3MGRB

Binding of rubidium ions to the nucleosome core particle
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgrB00
3AV2A 1EQZC 1P3LB 5BO0B 2AROB 5B33B 4KUDB 3AZFC 2AROC 1S32A 5AV8B 5B33C 2IO5C 4KUDC 4WU8A 5CPIC 1WWSA 4LD9A 3AZFD 3B0BA 1P3LD 2AROD 5B33D 4YS3B 4KUDD 3REHB 5CPID 3X1VA 5AV8D 3REHC 3MGQA 5B40C 4Z66B 5CPKB 4YS3D 5AY8A 5JRGC 3REHD 4KHAB 4Z66C 5CPKC 4NE5A 5B32G 5JRGD 4Z66D 5CPKD 4J8VB 3MGSB 2NZDC 3C1BC 3R45B 3MGSC 4J8VC 1P3KC 3UT9A 3MGPC 1F1EA 5B0ZA 4J8VD 3MGSD 5GSUC 1HQ3B 3LZ1A 3X1TA 1HQ3C 1TZYB 3AZJC 2F8NG 1TZYC 2FJ7A 3B6GC 2BYKB 5B24B 1HQ3D 3AZJD 3LZ0A 1AOIA 5B24C 1TZYD 4WZSB 3AYWB 5B24D 4QLCB 1KU5A 3REJB 3KXBB 3REJC 4J8UA 3R45A 3X1SA 1P3OA 3KXBC 1P3IB 3LELA 3LJAB 4HGAB 1P3IC 3REJD 3W98A 4AWLB 3LJAC 3KXBD 1ID3A 4YM6C 1P3ID 3LJAD 4J8XC 2HIOA 3KUYB 1KX4A 2F8NK 1U35C 5E5AC 3AZMA 4H9QA 3O62A 1M18B 4XZQA 3KUYD 5KDMB 4Z5TC 4X23B 3AN2B 4X23C 3AN2C 3VH5W 3REKB 3UTAA 3VH6W 4X23D 3AN2D 4XUJB 5AV9A 1P3BB 4H9SC 4H9OB 3NQJA 4NE6A 4DRAA 5AV6C 3WA9B 5DNMA 2NQBB 1H3OB 5BNXB 5B2JC 5B1LA 3MGRA 3AZHA 1P34B 4JJNB 2NQBC 3AFAB 3AZIB 3WA9D 4JJNC 2L5AA 5B2JD 3AFAC 5GXQC 5B31A 3UTBB 2CV5A 2NQBD 1P34D 1TAFB 3UTBC 1WWIA 5CP6A 4JJND 3AFAD 5GXQD 3AZID 3AZKB 3UTBD 3REKA 3TU4A 4WU9C 1P3AB 3WTPA 3X1UA 3V9RA 4WU9D 1M19B 3AZKD 1P3MA 5AV5A 3KWQA 4R8PA 4M6BA 3VH5A 3AZEA 3WTPE 1F66A 3VH6A 3AZNA 4CAYA 4CSRB 5GT3C 3AZLA 5JA4B 5B2IC 1P3PA 3MVDA 5F99C 1TAFA 3B6FA 5AVBA 4G91B 1B67A 3RELC 1KX3A 4KGCB 1EQZB 3AV2C 5GT0B 4KGCC 1BH9B 5B1MA 5BT1C 3AZFB 5GT0C 3B0CW 2IO5B 3AV2D 5CPIB 4KGCD 5DNNB 1S32C 4Z2MG 1EQZD 4WU8C 5BT1D 4WNNA 5GT0D 5DNNC 3NQUB 3W96A 5DNND 2F8NH 3MGQC 5B40B 3WAAB 5JRGB 5AVCB 3WAAC 3MGQD 5AVCC 5B40D 3WAAD 4NFTA 2NZDB 5AVCD 3C1BB 1P3KB 3MGPB 5B32B 1P3LA 5BO0A 2AROA 5B33A 5B32C 4KUDA 5GSUB 2NZDD 3C1BD 3W99B 2YFWB 5AV8A 3W99C 4NE3A 3AZJB 3MGPD 5B32D 1P3KD 3B6GB 4YS3A 5GSUD 3REHA 3W99D 2FJ7C 3LZ0C 1AOIC 1ZLAB 4H9PB 5BNVB 2F8NB 3AZGB 4Z66A 4E44A 1N1JB 5CPKA 1ZLAC 3B6GD 3AZGC 4KHAA 1ZLAD 3C1CB 2F8ND 3AZGD 3C1CC 4J8VA 3MGSA 2PYOB 3LELC 3C1CD 2PYOC 3W98C 4YM6B 1ULYA 4UUZB 1ID3C 3LELD 1HQ3A 2PYOD 5G49B 1BH8B 4J8XB 3W98D 1TZYA 1ID3D 1HTAA 2HIOC 4YM6D 2BYKA 5B24A 1R4VA 4J8XD 1U35B 5E5AB 2HIOD 1KX4C 4H9RB 1P3GB 3O62C 3REIB 1KX5B 1P3GC 3MNNB 3AYWA 4QLCA 3REIC 1KX5C 3MNNC 1U35D 4Z5TB 5E5AD 3REJA 1P3GD 1Q9CA 3REID 3KXBA 1KX5D 3MNND 1P3IA 3B0DB 2YFVB 4Z5TD 3LJAA 3UTAC 3B0DC 3VH6T 3UTAD 2BYMB 3W97B 5AV6B 1A7WA 3W97C 5B31G 5B2JB 4ZUXB 3KUYA 5B1LC 4ZUXC 3AZHC 3W97D 5AV6D 5GXQB 1M18A 5B1LD 4ZUXD 5B31C 4J8WB 5KDMA 3A6NB 4WV4B 4J8WC 4X23A 3A6NC 3AN2A 5B31D 4WU9B 3AV1B 3TU4C 4J8WD 1JFIB 4H9NB 3X1UC 3A6ND 3AV1C 5BS7A 5CPJB 3WKJB 4XUJA 1P3BA 3WKJC 3X1UD 3AV1D 5CPJC 4H9OA 3KWQC 4R8PC 5CPJD 3WKJD 3WA9A 4Z2MH 1M1AB 5B2JA 3AZEC 1F66C 1P3FB 5FUGB 5C3IC 1H3OA 5BNXA 5GT3B 5B0YB 3AZNC 1P34A 1M1AC 1P3FC 2NQBA 4JJNA 3AFAA 5B0YC 5GXQA 5B2IB 3AZIA 3AZLC 3AZND 1M1AD 5F99B 3UTBA 1P3PC 3MVDC 1P3FD 5GT3D 3B6FC 5B0YD 3RELB 5B2ID 3AZKA 1KX3C 5F99D 1P3AA 3AV2B 4DRBA 3RELD 5B1MC 1M19A 1S32B 4WU8B 2LY8A 4LD9B 4LD9C 3X1VB 1S32D 4EO5B 4WU8D 4CSRA 3X1VC 3MGQB 2CWEA 4LD9D 4EO5C 5JA4A 5AY8B 3X1VD 5AY8C 2RVQC 5AY8D 2RVQD 4KGCA 1EQZA 5GT0A 3UT9B 1BH9A 1BFMA 3AZFA 1P3LC 3UT9C 5B0ZB 5CPIA 5DNNA 5AV8C 5B0ZC 3LZ1B 3X1TB 3UT9D 3LZ1C 3X1TC 3NQUA 5B0ZD 2FJ7B 4YS3C 3LZ0B 1AOIB 3LZ1D 3X1TD 5B40A 3WAAA 5JRGA 2FJ7D 5AVCA 3LZ0D 1AOID 2NZDA 4J8UB 3C1BA 3X1SB 1P3OB 4J8UC 1P3KA 1B6WA 3LELB 3MGPA 5B32A 3X1SC 1P3OC 3W98B 1ID3B 5GSUA 4J8UD 3W99A 3X1SD 1P3OD 2YFWA 3AZJA 2HIOB 3B6GA 1KX4B 1ZLAA 4H9PA 5BNVA 3AZMB 2F8NA 4H9QB 3O62B 3AZGA 1N1JA 3AZMC 4XZQB 4QLCC 3AYWC 1KX4D 3C1CA 4XZQC 3AZMD 3O62D 3AYWD 4QLCD 4XZQD 2PYOA 3UTAB 4HGAC 4AWLC 4YM6A 4UUZA 5AV9B 3VH5T 5G49A 1BH8A 5AV9C 4J8XA 3NQJB 5AV9D 5DNMB 3KUYC 5E5AA 5B1LB 3MGRB 3AZHB 1U35A 4H9RA 5DNMC 1P3GA 3MGRC 3REIA 1KX5A 3MNNA 2CV5B 5B31B 1M18C 5DNMD 4Z5TA 3MGRD 2CV5C 3AZHD 5CP6B 1M18D 5CP6C 3TU4B 5CHLB 2CV5D 3WTPB 3X1UB 2YFVA 3REKC 5CP6D 3WTPC 3V9RB 5BS7C 1P3MB 5AV5B 4XUJC 4H9SA 3REKD 3TU4D 2BYMA 1P3BC 4ZBJB 3WTPD 1P3MC 5AV5C 3KWQB 4ZBJC 4R8PB 4XUJD 1P3BD 3W97A 5AV6A 1P3MD 5AV5D 3AZEB 1F66B 3WA9C 5C3IB 3AZNB 4ZUXA 4CAYB 3KWQD 1P34C 4R8PD 2HUEB 3AZLB 2HUEC 3AZED 3AZIC 1P3PB 3MVDB 1F66D 3B6FB 5AVBB 4J8WA 3A6NA 4G92B 3AZLD 5AVBC 1KX3B 4G92C 3AZKC 4WU9A 1P3PD 3MVDD 3AV1A 1P3AC 5AVBD 3B6FD 1JFIA 4H9NA 5B1MB 3KSYA 5CPJA 3WKJA 1KX3D 1P3AD 1M19C 2JSSA 4WNNB 1M19D 5B1MD 3B0CT 3W96B 1M1AA 3W96C 1P3FA 5FUGA 5GT3A 5B0YA 4E45A 5B2IA 3W96D 5F99A 4G91C 3RELA
