4R8PD

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 33
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pD00
3AZGC 3B0DC 5B2ID 5F99B 3AN2A 4J8UB 4Z2MG 3KWQD 1P3KB 3KSYA 4H9OB 3AZHB 1P3IA 5AV6C 5CP6B 3UTAA 1P3BA 1HQ3D 3KUYB 5G49B 5GSUC 4R8PD 4YS3C 1KU5A 5CP6C 4Z2MH 3MGPB 3AZHC 2HUEC 1TZYC 5AV5B 3MGPD 3VH5W 3MGSD 3REJA 5B1LC 1U35B 3LELD 4KGCD 1P34D 4WU9A 1AOID 4Z5TD 3KXBA 5AY8A 1B6WA 4J8WD 3UTBC 1M18B 3AYWB 5AVCA 4JJNC 4M6BA 1P3FB 5JA4A 3W99C 3X1UA 4H9SA 3REKC 4CSRB 3REHA 4J8VA 5BO0B 4J8XB 5B1LA 1KX3D 3LELA 2RVQC 4H9NA 5AV9B 1ID3A 4WNNB 3W96B 5CPKA 5DNNA 3AZLD 3AZNA 4J8WA 4QLCB 4J8UA 3LZ1B 5B24C 5GT0B 4XUJC 3WTPE 3REIC 2FJ7D 5B2IC 5BNVB 5B31B 4EO5B 4J8WB 1F66B 1ULYA 3LJAD 3REHC 3AZJA 4WU8C 1P3AA 4WNNA 1M1AC 3LZ1C 4KGCB 5B1LD 5JRGB 2NQBB 5BNXB 2CV5B 1TZYD 5CPKC 4NFTA 2PYOA 4ZBJB 5G49A 3AZLC 5B0YA 1HQ3B 3AZGA 3VH6A 3X1VC 3AN2C 3AYWA 2F8NK 1P3LD 4H9RB 5BS7A 3W97A 4Z66B 3X1SA 5AVCD 3MVDA 3AZJC 4AWLB 1P34B 4CAYA 5C3IC 4Z66D 1P3AC 3B6GB 4YM6A 3AZKC 1KX5C 1JFIB 3AZMD 5GSUA 3C1BC 1BH8A 3W98B 2PYOB 5CPID 1TAFB 3AZIB 2PYOD 5B0YC 2IO5B 1M19A 3WA9C 4WU9C 5B40A 3MGQA 4CSRA 5AY8C 4XZQB 1EQZD 5GT3A 1P3OD 5B1MA 1P3MA 3X1TC 3LZ0C 4KUDB 3MVDD 3AZED 3AFAB 3AV2C 5AVCC 1BFMA 3W99D 3X1TB 3UT9C 3MGRD 4QLCA 5GT0D 3UT9B 3C1CC 4H9SC 2AROB 5B32G 5AY8B 1KX4A 3LZ1D 1ZLAD 2HIOC 3O62B 4UUZA 3MGPA 5DNNC 3AZNC 1EQZA 4WU8D 2NQBA 3TU4D 2HIOB 5AV8D 3UTAB 1P3BB 1P3LA 5C3IB 5B33A 4NE6A 3W98C 4WZSB 3B6GA 3UT9A 5BNVA 2AROC 3AYWD 3MGRA 4XUJD 5B31G 1S32C 3AFAA 5B33B 3KXBB 3AN2D 3LZ1A 3AV2B 1KX3B 5AV9D 3RELA 3W96D 5AV5A 4Z5TB 1EQZC 2NQBC 5B40B 3LELB 4XZQC 3MGQB 4NE3A 3KWQC 2L5AA 1M1AB 4R8PA 5CPKD 4KGCA 4H9PA 1TAFA 4YS3A 3B0CT 5CP6A 3AZHA 5JA4B 3AZID 5CPIB 4X23C 5DNMD 3AV1C 1M18D 3C1BB 1S32A 4WU9D 1AOIA 3MGSC 2YFWA 5B0ZC 4AWLC 5CPIC 4EO5C 1P34C 3C1BA 4KUDA 5F99D 5B2IB 5GXQA 3UTBA 4DRBA 3AZMC 2JSSA 5FUGB 1P3GC 5AV6D 3NQJB 4H9NB 3AZFB 1JFIA 4R8PB 4R8PC 4JJNA 3MGQC 5B40C 2F8NH 3KUYD 5GT3C 2RVQD 4ZBJC 5CP6D 5AVBA 1BH8B 3W96C 5AV9C 4JJNB 5E5AD 3AZFA 5B33D 4J8XC 5B0ZB 2F8NB 5AV8A 1P3GB 4KHAB 1F66D 4Z66A 4X23B 3WTPA 5F99A 3V9RB 3AZMA 4X23D 2HIOD 5AV8B 5B24A 1P3GA 3B6FD 4XUJA 5CPJD 5B2JA 2NZDD 3REIA 4LD9A 4HGAB 5KDMA 2HUEB 3AV1B 3MGPC 1H3OA 1EQZB 4YS3B 4XZQD 3A6ND 3W96A 5AV9A 3RELD 3A6NB 4YS3D 2YFVA 3MNND 5B33C 4Z5TA 3W98A 3REKD 1H3OB 1P3FA 3W99B 5F99C 1WWIA 5B2JB 3X1SD 3B0CW 3AFAC 4KUDD 1M18A 3B6FA 3AYWC 1S32B 4KHAA 3B0DB 3C1BD 4JJND 4WU9B 3KWQA 3REHD 4YM6C 3AZKA 1KX5A 1M19D 3AZIC 5BO0A 5CPJC 5E5AA 1A7WA 3REKA 1TZYB 3AV1A 4J8VC 5KDMB 5JRGD 3O62C 3AZKB 1KX5B 3X1VD 3MGSA 5AVCB 3B6GD 1B67A 3AZEA 3AZJB 5GT3D 1P3AB 1P34A 4KUDC 3V9RA 4E45A 3AV2D 5CHLB 3KXBD 1P3KC 1WWSA 3MNNC 3AN2B 4J8UC 1P3IC 3LJAA 3WTPD 1Q9CA 1AOIB 3LZ0D 3AZGB 3WKJD 2NZDC 4QLCD 2IO5C 1ZLAA 5B2JD 5CPJA 5CPKB 1N1JA 4H9QB 3C1CA 1TZYA 4WU8A 2YFVB 3O62A 4HGAC 1M1AA 4ZUXB 5B0YD 4J8XA 3WA9B 3NQJA 1F66C 5AV8C 1N1JB 4H9QA 3X1UB 3RELB 1P3PC 3MNNA 4Z66C 5B32D 5DNND 3AZND 3AZLA 5B24B 2LY8A 4CAYB 3X1SB 3MGRB 3UT9D 3B6GC 3AZLB 5GSUD 3X1TD 3VH6T 3AFAD 4DRAA 3C1CD 3MVDC 3AZEB 5GT3B 3X1SC 3X1VB 5JRGC 3O62D 1U35D 5AVBB 3WAAD 5AV5D 3RELC 1P3FC 1P3PA 4J8WC 3AZGD 4NE5A 2CV5C 1KX3A 1M19C 1M18C 4KGCC 4H9OA 1BH9A 5B2IA 2BYKA 2F8NG 4X23A 3X1TA 3LZ0A 4WV4B 1KX4D 4G92C 1P3ID 5GT0C 1HQ3A 5CPIA 2CWEA 4QLCC 1P3MB 3WAAA 3REKB 3NQUB 4H9PB 2CV5A 1KX3C 3W98D 3TU4A 5AV6B 3AZFD 3KUYA 1P3MD 1P3OA 3KXBC 1M1AD 5AVBD 5B40D 1HTAA 3MGQD 3WAAB 1P3KA 5BS7C 5B32C 3B6FB 3LJAC 3LJAB 2YFWB 5B31D 5GT0A 2NZDA 1R4VA 2BYKB 5DNMB 5DNMC 3REJC 3W99A 3WAAC 3WTPC 5DNNB 5B24D 3AZNB 3WKJC 2BYMB 3REID 2CV5D 5B2JC 5B32B 2FJ7C 3WA9A 3KUYC 4LD9C 3R45A 3UTAD 1F1EA 5B1LB 1U35C 1P3BD 1ID3C 2NQBD 1P3MC 5AV5C 3C1CB 5BNXA 5GSUB 2BYMA 4E44A 4LD9B 3A6NC 3AV2A 2FJ7B 3WKJB 3LZ0B 3WTPB 5AY8D 1KX4C 2F8ND 3WKJA 4G92B 2FJ7A 5B0ZA 3B6FC 3WA9D 5B0YB 3REJB 5BT1C 3AZJD 1P3AD 2PYOC 4J8XD 1P3OB 3AZKD 1KX5D 4UUZB 4ZUXA 1P3LC 3X1VA 3AZIA 3NQUA 3VH5A 5E5AC 4G91C 2AROA 5AVBC 5GXQB 3W97C 3MGRC 5B31A 3AZHD 3B0BA 1P3KD 3AZFC 3VH6W 3AZMB 4J8UD 3MVDB 3AZEC 1S32D 1HQ3C 5GXQD 1BH9B 5B1MB 3MGSB 4YM6D 4XZQA 1P3LB 3UTBD 4ZUXC 3TU4C 3TU4B 3VH5T 1P3OC 1M19B 1P3PB 1ZLAC 4WU8B 3REHB 3X1UC 5B1MC 3REJD 3R45B 5B31C 1ZLAB 5B32A 1AOIC 3REIB 3KWQB 5FUGA 3LELC 4XUJB 1P3IB 1KX4B 1F66A 4Z5TC 5DNMA 5GXQC 3W97B 2NZDB 4G91B 4H9RA 3W97D 4LD9D 2F8NA 2HIOA 1P3GD 1U35A 3MNNB 5B0ZD 4J8VD 5E5AB 1ID3B 3X1UD 5AV6A 3UTAC 1P3BC 3AV1D 1ID3D 3A6NA 5JRGA 4J8VB 2AROD 4ZUXD 5BT1D 1P3PD 5CPJB 3UTBB 5B1MD 1P3FD 4YM6B
