3AZLB 2Y2OA 2CV5A 4DRBA 1W2EA 3WTPA 1AOIC 1P3AB 2YFVA 1Z2CB 3AZGA 3AZMC 3WKJC 3WAAB 1AOIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3B A;  4XZQ A;  3REK B;  3C1B B;  3AV2 A;  1TAF A;  5AVB A;  3KUY B;  1H3O A;  3UTA A;  3VH6 T;  4X23 A;  4J8W A;  3W96 B;  4CAY B;  1KX3 A;  3AZJ C;  1KX5 A;  5AVB C;  1S32 D;  3AZF D;  3C1B D;  2NQB D;  3X1U D;  5AVC D;  5F99 A;  4WNN A;  3WA9 A;  1P3K B;  5GT0 D;  3AFA B;  1EQZ D;  2HUE C;  3W96 D;  1P34 C;  2HIO A;  5B40 B;  3R45 B;  3TU4 B;  5B31 G;  1F66 B;  2FJ7 D;  1S32 B;  5GXQ C;  5B2I D;  3X1U B;  5B40 C;  3AZN C;  1P34 A;  5B1M C;  4WU8 C;  4KGC B;  5CPK C;  3LEL A;  3MVD B;  3KUY D;  5AV5 D;  4WU9 D;  3A6N D;  1JFI A;  5AV6 B;  2ARO D;  5B31 D;  4WZS B;  5GSU C;  1M1A A;  2NZD C;  2BYK A;  5BNV B;  5E5A B;  5CPI A;  4X23 C;  4Z2M G;  4J8W C;  3REI D;  2IO5 C;  4R8P B;  4KUD C;  4Z2M H;  5AVC B;  3KXB C;  5B0Z C;  4QLC D;  5G49 A;  5KDM A;  4UUZ B;  5JRG C;  3A6N B;  1TZY A;  4WU9 B;  1KX4 B;  5AV6 D;  4KUD B;  5CP6 A;  1BH8 B;  3AYW B;  1P3G C;  5B24 B;  1ID3 B;  5BT1 D;  3X1T D;  3AZG C;  4H9N A;  3AN2 C;  1M18 D;  3B6G C;  4YS3 D;  3AZL D;  4Z66 C;  3LZ0 C;  5B1M B;  5DNN D;  4H9P A;  4WU8 B;  4H9Q B;  1N1J B;  5B1L D;  1P3A D;  3MVD C;  5AV5 B;  3AYW D;  5B32 D;  2YFW B;  2ARO B;  5B31 B;  3MNN C;  1AOI D;  4JJN C;  5CP6 C;  1M18 B;  3REK D;  5GXQ B;  3AZM D;  3WKJ D;  5C3I C;  4H9S A;  1P3G A;  3REJ A;  2F8N A;  4J8U D;  1P3M D;  3W97 D;  1ZLA A;  3AZI A;  4Z5T A;  3AV1 A;  5B0Z A;  3X1V A;  4R8P C;  4H9S C;  3AZF B;  3AZJ B;  4J8U B;  2NZD B;  3NQU B;  3LJA A;  1U35 C;  3C1B C;  3UT9 A;  2NQB C;  3X1S B;  5B1L B;  1U35 B;  3VH5 A;  3LZ0 A;  5GT3 A;  4H9O B;  5B0Y A;  3AZH D;  5GT0 C;  5B2I B;  1EQZ C;  1F66 C;  2HIO C;  3MGR D;  4QLC A;  4KGC D;  3W99 C;  5GXQ D;  3AZM B;  4E45 A;  1P3F B;  3X1S D;  3NQJ A;  1P3O B;  3AZE D;  5CPK D;  4XUJ D;  5F99 C;  5GSU B;  5JRG B;  3O62 A;  3A6N C;  1KU5 A;  4WU9 C;  1M19 D;  5E5A C;  3KWQ C;  5BO0 B;  4YM6 C;  2NZD D;  1M1A C;  4JJN B;  2IO5 B;  5B2J A;  5FUG B;  5B32 A;  3REI C;  3AV2 C;  5CPK B;  3REL D;  3UTB D;  4KUD D;  4CSR B;  5JRG D;  1HTA A;  3MGQ B;  3WKJ A;  2PYO A;  2NQB B;  4KHA B;  5B24 C;  1F1E A;  5JA4 A;  4NE5 A;  1P3L C;  5BNX A;  1P3I B;  5BT1 C;  5AV9 A;  3AFA D;  3REL B;  4J8V B;  5CHL B;  5CPI D;  2FJ7 B;  3AZL C;  3AZE B;  3W98 B;  5B1L C;  3C1C A;  3WTP E;  5B32 C;  5AV8 C;  1P3I D;  1M19 B;  1KX3 C;  1KX5 C;  1P3M B;  3W97 B;  1WWS A;  4JJN D;  5CP6 D;  3KWQ B;  5AV8 B;  5B0Y D;  3LZ1 B;  3AZH A;  3UTB B;  1P3M C;  3W97 C;  3W98 D;  1BFM A;  