chains in the Genus database with same CATH superfamily
3AV2A 1EQZC 2Y2LA 1P3LB 5BO0B 2AROB 5B33B 4KUDB 3AZFC 2AROC 1S32A 5AV8B 5B33C 2IO5C 4KUDC 4WU8A 5CPIC 1WWSA 2W8SA 4LD9A 3AZFD 3B0BA 1P3LD 2AROD 5B33D 4YS3B 4KUDD 3REHB 5CPID 3X1VA 5AV8D 3REHC 3MGQA 2Y2OA 5B40C 4Z66B 5CPKB 4YS3D 5AY8A 5JRGC 3REHD 4KHAB 4Z66C 5CPKC 4NE5A 5B32G 5JRGD 4Z66D 5CPKD 4J8VB 3MGSB 2NZDC 3C1BC 3R45B 3MGSC 4J8VC 1P3KC 2Y2HA 3UT9A 3MGPC 1F1EA 5B0ZA 4J8VD 3MGSD 5GSUC 1HQ3B 1PZRA 3LZ1A 3X1TA 1HQ3C 1TZYB 3AZJC 2F8NG 1TZYC 2FJ7A 3B6GC 2BYKB 5B24B 1HQ3D 3AZJD 3LZ0A 2NQBA 1AOIA 5B24C 1TZYD 2DF4C 4WZSB 3AYWB 5B24D 4QLCB 1KU5A 2RIQA 3REJB 3EPKA 3KXBB 3REJC 4J8UA 3R45A 3X1SA 1P3OA 3KXBC 1P3IB 3LELA 3LJAB 4HGAB 1P3IC 3REJD 3W98A 4AWLB 3LJAC 3KXBD 1ID3A 4YM6C 1P3ID 3LJAD 4J8XC 2HIOA 2BG1A 3KUYB 1KX4A 2F8NK 1U35C 5E5AC 3AZMA 4H9QA 3O62A 1M18B 4XZQA 3KUYD 5KDMB 4Z5TC 4X23B 3AN2B 4X23C 3AN2C 3VH5W 3REKB 3UTAA 3VH6W 4X23D 3AN2D 4XUJB 5AV9A 1P3BB 4H9SC 4H9OB 3IP4C 2JE5A 3NQJA 2Y2KA 2XD1A 4NE6A 4DRAA 5AV6C 3WA9B 5DNMA 2NQBB 1H3OB 5BNXB 5B2JC 5B1LA 3MGRA 3AZHA 1P34B 4JJNB 2NQBC 3AFAB 3AZIB 3WA9D 4JJNC 2L5AA 5B2JD 3AFAC 5GXQC 5B31A 3UTBB 2CV5A 2NQBD 1P34D 1TAFB 3UTBC 1WWIA 5CP6A 4JJND 1Z2CB 3AFAD 5GXQD 1T3UA 3AZID 3AZKB 3UTBD 3REKA 3TU4A 4WU9C 1P3AB 3WTPA 3X1UA 2G5IC 2F2AC 3V9RA 4WU9D 1M19B 3AZKD 1P3MA 5AV5A 3KWQA 4R8PA 4M6BA 3VH5A 3AZEA 3WTPE 1F66A 3VH6A 3AZNA 2Y2NA 4CAYA 4CSRB 5GT3C 3AZLA 4WJ3C 5JA4B 5B2IC 1P3PA 3MVDA 5F99C 1TAFA 3B6FA 5AVBA 4G91B 1B67A 3RELC 1KX3A 4KGCB 1EQZB 3AV2C 5GT0B 4KGCC 1BH9B 5B1MA 5BT1C 3AZFB 5GT0C 3B0CW 2IO5B 3AV2D 5CPIB 4KGCD 5DNNB 1S32C 4Z2MG 1EQZD 4WU8C 5BT1D 4WNNA 5GT0D 5DNNC 3EPHA 3NQUB 2VQRA 3W96A 5DNND 2F8NH 3MGQC 5B40B 3WAAB 5JRGB 2Y2QA 5AVCB 3WAAC 3MGQD 5AVCC 3A1IA 5B40D 3WAAD 4NFTA 2NZDB 5AVCD 3C1BB 2ZY3A 1P3KB 3MGPB 5B32B 1P3LA 5BO0A 2AROA 5B33A 5B32C 4KUDA 5GSUB 2NZDD 3C1BD 3W99B 2YFWB 5AV8A 3W99C 4NE3A 3AZJB 3MGPD 5B32D 1P3KD 3B6GB 2Y2MA 5GSUD 3REHA 4YS3A 3W99D 2FJ7C 3LZ0C 1AOIC 1ZLAB 4H9PB 5BNVB 2F8NB 3AZGB 4Z66A 4E44A 1N1JB 5CPKA 1ZLAC 3B6GD 3AZGC 4KHAA 1ZLAD 3C1CB 2F8ND 3AZGD 2DQNC 3C1CC 4J8VA 3MGSA 2PYOB 3LELC 3C1CD 2PYOC 3W98C 4YM6B 1ULYA 4UUZB 1ID3C 3LELD 1HQ3A 2PYOD 5G49B 1BH8B 4J8XB 3W98D 1TZYA 1ID3D 1HTAA 2HIOC 4YM6D 4UPKA 2BYKA 5B24A 1R4VA 4J8XD 1U35B 2JCHA 5E5AB 2HIOD 1KX4C 4H9RB 1P3GB 3O62C 3REIB 1KX5B 1P3GC 3MNNB 3AYWA 4QLCA 3REIC 1KX5C 3MNNC 1U35D 4Z5TB 5E5AD 3REJA 1P3GD 2XD5A 1Q9CA 3REID 3KXBA 1KX5D 3MNND 1P3IA 3B0DB 2YFVB 4Z5TD 3LJAA 3UTAC 3B0DC 3VH6T 3UTAD 2BYMB 3AL0C 3W97B 5AV6B 1A7WA 3W97C 5B31G 5B2JB 4ZUXB 3KUYA 5B1LC 4ZUXC 3AZHC 3W97D 5AV6D 5GXQB 1M18A 5B1LD 4ZUXD 5B31C 4J8WB 5KDMA 3A6NB 4WV4B 4J8WC 4X23A 3A6NC 3AN2A 5B31D 4WU9B 3AV1B 3TU4C 4J8WD 1JFIB 4H9NB 3X1UC 3A6ND 3AV1C 5BS7A 5CPJB 3WKJB 4XUJA 1P3BA 3WKJC 3X1UD 3AV1D 5CPJC 4H9OA 2ZY4A 3KWQC 4R8PC 5CPJD 3WKJD 3WA9A 4Z2MH 1M1AB 5B2JA 3AZEC 1F66C 1P3FB 2J8PA 5FUGB 1H3OA 5BNXA 5C3IC 5GT3B 5B0YB 3AZNC 1P34A 1P3FC 1M1AC 4JJNA 1W2EA 3AFAA 5B0YC 5GXQA 5B2IB 3AZIA 3AZLC 3AZND 1M1AD 5F99B 3UTBA 1P3PC 3MVDC 1P3FD 5GT3D 3B6FC 5B0YD 3RELB 5B2ID 3AZKA 3H0LC 1KX3C 5F99D 1P3AA 3AV2B 4DRBA 3RELD 5B1MC 1M19A 1S32B 4WU8B 2LY8A 4LD9B 4LD9C 3X1VB 1S32D 2ZM5A 4EO5B 4WU8D 4CSRA 3X1VC 3MGQB 2CWEA 4LD9D 4EO5C 5JA4A 5AY8B 3X1VD 2Y2JA 5AY8C 2G5HC 3H0RC 2RVQC 3EPJA 5AY8D 2RVQD 4KGCA 1EQZA 5GT0A 3UT9B 1BH9A 1BFMA 3AZFA 1P3LC 3UT9C 5B0ZB 5CPIA 5DNNA 5AV8C 5B0ZC 3LZ1B 3X1TB 3UT9D 3LZ1C 3X1TC 3NQUA 5B0ZD 2FJ7B 4YS3C 2UWXA 3LZ0B 1AOIB 3LZ1D 3X1TD 5B40A 3WAAA 5JRGA 2FJ7D 5AVCA 3LZ0D 1AOID 2NZDA 4J8UB 3C1BA 3X1SB 1P3OB 4J8UC 1P3KA 1B6WA 3LELB 3MGPA 5B32A 3X1SC 1P3OC 3W98B 3P5JB 5GSUA 1ID3B 4J8UD 3W99A 3X1SD 1P3OD 2YFWA 3EPLA 3AZJA 3KFUG 2HIOB 3B6GA 1KX4B 1ZLAA 4H9PA 5BNVA 3AZMB 2F8NA 4H9QB 3O62B 3AZGA 1N1JA 3AZMC 3H0MC 4XZQB 4QLCC 3AYWC 1KX4D 3C1CA 4XZQC 3AZMD 3O62D 3AYWD 4QLCD 4XZQD 2PYOA 3UTAB 4HGAC 4AWLC 4YM6A 4UUZA 5AV9B 3VH5T 2Y2IA 3EG5B 5G49A 1BH8A 5AV9C 4J8XA 3F6TA 3NQJB 5AV9D 5DNMB 3KUYC 5E5AA 5B1LB 3MGRB 3AZHB 1U35A 4H9RA 5DNMC 1P3GA 3MGRC 3REIA 1KX5A 3MNNA 2CV5B 5B31B 1M18C 5DNMD 4Z5TA 3MGRD 2CV5C 3AZHD 2Y2GA 5CP6B 1M18D 5CP6C 3TU4B 5CHLB 2FFFB 2CV5D 3WTPB 3X1UB 2YFVA 3REKC 5CP6D 3WTPC 3FDDA 3V9RB 5BS7C 1P3MB 5AV5B 4XUJC 4H9SA 3REKD 3TU4D 2BYMA 1P3BC 4ZBJB 3WTPD 1P3MC 5AV5C 3KWQB 4ZBJC 4R8PB 4XUJD 1P3BD 3W97A 5AV6A 1P3MD 2Y2PA 5AV5D 3AZEB 1F66B 3WA9C 5C3IB 3AZNB 4ZUXA 4CAYB 3A1KA 3KWQD 1P34C 4R8PD 2HUEB 3AZLB 2HUEC 3AZED 3AZIC 1P3PB 3MVDB 1F66D 3B6FB 5AVBB 4J8WA 3A6NA 4G92B 3AZLD 5AVBC 1KX3B 4G92C 3AZKC 4WU9A 1P3PD 3MVDD 3AV1A 1P3AC 5AVBD 3B6FD 1JFIA 4H9NA 5B1MB 3KSYA 5CPJA 3WKJA 1KX3D 1P3AD 1M19C 2JSSA 2ZY2A 4WNNB 1M19D 5B1MD 3B0CT 3W96B 1M1AA 3W96C 1P3FA 5FUGA 5GT3A 5B0YA 4E45A 5B2IA 3W96D 2ZY5A 5F99A 4DQYB 4G91C 3RELA
