4R8PD

Crystal structure of the ring1b/bmi1/ubch5c prc1 ubiquitylation module bound to the nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4r8pD00
4AWLC 1F66A 4X23C 3AN2B 5B2IA 2L5AA 3MGPC 3B0DC 5JA4B 3O62A 2BYKA 5AVCB 1M19B 3WA9C 4G91C 1F66D 5F99B 1ZLAC 4YM6A 5B2ID 3AZNC 3B6GA 3W97D 3O62D 5AV5D 3TU4B 2YFWB 4Z2MG 4ZBJC 3VH5T 5AV8B 4YM6D 3AZLC 3X1TB 3KXBA 3AV2B 1KU5A 1N1JA 2NZDC 4R8PB 2CV5B 3AZGB 3KUYB 4KUDA 4H9SC 3REKA 1M1AC 3MGQA 3AZEA 3C1BA 3MVDA 1AOID 4KUDD 1S32C 3REKD 5B0YC 3MGQD 3AFAD 3AZED 1KX5A 2PYOC 3C1BD 2F8NA 5B2IB 4NFTA 3W97B 3O62B 5B31C 5AV5B 3KWQC 4J8VC 4HGAC 1P3MD 4WU9C 2F8ND 5DNMC 1M18C 4X23A 3MGPA 3NQUA 2IO5B 3WA9A 1ZLAA 3X1VB 3W98B 3MGPD 1N1JB 4J8WD 4H9NA 3AZNA 5KDMB 5CPID 3AYWC 3W96D 1ZLAD 3AZLA 1AOIB 1A7WA 4XUJC 4KUDB 5GXQC 5BT1C 5C3IB 3REKB 3AFAB 3AZEB 2NZDA 5B40C 5B32B 5CPJC 1U35C 1HQ3A 1P3MB 4J8XD 2NZDD 2F8NB 4H9SA 1M1AA 5GT3C 4WU8C 4DRAA 1S32A 3WTPD 5B0YA 2PYOA 3NQUB 3B0DB 3MGSC 4J8WB 1S32D 5B31A 4KGCC 3KWQA 4J8VA 5CPIB 1P3KC 3W96B 2HUEC 4WU9A 1P3BC 4JJNC 5DNMA 1M18A 3AZMC 5B31D 4J8VD 4EO5C 4ZBJB 4WU9D 3REJC 3R45B 3LELC 4WNNA 5GSUC 4Z66D 4J8XB 1H3OA 3RELD 5BNXA 3LJAC 3AYWA 4XUJA 3WTPE 5GXQA 3C1CB 3WTPB 2HIOD 3AYWD 2FJ7C 5B40A 1TZYC 5CPJA 3MNND 4QLCC 3X1UC 5BT1D 4YS3C 1U35A 1BH9A 3AZIB 4H9PB 5B40D 4M6BA 4Z5TC 4UUZA 5E5AC 5GT3A 5B31B 4WU8A 4J8VB 4HGAB 4WU9B 4CSRA 4KHAB 3NQJB 4WU8D 3WAAC 3W99C 4Z66B 4NE3A 5AV9C 3RELB 2NQBC 3MGSA 1P3AC 4KGCA 1P3KA 1P3BA 4JJNA 5CPKC 2F8NK 4ZUXC 3KSYA 3MGSD 3AZMA 3MGRC 4WV4B 2HIOB 5AV6B 3AYWB 1P3KD 1KX3C 3B6FC 3REJA 4WZSB 3MNNB 3LELA 1P34C 3AZMD 5GSUA 3B6GD 5B33C 1P3FC 3REJD 5BS7C 5B40B 3LJAA 4H9QA 1B67A 1BH9B 3KXBD 1HQ3C 3LJAD 1TAFA 2FJ7A 5B0ZC 4WU8B 1TZYA 4QLCA 3X1UA 2F8NH 4YS3A 3LZ1C 2AROC 4H9RA 4G92C 3LZ0C 1F66B 1TZYD 4Z5TA 5JRGC 3MVDD 4QLCD 3X1UD 5E5AA 3MGSB 4YS3D 1P3KB 1P3PC 3WKJC 2BYKB 3AZFC 1KX5D 4Z5TD 4YM6B 3AZMB 3B6GB 5AV9A 3W99A 3WAAA 1WWIA 5B32G 2NQBA 3VH6A 1P3AA 5B1MC 1P3IC 5AV9D 3W99D 4ZUXA 5B24C 4X23D 3KXBB 5CPKA 2NQBD 3WAAD 5FUGA 3MGRA 1P3AD 3LJAB 1R4VA 4CAYA 3B6FA 3WA9D 1KX3A 5CPKD 1EQZC 4ZUXD 1P34A 3AZND 1TAFB 3B6FD 5B33A 5B2JC 4H9OA 1P3FA 5BS7A 3MGQB 3UT9C 1TZYB 5AVBC 3C1BB 3MVDB 4QLCB 3X1UB 3REIC 3VH6T 3AZLD 3AV1C 1P34D 4YS3B 5B33D 3V9RA 3AN2C 1KX5B 4Z5TB 2YFVA 2JSSA 5B0ZA 1M19C 5F99C 1HQ3D 5B1LC 3X1SC 3LZ1A 2AROA 5CHLB 5B0ZD 3LZ0A 4AWLB 3TU4C 1M1AD 5AV9B 3WAAB 1F1EA 4X23B 5JRGA 2NQBB 3MGPB 1P3AB 1KX4C 3LZ1D 1P3PA 3WA9B 2AROD 3X1TC 3WKJA 2BYMA 3AZFA 4G91B 5AY8C 5B0YD 5CPKB 1ZLAB 2PYOD 1P3GC 5JRGD 4R8PC 3AZKC 2CV5C 3AZNB 4H9NB 4CAYB 1P3PD 3WKJD 3VH6W 3AZGC 3KWQD 4J8UC 3KUYC 3UTBC 5B1MA 3AZLB 1P3IA 5DNMD 5B24A 1M18D 5B33B 2NZDB 1P3ID 1EQZA 1HQ3B 3W97C 5B2JA 5AV5C 5B0ZB 1M1AB 3UT9A 5AVBA 3REIA 3AV1A 4XUJD 3A6NC 3LZ1B 1S32B 5GXQD 4G92B 5B2JD 3AN2A 5B0YB 3UT9D 5AVBD 2PYOB 5JRGB 3REID 3AV1D 1M19A 5G49A 5CPJD 1P3PB 3WKJB 5F99A 3X1VC 3KWQB 1U35D 3AN2D 5B1LA 3X1SA 3W98C 1BFMA 4XZQC 1M19D 5DNMB 3TU4A 2YFWA 1M18B 5GT3D 1KX4A 5B1LD 3X1SD 1AOIC 1Q9CA 5BO0A 3X1TA 1P3IB 5AY8A 4WNNB 3AFAC 3AZHC 3B0BA 1P3GA 4R8PA 3AZKA 5B32C 1KX4D 5GT0C 2CV5A 1H3OB 5BNXB 1JFIA 3X1TD 3AZGA 4KGCD 5AY8D 3KUYA 4J8UA 3UTBA 1P3MC 4Z2MH 3REHC 1P3GD 4NE6A 1P3BD 4R8PD 4JJND 3AZKD 4XUJB 5GXQB 5CP6C 5B2JB 2RVQC 4J8UD 1P3OC 3UTBD 5AVBB 3UT9B 3REIB 3AV1B 5CPJB 3LELD 5GSUD 1U35B 4E44A 3W97A 4J8WC 5AV5A 5G49B 5CPIC 3W96C 4UUZB 5GT3B 5B1LB 3X1SB 3UTAC 3A6NA 4CSRB 1B6WA 2FJ7D 1KX4B 3A6ND 1P3LC 5BO0B 4KGCB 3X1VA 3W98A 5AY8B 2HUEB 4J8XC 1P3GB 1P3BB 3AZKB 4JJNB 4XZQA 5KDMA 1JFIB 5E5AD 3AZJC 3X1VD 3W98D 4J8UB 1AOIA 4EO5B 3UTBB 3REJB 4XZQD 3C1CC 3WTPC 3LELB 3AFAA 3AZHA 5GSUB 4LD9C 5B32A 2F8NG 5GT0A 1HTAA 3AZIC 1P3MA 3AZHD 3REHA 4H9QB 5DNNC 5B32D 3VH5W 5GT0D 5CP6A 3MGRD 1ID3C 1P3OA 1KX3D 2FJ7B 3REHD 3A6NB 5CP6D 2RVQD 4H9RB 4Z66C 1P3OD 4J8WA 3RELC 1P3FD 2CWEA 5CPIA 3W96A 1WWSA 5E5AB 5AVCC 3UTAA 4XZQB 5AV6C 2HIOC 3W99B 5AV8C 3UTAD 3R45A 3MNNC 1P3LA 4J8XA 3AZHB 3AV2C 3LZ0D 4ZUXB 5GT0B 1P3LD 5FUGB 3MGRB 3AZJA 3B6FB 1KX3B 3AZFD 3REHB 3C1CA 3WTPA 1P34B 3B0CT 5CP6B 3AZJD 4LD9A 1P3OB 4H9OB 1P3FB 5B31G 3C1CD 3AZIA 5B1MD 4LD9D 4H9PA 1F66C 5DNNA 5B24D 3V9RB 5B2IC 5BNVA 1ID3A 2YFVB 3O62C 3AZID 5DNND 1BH8A 4KHAA 3UTAB 1EQZD 4YM6C 3NQJA 1ID3D 2AROB 3B6GC 4Z66A 3RELA 3LZ0B 2IO5C 5JA4A 5AVCA 1P3LB 3B0CW 2BYMB 3AZFB 3KXBC 5AV6A 2HIOA 5AVCD 3AZJB 5F99D 5AV8A 3MNNA 4E45A 4KUDC 5AV6D 2LY8A 5B1MB 3AV2A 3TU4D 5C3IC 3REKC 4LD9B 5B24B 3MGQC 3AZEC 5AV8D 3C1BC 3MVDC 1ULYA 4DRBA 3AV2D 5DNNB 1KX5C 1EQZB 5BNVB 2CV5D 1ID3B 3VH5A 3AZGD 3KUYD 1BH8B 4NE5A