3MGR A;  3V9R B;  4ZUX B;  3AZL A;  3WTP D;  3AZJ D;  5AVB D;  2JSS A;  1S32 C;  4R8P D;  3AZN A;  3X1U C;  4H9R A;  3MGQ C;  1KX4 D;  5B33 B;  1AOI A;  1U35 D;  2BYM A;  4XZQ B;  1P34 D;  4ZUX D;  3VH6 A;  3C1B A;  3AV2 B;  1B67 A;  3X1T B;  5AVB B;  4G91 C;  1H3O B;  1HQ3 B;  3AZH C;  3UTA B;  3AN2 B;  2RVQ D;  5B1M D;  5DNN B;  4X23 B;  3W96 A;  4J8W B;  4WU8 D;  1A7W A;  2HIO D;  3MGS D;  1KX3 B;  1KX5 B;  3KUY C;  4XZQ D;  4XUJ B;  4YM6 B;  3VH6 W;  5CPJ D;  2F8N K;  5F99 B;  5GSU D;  3AZE C;  3WA9 B;  1P3K A;  3AFA A;  4X23 D;  4J8W D;  1P3B C;  3B6F D;  2HIO B;  3MNN A;  3TU4 A;  3VH5 T;  4QLC C;  1P3L A;  3W99 A;  5B33 D;  4YM6 D;  1M1A D;  4HGA C;  5AV6 C;  3AZK B;  1P34 B;  2CV5 D;  5GT3 C;  3AV2 D;  3WA9 D;  3MVD A;  4J8X B;  3B6F B;  3X1T C;  3AZG D;  4E44 A;  2LY8 A;  1JFI B;  3AN2 D;  3B6G A;  4DRA A;  5AV6 A;  4YS3 C;  1M1A B;  5BNV A;  1ULY A;  5E5A A;  3REI A;  5AY8 C;  5CPI B;  1P3P A;  3TU4 C;  3AYW C;  5B2J C;  4LD9 B;  4R8P A;  5CPJ B;  5KDM B;  4UUZ A;  3O62 C;  5DNM A;  4NE3 A;  3A6N A;  4AWL C;  4WU9 A;  1P3F D;  3REK C;  3KXB A;  4KUD A;  5CP6 B;  3REJ C;  3AYW A;  1P3O D;  5AV8 D;  1ID3 A;  1P3I C;  4H9N B;  4G92 B;  4YS3 A;  3MGP A;  5GT0 A;  1EQZ A;  5B0Y C;  2F8N D;  5B1M A;  4WU8 A;  3W98 C;  1N1J A;  5AV5 A;  4Z66 A;  2ARO A;  5B31 A;  4J8X C;  5BS7 A;  4NFT A;  5GXQ A;  3MGQ D;  1KX4 C;  1P3G B;  2F8N B;  4Z5T D;  3X1V C;  3AZI B;  3AV1 D;  1BH9 A;  4ZUX C;  3UTA D;  3MGR C;  3W99 D;  4J8V D;  3MGS B;  5DNM C;  2CWE A;  3AZF A;  3AZJ A;  3REH A;  2NZD A;  4XUJ C;  5F99 D;  5AY8 B;  5B1L A;  3C1C C;  1M19 C;  3KWQ D;  3B0C T;  3LEL C;  5GT3 B;  4H9O A;  5B0Y B;  3LZ1 D;  2PYO D;  1P3B D;  3B6F C;  3AZK D;  3REL C;  3VH5 W;  5AV9 C;  2CV5 B;  3AZM A;  3WTP B;  1P3F A;  5B33 C;  1P3A A;  3NQJ B;  2YFV B;  3AZG B;  3AZI D;  2CV5 C;  1P3K C;  3WAA A;  1P3O A;  5GT3 D;  3WA9 C;  1P3B B;  3AFA C;  3REK A;  1TAF B;  1TZY C;  5JRG A;  3O62 B;  3KUY A;  5CPI C;  4LD9 D;  5BO0 A;  5B2J B;  5AY8 D;  1HQ3 D;  4EO5 C;  4CAY A;  4CSR A;  1KX3 D;  1KX5 D;  3O62 D;  3WAA C;  2PYO B;  3LJA D;  5JA4 B;  4WNN B;  3UT9 D;  1P3O C;  5BNX B;  2F8N H;  5AV9 B;  3REL A;  5B40 A;  3R45 A;  3WTP C;  1F66 A;  1S32 A;  3X1U A;  3W98 A;  3C1C B;  4KGC A;  2HUE B;  3LEL B;  1M19 A;  4J8X D;  3W97 A;  1P3M A;  3REH C;  3KWQ A;  5AV8 A;  3UTB A;  2BYK B;  2RVQ C;  3W96 C;  3AV1 C;  4ZBJ C;  3V9R A;  4ZUX A;  3UTA C;  3MGS C;  2FJ7 C;  4XZQ C;  5AVC A;  3AZN B;  4J8V C;  5G49 B;  1TZY B;  1KX4 A;  4H9R B;  1P3P C;  5CPJ C;  5BS7 C;  1BH8 A;  5B33 A;  1WWI A;  5C3I