chains in the Genus database with same CATH topology
3AV2A 1EQZC 2Y2LA 1P3LB 5BO0B 2AROB 5B33B 4KUDB 3AZFC 2AROC 1S32A 5AV8B 5B33C 2IO5C 4KUDC 4WU8A 5CPIC 1WWSA 2W8SA 4LD9A 3AZFD 3B0BA 1P3LD 2AROD 5B33D 4YS3B 4KUDD 3REHB 5CPID 3X1VA 5AV8D 3REHC 3MGQA 2Y2OA 5B40C 4Z66B 5CPKB 4YS3D 5AY8A 5JRGC 3REHD 4KHAB 4Z66C 5CPKC 4NE5A 5B32G 5JRGD 4Z66D 5CPKD 4J8VB 3MGSB 2NZDC 3C1BC 3R45B 3MGSC 4J8VC 1P3KC 2Y2HA 3UT9A 3MGPC 1F1EA 5B0ZA 4J8VD 3MGSD 5GSUC 1HQ3B 1PZRA 3LZ1A 3X1TA 1HQ3C 1TZYB 3AZJC 2F8NG 1TZYC 2FJ7A 3B6GC 2BYKB 5B24B 1HQ3D 3AZJD 3LZ0A 2NQBA 1AOIA 5B24C 1TZYD 2DF4C 4WZSB 3AYWB 5B24D 4QLCB 1KU5A 2RIQA 3REJB 3EPKA 3KXBB 3REJC 4J8UA 3R45A 3X1SA 1P3OA 3KXBC 1P3IB 3LELA 3LJAB 4HGAB 1P3IC 3REJD 3W98A 4AWLB 3LJAC 3KXBD 1ID3A 4YM6C 1P3ID 3LJAD 4J8XC 2HIOA 2BG1A 3KUYB 1KX4A 2F8NK 1U35C 5E5AC 3AZMA 4H9QA 3O62A 1M18B 4XZQA 3KUYD 5KDMB 4Z5TC 4X23B 3AN2B 4X23C 3AN2C 3VH5W 3REKB 3UTAA 3VH6W 4X23D 3AN2D 4XUJB 5AV9A 1P3BB 4H9SC 4H9OB 3IP4C 2JE5A 3NQJA 2Y2KA 2XD1A 4NE6A 4DRAA 5AV6C 3WA9B 5DNMA 2NQBB 1H3OB 5BNXB 5B2JC 5B1LA 3MGRA 3AZHA 1P34B 4JJNB 2NQBC 3AFAB 3AZIB 3WA9D 4JJNC 2L5AA 5B2JD 3AFAC 5GXQC 5B31A 3UTBB 2CV5A 2NQBD 1P34D 1TAFB 3UTBC 1WWIA 5CP6A 4JJND 1Z2CB 3AFAD 5GXQD 1T3UA 3AZID 3AZKB 3UTBD 3REKA 3TU4A 4WU9C 1P3AB 3WTPA 3X1UA 2G5IC 2F2AC 3V9RA 4WU9D 1M19B 3AZKD 1P3MA 5AV5A 3KWQA 4R8PA 4M6BA 3VH5A 3AZEA 3WTPE 1F66A 3VH6A 3AZNA 2Y2NA 4CAYA 4CSRB 5GT3C 3AZLA 4WJ3C 5JA4B 5B2IC 1P3PA 3MVDA 5F99C 1TAFA 3B6FA 5AVBA 4G91B 1B67A 3RELC 1KX3A 4KGCB 1EQZB 3AV2C 5GT0B 4KGCC 1BH9B 5B1MA 5BT1C 3AZFB 5GT0C 3B0CW 2IO5B 3AV2D 5CPIB 4KGCD 5DNNB 1S32C 4Z2MG 1EQZD 4WU8C 5BT1D 4WNNA 5GT0D 5DNNC 3EPHA 3NQUB 2VQRA 3W96A 5DNND 2F8NH 3MGQC 5B40B 3WAAB 5JRGB 2Y2QA 5AVCB 3WAAC 3MGQD 5AVCC 3A1IA 5B40D 3WAAD 4NFTA 2NZDB 5AVCD 3C1BB 2ZY3A 1P3KB 3MGPB 5B32B 1P3LA 5BO0A 2AROA 5B33A 5B32C 4KUDA 5GSUB 2NZDD 3C1BD 3W99B 2YFWB 5AV8A 3W99C 4NE3A 3AZJB 3MGPD 5B32D 1P3KD 3B6GB 2Y2MA 5GSUD 3REHA 4YS3A 3W99D 2FJ7C 3LZ0C 1AOIC 1ZLAB 4H9PB 5BNVB 2F8NB 3AZGB 4Z66A 4E44A 1N1JB 5CPKA 1ZLAC 3B6GD 3AZGC 4KHAA 1ZLAD 3C1CB 2F8ND 3AZGD 2DQNC 3C1CC 4J8VA 3MGSA 2PYOB 3LELC 3C1CD 2PYOC 3W98C 4YM6B 1ULYA 4UUZB 1ID3C 3LELD 1HQ3A 2PYOD 5G49B 1BH8B 4J8XB 3W98D 1TZYA 1ID3D 1HTAA 2HIOC 4YM6D 4UPKA 2BYKA 5B24A 1R4VA 4J8XD 1U35B 2JCHA 5E5AB 2HIOD 1KX4C 4H9RB 1P3GB 3O62C 3REIB 1KX5B 1P3GC 3MNNB 3AYWA 4QLCA 3REIC 1KX5C 3MNNC 1U35D 4Z5TB 5E5AD 3REJA 1P3GD 2XD5A 1Q9CA 3REID 3KXBA 1KX5D 3MNND 1P3IA 3B0DB 2YFVB 4Z5TD 3LJAA 3UTAC 3B0DC 3VH6T 3UTAD 2BYMB 3AL0C 3W97B 5AV6B 1A7WA 3W97C 5B31G 5B2JB 4ZUXB 3KUYA 5B1LC 4ZUXC 3AZHC 3W97D 5AV6D 5GXQB 1M18A 5B1LD 4ZUXD 5B31C 4J8WB 5KDMA 3A6NB 4WV4B 4J8WC 4X23A 3A6NC 3AN2A 5B31D 4WU9B 3AV1B 3TU4C 4J8WD 1JFIB 4H9NB 3X1UC 3A6ND 3AV1C 5BS7A 5CPJB 3WKJB 4XUJA 1P3BA 3WKJC 3X1UD 3AV1D 5CPJC 4H9OA 2ZY4A 3KWQC 4R8PC 5CPJD 3WKJD 3WA9A 4Z2MH 1M1AB 5B2JA 3AZEC 1F66C 1P3FB 2J8PA 5FUGB 1H3OA 5BNXA 5C3IC 5GT3B 5B0YB 3AZNC 1P34A 1P3FC 1M1AC 4JJNA 1W2EA 3AFAA 5B0YC 5GXQA 5B2IB 3AZIA 3AZLC 3AZND 1M1AD 5F99B 3UTBA 1P3PC 3MVDC 1P3FD 5GT3D 3B6FC 5B0YD 3RELB 5B2ID 3AZKA 3H0LC 1KX3C 5F99D 1P3AA 3AV2B 4DRBA 3RELD 5B1MC 1M19A 1S32B 4WU8B 2LY8A 4LD9B 4LD9C 3X1VB 1S32D 2ZM5A 4EO5B 4WU8D 4CSRA 3X1VC 3MGQB 2CWEA 4LD9D 4EO5C 5JA4A 5AY8B 3X1VD 2Y2JA 5AY8C 2G5HC 3H0RC 2RVQC 3EPJA 5AY8D 2RVQD 4KGCA 1EQZA 5GT0A 3UT9B 1BH9A 1BFMA 3AZFA 1P3LC 3UT9C 5B0ZB 5CPIA 5DNNA 5AV8C 5B0ZC 3LZ1B 3X1TB 3UT9D 3LZ1C 3X1TC 3NQUA 5B0ZD 2FJ7B 4YS3C 2UWXA 3LZ0B 1AOIB 3LZ1D 3X1TD 5B40A 3WAAA 5JRGA 2FJ7D 5AVCA 3LZ0D 1AOID 2NZDA 4J8UB 3C1BA 3X1SB 1P3OB 4J8UC 1P3KA 1B6WA 3LELB 3MGPA 5B32A 3X1SC 1P3OC 3W98B 3P5JB 5GSUA 1ID3B 4J8UD 3W99A 3X1SD 1P3OD 2YFWA 3EPLA 3AZJA 3KFUG 2HIOB 3B6GA 1KX4B 1ZLAA 4H9PA 5BNVA 3AZMB 2F8NA 4H9QB 3O62B 3AZGA 1N1JA 3AZMC 3H0MC 4XZQB 4QLCC 3AYWC 1KX4D 3C1CA 4XZQC 3AZMD 