chains in the Genus database with same CATH superfamily
4AWLC 1F66A 4X23C 3AN2B 5B2IA 2L5AA 3MGPC 3B0DC 5JA4B 3O62A 2BYKA 2XD1A 5AVCB 1M19B 3WA9C 4G91C 1F66D 5F99B 1ZLAC 4YM6A 5B2ID 3AZNC 3B6GA 3W97D 3O62D 1T3UA 5AV5D 3TU4B 2YFWB 4Z2MG 4ZBJC 3VH5T 5AV8B 4YM6D 3AZLC 2Y2LA 3X1TB 3KXBA 3AV2B 1KU5A 1N1JA 2NZDC 4R8PB 2CV5B 2Y2OA 3AZGB 3KUYB 4KUDA 4H9SC 3REKA 1M1AC 3MGQA 3AZEA 3C1BA 3MVDA 1AOID 2JCHA 4KUDD 1S32C 3REKD 5B0YC 3MGQD 3AFAD 3AZED 1KX5A 2PYOC 3C1BD 2F8NA 5B2IB 4NFTA 3W97B 3O62B 5B31C 5AV5B 3KWQC 4J8VC 4HGAC 1P3MD 4WU9C 2F8ND 5DNMC 1M18C 4X23A 3MGPA 2Y2IA 3NQUA 2IO5B 3WA9A 1ZLAA 3X1VB 3W98B 3MGPD 1N1JB 4J8WD 4H9NA 3AZNA 5KDMB 5CPID 3AYWC 3W96D 1ZLAD 3AZLA 2ZY2A 1AOIB 1A7WA 4XUJC 4KUDB 5GXQC 5BT1C 5C3IB 3REKB 3AFAB 3AZEB 2NZDA 5B40C 5B32B 5CPJC 1U35C 1HQ3A 2Y2NA 1P3MB 4J8XD 2NZDD 2F8NB 4H9SA 1M1AA 2DQNC 5GT3C 4WU8C 2VQRA 4DRAA 1S32A 3WTPD 5B0YA 2PYOA 3NQUB 3B0DB 3MGSC 4J8WB 1S32D 5B31A 4KGCC 3KWQA 4J8VA 5CPIB 1P3KC 3W96B 2HUEC 4WU9A 1P3BC 4JJNC 5DNMA 2JE5A 3AZMC 1M18A 5B31D 1Z2CB 4J8VD 4EO5C 4ZBJB 4WU9D 3REJC 3R45B 3LELC 4WNNA 5GSUC 4Z66D 2W8SA 4J8XB 1H3OA 3RELD 5BNXA 3LJAC 3AYWA 4XUJA 3EPKA 3WTPE 5GXQA 3C1CB 3WTPB 2HIOD 3AYWD 2FJ7C 5B40A 1TZYC 5CPJA 3MNND 4QLCC 3X1UC 3H0RC 5BT1D 4YS3C 1U35A 1BH9A 3AZIB 4H9PB 5B40D 4M6BA 4Z5TC 4UUZA 5E5AC 5GT3A 5B31B 4WU8A 4J8VB 4HGAB 4WU9B 3H0LC 4CSRA 4KHAB 3NQJB 4WU8D 3WAAC 3W99C 4Z66B 4NE3A 5AV9C 3RELB 2NQBC 3MGSA 1P3AC 4KGCA 1P3KA 1P3BA 4JJNA 5CPKC 2F8NK 4ZUXC 3KSYA 3MGSD 3AZMA 3MGRC 4WV4B 2HIOB 5AV6B 3AYWB 1P3KD 1KX3C 3B6FC 3REJA 4WZSB 2UWXA 3MNNB 3LELA 1P34C 3AZMD 5GSUA 3B6GD 5B33C 1P3FC 3REJD 2Y2PA 5BS7C 5B40B 3LJAA 3EPJA 4H9QA 1B67A 1BH9B 3KXBD 1HQ3C 3LJAD 1TAFA 2FJ7A 5B0ZC 4WU8B 1TZYA 4QLCA 3X1UA 2F8NH 4YS3A 2Y2JA 3LZ1C 3AL0C 2AROC 1PZRA 4H9RA 4G92C 3LZ0C 1F66B 1TZYD 4Z5TA 5JRGC 3MVDD 4QLCD 3X1UD 5E5AA 3MGSB 4YS3D 1P3KB 1P3PC 3WKJC 2BYKB 2Y2KA 2Y2HA 3AZFC 1KX5D 4Z5TD 4YM6B 3AZMB 3B6GB 5AV9A 3W99A 3WAAA 1WWIA 5B32G 2NQBA 3VH6A 1P3AA 2G5IC 1W2EA 5B1MC 1P3IC 5AV9D 3W99D 4ZUXA 5B24C 4X23D 3KXBB 5CPKA 2NQBD 3WAAD 5FUGA 3MGRA 1P3AD 3LJAB 1R4VA 4CAYA 3B6FA 4DQYB 3WA9D 1KX3A 5CPKD 1EQZC 4ZUXD 1P34A 3AZND 1TAFB 3B6FD 5B33A 5B2JC 4H9OA 1P3FA 5BS7A 3MGQB 3UT9C 1TZYB 5AVBC 3C1BB 3MVDB 4QLCB 3X1UB 3REIC 3VH6T 3AZLD 3AV1C 1P34D 4YS3B 2ZY5A 5B33D 3V9RA 3AN2C 1KX5B 4Z5TB 2YFVA 2JSSA 5B0ZA 1M19C 2FFFB 5F99C 1HQ3D 5B1LC 3X1SC 2XD5A 3LZ1A 2AROA 3FDDA 5CHLB 5B0ZD 3LZ0A 4AWLB 3TU4C 1M1AD 5AV9B 3WAAB 1F1EA 4X23B 5JRGA 2NQBB 2ZY3A 3F6TA 3MGPB 1P3AB 1KX4C 3LZ1D 1P3PA 3WA9B 2AROD 3X1TC 3WKJA 2BYMA 3AZFA 4G91B 5AY8C 5B0YD 5CPKB 1ZLAB 2PYOD 1P3GC 5JRGD 4R8PC 3AZKC 2CV5C 3AZNB 4H9NB 4CAYB 1P3PD 3WKJD 3VH6W 3AZGC 3KWQD 4J8UC 3KUYC 3UTBC 5B1MA 3AZLB 1P3IA 5DNMD 5B24A 1M18D 5B33B 2NZDB 1P3ID 1EQZA 1HQ3B 3W97C 5B2JA 5AV5C 5B0ZB 3H0MC 1M1AB 3UT9A 5AVBA 3REIA 3AV1A 4XUJD 3A6NC 3LZ1B 1S32B 5GXQD 4G92B 5B2JD 3AN2A 5B0YB 3UT9D 5AVBD 2PYOB 3A1IA 5JRGB 3REID 3AV1D 1M19A 5G49A 5CPJD 1P3PB 3WKJB 5F99A 3X1VC 3KWQB 1U35D 3AN2D 5B1LA 3X1SA 3W98C 1BFMA 3P5JB 4XZQC 1M19D 5DNMB 3TU4A 2YFWA 1M18B 5GT3D 1KX4A 5B1LD 3X1SD 1AOIC 1Q9CA 5BO0A 3X1TA 4UPKA 1P3IB 5AY8A 4WNNB 3AFAC 3AZHC 3B0BA 1P3GA 4R8PA 3AZKA 5B32C 1KX4D 5GT0C 2CV5A 1H3OB 5BNXB 1JFIA 3X1TD 2ZY4A 3AZGA 4KGCD 5AY8D 3KUYA 4J8UA 3UTBA 1P3MC 4Z2MH 3REHC 1P3GD 4NE6A 1P3BD 4R8PD 4JJND 3AZKD 4XUJB 5GXQB 5CP6C 5B2JB 2RVQC 2BG1A 4J8UD 1P3OC 3UTBD 5AVBB 3UT9B 3REIB 3AV1B 5CPJB 3LELD 5GSUD 1U35B 4E44A 3W97A 4J8WC 5AV5A 5G49B 5CPIC 3W96C 4UUZB 5GT3B 5B1LB 3X1SB 3UTAC 3A6NA 4CSRB 1B6WA 3EPLA 2FJ7D 1KX4B 3A6ND 1P3LC 5BO0B 4KGCB 3X1VA 3W98A 5AY8B 2RIQA 2HUEB 4J8XC 1P3GB 1P3BB 3AZKB 4JJNB 4XZQA 5KDMA 1JFIB 5E5AD 3AZJC 3X1VD 3W98D 4J8UB 1AOIA 4EO5B 3UTBB 3REJB 4XZQD 3C1CC 3WTPC 3LELB 3AFAA 3AZHA 5GSUB 4LD9C 5B32A 2F8NG 5GT0A 1HTAA 3AZIC 1P3MA 3AZHD 3REHA 4H9QB 4WJ3C 5DNNC 5B32D 3VH5W 5GT0D 5CP6A 3MGRD 2G5HC 1ID3C 1P3OA 1KX3D 2FJ7B 3REHD 3A6NB 5CP6D 3EG5B 2RVQD 4H9RB 4Z66C 1P3OD 4J8WA 3RELC 1P3FD 2CWEA 5CPIA 3W96A 1WWSA 5E5AB 5AVCC 3A1KA 3IP4C 3UTAA 4XZQB 5AV6C 2HIOC 2ZM5A 3EPHA 2Y2QA 3W99B 5AV8C 3UTAD 3R45A 3MNNC 1P3LA 2DF4C 4J8XA 3AZHB 3AV2C 3LZ0D 4ZUXB 5GT0B 1P3LD 5FUGB 3MGRB 3AZJA 3B6FB 1KX3B 3AZFD 3REHB 3C1CA 3WTPA 1P34B 3B0CT 5CP6B 3AZJD 4LD9A 1P3OB 4H9OB 1P3FB 2Y2GA 5B31G 3C1CD 3AZIA 5B1MD 4LD9D 4H9PA 1F66C 5DNNA 5B24D 3V9RB 5B2IC 5BNVA 1ID3A 2YFVB 3O62C 3AZID 5DNND 1BH8A 4KHAA 3UTAB 1EQZD 4YM6C 3NQJA 1ID3D 2AROB 3B6GC 4Z66A 3RELA 3LZ0B 2IO5C 5JA4A 5AVCA 1P3LB 3B0CW 2BYMB 3AZFB 2J8PA 3KXBC 2F2AC 5AV6A 2HIOA 5AVCD 3AZJB 5F99D 5AV8A 3MNNA 4E45A 4KUDC 5AV6D 2LY8A 5B1MB 3AV2A 3TU4D 5C3IC 3REKC 4LD9B 5B24B 3MGQC 3AZEC 3KFUG 5AV8D 3C1BC 3MVDC 1ULYA 4DRBA 3AV2D 2Y2MA 5DNNB 1KX5C 1EQZB 5BNVB 2CV5D 1ID3B 3VH5A 3AZGD 3KUYD 1BH8B 4NE5A