B;  5B24 A;  2BYM B;  4WV4 B;  5AV5 C;  3X1T A;  3C1C D;  2ARO C;  5B31 C;  3LEL D;  1HQ3 A;  3B0B A;  4H9P B;  4NE6 A;  4H9Q A;  3LZ1 C;  3AN2 A;  5DNN A;  1ZLA D;  2YFW A;  3MGP C;  5B0Z D;  4XUJ A;  4YM6 A;  1M18 A;  3KSY A;  1ID3 C;  1P3K D;  3REJ B;  1P3G D;  1B6W A;  3B0C W;  1ZLA B;  3TU4 D;  4Z5T B;  5B2J D;  3MNN B;  1TZY D;  3AV1 B;  5B0Z B;  3X1V B;  1M18 C;  3B6G D;  1P3L B;  3W99 B;  4LD9 C;  5B32 G;  3LZ0 D;  5DNN C;  1P3F C;  3AZK A;  1HQ3 C;  3MVD D;  3REJ D;  4J8U A;  3NQU A;  3LJA B;  4J8X A;  1Q9C A;  3B6F A;  3MNN D;  3B0D B;  3UT9 B;  3WAA D;  3X1S A;  3B6G B;  3LJA C;  1U35 A;  3LZ0 B;  4J8U C;  3B0D C;  3UT9 C;  5B2I A;  3REI B;  1P3P B;  4EO5 B;  4LD9 A;  4QLC B;  2F8N G;  5CPJ A;  3AZF C;  4G92 C;  5DNM B;  5AVC C;  3KXB B;  4ZBJ B;  4Z5T C;  3X1V D;  3REH D;  4AWL B;  5GSU A;  4YS3 B;  3MGP B;  5GT0 B;  5B2I C;  1EQZ B;  5DNM D;  4JJN A;  5B40 D;  3AZN D;  5FUG A;  1F66 D;  5B32 B;  5CPK A;  4Z66 B;  4KGC C;  3X1S C;  3MGQ A;  2NQB A;  1P3P D;  3WKJ B;  4KHA A;  2PYO C;  1P3I A;  1BH9 B;  4HGA B;  3AZK C;  2L5A A;  5AV9 D;  4J8V A;  3KXB D;  1R4V A;  4M6B A;  2FJ7 A;  5E5A D;  3MGS A;  3AZE A;  3AZI C;  1ZLA C;  3REH B;  3UTB C;  3MGP D;  5AY8 A;  4G91 B;  5B24 D;  1ID3 D;  3LZ1 A;  3AZH B;  4Z66 D;  1P3L D;  1P3A C;  3MGR B;  3AZL B;  2CV5 A;  4DRB A;  3WTP A;  1AOI C;  1P3A B;  2YFV A;  3AZG A;  3AZM C;  3WKJ C;  3WAA B;  1AOI B; 
#chains in the Genus database with same CATH topology
 2ZY2 A;  1P3B A;  4XZQ A;  3REK B;  3C1B B;  3AV2 A;  1TAF A;  2ZY5 A;  1T3U A;  5AVB A;  3KUY B;  1H3O A;  3UTA A;  3VH6 T;  4X23 A;  4J8W A;  3W96 B;  4CAY B;  1KX3 A;  3AZJ C;  1KX5 A;  5AVB C;  1S32 D;  3AZF D;  3C1B D;  2NQB D;  3X1U D;  5AVC D;  5F99 A;  4WNN A;  3WA9 A;  1P3K B;  5GT0 D;  3AFA B;  1EQZ D;  2HUE C;  3W96 D;  1P34 C;  2HIO A;  5B40 B;  3R45 B;  3TU4 B;  5B31 G;  1F66 B;  2FJ7 D;  1S32 B;  5GXQ C;  5B2I D;  3X1U B;  2BG1 A;  5B40 C;  3AZN C;  1P34 A;  5B1M C;  4WU8 C;  4KGC B;  4UPK A;  3EG5 B;  5CPK C;  3LEL A;  3MVD B;  3KUY D;  2ZY3 A;  2DQN C;  5AV5 D;  4WU9 D;  3A6N D;  1JFI A;  1PZR A;  5AV6 B;  2ARO D;  5B31 D;  4WZS B;  5GSU C;  1M1A A;  2NZD C;  2BYK A;  2Y2I A;  2Y2N A;  5E5A B;  5BNV B;  5CPI A;  4X23 C;  4Z2M G;  4J8W C;  3REI D;  2IO5 C;  4R8P B;  4KUD C;  4Z2M H;  5AVC B;  3KXB C;  5B0Z C;  4QLC D;  5G49 A;  5KDM A;  4UUZ B;  5JRG C;  3A6N B;  1TZY A;  4WU9 B;  1KX4 B;  3EPH A;  5AV6 D;  4KUD B;  5CP6 A;  1BH8 B;  3AYW B;  1P3G C;  5B24 B;  1ID3 B;  5BT1 D;  3X1T D;  3AZG C;  4H9N A;  3AN2 C;  1M18 D;  3B6G C;  4YS3 D;  