3O62D 3AYWD 4QLCD 4XZQD 2PYOA 3UTAB 4HGAC 4AWLC 4YM6A 4UUZA 5AV9B 3VH5T 2Y2IA 3EG5B 5G49A 1BH8A 5AV9C 4J8XA 3F6TA 3NQJB 5AV9D 5DNMB 3KUYC 5E5AA 5B1LB 3MGRB 3AZHB 1U35A 4H9RA 5DNMC 1P3GA 3MGRC 3REIA 1KX5A 3MNNA 2CV5B 5B31B 1M18C 5DNMD 4Z5TA 3MGRD 2CV5C 3AZHD 2Y2GA 5CP6B 1M18D 5CP6C 3TU4B 5CHLB 2FFFB 2CV5D 3WTPB 3X1UB 2YFVA 3REKC 5CP6D 3WTPC 3FDDA 3V9RB 5BS7C 1P3MB 5AV5B 4XUJC 4H9SA 3REKD 3TU4D 2BYMA 1P3BC 4ZBJB 3WTPD 1P3MC 5AV5C 3KWQB 4ZBJC 4R8PB 4XUJD 1P3BD 3W97A 5AV6A 1P3MD 2Y2PA 5AV5D 3AZEB 1F66B 3WA9C 5C3IB 3AZNB 4ZUXA 4CAYB 3A1KA 3KWQD 1P34C 4R8PD 2HUEB 3AZLB 2HUEC 3AZED 3AZIC 1P3PB 3MVDB 1F66D 3B6FB 5AVBB 4J8WA 3A6NA 4G92B 3AZLD 5AVBC 1KX3B 4G92C 3AZKC 4WU9A 1P3PD 3MVDD 3AV1A 1P3AC 5AVBD 3B6FD 1JFIA 4H9NA 5B1MB 3KSYA 5CPJA 3WKJA 1KX3D 1P3AD 1M19C 2JSSA 2ZY2A 4WNNB 1M19D 5B1MD 3B0CT 3W96B 1M1AA 3W96C 1P3FA 5FUGA 5GT3A 5B0YA 4E45A 5B2IA 3W96D 2ZY5A 5F99A 4DQYB 4G91C 3RELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV2 A;  1EQZ C;  1P3L B;  5BO0 B;  2ARO B;  5B33 B;  4KUD B;  3AZF C;  2ARO C;  1S32 A;  5AV8 B;  5B33 C;  2IO5 C;  4KUD C;  4WU8 A;  5CPI C;  1WWS A;  4LD9 A;  3AZF D;  3B0B A;  1P3L D;  2ARO D;  5B33 D;  4YS3 B;  4KUD D;  3REH B;  5CPI D;  3X1V A;  5AV8 D;  3REH C;  3MGQ A;  5B40 C;  4Z66 B;  5CPK B;  4YS3 D;  5AY8 A;  5JRG C;  3REH D;  4KHA B;  4Z66 C;  5CPK C;  4NE5 A;  5B32 G;  5JRG D;  4Z66 D;  5CPK D;  4J8V B;  3MGS B;  2NZD C;  3C1B C;  3R45 B;  3MGS C;  4J8V C;  1P3K C;  3UT9 A;  3MGP C;  1F1E A;  5B0Z A;  4J8V D;  3MGS D;  5GSU C;  1HQ3 B;  3LZ1 A;  3X1T A;  1HQ3 C;  1TZY B;  3AZJ C;  2F8N G;  1TZY C;  2FJ7 A;  3B6G C;  2BYK B;  5B24 B;  1HQ3 D;  3AZJ D;  3LZ0 A;  1AOI A;  5B24 C;  1TZY D;  4WZS B;  3AYW B;  5B24 D;  4QLC B;  1KU5 A;  3REJ B;  3KXB B;  3REJ C;  4J8U A;  3R45 A;  3X1S A;  1P3O A;  3KXB C;  1P3I B;  3LEL A;  3LJA B;  4HGA B;  1P3I C;  3REJ D;  3W98 A;  4AWL B;  3LJA C;  3KXB D;  1ID3 A;  4YM6 C;  1P3I D;  3LJA D;  4J8X C;  2HIO A;  3KUY B;  1KX4 A;  2F8N K;  1U35 C;  5E5A C;  3AZM A;  4H9Q A;  3O62 A;  1M18 B;  4XZQ A;  3KUY D;  5KDM B;  4Z5T C;  4X23 B;  3AN2 B;  4X23 C;  3AN2 C;  3VH5 W;  3REK B;  3UTA A;  3VH6 W;  4X23 D;  3AN2 D;  4XUJ B;  5AV9 A;  1P3B B;  4H9S C;  4H9O B;  3NQJ A;  4NE6 A;  4DRA A;  5AV6 C;  3WA9 B;  5DNM A;  2NQB B;  1H3O B;  5BNX B;  5B2J C;  5B1L A;  3MGR A;  3AZH A;  1P34 B;  4JJN B;  2NQB C;  3AFA B;  3AZI B;  3WA9 D;  4JJN C;  2L5A A;  5B2J D;  3AFA C;  5GXQ C;  5B31 A;  3UTB B;  2CV5 A;  2NQB D;  1P34 D;  1TAF B;  3UTB C;  1WWI A;  5CP6 A;  4JJN D;  3AFA D;  5GXQ D;  3AZI D;  3AZK B;  3UTB D;  3REK A;  3TU4 A;  4WU9 C;  1P3A B;  3WTP A;  3X1U A;  3V9R A;  4WU9 D;  1M19 B;  3AZK D;  1P3M A;  5AV5 A;  3KWQ A;  4R8P A;  4M6B A;  3VH5 A;  3AZE A;  3WTP E;  1F66 A;  3VH6 A;  3AZN A;  4CAY A;  4CSR B;  5GT3 C;  3AZL A;  5JA4 B;  5B2I C;  1P3P A;  3MVD A;  5F99 C;  1TAF A;  3B6F A;  5AVB A;  4G91 B;  1B67 A;  3REL C;  1KX3 A;  4KGC B;  1EQZ B;  3AV2 C;  5GT0 B;  4KGC C;  1BH9 B;  5B1M A;  5BT1 C;  3AZF B;  5GT0 C;  3B0C W;  2IO5 B;  3AV2 D;  5CPI B;  4KGC D;  5DNN B;  1S32 C;  4Z2M G;  1EQZ D;  4WU8 C;  5BT1 D;  4WNN A;  5GT0 D;  5DNN C;  3NQU B;  3W96 A;  5DNN D;  2F8N H;  3MGQ C;  5B40 B;  3WAA B;  5JRG B;  5AVC B;  3WAA C;  3MGQ D;  5AVC C;  5B40 D;  3WAA D;  4NFT A;  2NZD B;  5AVC D;  3C1B B;  1P3K B;  3MGP B;  5B32 B;  1P3L A;  5BO0 A;  2ARO A;  5B33 A;  5B32 C;  4KUD A;  5GSU B;  2NZD D;  3C1B D;  3W99 B;  2YFW B;  5AV8 A;  3W99 C;  4NE3 A;  3AZJ B;  3MGP D;  5B32 D;  1P3K D;  3B6G B;  4YS3 A;  5GSU D;  3REH A;  3W99 D;  2FJ7 C;  3LZ0 C;  1AOI C;  1ZLA B;  4H9P B;  5BNV B;  2F8N B;  3AZG B;  4Z66 A;  4E44 A;  1N1J B;  5CPK A;  1ZLA C;  3B6G D;  3AZG C;  4KHA A;  1ZLA D;  3C1C B;  2F8N D;  3AZG D;  3C1C C;  4J8V A;  3MGS A;  2PYO B;  3LEL C;  3C1C D;  2PYO C;  3W98 C;  4YM6 B;  1ULY A;  4UUZ B;  1ID3 C;  3LEL D;  1HQ3 A;  2PYO D;  5G49 B;  1BH8 B;  4J8X B;  3W98 D;  1TZY A;  1ID3 D;  1HTA A;  2HIO C;  4YM6 D;  2BYK A;  5B24 A;  1R4V A;  4J8X D;  1U35 B;  5E5A B;  2HIO D;  1KX4 C;  4H9R B;  1P3G B;  3O62 C;  3REI B;  1KX5 B;  1P3G C;  3MNN B;  3AYW A;  4QLC A;  3REI C;  1KX5 C;  3MNN C;  1U35 D;  4Z5T B;  5E5A D;  3REJ A;  1P3G D;  1Q9C A;  3REI D;  3KXB A;  1KX5 D;  3MNN D;  1P3I A;  3B0D B;  2YFV B;  4Z5T D;  3LJA A;  