chains in the Genus database with same CATH topology
4AWLC 1F66A 4X23C 3AN2B 5B2IA 2L5AA 3MGPC 3B0DC 5JA4B 3O62A 2BYKA 2XD1A 5AVCB 1M19B 3WA9C 4G91C 1F66D 5F99B 1ZLAC 4YM6A 5B2ID 3AZNC 3B6GA 3W97D 3O62D 1T3UA 5AV5D 3TU4B 2YFWB 4Z2MG 4ZBJC 3VH5T 5AV8B 4YM6D 3AZLC 2Y2LA 3X1TB 3KXBA 3AV2B 1KU5A 1N1JA 2NZDC 4R8PB 2CV5B 2Y2OA 3AZGB 3KUYB 4KUDA 4H9SC 3REKA 1M1AC 3MGQA 3AZEA 3C1BA 3MVDA 1AOID 2JCHA 4KUDD 1S32C 3REKD 5B0YC 3MGQD 3AFAD 3AZED 1KX5A 2PYOC 3C1BD 2F8NA 5B2IB 4NFTA 3W97B 3O62B 5B31C 5AV5B 3KWQC 4J8VC 4HGAC 1P3MD 4WU9C 2F8ND 5DNMC 1M18C 4X23A 3MGPA 2Y2IA 3NQUA 2IO5B 3WA9A 1ZLAA 3X1VB 3W98B 3MGPD 1N1JB 4J8WD 4H9NA 3AZNA 5KDMB 5CPID 3AYWC 3W96D 1ZLAD 3AZLA 2ZY2A 1AOIB 1A7WA 4XUJC 4KUDB 5GXQC 5BT1C 5C3IB 3REKB 3AFAB 3AZEB 2NZDA 5B40C 5B32B 5CPJC 1U35C 1HQ3A 2Y2NA 1P3MB 4J8XD 2NZDD 2F8NB 4H9SA 1M1AA 2DQNC 5GT3C 4WU8C 2VQRA 4DRAA 1S32A 3WTPD 5B0YA 2PYOA 3NQUB 3B0DB 3MGSC 4J8WB 1S32D 5B31A 4KGCC 3KWQA 4J8VA 5CPIB 1P3KC 3W96B 2HUEC 4WU9A 1P3BC 4JJNC 5DNMA 2JE5A 3AZMC 1M18A 5B31D 1Z2CB 4J8VD 4EO5C 4ZBJB 4WU9D 3REJC 3R45B 3LELC 4WNNA 5GSUC 4Z66D 2W8SA 4J8XB 1H3OA 3RELD 5BNXA 3LJAC 3AYWA 4XUJA 3EPKA 3WTPE 5GXQA 3C1CB 3WTPB 2HIOD 3AYWD 2FJ7C 5B40A 1TZYC 5CPJA 3MNND 4QLCC 3X1UC 3H0RC 5BT1D 4YS3C 1U35A 1BH9A 3AZIB 4H9PB 5B40D 4M6BA 4Z5TC 4UUZA 5E5AC 5GT3A 5B31B 4WU8A 4J8VB 4HGAB 4WU9B 3H0LC 4CSRA 4KHAB 3NQJB 4WU8D 3WAAC 3W99C 4Z66B 4NE3A 5AV9C 3RELB 2NQBC 3MGSA 1P3AC 4KGCA 1P3KA 1P3BA 4JJNA 5CPKC 2F8NK 4ZUXC 3KSYA 3MGSD 3AZMA 3MGRC 4WV4B 2HIOB 5AV6B 3AYWB 1P3KD 1KX3C 3B6FC 3REJA 4WZSB 2UWXA 3MNNB 3LELA 1P34C 3AZMD 5GSUA 3B6GD 5B33C 1P3FC 3REJD 2Y2PA 5BS7C 5B40B 3LJAA 3EPJA 4H9QA 1B67A 1BH9B 3KXBD 1HQ3C 3LJAD 1TAFA 2FJ7A 5B0ZC 4WU8B 1TZYA 4QLCA 3X1UA 2F8NH 4YS3A 2Y2JA 3LZ1C 3AL0C 2AROC 1PZRA 4H9RA 4G92C 3LZ0C 1F66B 1TZYD 4Z5TA 5JRGC 3MVDD 4QLCD 3X1UD 5E5AA 3MGSB 4YS3D 1P3KB 1P3PC 3WKJC 2BYKB 2Y2KA 2Y2HA 3AZFC 1KX5D 4Z5TD 4YM6B 3AZMB 3B6GB 5AV9A 3W99A 3WAAA 1WWIA 5B32G 2NQBA 3VH6A 1P3AA 2G5IC 1W2EA 5B1MC 1P3IC 5AV9D 3W99D 4ZUXA 5B24C 4X23D 3KXBB 5CPKA 2NQBD 3WAAD 5FUGA 3MGRA 1P3AD 3LJAB 1R4VA 4CAYA 3B6FA 4DQYB 3WA9D 1KX3A 5CPKD 1EQZC 4ZUXD 1P34A 3AZND 1TAFB 3B6FD 5B33A 5B2JC 4H9OA 1P3FA 5BS7A 3MGQB 3UT9C 1TZYB 5AVBC 3C1BB 3MVDB 4QLCB 3X1UB 3REIC 3VH6T 3AZLD 3AV1C 1P34D 4YS3B 2ZY5A 5B33D 3V9RA 3AN2C 1KX5B 4Z5TB 2YFVA 2JSSA 5B0ZA 1M19C 2FFFB 5F99C 1HQ3D 5B1LC 3X1SC 2XD5A 3LZ1A 2AROA 3FDDA 5CHLB 5B0ZD 3LZ0A 4AWLB 3TU4C 1M1AD 5AV9B 3WAAB 1F1EA 4X23B 5JRGA 2NQBB 2ZY3A 3F6TA 3MGPB 1P3AB 1KX4C 3LZ1D 1P3PA 3WA9B 2AROD 3X1TC 3WKJA 2BYMA 3AZFA 4G91B 5AY8C 5B0YD 5CPKB 1ZLAB 2PYOD 1P3GC 5JRGD 4R8PC 3AZKC 2CV5C 3AZNB 4H9NB 4CAYB 1P3PD 3WKJD 3VH6W 3AZGC 3KWQD 4J8UC 3KUYC 3UTBC 5B1MA 3AZLB 1P3IA 5DNMD 5B24A 1M18D 5B33B 2NZDB 1P3ID 1EQZA 1HQ3B 3W97C 5B2JA 5AV5C 5B0ZB 3H0MC 1M1AB 3UT9A 5AVBA 3REIA 3AV1A 4XUJD 3A6NC 3LZ1B 1S32B 5GXQD 4G92B 5B2JD 3AN2A 5B0YB 3UT9D 5AVBD 2PYOB 3A1IA 5JRGB 3REID 3AV1D 1M19A 5G49A 5CPJD 1P3PB 3WKJB 5F99A 3X1VC 3KWQB 1U35D 3AN2D 5B1LA 3X1SA 3W98C 1BFMA 3P5JB 4XZQC 1M19D 5DNMB 3TU4A 2YFWA 1M18B 5GT3D 1KX4A 5B1LD 3X1SD 1AOIC 1Q9CA 5BO0A 3X1TA 4UPKA 1P3IB 5AY8A 4WNNB 3AFAC 3AZHC 3B0BA 1P3GA 4R8PA 3AZKA 5B32C 1KX4D 5GT0C 2CV5A 1H3OB 5BNXB 1JFIA 3X1TD 2ZY4A 3AZGA 4KGCD 5AY8D 3KUYA 4J8UA 3UTBA 1P3MC 4Z2MH 3REHC 1P3GD 4NE6A 1P3BD 4R8PD 4JJND 3AZKD 4XUJB 5GXQB 5CP6C 5B2JB 2RVQC 2BG1A 4J8UD 1P3OC 3UTBD 5AVBB 3UT9B 3REIB 3AV1B 5CPJB 3LELD 5GSUD 1U35B 4E44A 3W97A 4J8WC 5AV5A 5G49B 5CPIC 3W96C 4UUZB 5GT3B 5B1LB 3X1SB 3UTAC 3A6NA 4CSRB 1B6WA 3EPLA 2FJ7D 1KX4B 3A6ND 1P3LC 5BO0B 4KGCB 3X1VA 3W98A 5AY8B 2RIQA 2HUEB 4J8XC 1P3GB 1P3BB 3AZKB 4JJNB 4XZQA 5KDMA 1JFIB 5E5AD 3AZJC 3X1VD 3W98D 4J8UB 1AOIA 4EO5B 3UTBB 3REJB 4XZQD 3C1CC 3WTPC 3LELB 3AFAA 3AZHA 5GSUB 4LD9C 5B32A 2F8NG 5GT0A 1HTAA 3AZIC 1P3MA 