3AZL D;  4Z66 C;  3LZ0 C;  5B1M B;  5DNN D;  4H9P A;  4WU8 B;  4H9Q B;  1N1J B;  5B1L D;  1P3A D;  3MVD C;  5AV5 B;  3AYW D;  5B32 D;  2YFW B;  3H0L C;  2ARO B;  5B31 B;  3MNN C;  1AOI D;  4JJN C;  5CP6 C;  1M18 B;  3REK D;  5GXQ B;  3AZM D;  3WKJ D;  5C3I C;  4H9S A;  1P3G A;  3REJ A;  2F8N A;  4J8U D;  1P3M D;  3W97 D;  3AL0 C;  1ZLA A;  3AZI A;  4Z5T A;  3AV1 A;  5B0Z A;  3X1V A;  4R8P C;  4H9S C;  3AZF B;  3AZJ B;  4J8U B;  2NZD B;  3NQU B;  3LJA A;  1U35 C;  3C1B C;  3UT9 A;  2NQB C;  3X1S B;  5B1L B;  1U35 B;  3VH5 A;  3LZ0 A;  5GT3 A;  4H9O B;  5B0Y A;  3AZH D;  5GT0 C;  5B2I B;  1EQZ C;  1F66 C;  2HIO C;  2UWX A;  3MGR D;  4QLC A;  4KGC D;  3W99 C;  5GXQ D;  3AZM B;  4E45 A;  3EPL A;  1P3F B;  3X1S D;  4DQY B;  3NQJ A;  2ZM5 A;  2JCH A;  1P3O B;  3AZE D;  5CPK D;  4XUJ D;  5F99 C;  5GSU B;  5JRG B;  3O62 A;  3A6N C;  1KU5 A;  4WU9 C;  1M19 D;  5E5A C;  3KWQ C;  5BO0 B;  2Y2Q A;  4YM6 C;  1M1A C;  4JJN B;  2NZD D;  2IO5 B;  5B2J A;  5FUG B;  5B32 A;  3REI C;  3AV2 C;  5CPK B;  3REL D;  3UTB D;  4KUD D;  4CSR B;  5JRG D;  1HTA A;  3MGQ B;  3WKJ A;  2PYO A;  2NQB B;  4KHA B;  5B24 C;  1F1E A;  5JA4 A;  4NE5 A;  1P3L C;  5BNX A;  1P3I B;  5BT1 C;  5AV9 A;  3AFA D;  2XD5 A;  3REL B;  4J8V B;  5CHL B;  5CPI D;  2FJ7 B;  3AZL C;  3AZE B;  3W98 B;  5B1L C;  3C1C A;  3WTP E;  5B32 C;  5AV8 C;  1P3I D;  1M19 B;  1KX3 C;  1KX5 C;  2RIQ A;  1P3M B;  1WWS A;  4JJN D;  3W97 B;  5CP6 D;  3KWQ B;  2F2A C;  5AV8 B;  5B0Y D;  3LZ1 B;  3AZH A;  3UTB B;  1P3M C;  3W97 C;  3W98 D;  1BFM A;  3MGR A;  3V9R B;  4ZUX B;  3AZL A;  3WTP D;  3AZJ D;  5AVB D;  2JSS A;  1S32 C;  4R8P D;  3AZN A;  3X1U C;  4H9R A;  3MGQ C;  1KX4 D;  5B33 B;  3EPK A;  1AOI A;  1U35 D;  2BYM A;  4XZQ B;  1P34 D;  4ZUX D;  3VH6 A;  3C1B A;  3AV2 B;  1B67 A;  3X1T B;  5AVB B;  2Y2J A;  3P5J B;  4G91 C;  1H3O B;  1HQ3 B;  3AZH C;  3UTA B;  2J8P A;  2RVQ D;  5DNN B;  5B1M D;  3W96 A;  4X23 B;  4J8W B;  3AN2 B;  4WU8 D;  1A7W A;  2HIO D;  3MGS D;  1KX3 B;  1KX5 B;  3KUY C;  4XZQ D;  4XUJ B;  4YM6 B;  3VH6 W;  5CPJ D;  2F8N K;  5F99 B;  5GSU D;  3AZE C;  3WA9 B;  1P3K A;  3AFA A;  4X23 D;  4J8W D;  1P3B C;  3B6F D;  2HIO B;  3MNN A;  3TU4 A;  3VH5 T;  4QLC C;  1P3L A;  3W99 A;  5B33 D;  4YM6 D;  1M1A D;  4HGA C;  5AV6 C;  3AZK B;  1P34 B;  2CV5 D;  5GT3 C;  3AV2 D;  3WA9 D;  3MVD A;  4J8X B;  2VQR A;  3B6F B;  3X1T C;  3AZG D;  4E44 A;  2LY8 A;  1JFI B;  3AN2 D;  3B6G A;  4DRA A;  5AV6 A;  4YS3 C;  1M1A B;  5BNV A;  1ULY A;  5E5A A;  3REI A;  5AY8 C;  5CPI B;  1P3P A;  3TU4 C;  3AYW C;  5B2J C;  4LD9 B;  4R8P