3UTA C;  3B0D C;  3VH6 T;  3UTA D;  2BYM B;  3W97 B;  5AV6 B;  1A7W A;  3W97 C;  5B31 G;  5B2J B;  4ZUX B;  3KUY A;  5B1L C;  4ZUX C;  3AZH C;  3W97 D;  5AV6 D;  5GXQ B;  1M18 A;  5B1L D;  4ZUX D;  5B31 C;  4J8W B;  5KDM A;  3A6N B;  4WV4 B;  4J8W C;  4X23 A;  3A6N C;  3AN2 A;  5B31 D;  4WU9 B;  3AV1 B;  3TU4 C;  4J8W D;  1JFI B;  4H9N B;  3X1U C;  3A6N D;  3AV1 C;  5BS7 A;  5CPJ B;  3WKJ B;  4XUJ A;  1P3B A;  3WKJ C;  3X1U D;  3AV1 D;  5CPJ C;  4H9O A;  3KWQ C;  4R8P C;  5CPJ D;  3WKJ D;  3WA9 A;  4Z2M H;  1M1A B;  5B2J A;  3AZE C;  1F66 C;  1P3F B;  5FUG B;  5C3I C;  1H3O A;  5BNX A;  5GT3 B;  5B0Y B;  3AZN C;  1P34 A;  1M1A C;  1P3F C;  2NQB A;  4JJN A;  3AFA A;  5B0Y C;  5GXQ A;  5B2I B;  3AZI A;  3AZL C;  3AZN D;  1M1A D;  5F99 B;  3UTB A;  1P3P C;  3MVD C;  1P3F D;  5GT3 D;  3B6F C;  5B0Y D;  3REL B;  5B2I D;  3AZK A;  1KX3 C;  5F99 D;  1P3A A;  3AV2 B;  4DRB A;  3REL D;  5B1M C;  1M19 A;  1S32 B;  4WU8 B;  2LY8 A;  4LD9 B;  4LD9 C;  3X1V B;  1S32 D;  4EO5 B;  4WU8 D;  4CSR A;  3X1V C;  3MGQ B;  2CWE A;  4LD9 D;  4EO5 C;  5JA4 A;  5AY8 B;  3X1V D;  5AY8 C;  2RVQ C;  5AY8 D;  2RVQ D;  4KGC A;  1EQZ A;  5GT0 A;  3UT9 B;  1BH9 A;  1BFM A;  3AZF A;  1P3L C;  3UT9 C;  5B0Z B;  5CPI A;  5DNN A;  5AV8 C;  5B0Z C;  3LZ1 B;  3X1T B;  3UT9 D;  3LZ1 C;  3X1T C;  3NQU A;  5B0Z D;  2FJ7 B;  4YS3 C;  3LZ0 B;  1AOI B;  3LZ1 D;  3X1T D;  5B40 A;  3WAA A;  5JRG A;  2FJ7 D;  5AVC A;  3LZ0 D;  1AOI D;  2NZD A;  4J8U B;  3C1B A;  3X1S B;  1P3O B;  4J8U C;  1P3K A;  1B6W A;  3LEL B;  3MGP A;  5B32 A;  3X1S C;  1P3O C;  3W98 B;  1ID3 B;  5GSU A;  4J8U D;  3W99 A;  3X1S D;  1P3O D;  2YFW A;  3AZJ A;  2HIO B;  3B6G A;  1KX4 B;  1ZLA A;  4H9P A;  5BNV A;  3AZM B;  2F8N A;  4H9Q B;  3O62 B;  3AZG A;  1N1J A;  3AZM C;  4XZQ B;  4QLC C;  3AYW C;  1KX4 D;  3C1C A;  4XZQ C;  3AZM D;  3O62 D;  3AYW D;  4QLC D;  4XZQ D;  2PYO A;  3UTA B;  4HGA C;  4AWL C;  4YM6 A;  4UUZ A;  5AV9 B;  3VH5 T;  5G49 A;  1BH8 A;  5AV9 C;  4J8X A;  3NQJ B;  5AV9 D;  5DNM B;  3KUY C;  5E5A A;  5B1L B;  3MGR B;  3AZH B;  1U35 A;  4H9R A;  5DNM C;  1P3G A;  3MGR C;  3REI A;  1KX5 A;  3MNN A;  2CV5 B;  5B31 B;  1M18 C;  5DNM D;  4Z5T A;  3MGR D;  2CV5 C;  3AZH D;  5CP6 B;  1M18 D;  5CP6 C;  3TU4 B;  5CHL B;  2CV5 D;  3WTP B;  3X1U B;  2YFV A;  3REK C;  5CP6 D;  3WTP C;  3V9R B;  5BS7 C;  1P3M B;  5AV5 B;  4XUJ C;  4H9S A;  3REK D;  3TU4 D;  2BYM A;  1P3B C;  4ZBJ B;  3WTP D;  1P3M C;  5AV5 C;  3KWQ B;  4ZBJ C;  4R8P B;  4XUJ D;  1P3B D;  3W97 A;  5AV6 A;  1P3M D;  5AV5 D;  3AZE B;  1F66 B;  3WA9 C;  5C3I B;  3AZN B;  4ZUX A;  4CAY B;  3KWQ D;  1P34 C;  4R8P D;  2HUE B;  3AZL B;  2HUE C;  3AZE D;  3AZI C;  1P3P B;  3MVD B;  1F66 D;  3B6F B;  5AVB B;  4J8W A;  3A6N A;  4G92 B;  3AZL D;  5AVB C;  1KX3 B;  4G92 C;  3AZK C;  4WU9 A;  1P3P D;  3MVD D;  3AV1 A;  1P3A C;  5AVB D;  3B6F D;  1JFI A;  4H9N A;  5B1M B;  3KSY A;  5CPJ A;  3WKJ A;  1KX3 D;  1P3A D;  1M19 C;  2JSS A;  4WNN B;  1M19 D;  5B1M D;  3B0C T;  3W96 B;  1M1A A;  3W96 C;  1P3F A;  5FUG A;  5GT3 A;  5B0Y A;  4E45 A;  5B2I A;  3W96 D;  5F99 A;  4G91 C;  3REL A; 
#chains in the Genus database with same CATH topology
 3AV2 A;  1EQZ C;  2Y2L A;  1P3L B;  5BO0 B;  2ARO B;  5B33 B;  4KUD B;  3AZF C;  2ARO C;  1S32 A;  5AV8 B;  5B33 C;  2IO5 C;  4KUD C;  4WU8 A;  5CPI C;  1WWS A;  2W8S A;  4LD9 A;  3AZF D;  3B0B A;  1P3L D;  2ARO D;  5B33 D;  4YS3 B;  4KUD D;  3REH B;  5CPI D;  3X1V A;  5AV8 D;  3REH C;  3MGQ A;  2Y2O A;  5B40 C;  4Z66 B;  5CPK B;  4YS3 D;  5AY8 A;  5JRG C;  3REH D;  4KHA B;  4Z66 C;  5CPK C;  4NE5 A;  5B32 G;  5JRG D;  4Z66 D;  5CPK D;  4J8V B;  3MGS B;  2NZD C;  3C1B C;  3R45 B;  3MGS C;  4J8V C;  1P3K C;  2Y2H A;  3UT9 A;  3MGP C;  1F1E A;  5B0Z A;  4J8V D;  3MGS D;  5GSU C;  1HQ3 B;  1PZR A;  3LZ1 A;  3X1T A;  1HQ3 C;  1TZY B;  3AZJ C;  2F8N G;  1TZY C;  2FJ7 A;  3B6G C;  2BYK B;  5B24 B;  1HQ3 D;  3AZJ D;  3LZ0 A;  2NQB A;  1AOI A;  5B24 C;  1TZY D;  2DF4 C;  4WZS B;  3AYW B;  5B24 D;  4QLC B;  1KU5 A;  2RIQ A;  3REJ B;  3EPK A;  3KXB B;  3REJ C;  4J8U A;  3R45 A;  3X1S A;  1P3O A;  3KXB C;  1P3I B;  3LEL A;  3LJA B;  4HGA B;  1P3I C;  3REJ D;  3W98 A;  4AWL B;  3LJA C;  3KXB D;  1ID3 A;  4YM6 C;  1P3I D;  3LJA D;  4J8X C;  2HIO A;  2BG1 A;  3KUY B;  1KX4 A;  2F8N K;  1U35 