3AZED

Crystal structure of human nucleosome core particle containing h3k64q mutation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
94
structure length
94
Chain Sequence
b'RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azeD00
4Z5TD 2FJ7B 1EQZB 4X23C 3VH5T 3REID 5KDMA 1P3OA 2BYKA 5GXQA 4LD9B 3UTAB 4H9NB 5AV6D 1P3MA 3AZMD 5B31D 3AYWB 1P3FD 4H9QA 5GT0D 1P3AB 5B2JC 3C1CD 1P3PC 5FUGB 3AV2B 3TU4D 1S32C 5AV5A 3NQJA 1R4VA 3KWQA 3UTBD 2F8ND 3W99C 4XUJC 1ID3B 5F99D 5CPJC 4ZUXC 5AVBA 2HUEC 5AV8B 3AV1B 3AFAB 1ZLAD 2PYOC 3X1TC 3AZID 1H3OB 2RVQD 3LZ0A 4WU8C 1F1EA 2NZDD 5B0YB 3MGPA 5B2IB 5AY8C 4J8WA 4YS3B 3WKJD 5B31G 4J8UB 3WA9D 5JRGB 3WTPD 3RELB 3MGRD 3UT9B 4KUDD 5CPIC 3AZFA 1TZYA 2BYMB 5B32A 3KUYD 3KSYA 4UUZB 3AZNC 1P3BB 3AZLC 5B40B 5G49B 4KGCD 4Z5TC 1KX5B 4YM6B 1M18B 3W96A 1P34D 4H9PA 5GSUD 5B33B 3AYWD 3X1TB 4WU9B 4WV4B 5DNNA 1P3AD 1P3GD 3C1BC 2CV5C 5B1MC 3AZGB 3LZ1C 3MVDC 5AVCB 3AZJC 1HQ3C 3A6NB 3B6FD 1A7WA 3X1VC 3MNNB 4J8VD 4Z66D 4R8PA 4AWLC 4G91B 5AV9A 1U35D 3VH5W 1M1AB 3AV1D 1M19C 4QLCC 3O62A 5B24B 5CPKA 4KHAA 1KX3A 3MGQB 4X23D 3AZKB 5B0ZA 3B0DB 5DNMC 5B0YD 3AZIC 3KXBA 3W97C 4E44A 3WAAB 3X1SA 1P3IC 1P3LA 5B2ID 1F66B 4J8XC 3REKC 1AOIC 3WKJC 3RELD 4JJNC 4WZSB 2NQBC 5B2JD 1P3PD 3MGSA 2YFWA 1S32D 5E5AB 3AN2A 3W98B 3KUYC 3W99D 3X1VB 4XUJD 2FJ7C 1EQZC 5CPJD 4H9OA 5B1LA 4ZUXD 4WNNB 5BO0B 5BNXB 1P3KB 3X1TD 4LD9C 3UTAC 4WU8D 3WTPE 2AROB 5BS7C 3LELB 3AYWC 2LY8A 3V9RB 5BNVA 3REIA 1P3AC 3AV2C 5AY8D 1AOIB 3X1UB 5AV6A 3REJB 3AZMA 2NQBB 5B31A 3AZEB 5GT0A 2JSSA 4NE3A 5CPID 1P3FA 3C1CA 1KX4B 1ID3C 3TU4A 4Z2MG 3AZND 3REHA 5B24D 1TAFA 5AV8C 3AZLD 3AFAC 5KDMB 3UTBA 2F8NA 1P3OB 3MGPC 2BYKB 5GXQB 5B0YC 1P3MB 5B2IC 4H9QB 4YS3C 1ZLAA 4J8UC 4ZBJB 4DRBA 5JRGC 3C1BD 3RELC 2CV5D 