A;  5CPJ B;  5KDM B;  4UUZ A;  3O62 C;  5DNM A;  4NE3 A;  3A6N A;  4AWL C;  4WU9 A;  1P3F D;  3REK C;  3KXB A;  4KUD A;  5CP6 B;  3REJ C;  3AYW A;  1P3O D;  5AV8 D;  1ID3 A;  1P3I C;  4H9N B;  4G92 B;  4YS3 A;  3MGP A;  5GT0 A;  1EQZ A;  5B0Y C;  2F8N D;  5B1M A;  4WU8 A;  3W98 C;  1N1J A;  3A1K A;  5AV5 A;  4Z66 A;  2ARO A;  5B31 A;  4J8X C;  5BS7 A;  4NFT A;  5GXQ A;  3MGQ D;  1KX4 C;  1P3G B;  2F8N B;  2FFF B;  4Z5T D;  3X1V C;  3AZI B;  3AV1 D;  1BH9 A;  4ZUX C;  3UTA D;  3MGR C;  3W99 D;  4J8V D;  3MGS B;  5DNM C;  2CWE A;  3AZF A;  3AZJ A;  3REH A;  2NZD A;  4XUJ C;  5F99 D;  5AY8 B;  3A1I A;  5B1L A;  3C1C C;  4WJ3 C;  1M19 C;  3KWQ D;  3B0C T;  3LEL C;  5GT3 B;  5B0Y B;  4H9O A;  3LZ1 D;  2Y2L A;  2PYO D;  1P3B D;  3B6F C;  3AZK D;  3REL C;  3VH5 W;  5AV9 C;  2CV5 B;  3AZM A;  3WTP B;  1P3F A;  5B33 C;  1P3A A;  3NQJ B;  2YFV B;  3AZG B;  3AZI D;  2XD1 A;  2CV5 C;  1P3K C;  3WAA A;  1P3O A;  5GT3 D;  3WA9 C;  1P3B B;  3AFA C;  3REK A;  1TAF B;  1TZY C;  5JRG A;  3O62 B;  3KUY A;  5CPI C;  4LD9 D;  5BO0 A;  5B2J B;  2Y2K A;  5AY8 D;  1HQ3 D;  4EO5 C;  4CAY A;  4CSR A;  1KX3 D;  1KX5 D;  3O62 D;  3WAA C;  2PYO B;  3LJA D;  5JA4 B;  2G5H C;  4WNN B;  3UT9 D;  1P3O C;  5BNX B;  2F8N H;  2Y2H A;  5AV9 B;  3REL A;  5B40 A;  3R45 A;  3WTP C;  1F66 A;  1S32 A;  3X1U A;  3W98 A;  3C1C B;  4KGC A;  2HUE B;  3LEL B;  1M19 A;  4J8X D;  3W97 A;  1P3M A;  3REH C;  3EPJ A;  3KWQ A;  3H0M C;  5AV8 A;  3UTB A;  2BYK B;  2RVQ C;  3W96 C;  3AV1 C;  4ZBJ C;  3V9R A;  4ZUX A;  3UTA C;  3MGS C;  2W8S A;  2FJ7 C;  4XZQ C;  5AVC A;  3AZN B;  4J8V C;  5G49 B;  1TZY B;  2G5I C;  1KX4 A;  4H9R B;  1P3P C;  5CPJ C;  5BS7 C;  1BH8 A;  3KFU G;  5B33 A;  3IP4 C;  1WWI A;  5C3I B;  5B24 A;  2BYM B;  4WV4 B;  5AV5 C;  3X1T A;  3C1C D;  2ARO C;  5B31 C;  3LEL D;  1HQ3 A;  3B0B A;  4H9P B;  4NE6 A;  4H9Q A;  3LZ1 C;  3AN2 A;  5DNN A;  1ZLA D;  2YFW A;  3MGP C;  5B0Z D;  4XUJ A;  4YM6 A;  1M18 A;  3KSY A;  1ID3 C;  1P3K D;  3REJ B;  1P3G D;  1B6W A;  3B0C W;  1ZLA B;  3TU4 D;  4Z5T B;  5B2J D;  3MNN B;  1TZY D;  3AV1 B;  5B0Z B;  3X1V B;  1M18 C;  3B6G D;  1P3L B;  2ZY4 A;  3W99 B;  4LD9 C;  5B32 G;  3LZ0 D;  5DNN C;  1P3F C;  3AZK A;  1HQ3 C;  3MVD D;  3REJ D;  4J8U A;  3NQU A;  3LJA B;  4J8X A;  1Q9C A;  3B6F A;  3MNN D;  3B0D B;  3UT9 B;  2JE5 A;  3WAA D;  3X1S A;  2DF4 C;  3H0R C;  3B6G B;  3LJA C;  1U35 A;  3LZ0 B;  4J8U C;  2Y2G A;  3B0D C;  5B2I A;  3REI B;  3UT9 C;  1P3P B;  4EO5 B;  2Y2M A;  4LD9 A;  4QLC B;  2F8N G;  5CPJ A;  3AZF C;  4G92 C;  5DNM B;  2Y2P A;  3FDD A;  5AVC C;  