3AZHD 3REHA 4H9QB 4WJ3C 5DNNC 5B32D 3VH5W 5GT0D 5CP6A 3MGRD 2G5HC 1ID3C 1P3OA 1KX3D 2FJ7B 3REHD 3A6NB 5CP6D 3EG5B 2RVQD 4H9RB 4Z66C 1P3OD 4J8WA 3RELC 1P3FD 2CWEA 5CPIA 3W96A 1WWSA 5E5AB 5AVCC 3A1KA 3IP4C 3UTAA 4XZQB 5AV6C 2HIOC 2ZM5A 3EPHA 2Y2QA 3W99B 5AV8C 3UTAD 3R45A 3MNNC 1P3LA 2DF4C 4J8XA 3AZHB 3AV2C 3LZ0D 4ZUXB 5GT0B 1P3LD 5FUGB 3MGRB 3AZJA 3B6FB 1KX3B 3AZFD 3REHB 3C1CA 3WTPA 1P34B 3B0CT 5CP6B 3AZJD 4LD9A 1P3OB 4H9OB 1P3FB 2Y2GA 5B31G 3C1CD 3AZIA 5B1MD 4LD9D 4H9PA 1F66C 5DNNA 5B24D 3V9RB 5B2IC 5BNVA 1ID3A 2YFVB 3O62C 3AZID 5DNND 1BH8A 4KHAA 3UTAB 1EQZD 4YM6C 3NQJA 1ID3D 2AROB 3B6GC 4Z66A 3RELA 3LZ0B 2IO5C 5JA4A 5AVCA 1P3LB 3B0CW 2BYMB 3AZFB 2J8PA 3KXBC 2F2AC 5AV6A 2HIOA 5AVCD 3AZJB 5F99D 5AV8A 3MNNA 4E45A 4KUDC 5AV6D 2LY8A 5B1MB 3AV2A 3TU4D 5C3IC 3REKC 4LD9B 5B24B 3MGQC 3AZEC 3KFUG 5AV8D 3C1BC 3MVDC 1ULYA 4DRBA 3AV2D 2Y2MA 5DNNB 1KX5C 1EQZB 5BNVB 2CV5D 1ID3B 3VH5A 3AZGD 3KUYD 1BH8B 4NE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AWL C;  1F66 A;  4X23 C;  3AN2 B;  5B2I A;  2L5A A;  3MGP C;  3B0D C;  5JA4 B;  3O62 A;  2BYK A;  5AVC B;  1M19 B;  3WA9 C;  4G91 C;  1F66 D;  5F99 B;  1ZLA C;  4YM6 A;  5B2I D;  3AZN C;  3B6G A;  3W97 D;  3O62 D;  5AV5 D;  3TU4 B;  2YFW B;  4Z2M G;  4ZBJ C;  3VH5 T;  5AV8 B;  4YM6 D;  3AZL C;  3X1T B;  3KXB A;  3AV2 B;  1KU5 A;  1N1J A;  2NZD C;  4R8P B;  2CV5 B;  3AZG B;  3KUY B;  4KUD A;  4H9S C;  3REK A;  1M1A C;  3MGQ A;  3AZE A;  3C1B A;  3MVD A;  1AOI D;  4KUD D;  1S32 C;  3REK D;  5B0Y C;  3MGQ D;  3AFA D;  3AZE D;  1KX5 A;  2PYO C;  3C1B D;  2F8N A;  5B2I B;  4NFT A;  3W97 B;  3O62 B;  5B31 C;  5AV5 B;  3KWQ C;  4J8V C;  4HGA C;  1P3M D;  4WU9 C;  2F8N D;  5DNM C;  1M18 C;  4X23 A;  3MGP A;  3NQU A;  2IO5 B;  3WA9 A;  1ZLA A;  3X1V B;  3W98 B;  3MGP D;  1N1J B;  4J8W D;  4H9N A;  3AZN A;  5KDM B;  5CPI D;  3AYW C;  3W96 D;  1ZLA D;  3AZL A;  1AOI B;  1A7W A;  4XUJ C;  4KUD B;  5GXQ C;  5BT1 C;  5C3I B;  3REK B;  3AFA B;  3AZE B;  2NZD A;  5B40 C;  5B32 B;  5CPJ C;  1U35 C;  1HQ3 A;  1P3M B;  4J8X D;  2NZD D;  2F8N B;  4H9S A;  1M1A A;  5GT3 C;  4WU8 C;  4DRA A;  1S32 A;  3WTP D;  5B0Y A;  2PYO A;  3NQU B;  3B0D B;  3MGS C;  4J8W B;  1S32 D;  5B31 A;  4KGC C;  3KWQ A;  4J8V A;  5CPI B;  1P3K C;  3W96 B;  2HUE C;  4WU9 A;  1P3B C;  4JJN C;  5DNM A;  1M18 A;  3AZM C;  5B31 D;  4J8V D;  4EO5 C;  4ZBJ B;  4WU9 D;  3REJ C;  3R45 B;  3LEL C;  4WNN A;  5GSU C;  4Z66 D;  4J8X B;  1H3O A;  3REL D;  5BNX A;  3LJA C;  3AYW A;  4XUJ A;  3WTP E;  5GXQ A;  3C1C B;  3WTP B;  2HIO D;  3AYW D;  2FJ7 C;  5B40 A;  1TZY C;  5CPJ A;  3MNN D;  4QLC C;  3X1U C;  5BT1 D;  4YS3 C;  1U35 A;  1BH9 A;  3AZI B;  4H9P B;  5B40 D;  4M6B A;  4Z5T C;  4UUZ A;  5E5A C;  5GT3 A;  5B31 B;  4WU8 A;  4J8V B;  4HGA B;  4WU9 B;  4CSR A;  4KHA B;  3NQJ B;  4WU8 D;  3WAA C;  3W99 C;  4Z66 B;  4NE3 A;  5AV9 C;  3REL B;  2NQB C;  3MGS A;  1P3A C;  4KGC A;  1P3K A;  1P3B A;  4JJN A;  5CPK C;  2F8N K;  4ZUX C;  3KSY A;  3MGS D;  3AZM A;  3MGR C;  4WV4 B;  2HIO B;  5AV6 B;  3AYW B;  1P3K D;  1KX3 C;  3B6F C;  3REJ A;  4WZS B;  3MNN B;  3LEL A;  1P34 C;  3AZM D;  5GSU A;  3B6G D;  5B33 C;  1P3F C;  3REJ D;  5BS7 C;  5B40 B;  3LJA A;  4H9Q A;  1B67 A;  1BH9 B;  3KXB D;  1HQ3 C;  3LJA D;  1TAF A;  2FJ7 A;  5B0Z C;  4WU8 B;  1TZY A;  4QLC A;  3X1U A;  2F8N H;  4YS3 A;  3LZ1 C;  2ARO C;  4H9R A;  4G92 C;  3LZ0 C;  1F66 B;  1TZY D;  4Z5T A;  5JRG C;  3MVD D;  4QLC D;  3X1U D;  5E5A A;  3MGS B;  4YS3 D;  1P3K B;  1P3P C;  3WKJ C;  2BYK B;  3AZF C;  1KX5 D;  4Z5T D;  4YM6 B;  3AZM B;  3B6G B;  5AV9 A;  3W99 A;  3WAA A;  1WWI A;  5B32 G;  2NQB A;  3VH6 A;  1P3A A;  5B1M C;  1P3I C;  5AV9 D;  3W99 D;  4ZUX A;  5B24 C;  4X23 D;  3KXB B;  5CPK A;  2NQB D;  3WAA D;  5FUG A;  3MGR A;  1P3A D;  3LJA B;  1R4V A;  4CAY A;  3B6F A;  3WA9 D;  1KX3 A;  5CPK D;  1EQZ C;  4ZUX D;  1P34 A;  3AZN D;  1TAF B;  3B6F D;  5B33 A;  5B2J C;  4H9O A;  1P3F A;  5BS7 A;  3MGQ B;  3UT9 C;  1TZY B;  5AVB C;  3C1B B;  3MVD B;  4QLC B;  3X1U B;  3REI C;  3VH6 T;  3AZL D;  3AV1 C;  1P34 D;  4YS3 B;  5B33 D;  3V9R A;  3AN2 C;  1KX5 B;  4Z5T B;  2YFV A;  2JSS A;  5B0Z A;  1M19 C;  5F99 C;  1HQ3 D;  5B1L C;  3X1S C;  3LZ1 A;  2ARO A;  5CHL B;  5B0Z D;  3LZ0 A;  4AWL B;  3TU4 C;  1M1A D;  5AV9 B;  3WAA B;  1F1E A;  4X23 B;  5JRG A;  2NQB