C;  5E5A C;  3AZM A;  4H9Q A;  3O62 A;  1M18 B;  4XZQ A;  3KUY D;  5KDM B;  4Z5T C;  4X23 B;  3AN2 B;  4X23 C;  3AN2 C;  3VH5 W;  3REK B;  3UTA A;  3VH6 W;  4X23 D;  3AN2 D;  4XUJ B;  5AV9 A;  1P3B B;  4H9S C;  4H9O B;  3IP4 C;  2JE5 A;  3NQJ A;  2Y2K A;  2XD1 A;  4NE6 A;  4DRA A;  5AV6 C;  3WA9 B;  5DNM A;  2NQB B;  1H3O B;  5BNX B;  5B2J C;  5B1L A;  3MGR A;  3AZH A;  1P34 B;  4JJN B;  2NQB C;  3AFA B;  3AZI B;  3WA9 D;  4JJN C;  2L5A A;  5B2J D;  3AFA C;  5GXQ C;  5B31 A;  3UTB B;  2CV5 A;  2NQB D;  1P34 D;  1TAF B;  3UTB C;  1WWI A;  5CP6 A;  4JJN D;  1Z2C B;  3AFA D;  5GXQ D;  1T3U A;  3AZI D;  3AZK B;  3UTB D;  3REK A;  3TU4 A;  4WU9 C;  1P3A B;  3WTP A;  3X1U A;  2G5I C;  2F2A C;  3V9R A;  4WU9 D;  1M19 B;  3AZK D;  1P3M A;  5AV5 A;  3KWQ A;  4R8P A;  4M6B A;  3VH5 A;  3AZE A;  3WTP E;  1F66 A;  3VH6 A;  3AZN A;  2Y2N A;  4CAY A;  4CSR B;  5GT3 C;  3AZL A;  4WJ3 C;  5JA4 B;  5B2I C;  1P3P A;  3MVD A;  5F99 C;  1TAF A;  3B6F A;  5AVB A;  4G91 B;  1B67 A;  3REL C;  1KX3 A;  4KGC B;  1EQZ B;  3AV2 C;  5GT0 B;  4KGC C;  1BH9 B;  5B1M A;  5BT1 C;  3AZF B;  5GT0 C;  3B0C W;  2IO5 B;  3AV2 D;  5CPI B;  4KGC D;  5DNN B;  1S32 C;  4Z2M G;  1EQZ D;  4WU8 C;  5BT1 D;  4WNN A;  5GT0 D;  5DNN C;  3EPH A;  3NQU B;  2VQR A;  3W96 A;  5DNN D;  2F8N H;  3MGQ C;  5B40 B;  3WAA B;  5JRG B;  2Y2Q A;  5AVC B;  3WAA C;  3MGQ D;  5AVC C;  3A1I A;  5B40 D;  3WAA D;  4NFT A;  2NZD B;  5AVC D;  3C1B B;  2ZY3 A;  1P3K B;  3MGP B;  5B32 B;  1P3L A;  5BO0 A;  2ARO A;  5B33 A;  5B32 C;  4KUD A;  5GSU B;  2NZD D;  3C1B D;  3W99 B;  2YFW B;  5AV8 A;  3W99 C;  4NE3 A;  3AZJ B;  3MGP D;  5B32 D;  1P3K D;  3B6G B;  2Y2M A;  5GSU D;  3REH A;  4YS3 A;  3W99 D;  2FJ7 C;  3LZ0 C;  1AOI C;  1ZLA B;  4H9P B;  5BNV B;  2F8N B;  3AZG B;  4Z66 A;  4E44 A;  1N1J B;  5CPK A;  1ZLA C;  3B6G D;  3AZG C;  4KHA A;  1ZLA D;  3C1C B;  2F8N D;  3AZG D;  2DQN C;  3C1C C;  4J8V A;  3MGS A;  2PYO B;  3LEL C;  3C1C D;  2PYO C;  3W98 C;  4YM6 B;  1ULY A;  4UUZ B;  1ID3 C;  3LEL D;  1HQ3 A;  2PYO D;  5G49 B;  1BH8 B;  4J8X B;  3W98 D;  1TZY A;  1ID3 D;  1HTA A;  2HIO C;  4YM6 D;  4UPK A;  2BYK A;  5B24 A;  1R4V A;  4J8X D;  1U35 B;  2JCH A;  5E5A B;  2HIO D;  1KX4 C;  4H9R B;  1P3G B;  3O62 C;  3REI B;  1KX5 B;  1P3G C;  3MNN B;  3AYW A;  4QLC A;  3REI C;  1KX5 C;  3MNN C;  1U35 D;  4Z5T B;  5E5A D;  3REJ A;  1P3G D;  2XD5 A;  1Q9C A;  3REI D;  3KXB A;  1KX5 D;  3MNN D;  1P3I A;  3B0D B;  2YFV B;  4Z5T D;  3LJA A;  3UTA C;  3B0D C;  3VH6 T;  3UTA D;  2BYM B;  3AL0 C;  3W97 B;  5AV6 B;  1A7W A;  3W97 C;  5B31 G;  5B2J B;  4ZUX B;  3KUY A;  5B1L C;  4ZUX C;  3AZH C;  3W97 D;  5AV6 D;  5GXQ B;  1M18 A;  5B1L D;  4ZUX D;  5B31 C;  4J8W B;  5KDM A;  3A6N B;  4WV4 B;  4J8W C;  4X23 A;  3A6N C;  3AN2 A;  5B31 D;  4WU9 B;  3AV1 B;  3TU4 C;  4J8W D;  1JFI B;  4H9N B;  3X1U C;  3A6N D;  3AV1 C;  5BS7 A;  5CPJ B;  3WKJ B;  4XUJ A;  1P3B A;  3WKJ C;  3X1U D;  3AV1 D;  5CPJ C;  4H9O A;  2ZY4 A;  3KWQ C;  4R8P C;  5CPJ D;  3WKJ D;  3WA9 A;  4Z2M H;  1M1A B;  5B2J A;  3AZE C;  1F66 C;  1P3F B;  2J8P A;  5FUG B;  1H3O A;  5BNX A;  5C3I C;  5GT3 B;  5B0Y B;  3AZN C;  1P34 A;  1P3F C;  1M1A C;  4JJN A;  1W2E A;  3AFA A;  5B0Y C;  5GXQ A;  5B2I B;  3AZI A;  3AZL C;  3AZN D;  1M1A D;  5F99 B;  3UTB A;  1P3P C;  3MVD C;  1P3F D;  5GT3 D;  3B6F C;  5B0Y D;  3REL B;  5B2I D;  3AZK A;  3H0L C;  1KX3 C;  5F99 D;  1P3A A;  3AV2 B;  4DRB A;  3REL D;  5B1M C;  1M19 A;  1S32 B;  4WU8 B;  2LY8 A;  4LD9 B;  4LD9 C;  3X1V B;  1S32 D;  2ZM5 A;  4EO5 B;  4WU8 D;  4CSR A;  3X1V C;  3MGQ B;  2CWE A;  4LD9 D;  4EO5 C;  5JA4 A;  5AY8 B;  3X1V D;  2Y2J A;  5AY8 C;  2G5H C;  3H0R C;  2RVQ C;  3EPJ A;  5AY8 D;  2RVQ D;  4KGC A;  1EQZ A;  5GT0 A;  3UT9 B;  1BH9 A;  1BFM A;  3AZF A;  1P3L C;  3UT9 C;  5B0Z B;  5CPI A;  5DNN A;  5AV8 C;  5B0Z C;  3LZ1 B;  3X1T B;  3UT9 D;  3LZ1 C;  3X1T C;  3NQU A;  5B0Z D;  2FJ7 B;  4YS3 C;  2UWX A;  3LZ0 B;  1AOI B;  3LZ1 D;  3X1T D;  5B40 A;  3WAA A;  5JRG A;  2FJ7 D;  5AVC A;  3LZ0 D;  1AOI D;  2NZD A;  4J8U B;  3C1B A;  3X1S B;  1P3O B;  4J8U C;  1P3K A;  1B6W A;  3LEL B;  3MGP A;  5B32 A;  3X1S C;  1P3O C;  3W98 B;  3P5J B;  5GSU A;  1ID3 B;  4J8U D;  3W99 A;  3X1S D;  1P3O D;  2YFW A;  3EPL A;  3AZJ A;  3KFU G;  2HIO B;  3B6G A;  1KX4 B;  1ZLA A;  