3KXB B;  4ZBJ B;  4Z5T C;  3X1V D;  3REH D;  4AWL B;  5GSU A;  4YS3 B;  3MGP B;  5GT0 B;  5B2I C;  1EQZ B;  5DNM D;  4JJN A;  5B40 D;  3AZN D;  5FUG A;  1F66 D;  5B32 B;  5CPK A;  4Z66 B;  4KGC C;  3X1S C;  3MGQ A;  2NQB A;  1P3P D;  3WKJ B;  4KHA A;  2PYO C;  1P3I A;  1BH9 B;  4HGA B;  3AZK C;  2L5A A;  5AV9 D;  4J8V A;  3KXB D;  1R4V A;  4M6B A;  2FJ7 A;  5E5A D;  3MGS A;  3AZE A;  3AZI C;  1ZLA C;  3REH B;  3UTB C;  3MGP D;  5AY8 A;  4G91 B;  5B24 D;  1ID3 D;  3LZ1 A;  3AZH B;  3F6T A;  4Z66 D;  1P3L D;  1P3A C;  3MGR B;  3AZL B;  2Y2O A;  2CV5 A;  4DRB A;  1W2E A;  3WTP A;  1AOI C;  1P3A B;  2YFV A;  1Z2C B;  3AZG A;  3AZM C;  3WKJ C;  3WAA B;  1AOI B; 
#chains in the Genus database with same CATH homology
 2ZY2 A;  1P3B A;  4XZQ A;  3REK B;  3C1B B;  3AV2 A;  1TAF A;  2ZY5 A;  1T3U A;  5AVB A;  3KUY B;  1H3O A;  3UTA A;  3VH6 T;  4X23 A;  4J8W A;  3W96 B;  4CAY B;  1KX3 A;  3AZJ C;  1KX5 A;  5AVB C;  1S32 D;  3AZF D;  3C1B D;  2NQB D;  3X1U D;  5AVC D;  5F99 A;  4WNN A;  3WA9 A;  1P3K B;  5GT0 D;  3AFA B;  1EQZ D;  2HUE C;  3W96 D;  1P34 C;  2HIO A;  5B40 B;  3R45 B;  3TU4 B;  5B31 G;  1F66 B;  2FJ7 D;  1S32 B;  5GXQ C;  5B2I D;  3X1U B;  2BG1 A;  5B40 C;  3AZN C;  1P34 A;  5B1M C;  4WU8 C;  4KGC B;  4UPK A;  3EG5 B;  5CPK C;  3LEL A;  3MVD B;  3KUY D;  2ZY3 A;  2DQN C;  5AV5 D;  4WU9 D;  3A6N D;  1JFI A;  1PZR A;  5AV6 B;  2ARO D;  5B31 D;  4WZS B;  5GSU C;  1M1A A;  2NZD C;  2BYK A;  2Y2I A;  2Y2N A;  5E5A B;  5BNV B;  5CPI A;  4X23 C;  4Z2M G;  4J8W C;  3REI D;  2IO5 C;  4R8P B;  4KUD C;  4Z2M H;  5AVC B;  3KXB C;  5B0Z C;  4QLC D;  5G49 A;  5KDM A;  4UUZ B;  5JRG C;  3A6N B;  1TZY A;  4WU9 B;  1KX4 B;  3EPH A;  5AV6 D;  4KUD B;  5CP6 A;  1BH8 B;  3AYW B;  1P3G C;  5B24 B;  1ID3 B;  5BT1 D;  3X1T D;  3AZG C;  4H9N A;  3AN2 C;  1M18 D;  3B6G C;  4YS3 D;  3AZL D;  4Z66 C;  3LZ0 C;  5B1M B;  5DNN D;  4H9P A;  4WU8 B;  4H9Q B;  1N1J B;  5B1L D;  1P3A D;  3MVD C;  5AV5 B;  3AYW D;  5B32 D;  2YFW B;  3H0L C;  2ARO B;  5B31 B;  3MNN C;  1AOI D;  4JJN C;  5CP6 C;  1M18 B;  3REK D;  5GXQ B;  3AZM D;  3WKJ D;  5C3I C;  4H9S A;  1P3G A;  3REJ A;  2F8N A;  4J8U D;  1P3M D;  3W97 D;  3AL0 C;  1ZLA A;  3AZI A;  4Z5T A;  3AV1 A;  5B0Z A;  3X1V A;  4R8P C;  4H9S C;  3AZF B;  3AZJ B;  4J8U B;  2NZD B;  3NQU B;  3LJA A;  1U35 C;  3C1B C;  3UT9 A;  2NQB C;  3X1S B;  5B1L B;  1U35 B;  3VH5 A;  3LZ0 A;  5GT3 A;  4H9O B;  5B0Y A;  3AZH D;  5GT0 C;  5B2I B;  1EQZ C;  1F66 C;  2HIO C;  2UWX A;  3MGR D;  4QLC A;  4KGC D;  3W99 C;  5GXQ D;  3AZM B;  4E45 A;  3EPL A;  1P3F B;  3X1S