B;  3MGP B;  1P3A B;  1KX4 C;  3LZ1 D;  1P3P A;  3WA9 B;  2ARO D;  3X1T C;  3WKJ A;  2BYM A;  3AZF A;  4G91 B;  5AY8 C;  5B0Y D;  5CPK B;  1ZLA B;  2PYO D;  1P3G C;  5JRG D;  4R8P C;  3AZK C;  2CV5 C;  3AZN B;  4H9N B;  4CAY B;  1P3P D;  3WKJ D;  3VH6 W;  3AZG C;  3KWQ D;  4J8U C;  3KUY C;  3UTB C;  5B1M A;  3AZL B;  1P3I A;  5DNM D;  5B24 A;  1M18 D;  5B33 B;  2NZD B;  1P3I D;  1EQZ A;  1HQ3 B;  3W97 C;  5B2J A;  5AV5 C;  5B0Z B;  1M1A B;  3UT9 A;  5AVB A;  3REI A;  3AV1 A;  4XUJ D;  3A6N C;  3LZ1 B;  1S32 B;  5GXQ D;  4G92 B;  5B2J D;  3AN2 A;  5B0Y B;  3UT9 D;  5AVB D;  2PYO B;  5JRG B;  3REI D;  3AV1 D;  1M19 A;  5G49 A;  5CPJ D;  1P3P B;  3WKJ B;  5F99 A;  3X1V C;  3KWQ B;  1U35 D;  3AN2 D;  5B1L A;  3X1S A;  3W98 C;  1BFM A;  4XZQ C;  1M19 D;  5DNM B;  3TU4 A;  2YFW A;  1M18 B;  5GT3 D;  1KX4 A;  5B1L D;  3X1S D;  1AOI C;  1Q9C A;  5BO0 A;  3X1T A;  1P3I B;  5AY8 A;  4WNN B;  3AFA C;  3AZH C;  3B0B A;  1P3G A;  4R8P A;  3AZK A;  5B32 C;  1KX4 D;  5GT0 C;  2CV5 A;  1H3O B;  5BNX B;  1JFI A;  3X1T D;  3AZG A;  4KGC D;  5AY8 D;  3KUY A;  4J8U A;  3UTB A;  1P3M C;  4Z2M H;  3REH C;  1P3G D;  4NE6 A;  1P3B D;  4R8P D;  4JJN D;  3AZK D;  4XUJ B;  5GXQ B;  5CP6 C;  5B2J B;  2RVQ C;  4J8U D;  1P3O C;  3UTB D;  5AVB B;  3UT9 B;  3REI B;  3AV1 B;  5CPJ B;  3LEL D;  5GSU D;  1U35 B;  4E44 A;  3W97 A;  4J8W C;  5AV5 A;  5G49 B;  5CPI C;  3W96 C;  4UUZ B;  5GT3 B;  5B1L B;  3X1S B;  3UTA C;  3A6N A;  4CSR B;  1B6W A;  2FJ7 D;  1KX4 B;  3A6N D;  1P3L C;  5BO0 B;  4KGC B;  3X1V A;  3W98 A;  5AY8 B;  2HUE B;  4J8X C;  1P3G B;  1P3B B;  3AZK B;  4JJN B;  4XZQ A;  5KDM A;  1JFI B;  5E5A D;  3AZJ C;  3X1V D;  3W98 D;  4J8U B;  1AOI A;  4EO5 B;  3UTB B;  3REJ B;  4XZQ D;  3C1C C;  3WTP C;  3LEL B;  3AFA A;  3AZH A;  5GSU B;  4LD9 C;  5B32 A;  2F8N G;  5GT0 A;  1HTA A;  3AZI C;  1P3M A;  3AZH D;  3REH A;  4H9Q B;  5DNN C;  5B32 D;  3VH5 W;  5GT0 D;  5CP6 A;  3MGR D;  1ID3 C;  1P3O A;  1KX3 D;  2FJ7 B;  3REH D;  3A6N B;  5CP6 D;  2RVQ D;  4H9R B;  4Z66 C;  1P3O D;  4J8W A;  3REL C;  1P3F D;  2CWE A;  5CPI A;  3W96 A;  1WWS A;  5E5A B;  5AVC C;  3UTA A;  4XZQ B;  5AV6 C;  2HIO C;  3W99 B;  5AV8 C;  3UTA D;  3R45 A;  3MNN C;  1P3L A;  4J8X A;  3AZH B;  3AV2 C;  3LZ0 D;  4ZUX B;  5GT0 B;  1P3L D;  5FUG B;  3MGR B;  3AZJ A;  3B6F B;  1KX3 B;  3AZF D;  3REH B;  3C1C A;  3WTP A;  1P34 B;  3B0C T;  5CP6 B;  3AZJ D;  4LD9 A;  1P3O B;  4H9O B;  1P3F B;  5B31 G;  3C1C D;  3AZI A;  5B1M D;  4LD9 D;  4H9P A;  1F66 C;  5DNN A;  5B24 D;  3V9R B;  5B2I C;  5BNV A;  1ID3 A;  2YFV B;  3O62 C;  3AZI D;  5DNN D;  1BH8 A;  4KHA A;  3UTA B;  1EQZ D;  4YM6 C;  3NQJ A;  1ID3 D;  2ARO B;  3B6G C;  4Z66 A;  3REL A;  3LZ0 B;  2IO5 C;  5JA4 A;  5AVC A;  1P3L B;  3B0C W;  2BYM B;  3AZF B;  3KXB C;  5AV6 A;  2HIO A;  5AVC D;  3AZJ B;  5F99 D;  5AV8 A;  3MNN A;  4E45 A;  4KUD C;  5AV6 D;  2LY8 A;  5B1M B;  3AV2 A;  3TU4 D;  5C3I C;  3REK C;  4LD9 B;  5B24 B;  3MGQ C;  3AZE C;  5AV8 D;  3C1B C;  3MVD C;  1ULY A;  4DRB A;  3AV2 D;  5DNN B;  1KX5 C;  1EQZ B;  5BNV B;  2CV5 D;  1ID3 B;  3VH5 A;  3AZG D;  3KUY D;  1BH8 B;  4NE5 A; 
#chains in the Genus database with same CATH topology
 4AWL C;  1F66 A;  4X23 C;  3AN2 B;  5B2I A;  2L5A A;  3MGP C;  3B0D C;  5JA4 B;  3O62 A;  2BYK A;  2XD1 A;  5AVC B;  1M19 B;  3WA9 C;  4G91 C;  1F66 D;  5F99 B;  1ZLA C;  4YM6 A;  5B2I D;  3AZN C;  3B6G A;  3W97 D;  3O62 D;  1T3U A;  5AV5 D;  3TU4 B;  2YFW B;  4Z2M G;  4ZBJ C;  3VH5 T;  5AV8 B;  4YM6 D;  3AZL C;  2Y2L A;  3X1T B;  3KXB A;  3AV2 B;  1KU5 A;  1N1J A;  2NZD C;  4R8P B;  2CV5 B;  2Y2O A;  3AZG B;  3KUY B;  4KUD A;  4H9S C;  3REK A;  1M1A C;  3MGQ A;  3AZE A;  3C1B A;  3MVD A;  1AOI D;  2JCH A;  4KUD D;  1S32 C;  3REK D;  5B0Y C;  3MGQ D;  3AFA D;  3AZE D;  1KX5 A;  2PYO C;  3C1B D;  2F8N A;  5B2I B;  4NFT A;  3W97 B;  3O62 B;  5B31 C;  5AV5 B;  3KWQ C;  4J8V C;  4HGA C;  1P3M D;  4WU9 C;  2F8N D;  5DNM C;  1M18 C;  4X23 A;  3MGP A;  2Y2I A;  3NQU A;  2IO5 B;  3WA9 A;  1ZLA A;  3X1V B;  3W98 B;  3MGP D;  1N1J B;  4J8W D;  4H9N A;  3AZN A;  5KDM B;  5CPI D;  3AYW C;  3W96 D;  1ZLA D;  3AZL A;  2ZY2 A;  1AOI B;  1A7W A;  4XUJ C;  4KUD B;  5GXQ C;  5BT1 C;  5C3I B;  3REK B;  3AFA B;  3AZE B;  2NZD A;  5B40 C;  5B32 B;  5CPJ C;  1U35 C;  1HQ3 A;  2Y2N A;  