4H9P A;  5BNV A;  3AZM B;  2F8N A;  4H9Q B;  3O62 B;  3AZG A;  1N1J A;  3AZM C;  3H0M C;  4XZQ B;  4QLC C;  3AYW C;  1KX4 D;  3C1C A;  4XZQ C;  3AZM D;  3O62 D;  3AYW D;  4QLC D;  4XZQ D;  2PYO A;  3UTA B;  4HGA C;  4AWL C;  4YM6 A;  4UUZ A;  5AV9 B;  3VH5 T;  2Y2I A;  3EG5 B;  5G49 A;  1BH8 A;  5AV9 C;  4J8X A;  3F6T A;  3NQJ B;  5AV9 D;  5DNM B;  3KUY C;  5E5A A;  5B1L B;  3MGR B;  3AZH B;  1U35 A;  4H9R A;  5DNM C;  1P3G A;  3MGR C;  3REI A;  1KX5 A;  3MNN A;  2CV5 B;  5B31 B;  1M18 C;  5DNM D;  4Z5T A;  3MGR D;  2CV5 C;  3AZH D;  2Y2G A;  5CP6 B;  1M18 D;  5CP6 C;  3TU4 B;  5CHL B;  2FFF B;  2CV5 D;  3WTP B;  3X1U B;  2YFV A;  3REK C;  5CP6 D;  3WTP C;  3FDD A;  3V9R B;  5BS7 C;  1P3M B;  5AV5 B;  4XUJ C;  4H9S A;  3REK D;  3TU4 D;  2BYM A;  1P3B C;  4ZBJ B;  3WTP D;  1P3M C;  5AV5 C;  3KWQ B;  4ZBJ C;  4R8P B;  4XUJ D;  1P3B D;  3W97 A;  5AV6 A;  1P3M D;  2Y2P A;  5AV5 D;  3AZE B;  1F66 B;  3WA9 C;  5C3I B;  3AZN B;  4ZUX A;  4CAY B;  3A1K A;  3KWQ D;  1P34 C;  4R8P D;  2HUE B;  3AZL B;  2HUE C;  3AZE D;  3AZI C;  1P3P B;  3MVD B;  1F66 D;  3B6F B;  5AVB B;  4J8W A;  3A6N A;  4G92 B;  3AZL D;  5AVB C;  1KX3 B;  4G92 C;  3AZK C;  4WU9 A;  1P3P D;  3MVD D;  3AV1 A;  1P3A C;  5AVB D;  3B6F D;  1JFI A;  4H9N A;  5B1M B;  3KSY A;  5CPJ A;  3WKJ A;  1KX3 D;  1P3A D;  1M19 C;  2JSS A;  2ZY2 A;  4WNN B;  1M19 D;  5B1M D;  3B0C T;  3W96 B;  1M1A A;  3W96 C;  1P3F A;  5FUG A;  5GT3 A;  5B0Y A;  4E45 A;  5B2I A;  3W96 D;  2ZY5 A;  5F99 A;  4DQY B;  4G91 C;  3REL A; 
#chains in the Genus database with same CATH homology
 3AV2 A;  1EQZ C;  2Y2L A;  1P3L B;  5BO0 B;  2ARO B;  5B33 B;  4KUD B;  3AZF C;  2ARO C;  1S32 A;  5AV8 B;  5B33 C;  2IO5 C;  4KUD C;  4WU8 A;  5CPI C;  1WWS A;  2W8S A;  4LD9 A;  3AZF D;  3B0B A;  1P3L D;  2ARO D;  5B33 D;  4YS3 B;  4KUD D;  3REH B;  5CPI D;  3X1V A;  5AV8 D;  3REH C;  3MGQ A;  2Y2O A;  5B40 C;  4Z66 B;  5CPK B;  4YS3 D;  5AY8 A;  5JRG C;  3REH D;  4KHA B;  4Z66 C;  5CPK C;  4NE5 A;  5B32 G;  5JRG D;  4Z66 D;  5CPK D;  4J8V B;  3MGS B;  2NZD C;  3C1B C;  3R45 B;  3MGS C;  4J8V C;  1P3K C;  2Y2H A;  3UT9 A;  3MGP C;  1F1E A;  5B0Z A;  4J8V D;  3MGS D;  5GSU C;  1HQ3 B;  1PZR A;  3LZ1 A;  3X1T A;  1HQ3 C;  1TZY B;  3AZJ C;  2F8N G;  1TZY C;  2FJ7 A;  3B6G C;  2BYK B;  5B24 B;  1HQ3 D;  3AZJ D;  3LZ0 A;  2NQB A;  1AOI A;  5B24 C;  1TZY D;  2DF4 C;  4WZS B;  3AYW B;  5B24 D;  4QLC B;  1KU5 A;  2RIQ A;  3REJ B;  3EPK A;  3KXB B;  3REJ C;  4J8U A;  3R45 A;  3X1S A;  1P3O A;  3KXB C;  1P3I B;  3LEL A;  3LJA B;  4HGA B;  1P3I C;  3REJ D;  3W98 A;  4AWL B;  3LJA C;  3KXB D;  1ID3 A;  4YM6 C;  1P3I D;  3LJA D;  4J8X C;  2HIO A;  2BG1 A;  3KUY B;  1KX4 A;  2F8N K;  1U35 C;  5E5A C;  3AZM A;  4H9Q A;  3O62 A;  1M18 B;  4XZQ A;  3KUY D;  5KDM B;  4Z5T C;  4X23 B;  3AN2 B;  4X23 C;  3AN2 C;  3VH5 W;  3REK B;  3UTA A;  3VH6 W;  4X23 D;  3AN2 D;  4XUJ B;  5AV9 A;  1P3B B;  4H9S C;  4H9O B;  3IP4 C;  2JE5 A;  3NQJ A;  2Y2K A;  2XD1 A;  4NE6 A;  4DRA A;  5AV6 C;  3WA9 B;  5DNM A;  2NQB B;  1H3O B;  5BNX B;  5B2J C;  5B1L A;  3MGR A;  3AZH A;  1P34 B;  4JJN B;  2NQB C;  3AFA B;  3AZI B;  3WA9 D;  4JJN C;  2L5A A;  5B2J D;  3AFA C;  5GXQ C;  5B31 A;  3UTB B;  2CV5 A;  2NQB D;  1P34 D;  1TAF B;  3UTB C;  1WWI A;  5CP6 A;  4JJN D;  1Z2C B;  3AFA D;  5GXQ D;  1T3U A;  3AZI D;  3AZK B;  3UTB D;  3REK A;  3TU4 A;  4WU9 C;  1P3A B;  3WTP A;  3X1U A;  2G5I C;  2F2A C;  3V9R A;  4WU9 D;  1M19 B;  3AZK D;  1P3M A;  5AV5 A;  3KWQ A;  4R8P A;  4M6B A;  3VH5 A;  3AZE A;  3WTP E;  1F66 A;  3VH6 A;  3AZN A;  2Y2N A;  4CAY A;  4CSR B;  5GT3 C;  3AZL A;  4WJ3 C;  5JA4 B;  5B2I C;  1P3P A;  3MVD A;  5F99 C;  1TAF A;  3B6F A;  5AVB A;  4G91 B;  1B67 A;  3REL C;  1KX3 A;  4KGC B;  1EQZ B;  3AV2 C;  5GT0 B;  4KGC C;  1BH9 B;  5B1M A;  5BT1 C;  3AZF B;  5GT0 C;  3B0C W;  2IO5 B;  3AV2 D;  5CPI B;  4KGC D;  5DNN B;  1S32 C;  4Z2M G;  1EQZ D;  4WU8 C;  5BT1 D;  4WNN A;  5GT0 D;  5DNN C;  3EPH A;  3NQU B;  2VQR A;  3W96 A;  5DNN D;  2F8N H;  3MGQ C;  5B40 B;  3WAA B;  5JRG B;  2Y2Q A;  5AVC B;  3WAA C;  3MGQ D;  5AVC C;  3A1I A;  5B40 D;  3WAA D;  4NFT A;  2NZD B;  5AVC D;  3C1B B;  2ZY3 A;  1P3K B;  3MGP B;  5B32 B;  1P3L A;  5BO0 A;  2ARO A;  5B33 A;  5B32 C;  4KUD A;  5GSU B;  2NZD D;  3C1B D;  3W99 B;  