D;  4DQY B;  3NQJ A;  2ZM5 A;  2JCH A;  1P3O B;  3AZE D;  5CPK D;  4XUJ D;  5F99 C;  5GSU B;  5JRG B;  3O62 A;  3A6N C;  1KU5 A;  4WU9 C;  1M19 D;  5E5A C;  3KWQ C;  5BO0 B;  2Y2Q A;  4YM6 C;  1M1A C;  4JJN B;  2NZD D;  2IO5 B;  5B2J A;  5FUG B;  5B32 A;  3REI C;  3AV2 C;  5CPK B;  3REL D;  3UTB D;  4KUD D;  4CSR B;  5JRG D;  1HTA A;  3MGQ B;  3WKJ A;  2PYO A;  2NQB B;  4KHA B;  5B24 C;  1F1E A;  5JA4 A;  4NE5 A;  1P3L C;  5BNX A;  1P3I B;  5BT1 C;  5AV9 A;  3AFA D;  2XD5 A;  3REL B;  4J8V B;  5CHL B;  5CPI D;  2FJ7 B;  3AZL C;  3AZE B;  3W98 B;  5B1L C;  3C1C A;  3WTP E;  5B32 C;  5AV8 C;  1P3I D;  1M19 B;  1KX3 C;  1KX5 C;  2RIQ A;  1P3M B;  1WWS A;  4JJN D;  3W97 B;  5CP6 D;  3KWQ B;  2F2A C;  5AV8 B;  5B0Y D;  3LZ1 B;  3AZH A;  3UTB B;  1P3M C;  3W97 C;  3W98 D;  1BFM A;  3MGR A;  3V9R B;  4ZUX B;  3AZL A;  3WTP D;  3AZJ D;  5AVB D;  2JSS A;  1S32 C;  4R8P D;  3AZN A;  3X1U C;  4H9R A;  3MGQ C;  1KX4 D;  5B33 B;  3EPK A;  1AOI A;  1U35 D;  2BYM A;  4XZQ B;  1P34 D;  4ZUX D;  3VH6 A;  3C1B A;  3AV2 B;  1B67 A;  3X1T B;  5AVB B;  2Y2J A;  3P5J B;  4G91 C;  1H3O B;  1HQ3 B;  3AZH C;  3UTA B;  2J8P A;  2RVQ D;  5DNN B;  5B1M D;  3W96 A;  4X23 B;  4J8W B;  3AN2 B;  4WU8 D;  1A7W A;  2HIO D;  3MGS D;  1KX3 B;  1KX5 B;  3KUY C;  4XZQ D;  4XUJ B;  4YM6 B;  3VH6 W;  5CPJ D;  2F8N K;  5F99 B;  5GSU D;  3AZE C;  3WA9 B;  1P3K A;  3AFA A;  4X23 D;  4J8W D;  1P3B C;  3B6F D;  2HIO B;  3MNN A;  3TU4 A;  3VH5 T;  4QLC C;  1P3L A;  3W99 A;  5B33 D;  4YM6 D;  1M1A D;  4HGA C;  5AV6 C;  3AZK B;  1P34 B;  2CV5 D;  5GT3 C;  3AV2 D;  3WA9 D;  3MVD A;  4J8X B;  2VQR A;  3B6F B;  3X1T C;  3AZG D;  4E44 A;  2LY8 A;  1JFI B;  3AN2 D;  3B6G A;  4DRA A;  5AV6 A;  4YS3 C;  1M1A B;  5BNV A;  1ULY A;  5E5A A;  3REI A;  5AY8 C;  5CPI B;  1P3P A;  3TU4 C;  3AYW C;  5B2J C;  4LD9 B;  4R8P A;  5CPJ B;  5KDM B;  4UUZ A;  3O62 C;  5DNM A;  4NE3 A;  3A6N A;  4AWL C;  4WU9 A;  1P3F D;  3REK C;  3KXB A;  4KUD A;  5CP6 B;  3REJ C;  3AYW A;  1P3O D;  5AV8 D;  1ID3 A;  1P3I C;  4H9N B;  4G92 B;  4YS3 A;  3MGP A;  5GT0 A;  1EQZ A;  5B0Y C;  2F8N D;  5B1M A;  4WU8 A;  3W98 C;  1N1J A;  3A1K A;  5AV5 A;  4Z66 A;  2ARO A;  5B31 A;  4J8X C;  5BS7 A;  4NFT A;  5GXQ A;  3MGQ D;  1KX4 C;  1P3G B;  2F8N B;  2FFF B;  4Z5T D;  3X1V C;  3AZI B;  3AV1 D;  1BH9 A;  4ZUX C;  3UTA D;  3MGR C;  3W99 D;  4J8V D;  3MGS B;  5DNM C;  2CWE A;  3AZF A;  3AZJ A;  3REH A;  2NZD A;  4XUJ C;  5F99 D;  5AY8 B;  3A1I A;  5B1L A;  3C1C C;  4WJ3 C;  1M19 C;  3KWQ D;  3B0C T;  3LEL C;  5GT3 B;  5B0Y B;  4H9O A;  3LZ1 D;  2Y2L A;  