1P3M B;  4J8X D;  2NZD D;  2F8N B;  4H9S A;  1M1A A;  2DQN C;  5GT3 C;  4WU8 C;  2VQR A;  4DRA A;  1S32 A;  3WTP D;  5B0Y A;  2PYO A;  3NQU B;  3B0D B;  3MGS C;  4J8W B;  1S32 D;  5B31 A;  4KGC C;  3KWQ A;  4J8V A;  5CPI B;  1P3K C;  3W96 B;  2HUE C;  4WU9 A;  1P3B C;  4JJN C;  5DNM A;  2JE5 A;  3AZM C;  1M18 A;  5B31 D;  1Z2C B;  4J8V D;  4EO5 C;  4ZBJ B;  4WU9 D;  3REJ C;  3R45 B;  3LEL C;  4WNN A;  5GSU C;  4Z66 D;  2W8S A;  4J8X B;  1H3O A;  3REL D;  5BNX A;  3LJA C;  3AYW A;  4XUJ A;  3EPK A;  3WTP E;  5GXQ A;  3C1C B;  3WTP B;  2HIO D;  3AYW D;  2FJ7 C;  5B40 A;  1TZY C;  5CPJ A;  3MNN D;  4QLC C;  3X1U C;  3H0R C;  5BT1 D;  4YS3 C;  1U35 A;  1BH9 A;  3AZI B;  4H9P B;  5B40 D;  4M6B A;  4Z5T C;  4UUZ A;  5E5A C;  5GT3 A;  5B31 B;  4WU8 A;  4J8V B;  4HGA B;  4WU9 B;  3H0L C;  4CSR A;  4KHA B;  3NQJ B;  4WU8 D;  3WAA C;  3W99 C;  4Z66 B;  4NE3 A;  5AV9 C;  3REL B;  2NQB C;  3MGS A;  1P3A C;  4KGC A;  1P3K A;  1P3B A;  4JJN A;  5CPK C;  2F8N K;  4ZUX C;  3KSY A;  3MGS D;  3AZM A;  3MGR C;  4WV4 B;  2HIO B;  5AV6 B;  3AYW B;  1P3K D;  1KX3 C;  3B6F C;  3REJ A;  4WZS B;  2UWX A;  3MNN B;  3LEL A;  1P34 C;  3AZM D;  5GSU A;  3B6G D;  5B33 C;  1P3F C;  3REJ D;  2Y2P A;  5BS7 C;  5B40 B;  3LJA A;  3EPJ A;  4H9Q A;  1B67 A;  1BH9 B;  3KXB D;  1HQ3 C;  3LJA D;  1TAF A;  2FJ7 A;  5B0Z C;  4WU8 B;  1TZY A;  4QLC A;  3X1U A;  2F8N H;  4YS3 A;  2Y2J A;  3LZ1 C;  3AL0 C;  2ARO C;  1PZR A;  4H9R A;  4G92 C;  3LZ0 C;  1F66 B;  1TZY D;  4Z5T A;  5JRG C;  3MVD D;  4QLC D;  3X1U D;  5E5A A;  3MGS B;  4YS3 D;  1P3K B;  1P3P C;  3WKJ C;  2BYK B;  2Y2K A;  2Y2H A;  3AZF C;  1KX5 D;  4Z5T D;  4YM6 B;  3AZM B;  3B6G B;  5AV9 A;  3W99 A;  3WAA A;  1WWI A;  5B32 G;  2NQB A;  3VH6 A;  1P3A A;  2G5I C;  1W2E A;  5B1M C;  1P3I C;  5AV9 D;  3W99 D;  4ZUX A;  5B24 C;  4X23 D;  3KXB B;  5CPK A;  2NQB D;  3WAA D;  5FUG A;  3MGR A;  1P3A D;  3LJA B;  1R4V A;  4CAY A;  3B6F A;  4DQY B;  3WA9 D;  1KX3 A;  5CPK D;  1EQZ C;  4ZUX D;  1P34 A;  3AZN D;  1TAF B;  3B6F D;  5B33 A;  5B2J C;  4H9O A;  1P3F A;  5BS7 A;  3MGQ B;  3UT9 C;  1TZY B;  5AVB C;  3C1B B;  3MVD B;  4QLC B;  3X1U B;  3REI C;  3VH6 T;  3AZL D;  3AV1 C;  1P34 D;  4YS3 B;  2ZY5 A;  5B33 D;  3V9R A;  3AN2 C;  1KX5 B;  4Z5T B;  2YFV A;  2JSS A;  5B0Z A;  1M19 C;  2FFF B;  5F99 C;  1HQ3 D;  5B1L C;  3X1S C;  2XD5 A;  3LZ1 A;  2ARO A;  3FDD A;  5CHL B;  5B0Z D;  3LZ0 A;  4AWL B;  3TU4 C;  1M1A D;  5AV9 B;  3WAA B;  1F1E A;  4X23 B;  5JRG A;  2NQB B;  2ZY3 A;  3F6T A;  3MGP B;  1P3A B;  1KX4 C;  3LZ1 D;  1P3P A;  3WA9 B;  2ARO D;  3X1T C;  3WKJ A;  2BYM A;  3AZF A;  4G91 B;  5AY8 C;  5B0Y D;  5CPK B;  1ZLA B;  2PYO D;  1P3G C;  5JRG D;  4R8P C;  3AZK C;  2CV5 C;  3AZN B;  4H9N B;  4CAY B;  1P3P D;  3WKJ D;  3VH6 W;  3AZG C;  3KWQ D;  4J8U C;  3KUY C;  3UTB C;  5B1M A;  3AZL B;  1P3I A;  5DNM D;  5B24 A;  1M18 D;  5B33 B;  2NZD B;  1P3I D;  1EQZ A;  1HQ3 B;  3W97 C;  5B2J A;  5AV5 C;  5B0Z B;  3H0M C;  1M1A B;  3UT9 A;  5AVB A;  3REI A;  3AV1 A;  4XUJ D;  3A6N C;  3LZ1 B;  1S32 B;  5GXQ D;  4G92 B;  5B2J D;  3AN2 A;  5B0Y B;  3UT9 D;  5AVB D;  2PYO B;  3A1I A;  5JRG B;  3REI D;  3AV1 D;  1M19 A;  5G49 A;  5CPJ D;  1P3P B;  3WKJ B;  5F99 A;  3X1V C;  3KWQ B;  1U35 D;  3AN2 D;  5B1L A;  3X1S A;  3W98 C;  1BFM A;  3P5J B;  4XZQ C;  1M19 D;  5DNM B;  3TU4 A;  2YFW A;  1M18 B;  5GT3 D;  1KX4 A;  5B1L D;  3X1S D;  1AOI C;  1Q9C A;  5BO0 A;  3X1T A;  4UPK A;  1P3I B;  5AY8 A;  4WNN B;  3AFA C;  3AZH C;  3B0B A;  1P3G A;  4R8P A;  3AZK A;  5B32 C;  1KX4 D;  5GT0 C;  2CV5 A;  1H3O B;  5BNX B;  1JFI A;  3X1T D;  2ZY4 A;  3AZG A;  4KGC D;  5AY8 D;  3KUY A;  4J8U A;  3UTB A;  1P3M C;  4Z2M H;  3REH C;  1P3G D;  4NE6 A;  1P3B D;  4R8P D;  4JJN D;  3AZK D;  4XUJ B;  5GXQ B;  5CP6 C;  5B2J B;  2RVQ C;  2BG1 A;  4J8U D;  1P3O C;  3UTB D;  5AVB B;  3UT9 B;  3REI B;  3AV1 B;  5CPJ B;  3LEL D;  5GSU D;  1U35 B;  4E44 A;  3W97 A;  4J8W C;  5AV5 A;  5G49 B;  5CPI C;  3W96 C;  4UUZ B;  5GT3 B;  5B1L B;  3X1S B;  3UTA C;  3A6N A;  4CSR B;  1B6W A;  3EPL A;  2FJ7 D;  1KX4 B;  3A6N D;  1P3L C;  5BO0 B;  4KGC B;  3X1V A;  3W98 A;  5AY8 B;  2RIQ A;  2HUE B;  4J8X C;  1P3G B;  1P3B B;  3AZK B;  4JJN B;  4XZQ A;  5KDM A;  1JFI B;  5E5A D;  3AZJ C;  3X1V D;  3W98 D;  4J8U B;  1AOI A;  4EO5 B;  3UTB B;  