chains in the Genus database with same CATH superfamily
3AZGC 3B0DC 5B2ID 5F99B 3AN2A 4J8UB 4Z2MG 3KWQD 1P3KB 3KSYA 4H9OB 3AZHB 1P3IA 5AV6C 5CP6B 3UTAA 1P3BA 1HQ3D 3KUYB 5G49B 5GSUC 4R8PD 4YS3C 1KU5A 5CP6C 4Z2MH 3MGPB 3AZHC 2HUEC 1TZYC 5AV5B 3MGPD 3VH5W 3MGSD 3REJA 5B1LC 1U35B 3LELD 4KGCD 1P34D 4WU9A 1AOID 4Z5TD 3KXBA 5AY8A 1B6WA 4J8WD 3UTBC 2ZY3A 1M18B 3AYWB 5AVCA 4JJNC 4M6BA 1P3FB 5JA4A 3W99C 3X1UA 4H9SA 3REKC 2Y2QA 4CSRB 3REHA 4J8VA 5BO0B 4J8XB 5B1LA 1KX3D 3LELA 2RVQC 4H9NA 5AV9B 1ID3A 4WNNB 3W96B 5CPKA 5DNNA 3AZLD 3AZNA 4J8WA 4QLCB 4J8UA 2Y2JA 3LZ1B 2Y2LA 5B24C 5GT0B 2Y2OA 4XUJC 3WTPE 3REIC 2FJ7D 5B2IC 5BNVB 5B31B 4EO5B 4J8WB 1F66B 1ULYA 3LJAD 3REHC 3AZJA 4WU8C 1P3AA 4WNNA 1M1AC 3LZ1C 4KGCB 5B1LD 5JRGB 2NQBB 5BNXB 2CV5B 1TZYD 5CPKC 4NFTA 3EPKA 2PYOA 4ZBJB 5G49A 3AZLC 5B0YA 1HQ3B 3AZGA 3VH6A 3X1VC 3AN2C 3AYWA 2F8NK 1P3LD 4H9RB 2G5IC 5BS7A 3W97A 4Z66B 3X1SA 5AVCD 3MVDA 3AZJC 4AWLB 1P34B 4CAYA 5C3IC 2Y2PA 4Z66D 1P3AC 4YM6A 3AZKC 1KX5C 1JFIB 3AZMD 5GSUA 3C1BC 1BH8A 3W98B 2PYOB 5CPID 1TAFB 3AZIB 2PYOD 5B0YC 2IO5B 1M19A 3WA9C 2Y2HA 5B40A 3MGQA 4WU9C 4CSRA 5AY8C 4XZQB 1EQZD 5GT3A 1P3OD 5B1MA 1P3MA 3X1TC 3LZ0C 4KUDB 3MVDD 3AZED 3AFAB 3A1KA 3AV2C 5AVCC 1BFMA 3W99D 3KFUG 3X1TB 3P5JB 4WJ3C 3UT9C 3MGRD 4QLCA 5GT0D 3UT9B 3C1CC 4H9SC 2AROB 5B32G 5AY8B 1KX4A 3B6GB 3LZ1D 1ZLAD 2HIOC 3O62B 4UUZA 2F2AC 3MGPA 5DNNC 3AZNC 1EQZA 4WU8D 2NQBA 3H0RC 3TU4D 2HIOB 5AV8D 3UTAB 1P3BB 1P3LA 5C3IB 2Y2NA 5B33A 4NE6A 3W98C 4WZSB 3B6GA 3UT9A 5BNVA 2AROC 3AYWD 3MGRA 2DQNC 4XUJD 2ZY5A 5B31G 1S32C 3AFAA 5B33B 3KXBB 3AN2D 3LZ1A 3AV2B 2RIQA 1KX3B 5AV9D 3RELA 3W96D 5AV5A 4Z5TB 1EQZC 2NQBC 5B40B 3LELB 4XZQC 3MGQB 4NE3A 3KWQC 2L5AA 1M1AB 2Y2MA 4R8PA 5CPKD 4KGCA 4H9PA 1TAFA 4YS3A 3B0CT 5CP6A 3AZHA 5JA4B 3AZID 5CPIB 4X23C 5DNMD 3AV1C 1M18D 3C1BB 1S32A 4WU9D 1AOIA 3MGSC 2YFWA 5B0ZC 4AWLC 5CPIC 4EO5C 1P34C 3C1BA 4KUDA 5F99D 5B2IB 5GXQA 3UTBA 4DRBA 3AZMC 2JSSA 5FUGB 1P3GC 5AV6D 3NQJB 4H9NB 3AZFB 1JFIA 4R8PB 4R8PC 4JJNA 3MGQC 5B40C 2F8NH 3KUYD 5GT3C 2RVQD 4ZBJC 5CP6D 5AVBA 1BH8B 5AV9C 2G5HC 3W96C 4JJNB 5E5AD 3AZFA 5B33D 4J8XC 5B0ZB 2F8NB 5AV8A 1P3GB 4KHAB 1F66D 4Z66A 4X23B 3WTPA 5F99A 3V9RB 3AZMA 4X23D 2HIOD 5AV8B 5B24A 1P3GA 3B6FD 4XUJA 5CPJD 5B2JA 2NZDD 3REIA 4LD9A 4HGAB 5KDMA 2HUEB 3AV1B 3MGPC 1H3OA 1EQZB 4YS3B 4XZQD 3A6ND 3W96A 5AV9A 3RELD 2JCHA 2Y2KA 3A6NB 4YS3D 3H0LC 2YFVA 3MNND 5B33C 4Z5TA 3W98A 3REKD 1H3OB 2JE5A 1P3FA 3W99B 5F99C 1WWIA 5B2JB 3X1SD 3B0CW 3AFAC 4KUDD 2BG1A 1M18A 3B6FA 3AYWC 1S32B 3EPHA 2Y2IA 4KHAA 3B0DB 3C1BD 4JJND 4WU9B 3KWQA 3REHD 4YM6C 3AZKA 1KX5A 1M19D 2ZM5A 3AL0C 3AZIC 5BO0A 5CPJC 5E5AA 1A7WA 3REKA 1TZYB 3AV1A 4J8VC 5KDMB 5JRGD 3O62C 3AZKB 1KX5B 3X1VD 3MGSA 5AVCB 3B6GD 1B67A 3AZEA 3AZJB 5GT3D 1P3AB 1PZRA 1P34A 4KUDC 3V9RA 4E45A 3AV2D 5CHLB 3KXBD 1P3KC 1WWSA 3MNNC 3AN2B 4J8UC 1P3IC 3LJAA 3WTPD 1Q9CA 1AOIB 3LZ0D 3AZGB 3WKJD 2NZDC 4QLCD 2IO5C 1ZLAA 5B2JD 5CPJA 5CPKB 1N1JA 4H9QB 3C1CA 1TZYA 4WU8A 2YFVB 3O62A 4HGAC 1M1AA 4ZUXB 2FFFB 5B0YD 4J8XA 3WA9B 3NQJA 1F66C 5AV8C 1N1JB 4H9QA 3X1UB 3RELB 1P3PC 3MNNA 4Z66C 5B32D 5DNND 3AZND 3AZLA 5B24B 2LY8A 4CAYB 3X1SB 2XD5A 3MGRB 2W8SA 3UT9D 3B6GC 3AZLB 5GSUD 3X1TD 2Y2GA 3VH6T 3AFAD 4DRAA 3C1CD 3MVDC 3AZEB 5GT3B 3X1SC 3X1VB 5JRGC 3O62D 1U35D 2XD1A 3EG5B 5AVBB 3WAAD 5AV5D 3RELC 1P3FC 1P3PA 4J8WC 3IP4C 3AZGD 4NE5A 1W2EA 2CV5C 1KX3A 1M19C 3H0MC 1M18C 4KGCC 3FDDA 4H9OA 1BH9A 5B2IA 2BYKA 2F8NG 4X23A 3X1TA 3LZ0A 4WV4B 1KX4D 4G92C 1P3ID 5GT0C 1HQ3A 4DQYB 5CPIA 2CWEA 4QLCC 1P3MB 3WAAA 3REKB 3NQUB 4H9PB 2CV5A 1KX3C 3W98D 3TU4A 5AV6B 3AZFD 3KUYA 1P3MD 1P3OA 3KXBC 1M1AD 5AVBD 5B40D 1HTAA 3MGQD 3WAAB 1P3KA 2ZY2A 5BS7C 5B32C 3B6FB 3LJAC 3LJAB 2YFWB 5B31D 5GT0A 2NZDA 1R4VA 2BYKB 5DNMB 5DNMC 3REJC 3W99A 3WAAC 3WTPC 5DNNB 5B24D 3AZNB 3WKJC 2BYMB 3REID 2CV5D 5B2JC 5B32B 2FJ7C 3WA9A 3KUYC 4LD9C 3R45A 3UTAD 1F1EA 5B1LB 1U35C 1P3BD 1ID3C 2ZY4A 2NQBD 1P3MC 5AV5C 3C1CB 5BNXA 5GSUB 2BYMA 4E44A 4LD9B 3A6NC 3EPJA 3AV2A 2FJ7B 3WKJB 3LZ0B 3WTPB 5AY8D 1KX4C 2F8ND 1T3UA 3WKJA 2UWXA 4G92B 2FJ7A 5B0ZA 3B6FC 4UPKA 3WA9D 5B0YB 3REJB 5BT1C 3AZJD 1P3AD 2PYOC 3F6TA 4J8XD 1P3OB 3AZKD 1KX5D 4UUZB 4ZUXA 1P3LC 3EPLA 3X1VA 3AZIA 3NQUA 3VH5A 5E5AC 4G91C 2AROA 5AVBC 5GXQB 3W97C 3MGRC 5B31A 3AZHD 3B0BA 1P3KD 3AZFC 3VH6W 3AZMB 4J8UD 2VQRA 3MVDB 3AZEC 1S32D 1HQ3C 5GXQD 1BH9B 5B1MB 3MGSB 4YM6D 4XZQA 1P3LB 3UTBD 4ZUXC 3TU4C 3TU4B 3VH5T 1P3OC 1M19B 1P3PB 1ZLAC 4WU8B 3REHB 3X1UC 5B1MC 3REJD 3R45B 5B31C 1ZLAB 2J8PA 5B32A 1AOIC 3REIB 3KWQB 5FUGA 3LELC 4XUJB 1P3IB 1KX4B 1F66A 4Z5TC 5DNMA 3A1IA 5GXQC 3W97B 2NZDB 4G91B 4H9RA 3W97D 4LD9D 2F8NA 2HIOA 1P3GD 1U35A 3MNNB 5B0ZD 4J8VD 5E5AB 1Z2CB 1ID3B 3X1UD 5AV6A 3UTAC 1P3BC 3AV1D 1ID3D 3A6NA 5JRGA 4J8VB 2DF4C 2AROD 4ZUXD 5BT1D 1P3PD 5CPJB 3UTBB 5B1MD 1P3FD 4YM6B