2PYO D;  1P3B D;  3B6F C;  3AZK D;  3REL C;  3VH5 W;  5AV9 C;  2CV5 B;  3AZM A;  3WTP B;  1P3F A;  5B33 C;  1P3A A;  3NQJ B;  2YFV B;  3AZG B;  3AZI D;  2XD1 A;  2CV5 C;  1P3K C;  3WAA A;  1P3O A;  5GT3 D;  3WA9 C;  1P3B B;  3AFA C;  3REK A;  1TAF B;  1TZY C;  5JRG A;  3O62 B;  3KUY A;  5CPI C;  4LD9 D;  5BO0 A;  5B2J B;  2Y2K A;  5AY8 D;  1HQ3 D;  4EO5 C;  4CAY A;  4CSR A;  1KX3 D;  1KX5 D;  3O62 D;  3WAA C;  2PYO B;  3LJA D;  5JA4 B;  2G5H C;  4WNN B;  3UT9 D;  1P3O C;  5BNX B;  2F8N H;  2Y2H A;  5AV9 B;  3REL A;  5B40 A;  3R45 A;  3WTP C;  1F66 A;  1S32 A;  3X1U A;  3W98 A;  3C1C B;  4KGC A;  2HUE B;  3LEL B;  1M19 A;  4J8X D;  3W97 A;  1P3M A;  3REH C;  3EPJ A;  3KWQ A;  3H0M C;  5AV8 A;  3UTB A;  2BYK B;  2RVQ C;  3W96 C;  3AV1 C;  4ZBJ C;  3V9R A;  4ZUX A;  3UTA C;  3MGS C;  2W8S A;  2FJ7 C;  4XZQ C;  5AVC A;  3AZN B;  4J8V C;  5G49 B;  1TZY B;  2G5I C;  1KX4 A;  4H9R B;  1P3P C;  5CPJ C;  5BS7 C;  1BH8 A;  3KFU G;  5B33 A;  3IP4 C;  1WWI A;  5C3I B;  5B24 A;  2BYM B;  4WV4 B;  5AV5 C;  3X1T A;  3C1C D;  2ARO C;  5B31 C;  3LEL D;  1HQ3 A;  3B0B A;  4H9P B;  4NE6 A;  4H9Q A;  3LZ1 C;  3AN2 A;  5DNN A;  1ZLA D;  2YFW A;  3MGP C;  5B0Z D;  4XUJ A;  4YM6 A;  1M18 A;  3KSY A;  1ID3 C;  1P3K D;  3REJ B;  1P3G D;  1B6W A;  3B0C W;  1ZLA B;  3TU4 D;  4Z5T B;  5B2J D;  3MNN B;  1TZY D;  3AV1 B;  5B0Z B;  3X1V B;  1M18 C;  3B6G D;  1P3L B;  2ZY4 A;  3W99 B;  4LD9 C;  5B32 G;  3LZ0 D;  5DNN C;  1P3F C;  3AZK A;  1HQ3 C;  3MVD D;  3REJ D;  4J8U A;  3NQU A;  3LJA B;  4J8X A;  1Q9C A;  3B6F A;  3MNN D;  3B0D B;  3UT9 B;  2JE5 A;  3WAA D;  3X1S A;  2DF4 C;  3H0R C;  3B6G B;  3LJA C;  1U35 A;  3LZ0 B;  4J8U C;  2Y2G A;  3B0D C;  5B2I A;  3REI B;  3UT9 C;  1P3P B;  4EO5 B;  2Y2M A;  4LD9 A;  4QLC B;  2F8N G;  5CPJ A;  3AZF C;  4G92 C;  5DNM B;  2Y2P A;  3FDD A;  5AVC C;  3KXB B;  4ZBJ B;  4Z5T C;  3X1V D;  3REH D;  4AWL B;  5GSU A;  4YS3 B;  3MGP B;  5GT0 B;  5B2I C;  1EQZ B;  5DNM D;  4JJN A;  5B40 D;  3AZN D;  5FUG A;  1F66 D;  5B32 B;  5CPK A;  4Z66 B;  4KGC C;  3X1S C;  3MGQ A;  2NQB A;  1P3P D;  3WKJ B;  4KHA A;  2PYO C;  1P3I A;  1BH9 B;  4HGA B;  3AZK C;  2L5A A;  5AV9 D;  4J8V A;  3KXB D;  1R4V A;  4M6B A;  2FJ7 A;  5E5A D;  3MGS A;  3AZE A;  3AZI C;  1ZLA C;  3REH B;  3UTB C;  3MGP D;  5AY8 A;  4G91 B;  5B24 D;  1ID3 D;  3LZ1 A;  3AZH B;  3F6T A;  4Z66 D;  1P3L D;  1P3A C;  3MGR B;  3AZL B;  2Y2O A;  2CV5 A;  4DRB A;  1W2E A;  3WTP A;  1AOI C;  1P3A B;  2YFV A;  1Z2C B;  3AZG A;  3AZM C;  3WKJ C;  3WAA B;  1AOI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...