3REJ B;  4XZQ D;  3C1C C;  3WTP C;  3LEL B;  3AFA A;  3AZH A;  5GSU B;  4LD9 C;  5B32 A;  2F8N G;  5GT0 A;  1HTA A;  3AZI C;  1P3M A;  3AZH D;  3REH A;  4H9Q B;  4WJ3 C;  5DNN C;  5B32 D;  3VH5 W;  5GT0 D;  5CP6 A;  3MGR D;  2G5H C;  1ID3 C;  1P3O A;  1KX3 D;  2FJ7 B;  3REH D;  3A6N B;  5CP6 D;  3EG5 B;  2RVQ D;  4H9R B;  4Z66 C;  1P3O D;  4J8W A;  3REL C;  1P3F D;  2CWE A;  5CPI A;  3W96 A;  1WWS A;  5E5A B;  5AVC C;  3A1K A;  3IP4 C;  3UTA A;  4XZQ B;  5AV6 C;  2HIO C;  2ZM5 A;  3EPH A;  2Y2Q A;  3W99 B;  5AV8 C;  3UTA D;  3R45 A;  3MNN C;  1P3L A;  2DF4 C;  4J8X A;  3AZH B;  3AV2 C;  3LZ0 D;  4ZUX B;  5GT0 B;  1P3L D;  5FUG B;  3MGR B;  3AZJ A;  3B6F B;  1KX3 B;  3AZF D;  3REH B;  3C1C A;  3WTP A;  1P34 B;  3B0C T;  5CP6 B;  3AZJ D;  4LD9 A;  1P3O B;  4H9O B;  1P3F B;  2Y2G A;  5B31 G;  3C1C D;  3AZI A;  5B1M D;  4LD9 D;  4H9P A;  1F66 C;  5DNN A;  5B24 D;  3V9R B;  5B2I C;  5BNV A;  1ID3 A;  2YFV B;  3O62 C;  3AZI D;  5DNN D;  1BH8 A;  4KHA A;  3UTA B;  1EQZ D;  4YM6 C;  3NQJ A;  1ID3 D;  2ARO B;  3B6G C;  4Z66 A;  3REL A;  3LZ0 B;  2IO5 C;  5JA4 A;  5AVC A;  1P3L B;  3B0C W;  2BYM B;  3AZF B;  2J8P A;  3KXB C;  2F2A C;  5AV6 A;  2HIO A;  5AVC D;  3AZJ B;  5F99 D;  5AV8 A;  3MNN A;  4E45 A;  4KUD C;  5AV6 D;  2LY8 A;  5B1M B;  3AV2 A;  3TU4 D;  5C3I C;  3REK C;  4LD9 B;  5B24 B;  3MGQ C;  3AZE C;  3KFU G;  5AV8 D;  3C1B C;  3MVD C;  1ULY A;  4DRB A;  3AV2 D;  2Y2M A;  5DNN B;  1KX5 C;  1EQZ B;  5BNV B;  2CV5 D;  1ID3 B;  3VH5 A;  3AZG D;  3KUY D;  1BH8 B;  4NE5 A; 
#chains in the Genus database with same CATH homology
 4AWL C;  1F66 A;  4X23 C;  3AN2 B;  5B2I A;  2L5A A;  3MGP C;  3B0D C;  5JA4 B;  3O62 A;  2BYK A;  2XD1 A;  5AVC B;  1M19 B;  3WA9 C;  4G91 C;  1F66 D;  5F99 B;  1ZLA C;  4YM6 A;  5B2I D;  3AZN C;  3B6G A;  3W97 D;  3O62 D;  1T3U A;  5AV5 D;  3TU4 B;  2YFW B;  4Z2M G;  4ZBJ C;  3VH5 T;  5AV8 B;  4YM6 D;  3AZL C;  2Y2L A;  3X1T B;  3KXB A;  3AV2 B;  1KU5 A;  1N1J A;  2NZD C;  4R8P B;  2CV5 B;  2Y2O A;  3AZG B;  3KUY B;  4KUD A;  4H9S C;  3REK A;  1M1A C;  3MGQ A;  3AZE A;  3C1B A;  3MVD A;  1AOI D;  2JCH A;  4KUD D;  1S32 C;  3REK D;  5B0Y C;  3MGQ D;  3AFA D;  3AZE D;  1KX5 A;  2PYO C;  3C1B D;  2F8N A;  5B2I B;  4NFT A;  3W97 B;  3O62 B;  5B31 C;  5AV5 B;  3KWQ C;  4J8V C;  4HGA C;  1P3M D;  4WU9 C;  2F8N D;  5DNM C;  1M18 C;  4X23 A;  3MGP A;  2Y2I A;  3NQU A;  2IO5 B;  3WA9 A;  1ZLA A;  3X1V B;  3W98 B;  3MGP D;  1N1J B;  4J8W D;  4H9N A;  3AZN A;  5KDM B;  5CPI D;  3AYW C;  3W96 D;  1ZLA D;  3AZL A;  2ZY2 A;  1AOI B;  1A7W A;  4XUJ C;  4KUD B;  5GXQ C;  5BT1 C;  5C3I B;  3REK B;  3AFA B;  3AZE B;  2NZD A;  5B40 C;  5B32 B;  5CPJ C;  1U35 C;  1HQ3 A;  2Y2N A;  1P3M B;  4J8X D;  2NZD D;  2F8N B;  4H9S A;  1M1A A;  2DQN C;  5GT3 C;  4WU8 C;  2VQR A;  4DRA A;  1S32 A;  3WTP D;  5B0Y A;  2PYO A;  3NQU B;  3B0D B;  3MGS C;  4J8W B;  1S32 D;  5B31 A;  4KGC C;  3KWQ A;  4J8V A;  5CPI B;  1P3K C;  3W96 B;  2HUE C;  4WU9 A;  1P3B C;  4JJN C;  5DNM A;  2JE5 A;  3AZM C;  1M18 A;  5B31 D;  1Z2C B;  4J8V D;  4EO5 C;  4ZBJ B;  4WU9 D;  3REJ C;  3R45 B;  3LEL C;  4WNN A;  5GSU C;  4Z66 D;  2W8S A;  4J8X B;  1H3O A;  3REL D;  5BNX A;  3LJA C;  3AYW A;  4XUJ A;  3EPK A;  3WTP E;  5GXQ A;  3C1C B;  3WTP B;  2HIO D;  3AYW D;  2FJ7 C;  5B40 A;  1TZY C;  5CPJ A;  3MNN D;  4QLC C;  3X1U C;  3H0R C;  5BT1 D;  4YS3 C;  1U35 A;  1BH9 A;  3AZI B;  4H9P B;  5B40 D;  4M6B A;  4Z5T C;  4UUZ A;  5E5A C;  5GT3 A;  5B31 B;  4WU8 A;  4J8V B;  4HGA B;  4WU9 B;  3H0L C;  4CSR A;  4KHA B;  3NQJ B;  4WU8 D;  3WAA C;  3W99 C;  4Z66 B;  4NE3 A;  5AV9 C;  3REL B;  2NQB C;  3MGS A;  1P3A C;  4KGC A;  1P3K A;  1P3B A;  4JJN A;  5CPK C;  2F8N K;  4ZUX C;  3KSY A;  3MGS D;  3AZM A;  3MGR C;  4WV4 B;  2HIO B;  5AV6 B;  3AYW B;  1P3K D;  1KX3 C;  3B6F C;  3REJ A;  4WZS B;  2UWX A;  3MNN B;  3LEL A;  1P34 C;  3AZM D;  5GSU A;  3B6G D;  5B33 C;  1P3F C;  3REJ D;  2Y2P A;  5BS7 C;  5B40 B;  3LJA A;  3EPJ A;  4H9Q A;  1B67 A;  1BH9 B;  3KXB D;  1HQ3 C;  3LJA D;  1TAF A;  2FJ7 A;  5B0Z C;  4WU8 B;  1TZY A;  4QLC A;  3X1U A;  2F8N H;  4YS3 A;  2Y2J A;  3LZ1 C;  3AL0 C;  2ARO C;  1PZR A;  4H9R A;  4G92 C;  3LZ0 C;  1F66 B;  1TZY D;  4Z5T A;  5JRG C;  3MVD D;  4QLC D;  3X1U D;  5E5A A;  3MGS B;  4YS3 D;  1P3K B;  1P3P C;  3WKJ C;  2BYK B;  2Y2K A;  2Y2H A;  3AZF C;  1KX5 D;  4Z5T D;  4YM6 B;  3AZM B;  3B6G B;  5AV9 A;  3W99 A;  3WAA A;  1WWI A;  5B32 G;  2NQB A;  3VH6 A;  1P3A A;  2G5I C;  1W2E A;  5B1M C;  1P3I C;  5AV9 D;  3W99 D;  4ZUX A;  5B24 C;  4X23 D;  3KXB B;  5CPK A;  2NQB D;  3WAA D;  5FUG A;  3MGR A;  1P3A D;  3LJA B;  1R4V A;  4CAY A;  3B6F A;  4DQY B;  3WA9 D;  1KX3 A;  5CPK D;  1EQZ C;  4ZUX D;  1P34 A;  3AZN D;  1TAF B;  3B6F D;  5B33 A;  5B2J C;  4H9O A;  1P3F A;  5BS7 A;  3MGQ B;  3UT9 C;  1TZY B;  5AVB C;  3C1B B;  3MVD B;  4QLC B;  3X1U B;  3REI C;  3VH6 T;  3AZL D;  3AV1 C;  1P34 D;  4YS3 B;  2ZY5 A;  5B33 D;  3V9R A;  3AN2 C;  1KX5 B;  4Z5T B;  2YFV A;  2JSS A;  5B0Z A;  1M19 C;  2FFF B;  5F99 C;  1HQ3 D;  5B1L C;  3X1S C;  2XD5 A;  3LZ1 A;  2ARO A;  3FDD A;  5CHL B;  5B0Z D;  3LZ0 A;  4AWL B;  3TU4 C;  1M1A D;  5AV9 B;  3WAA B;  1F1E A;  4X23 B;  5JRG A;  2NQB B;  2ZY3 A;  3F6T A;  3MGP B;  1P3A B;  1KX4 C;  3LZ1 D;  1P3P A;  3WA9 B;  2ARO D;  3X1T C;  3WKJ A;  2BYM A;  3AZF A;  4G91 B;  5AY8 C;  5B0Y D;  5CPK B;  1ZLA B;  2PYO D;  1P3G C;  5JRG D;  4R8P C;  3AZK C;  2CV5 C;  3AZN B;  4H9N B;  4CAY B;  1P3P D;  3WKJ D;  3VH6 W;  3AZG C;  3KWQ D;  4J8U C;  3KUY C;  3UTB C;  5B1M A;  3AZL B;  1P3I A;  5DNM D;  5B24 A;  1M18 D;  5B33 B;  2NZD B;  1P3I D;  1EQZ A;  1HQ3 B;  3W97 C;  5B2J A;  5AV5 C;  5B0Z B;  3H0M C;  1M1A B;  3UT9 A;  5AVB A;  3REI A;  3AV1 A;  4XUJ D;  3A6N C;  3LZ1 B;  1S32 B;  5GXQ D;  4G92 B;  5B2J D;  3AN2 A;  5B0Y B;  3UT9 D;  5AVB D;  2PYO B;  3A1I A;  5JRG B;  3REI D;  3AV1 D;  1M19 A;  5G49 A;  5CPJ D;  1P3P B;  3WKJ B;  5F99 A;  3X1V C;  3KWQ B;  1U35 D;  3AN2 D;  5B1L A;  3X1S A;  3W98 C;  1BFM A;  3P5J B;  4XZQ C;  1M19 D;  5DNM B;  3TU4 A;  2YFW A;  1M18 B;  5GT3 D;  1KX4 A;  5B1L D;  3X1S D;  1AOI C;  1Q9C A;  5BO0 A;  3X1T A;  4UPK A;  1P3I B;  5AY8 A;  4WNN B;  3AFA C;  3AZH C;  3B0B A;  1P3G A;  4R8P A;  3AZK A;  5B32 C;  1KX4 D;  5GT0 C;  2CV5 A;  1H3O B;  5BNX B;  1JFI A;  3X1T D;  2ZY4 A;  3AZG A;  4KGC D;  5AY8 D;  3KUY A;  4J8U A;  3UTB A;  1P3M C;  4Z2M H;  3REH C;  1P3G D;  4NE6 A;  1P3B D;  4R8P D;  4JJN D;  3AZK D;  4XUJ B;  5GXQ B;  5CP6 C;  5B2J B;  2RVQ C;  2BG1 A;  4J8U D;  1P3O C;  3UTB D;  5AVB B;  3UT9 B;  3REI B;  3AV1 B;  5CPJ B;  3LEL D;  5GSU D;  1U35 B;  4E44 A;  3W97 A;  4J8W C;  5AV5 A;  5G49 B;  5CPI C;  3W96 C;  4UUZ B;  5GT3 B;  5B1L B;  3X1S B;  3UTA C;  3A6N A;  4CSR B;  1B6W A;  3EPL A;  2FJ7 D;  1KX4 B;  3A6N D;  1P3L C;  5BO0 B;  4KGC B;  3X1V A;  3W98 A;  5AY8 B;  2RIQ A;  2HUE B;  4J8X C;  1P3G B;  1P3B B;  3AZK B;  4JJN B;  4XZQ A;  5KDM A;  1JFI B;  5E5A D;  3AZJ C;  3X1V D;  3W98 D;  4J8U B;  1AOI A;  4EO5 B;  3UTB B;  3REJ B;  4XZQ D;  3C1C C;  3WTP C;  3LEL B;  3AFA A;  3AZH A;  5GSU B;  4LD9 C;  5B32 A;  2F8N G;  5GT0 A;  1HTA A;  3AZI C;  1P3M A;  3AZH D;  3REH A;  4H9Q B;  4WJ3 C;  5DNN C;  5B32 D;  3VH5 W;  5GT0 D;  5CP6 A;  3MGR D;  2G5H C;  1ID3 C;  1P3O A;  1KX3 D;  2FJ7 B;  3REH D;  3A6N B;  5CP6 D;  3EG5 B;  2RVQ D;  4H9R B;  4Z66 C;  1P3O D;  4J8W A;  3REL C;  1P3F D;  2CWE A;  5CPI A;  3W96 A;  1WWS A;  5E5A B;  5AVC C;  3A1K A;  3IP4 C;  3UTA A;  4XZQ B;  5AV6 C;  2HIO C;  2ZM5 A;  3EPH A;  2Y2Q A;  3W99 B;  5AV8 C;  3UTA D;  3R45 A;  3MNN C;  1P3L A;  2DF4 C;  4J8X A;  3AZH B;  3AV2 C;  3LZ0 D;  4ZUX B;  5GT0 B;  1P3L D;  5FUG B;  3MGR B;  3AZJ A;  3B6F B;  1KX3 B;  3AZF D;  3REH B;  3C1C A;  3WTP A;  1P34 B;  3B0C T;  5CP6 B;  3AZJ D;  4LD9 A;  1P3O B;  4H9O B;  1P3F B;  2Y2G A;  5B31 G;  3C1C D;  3AZI A;  5B1M D;  4LD9 D;  4H9P A;  1F66 C;  5DNN A;  5B24 D;  3V9R B;  5B2I C;  5BNV A;  1ID3 A;  2YFV B;  3O62 C;  3AZI D;  5DNN D;  1BH8 A;  4KHA A;  3UTA B;  1EQZ D;  4YM6 C;  3NQJ A;  1ID3 D;  2ARO B;  3B6G C;  4Z66 A;  3REL A;  3LZ0 B;  2IO5 C;  5JA4 A;  5AVC A;  1P3L B;  3B0C W;  2BYM B;  3AZF B;  2J8P A;  3KXB C;  2F2A C;  5AV6 A;  2HIO A;  5AVC D;  3AZJ B;  5F99 D;  5AV8 A;  3MNN A;  4E45 A;  4KUD C;  5AV6 D;  2LY8 A;  5B1M B;  3AV2 A;  3TU4 D;  5C3I C;  3REK C;  4LD9 B;  5B24 B;  3MGQ C;  3AZE C;  3KFU G;  5AV8 D;  3C1B C;  3MVD C;  1ULY A;  4DRB A;  3AV2 D;  2Y2M A;  5DNN B;  1KX5 C;  1EQZ B;  5BNV B;  2CV5 D;  1ID3 B;  3VH5 A;  3AZG D;  3KUY D;  1BH8 B;  4NE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...