chains in the Genus database with same CATH topology
3AZGC 3B0DC 5B2ID 5F99B 3AN2A 4J8UB 4Z2MG 3KWQD 1P3KB 3KSYA 4H9OB 3AZHB 1P3IA 5AV6C 5CP6B 3UTAA 1P3BA 1HQ3D 3KUYB 5G49B 5GSUC 4R8PD 4YS3C 1KU5A 5CP6C 4Z2MH 3MGPB 3AZHC 2HUEC 1TZYC 5AV5B 3MGPD 3VH5W 3MGSD 3REJA 5B1LC 1U35B 3LELD 4KGCD 1P34D 4WU9A 1AOID 4Z5TD 3KXBA 5AY8A 1B6WA 4J8WD 3UTBC 2ZY3A 1M18B 3AYWB 5AVCA 4JJNC 4M6BA 1P3FB 5JA4A 3W99C 3X1UA 4H9SA 3REKC 2Y2QA 4CSRB 3REHA 4J8VA 5BO0B 4J8XB 5B1LA 1KX3D 3LELA 2RVQC 4H9NA 5AV9B 1ID3A 4WNNB 3W96B 5CPKA 5DNNA 3AZLD 3AZNA 4J8WA 4QLCB 4J8UA 2Y2JA 3LZ1B 2Y2LA 5B24C 5GT0B 2Y2OA 4XUJC 3WTPE 3REIC 2FJ7D 5B2IC 5BNVB 5B31B 4EO5B 4J8WB 1F66B 1ULYA 3LJAD 3REHC 3AZJA 4WU8C 1P3AA 4WNNA 1M1AC 3LZ1C 4KGCB 5B1LD 5JRGB 2NQBB 5BNXB 2CV5B 1TZYD 5CPKC 4NFTA 3EPKA 2PYOA 4ZBJB 5G49A 3AZLC 5B0YA 1HQ3B 3AZGA 3VH6A 3X1VC 3AN2C 3AYWA 2F8NK 1P3LD 4H9RB 2G5IC 5BS7A 3W97A 4Z66B 3X1SA 5AVCD 3MVDA 3AZJC 4AWLB 1P34B 4CAYA 5C3IC 2Y2PA 4Z66D 1P3AC 4YM6A 3AZKC 1KX5C 1JFIB 3AZMD 5GSUA 3C1BC 1BH8A 3W98B 2PYOB 5CPID 1TAFB 3AZIB 2PYOD 5B0YC 2IO5B 1M19A 3WA9C 2Y2HA 5B40A 3MGQA 4WU9C 4CSRA 5AY8C 4XZQB 1EQZD 5GT3A 1P3OD 5B1MA 1P3MA 3X1TC 3LZ0C 4KUDB 3MVDD 3AZED 3AFAB 3A1KA 3AV2C 5AVCC 1BFMA 3W99D 3KFUG 3X1TB 3P5JB 4WJ3C 3UT9C 3MGRD 4QLCA 5GT0D 3UT9B 3C1CC 4H9SC 2AROB 5B32G 5AY8B 1KX4A 3B6GB 3LZ1D 1ZLAD 2HIOC 3O62B 4UUZA 2F2AC 3MGPA 5DNNC 3AZNC 1EQZA 4WU8D 2NQBA 3H0RC 3TU4D 2HIOB 5AV8D 3UTAB 1P3BB 1P3LA 5C3IB 2Y2NA 5B33A 4NE6A 3W98C 4WZSB 3B6GA 3UT9A 5BNVA 2AROC 3AYWD 3MGRA 2DQNC 4XUJD 2ZY5A 5B31G 1S32C 3AFAA 5B33B 3KXBB 3AN2D 3LZ1A 3AV2B 2RIQA 1KX3B 5AV9D 3RELA 3W96D 5AV5A 4Z5TB 1EQZC 2NQBC 5B40B 3LELB 4XZQC 3MGQB 4NE3A 3KWQC 2L5AA 1M1AB 2Y2MA 4R8PA 5CPKD 4KGCA 4H9PA 1TAFA 4YS3A 3B0CT 5CP6A 3AZHA 5JA4B 3AZID 5CPIB 4X23C 5DNMD 3AV1C 1M18D 3C1BB 1S32A 4WU9D 1AOIA 3MGSC 2YFWA 5B0ZC 4AWLC 5CPIC 4EO5C 1P34C 3C1BA 4KUDA 5F99D 5B2IB 5GXQA 3UTBA 4DRBA 3AZMC 2JSSA 5FUGB 1P3GC 5AV6D 3NQJB 4H9NB 3AZFB 1JFIA 4R8PB 4R8PC 4JJNA 3MGQC 5B40C 2F8NH 3KUYD 5GT3C 2RVQD 4ZBJC 5CP6D 5AVBA 1BH8B 5AV9C 2G5HC 3W96C 4JJNB 5E5AD 3AZFA 5B33D 4J8XC 5B0ZB 2F8NB 5AV8A 1P3GB 4KHAB 1F66D 4Z66A 4X23B 3WTPA 5F99A 3V9RB 3AZMA 4X23D 2HIOD 5AV8B 5B24A 1P3GA 3B6FD 4XUJA 5CPJD 5B2JA 2NZDD 3REIA 4LD9A 4HGAB 5KDMA 2HUEB 3AV1B 3MGPC 1H3OA 1EQZB 4YS3B 4XZQD 3A6ND 3W96A 5AV9A 3RELD 2JCHA 2Y2KA 3A6NB 4YS3D 3H0LC 2YFVA 3MNND 5B33C 4Z5TA 3W98A 3REKD 1H3OB 2JE5A 1P3FA 3W99B 5F99C 1WWIA 5B2JB 3X1SD 3B0CW 3AFAC 4KUDD 2BG1A 1M18A 3B6FA 3AYWC 1S32B 3EPHA 2Y2IA 4KHAA 3B0DB 3C1BD 4JJND 4WU9B 3KWQA 3REHD 4YM6C 3AZKA 1KX5A 1M19D 2ZM5A 3AL0C 3AZIC 5BO0A 5CPJC 5E5AA 1A7WA 3REKA 1TZYB 3AV1A 4J8VC 5KDMB 5JRGD 3O62C 3AZKB 1KX5B 3X1VD 3MGSA 5AVCB 3B6GD 1B67A 3AZEA 3AZJB 5GT3D 1P3AB 1PZRA 1P34A 4KUDC 3V9RA 4E45A 3AV2D 5CHLB 3KXBD 1P3KC 1WWSA 3MNNC 3AN2B 4J8UC 1P3IC 3LJAA 3WTPD 1Q9CA 1AOIB 3LZ0D 3AZGB 3WKJD 2NZDC 4QLCD 2IO5C 1ZLAA 5B2JD 5CPJA 5CPKB 1N1JA 4H9QB 3C1CA 1TZYA 4WU8A 2YFVB 3O62A 4HGAC 1M1AA 4ZUXB 2FFFB 5B0YD 4J8XA 3WA9B 3NQJA 1F66C 5AV8C 1N1JB 4H9QA 3X1UB 3RELB 1P3PC 3MNNA 4Z66C 5B32D 5DNND 3AZND 3AZLA 5B24B 2LY8A 4CAYB 3X1SB 2XD5A 3MGRB 2W8SA 3UT9D 3B6GC 3AZLB 5GSUD 3X1TD 2Y2GA 3VH6T 3AFAD 4DRAA 3C1CD 3MVDC 3AZEB 5GT3B 3X1SC 3X1VB 5JRGC 3O62D 1U35D 2XD1A 3EG5B 5AVBB 3WAAD 5AV5D 3RELC 1P3FC 1P3PA 4J8WC 3IP4C 3AZGD 4NE5A 1W2EA 2CV5C 1KX3A 1M19C 3H0MC 1M18C 4KGCC 3FDDA 4H9OA 1BH9A 5B2IA 2BYKA 2F8NG 4X23A 3X1TA 3LZ0A 4WV4B 1KX4D 4G92C 1P3ID 5GT0C 1HQ3A 4DQYB 5CPIA 2CWEA 4QLCC 1P3MB 3WAAA 3REKB 3NQUB 4H9PB 2CV5A 1KX3C 3W98D 3TU4A 5AV6B 3AZFD 3KUYA 1P3MD 1P3OA 3KXBC 1M1AD 5AVBD 5B40D 1HTAA 3MGQD 3WAAB 1P3KA 2ZY2A 5BS7C 5B32C 3B6FB 3LJAC 3LJAB 2YFWB 5B31D 5GT0A 2NZDA 1R4VA 2BYKB 5DNMB 5DNMC 3REJC 3W99A 3WAAC 3WTPC 5DNNB 5B24D 3AZNB 3WKJC 2BYMB 3REID 2CV5D 5B2JC 5B32B 2FJ7C 3WA9A 3KUYC 4LD9C 3R45A 