2YFW B;  5AV8 A;  3W99 C;  4NE3 A;  3AZJ B;  3MGP D;  5B32 D;  1P3K D;  3B6G B;  2Y2M A;  5GSU D;  3REH A;  4YS3 A;  3W99 D;  2FJ7 C;  3LZ0 C;  1AOI C;  1ZLA B;  4H9P B;  5BNV B;  2F8N B;  3AZG B;  4Z66 A;  4E44 A;  1N1J B;  5CPK A;  1ZLA C;  3B6G D;  3AZG C;  4KHA A;  1ZLA D;  3C1C B;  2F8N D;  3AZG D;  2DQN C;  3C1C C;  4J8V A;  3MGS A;  2PYO B;  3LEL C;  3C1C D;  2PYO C;  3W98 C;  4YM6 B;  1ULY A;  4UUZ B;  1ID3 C;  3LEL D;  1HQ3 A;  2PYO D;  5G49 B;  1BH8 B;  4J8X B;  3W98 D;  1TZY A;  1ID3 D;  1HTA A;  2HIO C;  4YM6 D;  4UPK A;  2BYK A;  5B24 A;  1R4V A;  4J8X D;  1U35 B;  2JCH A;  5E5A B;  2HIO D;  1KX4 C;  4H9R B;  1P3G B;  3O62 C;  3REI B;  1KX5 B;  1P3G C;  3MNN B;  3AYW A;  4QLC A;  3REI C;  1KX5 C;  3MNN C;  1U35 D;  4Z5T B;  5E5A D;  3REJ A;  1P3G D;  2XD5 A;  1Q9C A;  3REI D;  3KXB A;  1KX5 D;  3MNN D;  1P3I A;  3B0D B;  2YFV B;  4Z5T D;  3LJA A;  3UTA C;  3B0D C;  3VH6 T;  3UTA D;  2BYM B;  3AL0 C;  3W97 B;  5AV6 B;  1A7W A;  3W97 C;  5B31 G;  5B2J B;  4ZUX B;  3KUY A;  5B1L C;  4ZUX C;  3AZH C;  3W97 D;  5AV6 D;  5GXQ B;  1M18 A;  5B1L D;  4ZUX D;  5B31 C;  4J8W B;  5KDM A;  3A6N B;  4WV4 B;  4J8W C;  4X23 A;  3A6N C;  3AN2 A;  5B31 D;  4WU9 B;  3AV1 B;  3TU4 C;  4J8W D;  1JFI B;  4H9N B;  3X1U C;  3A6N D;  3AV1 C;  5BS7 A;  5CPJ B;  3WKJ B;  4XUJ A;  1P3B A;  3WKJ C;  3X1U D;  3AV1 D;  5CPJ C;  4H9O A;  2ZY4 A;  3KWQ C;  4R8P C;  5CPJ D;  3WKJ D;  3WA9 A;  4Z2M H;  1M1A B;  5B2J A;  3AZE C;  1F66 C;  1P3F B;  2J8P A;  5FUG B;  1H3O A;  5BNX A;  5C3I C;  5GT3 B;  5B0Y B;  3AZN C;  1P34 A;  1P3F C;  1M1A C;  4JJN A;  1W2E A;  3AFA A;  5B0Y C;  5GXQ A;  5B2I B;  3AZI A;  3AZL C;  3AZN D;  1M1A D;  5F99 B;  3UTB A;  1P3P C;  3MVD C;  1P3F D;  5GT3 D;  3B6F C;  5B0Y D;  3REL B;  5B2I D;  3AZK A;  3H0L C;  1KX3 C;  5F99 D;  1P3A A;  3AV2 B;  4DRB A;  3REL D;  5B1M C;  1M19 A;  1S32 B;  4WU8 B;  2LY8 A;  4LD9 B;  4LD9 C;  3X1V B;  1S32 D;  2ZM5 A;  4EO5 B;  4WU8 D;  4CSR A;  3X1V C;  3MGQ B;  2CWE A;  4LD9 D;  4EO5 C;  5JA4 A;  5AY8 B;  3X1V D;  2Y2J A;  5AY8 C;  2G5H C;  3H0R C;  2RVQ C;  3EPJ A;  5AY8 D;  2RVQ D;  4KGC A;  1EQZ A;  5GT0 A;  3UT9 B;  1BH9 A;  1BFM A;  3AZF A;  1P3L C;  3UT9 C;  5B0Z B;  5CPI A;  5DNN A;  5AV8 C;  5B0Z C;  3LZ1 B;  3X1T B;  3UT9 D;  3LZ1 C;  3X1T C;  3NQU A;  5B0Z D;  2FJ7 B;  4YS3 C;  2UWX A;  3LZ0 B;  1AOI B;  3LZ1 D;  3X1T D;  5B40 A;  3WAA A;  5JRG A;  2FJ7 D;  5AVC A;  3LZ0 D;  1AOI D;  2NZD A;  4J8U B;  3C1B A;  3X1S B;  1P3O B;  4J8U C;  1P3K A;  1B6W A;  3LEL B;  3MGP A;  5B32 A;  3X1S C;  1P3O C;  3W98 B;  3P5J B;  5GSU A;  1ID3 B;  4J8U D;  3W99 A;  3X1S D;  1P3O D;  2YFW A;  3EPL A;  3AZJ A;  3KFU G;  2HIO B;  3B6G A;  1KX4 B;  1ZLA A;  4H9P A;  5BNV A;  3AZM B;  2F8N A;  4H9Q B;  3O62 B;  3AZG A;  1N1J A;  3AZM C;  3H0M C;  4XZQ B;  4QLC C;  3AYW C;  1KX4 D;  3C1C A;  4XZQ C;  3AZM D;  3O62 D;  3AYW D;  4QLC D;  4XZQ D;  2PYO A;  3UTA B;  4HGA C;  4AWL C;  4YM6 A;  4UUZ A;  5AV9 B;  3VH5 T;  2Y2I A;  3EG5 B;  5G49 A;  1BH8 A;  5AV9 C;  4J8X A;  3F6T A;  3NQJ B;  5AV9 D;  5DNM B;  3KUY C;  5E5A A;  5B1L B;  3MGR B;  3AZH B;  1U35 A;  4H9R A;  5DNM C;  1P3G A;  3MGR C;  3REI A;  1KX5 A;  3MNN A;  2CV5 B;  5B31 B;  1M18 C;  5DNM D;  4Z5T A;  3MGR D;  2CV5 C;  3AZH D;  2Y2G A;  5CP6 B;  1M18 D;  5CP6 C;  3TU4 B;  5CHL B;  2FFF B;  2CV5 D;  3WTP B;  3X1U B;  2YFV A;  3REK C;  5CP6 D;  3WTP C;  3FDD A;  3V9R B;  5BS7 C;  1P3M B;  5AV5 B;  4XUJ C;  4H9S A;  3REK D;  3TU4 D;  2BYM A;  1P3B C;  4ZBJ B;  3WTP D;  1P3M C;  5AV5 C;  3KWQ B;  4ZBJ C;  4R8P B;  4XUJ D;  1P3B D;  3W97 A;  5AV6 A;  1P3M D;  2Y2P A;  5AV5 D;  3AZE B;  1F66 B;  3WA9 C;  5C3I B;  3AZN B;  4ZUX A;  4CAY B;  3A1K A;  3KWQ D;  1P34 C;  4R8P D;  2HUE B;  3AZL B;  2HUE C;  3AZE D;  3AZI C;  1P3P B;  3MVD B;  1F66 D;  3B6F B;  5AVB B;  4J8W A;  3A6N A;  4G92 B;  3AZL D;  5AVB C;  1KX3 B;  4G92 C;  3AZK C;  4WU9 A;  1P3P D;  3MVD D;  3AV1 A;  1P3A C;  5AVB D;  3B6F D;  1JFI A;  4H9N A;  5B1M B;  3KSY A;  5CPJ A;  3WKJ A;  1KX3 D;  1P3A D;  1M19 C;  2JSS A;  2ZY2 A;  4WNN B;  1M19 D;  5B1M D;  3B0C T;  3W96 B;  1M1A A;  3W96 C;  1P3F A;  5FUG A;  5GT3 A;  5B0Y A;  4E45 A;  5B2I A;  3W96 D;  2ZY5 A;  5F99 A;  4DQY B;  4G91 C;  3REL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...