3UTAD 1F1EA 5B1LB 1U35C 1P3BD 1ID3C 2ZY4A 2NQBD 1P3MC 5AV5C 3C1CB 5BNXA 5GSUB 2BYMA 4E44A 4LD9B 3A6NC 3EPJA 3AV2A 2FJ7B 3WKJB 3LZ0B 3WTPB 5AY8D 1KX4C 2F8ND 1T3UA 3WKJA 2UWXA 4G92B 2FJ7A 5B0ZA 3B6FC 4UPKA 3WA9D 5B0YB 3REJB 5BT1C 3AZJD 1P3AD 2PYOC 3F6TA 4J8XD 1P3OB 3AZKD 1KX5D 4UUZB 4ZUXA 1P3LC 3EPLA 3X1VA 3AZIA 3NQUA 3VH5A 5E5AC 4G91C 2AROA 5AVBC 5GXQB 3W97C 3MGRC 5B31A 3AZHD 3B0BA 1P3KD 3AZFC 3VH6W 3AZMB 4J8UD 2VQRA 3MVDB 3AZEC 1S32D 1HQ3C 5GXQD 1BH9B 5B1MB 3MGSB 4YM6D 4XZQA 1P3LB 3UTBD 4ZUXC 3TU4C 3TU4B 3VH5T 1P3OC 1M19B 1P3PB 1ZLAC 4WU8B 3REHB 3X1UC 5B1MC 3REJD 3R45B 5B31C 1ZLAB 2J8PA 5B32A 1AOIC 3REIB 3KWQB 5FUGA 3LELC 4XUJB 1P3IB 1KX4B 1F66A 4Z5TC 5DNMA 3A1IA 5GXQC 3W97B 2NZDB 4G91B 4H9RA 3W97D 4LD9D 2F8NA 2HIOA 1P3GD 1U35A 3MNNB 5B0ZD 4J8VD 5E5AB 1Z2CB 1ID3B 3X1UD 5AV6A 3UTAC 1P3BC 3AV1D 1ID3D 3A6NA 5JRGA 4J8VB 2DF4C 2AROD 4ZUXD 5BT1D 1P3PD 5CPJB 3UTBB 5B1MD 1P3FD 4YM6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZG C;  3B0D C;  5B2I D;  5F99 B;  3AN2 A;  4J8U B;  4Z2M G;  3KWQ D;  1P3K B;  3KSY A;  4H9O B;  3AZH B;  1P3I A;  5AV6 C;  5CP6 B;  3UTA A;  1P3B A;  1HQ3 D;  3KUY B;  5G49 B;  5GSU C;  4R8P D;  4YS3 C;  1KU5 A;  5CP6 C;  4Z2M H;  3MGP B;  3AZH C;  2HUE C;  1TZY C;  5AV5 B;  3MGP D;  3VH5 W;  3MGS D;  3REJ A;  5B1L C;  1U35 B;  3LEL D;  4KGC D;  1P34 D;  4WU9 A;  1AOI D;  4Z5T D;  3KXB A;  5AY8 A;  1B6W A;  4J8W D;  3UTB C;  1M18 B;  3AYW B;  5AVC A;  4JJN C;  4M6B A;  1P3F B;  5JA4 A;  3W99 C;  3X1U A;  4H9S A;  3REK C;  4CSR B;  3REH A;  4J8V A;  5BO0 B;  4J8X B;  5B1L A;  1KX3 D;  3LEL A;  2RVQ C;  4H9N A;  5AV9 B;  1ID3 A;  4WNN B;  3W96 B;  5CPK A;  5DNN A;  3AZL D;  3AZN A;  4J8W A;  4QLC B;  4J8U A;  3LZ1 B;  5B24 C;  5GT0 B;  4XUJ C;  3WTP E;  3REI C;  2FJ7 D;  5B2I C;  5BNV B;  5B31 B;  4EO5 B;  4J8W B;  1F66 B;  1ULY A;  3LJA D;  3REH C;  3AZJ A;  4WU8 C;  1P3A A;  4WNN A;  1M1A C;  3LZ1 C;  4KGC B;  5B1L D;  5JRG B;  2NQB B;  5BNX B;  2CV5 B;  1TZY D;  5CPK C;  4NFT A;  2PYO A;  4ZBJ B;  5G49 A;  3AZL C;  5B0Y A;  1HQ3 B;  3AZG A;  3VH6 A;  3X1V C;  3AN2 C;  3AYW A;  2F8N K;  1P3L D;  4H9R B;  5BS7 A;  3W97 A;  4Z66 B;  3X1S A;  5AVC D;  3MVD A;  3AZJ C;  4AWL B;  1P34 B;  4CAY A;  5C3I C;  4Z66 D;  1P3A C;  3B6G B;  4YM6 A;  3AZK C;  1KX5 C;  1JFI B;  3AZM D;  5GSU A;  3C1B C;  1BH8 A;  3W98 B;  2PYO B;  5CPI D;  1TAF B;  3AZI B;  2PYO D;  5B0Y C;  2IO5 B;  1M19 A;  3WA9 C;  4WU9 C;  5B40 A;  3MGQ A;  4CSR A;  5AY8 C;  4XZQ B;  1EQZ D;  5GT3 A;  1P3O D;  5B1M A;  1P3M A;  3X1T C;  3LZ0 C;  4KUD B;  3MVD D;  3AZE D;  3AFA B;  3AV2 C;  5AVC C;  1BFM A;  3W99 D;  3X1T B;  3UT9 C;  3MGR D;  4QLC A;  5GT0 D;  3UT9 B;  3C1C C;  4H9S C;  2ARO B;  5B32 G;  5AY8 B;  1KX4 A;  3LZ1 D;  1ZLA D;  2HIO C;  3O62 B;  4UUZ A;  3MGP A;  5DNN C;  3AZN C;  1EQZ A;  4WU8 D;  2NQB A;  3TU4 D;  2HIO B;  5AV8 D;  3UTA B;  1P3B B;  1P3L A;  5C3I B;  5B33 A;  4NE6 A;  3W98 C;  4WZS B;  3B6G A;  3UT9 A;  5BNV A;  2ARO C;  3AYW D;  3MGR A;  4XUJ D;  5B31 G;  1S32 C;  3AFA A;  5B33 B;  3KXB B;  3AN2 D;  3LZ1 A;  3AV2 B;  1KX3 B;  5AV9 D;  3REL A;  3W96 D;  5AV5 A;  4Z5T B;  1EQZ C;  2NQB C;  5B40 B;  3LEL B;  4XZQ C;  3MGQ B;  4NE3 A;  3KWQ C;  2L5A A;  1M1A B;  4R8P A;  5CPK D;  4KGC A;  4H9P A;  1TAF A;  4YS3 A;  3B0C T;  5CP6 A;  3AZH A;  5JA4 B;  3AZI D;  5CPI B;  4X23 C;  5DNM D;  3AV1 C;  1M18 D;  3C1B B;  1S32 A;  4WU9 D;  1AOI A;  3MGS C;  2YFW A;  5B0Z C;  4AWL C;  5CPI C;  4EO5 C;  1P34 C;  3C1B A;  4KUD A;  5F99 D;  5B2I B;  5GXQ A;  3UTB A;  4DRB A;  3AZM C;  2JSS A;  5FUG B;  1P3G C;  5AV6 D;  3NQJ B;  4H9N B;  3AZF B;  1JFI A;  4R8P B;  4R8P C;  4JJN A;  3MGQ C;  5B40 C;  2F8N H;  3KUY D;  5GT3 C;  2RVQ D;  4ZBJ C;  5CP6 D;  5AVB A;  1BH8 B;  3W96 C;  5AV9 C;  4JJN B;  5E5A D;  3AZF A;  5B33 D;  4J8X C;  5B0Z B;  2F8N B;  5AV8 A;  1P3G B;  4KHA B;  1F66 D;  4Z66 A;  4X23 B;  3WTP A;  5F99 A;  3V9R B;  3AZM A;  4X23 D;  2HIO D;  5AV8 B;  5B24 A;  1P3G A;  3B6F D;  4XUJ A;  5CPJ D;  5B2J A;  2NZD D;  3REI A;  4LD9 A;  4HGA B;  5KDM A;  2HUE B;  3AV1 B;  3MGP C;  1H3O A;  1EQZ B;  4YS3 B;  4XZQ D;  3A6N D;  3W96 A;  5AV9 A;  3REL D;  3A6N B;  4YS3 D;  2YFV A;  3MNN D;  5B33 C;  4Z5T A;  3W98 A;  3REK D;  1H3O B;  1P3F A;  3W99 B;  5F99 C;  1WWI A;  5B2J B;  3X1S D;  3B0C W;  3AFA C;  4KUD D;  1M18 A;  3B6F A;  3AYW C;  1S32 B;  4KHA A;  3B0D B;  3C1B D;  4JJN D;  4WU9 B;  3KWQ A;  3REH D;  4YM6 C;  3AZK A;  1KX5 A;  1M19 D;  3AZI C;  5BO0 A;  5CPJ C;  5E5A A;  1A7W A;  3REK A;  1TZY B;  3AV1 A;  4J8V C;  5KDM B;  5JRG D;  3O62 C;  3AZK B;  1KX5 B;  3X1V D;  3MGS A;  5AVC B;  3B6G D;  1B67 A;  3AZE A;  3AZJ B;  5GT3 D;  1P3A B;  1P34 A;  4KUD C;  3V9R A;  4E45 A;  3AV2 D;  5CHL B;  3KXB D;  1P3K C;  1WWS A;  3MNN C;  3AN2 B;  4J8U C;  1P3I C;  3LJA A;  3WTP D;  1Q9C A;  1AOI B;  3LZ0 D;  3AZG B;  3WKJ D;  2NZD C;  4QLC D;  2IO5 C;  1ZLA A;  5B2J D;  5CPJ A;  5CPK B;  1N1J A;  4H9Q B;  3C1C A;  1TZY A;  4WU8 A;  2YFV B;  3O62 A;  4HGA C;  1M1A A;  4ZUX B;  5B0Y D;  4J8X A;  3WA9 B;  3NQJ A;  1F66 C;  5AV8 C;  1N1J B;  4H9Q A;  3X1U B;  3REL B;  1P3P C;  3MNN A;  4Z66 C;  5B32 D;  5DNN D;  3AZN D;  3AZL A;  5B24 B;  2LY8 A;  4CAY B;  3X1S B;  3MGR B;  3UT9 D;  3B6G C;  3AZL B;  5GSU D;  3X1T D;  3VH6 T;  3AFA D;  4DRA A;  3C1C D;  3MVD C;  3AZE B;  5GT3 B;  3X1S C;  3X1V B;  5JRG C;  3O62 D;  1U35 D;  5AVB B;  3WAA D;  5AV5 D;  3REL C;  1P3F C;  1P3P A;  4J8W C;  3AZG D;  4NE5 A;  2CV5 C;  1KX3 A;  1M19 C;  1M18 C;  4KGC C;  4H9O A;  1BH9 A;  5B2I A;  2BYK A;  2F8N G;  4X23 A;  3X1T A;  3LZ0 A;  4WV4 B;  1KX4 D;  4G92 C;  1P3I D;  5GT0 C;  1HQ3 A;  5CPI A;  2CWE A;  4QLC C;  1P3M B;  3WAA A;  3REK B;  3NQU B;  4H9P B;  2CV5 A;  1KX3 C;  3W98 D;  3TU4 A;  5AV6 B;  3AZF D;  3KUY A;  1P3M D;  1P3O A;  3KXB C;  1M1A D;  5AVB D;  5B40 D;  1HTA A;  3MGQ D;  3WAA B;  1P3K A;  5BS7 C;  5B32 C;  3B6F B;  3LJA C;  3LJA B;  2YFW B;  5B31 D;  5GT0 A;  2NZD A;  1R4V A;  2BYK B;  5DNM B;  5DNM C;  3REJ C;  3W99 A;  3WAA C;  3WTP C;  5DNN B;  5B24 D;  3AZN B;  3WKJ C;  2BYM B;  3REI D;  2CV5 D;  5B2J C;  5B32 B;  2FJ7 C;  3WA9 A;  3KUY C;  4LD9 C;  3R45 A;  3UTA D;  1F1E A;  5B1L B;  1U35 C;  1P3B D;  1ID3 C;  2NQB D;  1P3M C;  5AV5 C;  3C1C B;  5BNX A;  5GSU B;  2BYM A;  4E44 A;  4LD9 B;  3A6N C;  3AV2 A;  2FJ7 B;  3WKJ B;  3LZ0 B;  3WTP B;  5AY8 D;  1KX4 C;  2F8N D;  3WKJ A;  4G92 B;  2FJ7 A;  5B0Z A;  3B6F C;  3WA9 D;  5B0Y B;  3REJ B;  5BT1 C;  3AZJ D;  1P3A D;  2PYO C;  4J8X D;  1P3O B;  3AZK D;  1KX5 D;  4UUZ B;  4ZUX A;  1P3L C;  3X1V A;  3AZI A;  3NQU A;  3VH5 A;  5E5A C;  4G91 C;  2ARO A;  5AVB C;  5GXQ B;  3W97 C;  3MGR C;  5B31 A;  3AZH D;  3B0B A;  1P3K D;  3AZF C;  3VH6 W;  3AZM B;  4J8U D;  3MVD B;  3AZE C;  1S32 D;  1HQ3 C;  5GXQ D;  1BH9 B;  5B1M B;  3MGS B;  4YM6 D;  4XZQ A;  1P3L B;  3UTB D;  4ZUX C;  3TU4 C;  3TU4 B;  3VH5 T;  1P3O C;  1M19 B;  1P3P B;  1ZLA C;  4WU8 B;  3REH B;  3X1U C;  5B1M C;  3REJ D;  3R45 B;  5B31 C;  1ZLA B;  5B32 A;  1AOI C;  3REI B;  3KWQ B;  5FUG A;  3LEL C;  4XUJ B;  1P3I B;  1KX4 B;  1F66 A;  4Z5T C;  5DNM A;  5GXQ C;  3W97 B;  2NZD B;  4G91 B;  4H9R A;  3W97 D;  4LD9 D;  2F8N A;  2HIO A;  1P3G D;  1U35 A;  3MNN B;  5B0Z D;  4J8V D;  5E5A B;  1ID3 B;  3X1U D;  5AV6 A;  3UTA C;  1P3B C;  3AV1 D;  1ID3 D;  3A6N A;  5JRG A;  4J8V B;  2ARO D;  4ZUX D;  5BT1 D;  1P3P D;  5CPJ B;  3UTB B;  5B1M D;  1P3F D;  4YM6 B; 
#chains in the Genus database with same CATH topology
 3AZG C;  3B0D C;  5B2I D;  5F99 B;  3AN2 A;  4J8U B;  4Z2M G;  3KWQ D;  1P3K B;  3KSY A;  4H9O B;  3AZH B;  1P3I A;  5AV6 C;  5CP6 B;  3UTA A;  1P3B A;  1HQ3 D;  3KUY B;  5G49 B;  5GSU C;  4R8P D;  4YS3 C;  1KU5 A;  5CP6 C;  4Z2M H;  3MGP B;  3AZH C;  2HUE C;  1TZY C;  5AV5 B;  3MGP D;  3VH5 W;  3MGS D;  3REJ A;  5B1L C;  1U35 B;  3LEL D;  4KGC D;  1P34 D;  4WU9 A;  1AOI D;  4Z5T D;  3KXB A;  5AY8 A;  1B6W A;  4J8W D;  3UTB C;  2ZY3 A;  1M18 B;  3AYW B;  5AVC A;  4JJN C;  4M6B A;  1P3F B;  5JA4 A;  3W99 C;  3X1U A;  4H9S A;  3REK C;  2Y2Q A;  4CSR B;  3REH A;  4J8V A;  5BO0 B;  4J8X B;  5B1L A;  1KX3 D;  3LEL A;  2RVQ C;  4H9N A;  5AV9 B;  1ID3 A;  4WNN B;  3W96 B;  5CPK A;  5DNN A;  3AZL D;  3AZN A;  4J8W A;  4QLC B;  4J8U A;  2Y2J A;  3LZ1 B;  2Y2L A;  5B24 C;  5GT0 B;  2Y2O A;  4XUJ C;  3WTP E;  3REI C;  2FJ7 D;  5B2I C;  5BNV B;  5B31 B;  4EO5 B;  4J8W B;  1F66 B;  1ULY A;  3LJA D;  3REH C;  3AZJ A;  4WU8 C;  1P3A A;  4WNN A;  1M1A C;  3LZ1 C;  4KGC B;  5B1L D;  5JRG B;  2NQB B;  5BNX B;  2CV5 B;  1TZY D;  5CPK C;  4NFT A;  3EPK A;  2PYO A;  4ZBJ B;  5G49 A;  3AZL C;  5B0Y A;  1HQ3 B;  3AZG A;  3VH6 A;  3X1V C;  3AN2 C;  3AYW A;  2F8N K;  1P3L D;  4H9R B;  2G5I C;  5BS7 A;  3W97 A;  4Z66 B;  3X1S A;  5AVC D;  3MVD A;  3AZJ C;  4AWL B;  1P34 B;  4CAY A;  5C3I C;  2Y2P A;  4Z66 D;  1P3A C;  4YM6 A;  3AZK C;  1KX5 C;  1JFI B;  3AZM D;  5GSU A;  3C1B C;  1BH8 A;  3W98 B;  2PYO B;  5CPI D;  1TAF B;  3AZI B;  2PYO D;  5B0Y C;  2IO5 B;  1M19 A;  3WA9 C;  2Y2H A;  5B40 A;  3MGQ A;  4WU9 C;  4CSR A;  5AY8 C;  4XZQ B;  1EQZ D;  5GT3 A;  1P3O D;  5B1M A;  1P3M A;  3X1T C;  3LZ0 C;  4KUD B;  3MVD D;  3AZE D;  3AFA B;  3A1K A;  3AV2 C;  5AVC C;  1BFM A;  3W99 D;  3KFU G;  3X1T B;  3P5J B;  4WJ3 C;  3UT9 C;  3MGR D;  4QLC A;  5GT0 D;  3UT9 B;  3C1C C;  4H9S C;  2ARO B;  5B32 G;  5AY8 B;  1KX4 A;  3B6G B;  3LZ1 D;  1ZLA D;  2HIO C;  3O62 B;  4UUZ A;  2F2A C;  3MGP A;  5DNN C;  3AZN C;  1EQZ A;  4WU8 D;  2NQB A;  3H0R C;  3TU4 D;  2HIO B;  5AV8 D;  3UTA B;  1P3B B;  1P3L A;  5C3I B;  2Y2N A;  5B33 A;  4NE6 A;  3W98 C;  4WZS B;  3B6G A;  3UT9 A;  5BNV A;  2ARO C;  3AYW D;  3MGR A;  2DQN C;  4XUJ D;  2ZY5 A;  5B31 G;  1S32 C;  3AFA A;  5B33 B;  3KXB B;  3AN2 D;  3LZ1 A;  3AV2 B;  2RIQ A;  1KX3 B;  5AV9 D;  3REL A;  3W96 D;  5AV5 A;  4Z5T B;  1EQZ C;  2NQB C;  5B40 B;  3LEL B;  4XZQ C;  3MGQ B;  4NE3 A;  3KWQ C;  2L5A A;  1M1A B;  2Y2M A;  4R8P A;  5CPK D;  4KGC A;  4H9P A;  1TAF A;  4YS3 A;  3B0C T;  5CP6 A;  3AZH A;  5JA4 B;  3AZI D;  5CPI B;  4X23 C;  5DNM D;  3AV1 C;  1M18 D;  3C1B B;  1S32 A;  4WU9 D;  1AOI A;  3MGS C;  2YFW A;  5B0Z C;  4AWL C;  5CPI C;  4EO5 C;  1P34 C;  3C1B A;  4KUD A;  5F99 D;  5B2I B;  5GXQ A;  3UTB A;  4DRB A;  3AZM C;  2JSS A;  5FUG B;  1P3G C;  5AV6 D;  3NQJ B;  4H9N B;  3AZF B;  1JFI A;  4R8P B;  4R8P C;  4JJN A;  3MGQ C;  5B40 C;  2F8N H;  3KUY D;  5GT3 C;  2RVQ D;  4ZBJ C;  5CP6 D;  5AVB A;  1BH8 B;  5AV9 C;  2G5H C;  3W96 C;  4JJN B;  5E5A D;  3AZF A;  5B33 D;  4J8X C;  5B0Z B;  2F8N B;  5AV8 A;  1P3G B;  4KHA B;  1F66 D;  4Z66 A;  4X23 B;  3WTP A;  5F99 A;  3V9R B;  3AZM A;  4X23 D;  2HIO D;  5AV8 B;  5B24 A;  1P3G A;  3B6F D;  4XUJ A;  5CPJ D;  5B2J A;  2NZD D;  3REI A;  4LD9 A;  4HGA B;  5KDM A;  2HUE B;  3AV1 B;  3MGP C;  1H3O A;  1EQZ B;  4YS3 B;  4XZQ D;  3A6N D;  3W96 A;  5AV9 A;  3REL D;  2JCH A;  2Y2K A;  3A6N B;  4YS3 D;  3H0L C;  2YFV A;  3MNN D;  5B33 C;  4Z5T A;  3W98 A;  3REK D;  1H3O B;  2JE5 A;  1P3F A;  3W99 B;  5F99 C;  1WWI A;  5B2J B;  3X1S D;  3B0C W;  3AFA C;  4KUD D;  2BG1 A;  1M18 A;  3B6F A;  3AYW C;  1S32 B;  3EPH A;  2Y2I A;  4KHA A;  3B0D B;  3C1B D;  4JJN D;  4WU9 B;  3KWQ A;  3REH D;  4YM6 C;  3AZK A;  1KX5 A;  1M19 D;  2ZM5 A;  3AL0 C;  3AZI C;  5BO0 A;  5CPJ C;  5E5A A;  1A7W A;  3REK A;  1TZY B;  3AV1 A;  4J8V C;  5KDM B;  5JRG D;  3O62 C;  3AZK B;  1KX5 B;  3X1V D;  3MGS A;  5AVC B;  3B6G D;  1B67 A;  3AZE A;  3AZJ B;  5GT3 D;  1P3A B;  1PZR A;  1P34 A;  4KUD C;  3V9R A;  4E45 A;  3AV2 D;  5CHL B;  3KXB D;  1P3K C;  1WWS A;  3MNN C;  3AN2 B;  4J8U C;  1P3I C;  3LJA A;  3WTP D;  1Q9C A;  1AOI B;  3LZ0 D;  3AZG B;  3WKJ D;  2NZD C;  4QLC D;  2IO5 C;  1ZLA A;  5B2J D;  5CPJ A;  5CPK B;  1N1J A;  4H9Q B;  3C1C A;  1TZY A;  4WU8 A;  2YFV B;  3O62 A;  4HGA C;  1M1A A;  4ZUX B;  2FFF B;  5B0Y D;  4J8X A;  3WA9 B;  3NQJ A;  1F66 C;  5AV8 C;  1N1J B;  4H9Q A;  3X1U B;  3REL B;  1P3P C;  3MNN A;  4Z66 C;  5B32 D;  5DNN D;  3AZN D;  3AZL A;  5B24 B;  2LY8 A;  4CAY B;  3X1S B;  2XD5 A;  3MGR B;  2W8S A;  3UT9 D;  3B6G C;  3AZL B;  5GSU D;  3X1T D;  2Y2G A;  3VH6 T;  3AFA D;  4DRA A;  3C1C D;  3MVD C;  3AZE B;  5GT3 B;  3X1S C;  3X1V B;  5JRG C;  3O62 D;  1U35 D;  2XD1 A;  3EG5 B;  5AVB B;  3WAA D;  5AV5 D;  3REL C;  1P3F C;  1P3P A;  4J8W C;  3IP4 C;  3AZG D;  4NE5 A;  1W2E A;  2CV5 C;  1KX3 A;  1M19 C;  3H0M C;  1M18 C;  4KGC C;  3FDD A;  4H9O A;  1BH9 A;  5B2I A;  2BYK A;  2F8N G;  4X23 A;  3X1T A;  3LZ0 A;  4WV4 B;  1KX4 D;  4G92 C;  1P3I D;  5GT0 C;  1HQ3 A;  4DQY B;  5CPI A;  2CWE A;  4QLC C;  1P3M B;  3WAA A;  3REK B;  3NQU B;  4H9P B;  2CV5 A;  1KX3 C;  3W98 D;  3TU4 A;  5AV6 B;  3AZF D;  3KUY A;  1P3M D;  1P3O A;  3KXB C;  1M1A D;  5AVB D;  5B40 D;  1HTA A;  3MGQ D;  3WAA B;  1P3K A;  2ZY2 A;  5BS7 C;  5B32 C;  3B6F B;  3LJA C;  3LJA B;  2YFW B;  5B31 D;  5GT0 A;  2NZD A;  1R4V A;  2BYK B;  5DNM B;  5DNM C;  3REJ C;  3W99 A;  3WAA C;  3WTP C;  5DNN B;  5B24 D;  3AZN B;  3WKJ C;  2BYM B;  3REI D;  2CV5 D;  5B2J C;  5B32 B;  2FJ7 C;  3WA9 A;  3KUY C;  4LD9 C;  3R45 A;  3UTA D;  1F1E A;  5B1L B;  1U35 C;  1P3B D;  1ID3 C;  2ZY4 A;  2NQB D;  1P3M C;  5AV5 C;  3C1C B;  5BNX A;  5GSU B;  2BYM A;  4E44 A;  4LD9 B;  3A6N C;  3EPJ A;  3AV2 A;  2FJ7 B;  3WKJ B;  3LZ0 B;  3WTP B;  5AY8 D;  1KX4 C;  2F8N D;  1T3U A;  3WKJ A;  2UWX A;  4G92 B;  2FJ7 A;  5B0Z A;  3B6F C;  4UPK A;  3WA9 D;  5B0Y B;  3REJ B;  5BT1 C;  3AZJ D;  1P3A D;  2PYO C;  3F6T A;  4J8X D;  1P3O B;  3AZK D;  1KX5 D;  4UUZ B;  4ZUX A;  1P3L C;  3EPL A;  3X1V A;  3AZI A;  3NQU A;  3VH5 A;  5E5A C;  4G91 C;  2ARO A;  5AVB C;  5GXQ B;  3W97 C;  3MGR C;  5B31 A;  3AZH D;  3B0B A;  1P3K D;  3AZF C;  3VH6 W;  3AZM B;  4J8U D;  2VQR A;  3MVD B;  3AZE C;  1S32 D;  1HQ3 C;  5GXQ D;  1BH9 B;  5B1M B;  3MGS B;  4YM6 D;  4XZQ A;  1P3L B;  3UTB D;  4ZUX C;  3TU4 C;  3TU4 B;  3VH5 T;  1P3O C;  1M19 B;  1P3P B;  1ZLA C;  4WU8 B;  3REH B;  3X1U C;  5B1M C;  3REJ D;  3R45 B;  5B31 C;  1ZLA B;  2J8P A;  5B32 A;  1AOI C;  3REI B;  3KWQ B;  5FUG A;  3LEL C;  4XUJ B;  1P3I B;  1KX4 B;  1F66 A;  4Z5T C;  5DNM A;  3A1I A;  5GXQ C;  3W97 B;  2NZD B;  4G91 B;  4H9R A;  3W97 D;  4LD9 D;  2F8N A;  2HIO A;  1P3G D;  1U35 A;  3MNN B;  5B0Z D;  4J8V D;  5E5A B;  1Z2C B;  1ID3 B;  3X1U D;  5AV6 A;  3UTA C;  1P3B C;  3AV1 D;  1ID3 D;  3A6N A;  5JRG A;  4J8V B;  2DF4 C;  2ARO D;  4ZUX D;  5BT1 D;  1P3P D;  5CPJ B;  3UTB B;  5B1M D;  1P3F D;  4YM6 B; 
#chains in the Genus database with same CATH homology
 3AZG C;  3B0D C;  5B2I D;  5F99 B;  3AN2 A;  4J8U B;  4Z2M G;  3KWQ D;  1P3K B;  3KSY A;  4H9O B;  3AZH B;  1P3I A;  5AV6 C;  5CP6 B;  3UTA A;  1P3B A;  1HQ3 D;  3KUY B;  5G49 B;  5GSU C;  4R8P D;  4YS3 C;  1KU5 A;  5CP6 C;  4Z2M H;  3MGP B;  3AZH C;  2HUE C;  1TZY C;  5AV5 B;  3MGP D;  3VH5 W;  3MGS D;  3REJ A;  5B1L C;  1U35 B;  3LEL D;  4KGC D;  1P34 D;  4WU9 A;  1AOI D;  4Z5T D;  3KXB A;  5AY8 A;  1B6W A;  4J8W D;  3UTB C;  2ZY3 A;  1M18 B;  3AYW B;  5AVC A;  4JJN C;  4M6B A;  1P3F B;  5JA4 A;  3W99 C;  3X1U A;  4H9S A;  3REK C;  2Y2Q A;  4CSR B;  3REH A;  4J8V A;  5BO0 B;  4J8X B;  5B1L A;  1KX3 D;  3LEL A;  2RVQ C;  4H9N A;  5AV9 B;  1ID3 A;  4WNN B;  3W96 B;  5CPK A;  5DNN A;  3AZL D;  3AZN A;  4J8W A;  4QLC B;  4J8U A;  2Y2J A;  3LZ1 B;  2Y2L A;  5B24 C;  5GT0 B;  2Y2O A;  4XUJ C;  3WTP E;  3REI C;  2FJ7 D;  5B2I C;  5BNV B;  5B31 B;  4EO5 B;  4J8W B;  1F66 B;  1ULY A;  3LJA D;  3REH C;  3AZJ A;  4WU8 C;  1P3A A;  4WNN A;  1M1A C;  3LZ1 C;  4KGC B;  5B1L D;  5JRG B;  2NQB B;  5BNX B;  2CV5 B;  1TZY D;  5CPK C;  4NFT A;  3EPK A;  2PYO A;  4ZBJ B;  5G49 A;  3AZL C;  5B0Y A;  1HQ3 B;  3AZG A;  3VH6 A;  3X1V C;  3AN2 C;  3AYW A;  2F8N K;  1P3L D;  4H9R B;  2G5I C;  5BS7 A;  3W97 A;  4Z66 B;  3X1S A;  5AVC D;  3MVD A;  3AZJ C;  4AWL B;  1P34 B;  4CAY A;  5C3I C;  2Y2P A;  4Z66 D;  1P3A C;  4YM6 A;  3AZK C;  1KX5 C;  1JFI B;  3AZM D;  5GSU A;  3C1B C;  1BH8 A;  3W98 B;  2PYO B;  5CPI D;  1TAF B;  3AZI B;  2PYO D;  5B0Y C;  2IO5 B;  1M19 A;  3WA9 C;  2Y2H A;  5B40 A;  3MGQ A;  4WU9 C;  4CSR A;  5AY8 C;  4XZQ B;  1EQZ D;  5GT3 A;  1P3O D;  5B1M A;  1P3M A;  3X1T C;  3LZ0 C;  4KUD B;  3MVD D;  3AZE D;  3AFA B;  3A1K A;  3AV2 C;  5AVC C;  1BFM A;  3W99 D;  3KFU G;  3X1T B;  3P5J B;  4WJ3 C;  3UT9 C;  3MGR D;  4QLC A;  5GT0 D;  3UT9 B;  3C1C C;  4H9S C;  2ARO B;  5B32 G;  5AY8 B;  1KX4 A;  3B6G B;  3LZ1 D;  1ZLA D;  2HIO C;  3O62 B;  4UUZ A;  2F2A C;  3MGP A;  5DNN C;  3AZN C;  1EQZ A;  4WU8 D;  2NQB A;  3H0R C;  3TU4 D;  2HIO B;  5AV8 D;  3UTA B;  1P3B B;  1P3L A;  5C3I B;  2Y2N A;  5B33 A;  4NE6 A;  3W98 C;  4WZS B;  3B6G A;  3UT9 A;  5BNV A;  2ARO C;  3AYW D;  3MGR A;  2DQN C;  4XUJ D;  2ZY5 A;  5B31 G;  1S32 C;  3AFA A;  5B33 B;  3KXB B;  3AN2 D;  3LZ1 A;  3AV2 B;  2RIQ A;  1KX3 B;  5AV9 D;  3REL A;  3W96 D;  5AV5 A;  4Z5T B;  1EQZ C;  2NQB C;  5B40 B;  3LEL B;  4XZQ C;  3MGQ B;  4NE3 A;  3KWQ C;  2L5A A;  1M1A B;  2Y2M A;  4R8P A;  5CPK D;  4KGC A;  4H9P A;  1TAF A;  4YS3 A;  3B0C T;  5CP6 A;  3AZH A;  5JA4 B;  3AZI D;  5CPI B;  4X23 C;  5DNM D;  3AV1 C;  1M18 D;  3C1B B;  1S32 A;  4WU9 D;  1AOI A;  3MGS C;  2YFW A;  5B0Z C;  4AWL C;  5CPI C;  4EO5 C;  1P34 C;  3C1B A;  4KUD A;  5F99 D;  5B2I B;  5GXQ A;  3UTB A;  4DRB A;  3AZM C;  2JSS A;  5FUG B;  1P3G C;  5AV6 D;  3NQJ B;  4H9N B;  3AZF B;  1JFI A;  4R8P B;  4R8P C;  4JJN A;  3MGQ C;  5B40 C;  2F8N H;  3KUY D;  5GT3 C;  2RVQ D;  4ZBJ C;  5CP6 D;  5AVB A;  1BH8 B;  5AV9 C;  2G5H C;  3W96 C;  4JJN B;  5E5A D;  3AZF A;  5B33 D;  4J8X C;  5B0Z B;  2F8N B;  5AV8 A;  1P3G B;  4KHA B;  1F66 D;  4Z66 A;  4X23 B;  3WTP A;  5F99 A;  3V9R B;  3AZM A;  4X23 D;  2HIO D;  5AV8 B;  5B24 A;  1P3G A;  3B6F D;  4XUJ A;  5CPJ D;  5B2J A;  2NZD D;  3REI A;  4LD9 A;  4HGA B;  5KDM A;  2HUE B;  3AV1 B;  3MGP C;  1H3O A;  1EQZ B;  4YS3 B;  4XZQ D;  3A6N D;  3W96 A;  5AV9 A;  3REL D;  2JCH A;  2Y2K A;  3A6N B;  4YS3 D;  3H0L C;  2YFV A;  3MNN D;  5B33 C;  4Z5T A;  3W98 A;  3REK D;  1H3O B;  2JE5 A;  1P3F A;  3W99 B;  5F99 C;  1WWI A;  5B2J B;  3X1S D;  3B0C W;  3AFA C;  4KUD D;  2BG1 A;  1M18 A;  3B6F A;  3AYW C;  1S32 B;  3EPH A;  2Y2I A;  4KHA A;  3B0D B;  3C1B D;  4JJN D;  4WU9 B;  3KWQ A;  3REH D;  4YM6 C;  3AZK A;  1KX5 A;  1M19 D;  2ZM5 A;  3AL0 C;  3AZI C;  5BO0 A;  5CPJ C;  5E5A A;  1A7W A;  3REK A;  1TZY B;  3AV1 A;  4J8V C;  5KDM B;  5JRG D;  3O62 C;  3AZK B;  1KX5 B;  3X1V D;  3MGS A;  5AVC B;  3B6G D;  1B67 A;  3AZE A;  3AZJ B;  5GT3 D;  1P3A B;  1PZR A;  1P34 A;  4KUD C;  3V9R A;  4E45 A;  3AV2 D;  5CHL B;  3KXB D;  1P3K C;  1WWS A;  3MNN C;  3AN2 B;  4J8U C;  1P3I C;  3LJA A;  3WTP D;  1Q9C A;  1AOI B;  3LZ0 D;  3AZG B;  3WKJ D;  2NZD C;  4QLC D;  2IO5 C;  1ZLA A;  5B2J D;  5CPJ A;  5CPK B;  1N1J A;  4H9Q B;  3C1C A;  1TZY A;  4WU8 A;  2YFV B;  3O62 A;  4HGA C;  1M1A A;  4ZUX B;  2FFF B;  5B0Y D;  4J8X A;  3WA9 B;  3NQJ A;  1F66 C;  5AV8 C;  1N1J B;  4H9Q A;  3X1U B;  3REL B;  1P3P C;  3MNN A;  4Z66 C;  5B32 D;  5DNN D;  3AZN D;  3AZL A;  5B24 B;  2LY8 A;  4CAY B;  3X1S B;  2XD5 A;  3MGR B;  2W8S A;  3UT9 D;  3B6G C;  3AZL B;  5GSU D;  3X1T D;  2Y2G A;  3VH6 T;  3AFA D;  4DRA A;  3C1C D;  3MVD C;  3AZE B;  5GT3 B;  3X1S C;  3X1V B;  5JRG C;  3O62 D;  1U35 D;  2XD1 A;  3EG5 B;  5AVB B;  3WAA D;  5AV5 D;  3REL C;  1P3F C;  1P3P A;  4J8W C;  3IP4 C;  3AZG D;  4NE5 A;  1W2E A;  2CV5 C;  1KX3 A;  1M19 C;  3H0M C;  1M18 C;  4KGC C;  3FDD A;  4H9O A;  1BH9 A;  5B2I A;  2BYK A;  2F8N G;  4X23 A;  3X1T A;  3LZ0 A;  4WV4 B;  1KX4 D;  4G92 C;  1P3I D;  5GT0 C;  1HQ3 A;  4DQY B;  5CPI A;  2CWE A;  4QLC C;  1P3M B;  3WAA A;  3REK B;  3NQU B;  4H9P B;  2CV5 A;  1KX3 C;  3W98 D;  3TU4 A;  5AV6 B;  3AZF D;  3KUY A;  1P3M D;  1P3O A;  3KXB C;  1M1A D;  5AVB D;  5B40 D;  1HTA A;  3MGQ D;  3WAA B;  1P3K A;  2ZY2 A;  5BS7 C;  5B32 C;  3B6F B;  3LJA C;  3LJA B;  2YFW B;  5B31 D;  5GT0 A;  2NZD A;  1R4V A;  2BYK B;  5DNM B;  5DNM C;  3REJ C;  3W99 A;  3WAA C;  3WTP C;  5DNN B;  5B24 D;  3AZN B;  3WKJ C;  2BYM B;  3REI D;  2CV5 D;  5B2J C;  5B32 B;  2FJ7 C;  3WA9 A;  3KUY C;  4LD9 C;  3R45 A;  3UTA D;  1F1E A;  5B1L B;  1U35 C;  1P3B D;  1ID3 C;  2ZY4 A;  2NQB D;  1P3M C;  5AV5 C;  3C1C B;  5BNX A;  5GSU B;  2BYM A;  4E44 A;  4LD9 B;  3A6N C;  3EPJ A;  3AV2 A;  2FJ7 B;  3WKJ B;  3LZ0 B;  3WTP B;  5AY8 D;  1KX4 C;  2F8N D;  1T3U A;  3WKJ A;  2UWX A;  4G92 B;  2FJ7 A;  5B0Z A;  3B6F C;  4UPK A;  3WA9 D;  5B0Y B;  3REJ B;  5BT1 C;  3AZJ D;  1P3A D;  2PYO C;  3F6T A;  4J8X D;  1P3O B;  3AZK D;  1KX5 D;  4UUZ B;  4ZUX A;  1P3L C;  3EPL A;  3X1V A;  3AZI A;  3NQU A;  3VH5 A;  5E5A C;  4G91 C;  2ARO A;  5AVB C;  5GXQ B;  3W97 C;  3MGR C;  5B31 A;  3AZH D;  3B0B A;  1P3K D;  3AZF C;  3VH6 W;  3AZM B;  4J8U D;  2VQR A;  3MVD B;  3AZE C;  1S32 D;  1HQ3 C;  5GXQ D;  1BH9 B;  5B1M B;  3MGS B;  4YM6 D;  4XZQ A;  1P3L B;  3UTB D;  4ZUX C;  3TU4 C;  3TU4 B;  3VH5 T;  1P3O C;  1M19 B;  1P3P B;  1ZLA C;  4WU8 B;  3REH B;  3X1U C;  5B1M C;  3REJ D;  3R45 B;  5B31 C;  1ZLA B;  2J8P A;  5B32 A;  1AOI C;  3REI B;  3KWQ B;  5FUG A;  3LEL C;  4XUJ B;  1P3I B;  1KX4 B;  1F66 A;  4Z5T C;  5DNM A;  3A1I A;  5GXQ C;  3W97 B;  2NZD B;  4G91 B;  4H9R A;  3W97 D;  4LD9 D;  2F8N A;  2HIO A;  1P3G D;  1U35 A;  3MNN B;  5B0Z D;  4J8V D;  5E5A B;  1Z2C B;  1ID3 B;  3X1U D;  5AV6 A;  3UTA C;  1P3B C;  3AV1 D;  1ID3 D;  3A6N A;  5JRG A;  4J8V B;  2DF4 C;  2ARO D;  4ZUX D;  5BT1 D;  1P3P D;  5CPJ B;  3UTB B;  5B1M D;  1P3F D;  4YM6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...