3UT9C 5GT3A 5B1MD 5AV5B 3NQJB 2NZDA 3LZ1D 3MVDD 3KWQB 3AZJD 2HIOA 1HQ3D 3W98D 3X1VD 1P3BC 3WA9A 5B40C 4CAYA 4CSRA 3WTPA 5AVBB 3MGRA 4KUDA 1KX5C 4YM6C 1M18C 1M19D 3LZ0B 4QLCD 5B33C 4H9SC 4WU9C 4EO5B 5DNMD 3MGPB 3W97D 4KGCA 4J8WB 1P3ID 1P34A 4J8XD 3REKD 3AZGC 5AVCC 1AOID 4XZQA 3A6NC 3X1UD 5GSUA 3AZFB 2NQBD 1TZYB 4JJND 3MNNC 5B32B 1JFIA 3B6GA 1P3GA 4G91C 1Q9CA 3VH6A 1B67A 1M1AC 3B6FA 5B24C 2FJ7D 4J8VA 4Z66A 4H9PB 3W96B 5GXQD 1EQZD 3MGQC 5CP6A 3AZKC 3B0DC 1U35A 3WAAC 1P3MD 1F66C 5DNNB 3VH5A 4LD9D 3UTAD 4X23A 4Z2MH 3VH6W 3AV2D 5E5AC 4R8PB 3W98C 5AV9B 2YFVA 4E45A 5B2JA 1P3PA 3O62B 1ID3D 5CPKB 1S32A 4KHAB 1KX3B 5AV8D 3AFAD 5B0ZB 1P3KC 3KXBB 3W99A 3X1SB 3MGPD 1P3LB 4XUJA 2AROC 3LELC 5CPJA 5C3IB 4ZUXA 1ULYA 4YS3D 2PYOA 4J8UD 1BH8A 3MGSB 4WU8A 2YFWB 3X1UC 5JRGD 3REJC 3AN2B 3REHC 3UT9D 3AZEC 3AZHA 1KX4C 3LJAA 5AY8A 1P3BD 5B40D 4H9OB 5B1LB 1P3OC 5CPIA 3NQUA 1KX5D 5GXQC 4YM6D 4H9RA 1M18D 3AZNA 5CHLB 1P3MC 3AZLA 5GT3C 5BNVB 3REIB 5B33D 4WU9D 4Z5TA 4ZBJC 3R45A 5AV5C 3AZGD 5AV6B 5AVCD 3KWQC 3AZMB 4HGAB 3A6ND 5B31B 5B32G 1P3FB 5GT0B 1B6WA 3MNND 3C1CB 3TU4B 1HTAA 5AVBC 5JA4A 3C1BA 3REHB 1TAFB 2CV5A 5B1MA 3LZ1A 3MVDA 3AZJA 1N1JA 1HQ3A 3UTBB 1M1AD 2F8NB 3LZ0C 1WWIA 3MGQD 3AZKD 4EO5C 4XZQC 3WAAD 4J8WC 1ZLAB 5F99A 1F66D 1M19A 3B6GC 4QLCA 2NZDB 5GT3B 3AZFC 1TZYC 2HIOB 3AZIA 3W97A 5DNMA 5B32C 1P3IA 1BH9A 4J8XA 3REKA 4CAYB 4CSRB 5E5AD 3WA9B 3WTPB 3MGRB 3WKJA 4KUDB 4JJNA 3W96C 1KU5A 5BT1C 1P3KD 3KUYA 4KGCB 5DNNC 3B0CT 2FJ7A 1P34B 1EQZA 2AROD 3LELD 4XZQB 4G92B 5GSUB 4NE5A 1JFIB 3B6GB 2IO5B 1P3GB 4LD9A 3UTAA 4R8PC 4H9NA 3REJD 5AV9C 5BS7A 3REHD 3AYWA 3AZED 1P3AA 3B6FB 1KX4D 5FUGA 3O62C 3AV2A 4J8VB 4Z66B 5CPKC 1KX3C 5CP6B 5B0ZC 1U35B 3KXBC 1P3OD 3X1SC 1P3LC 1BFMA 1ID3A 5C3IC 4X23B 5AV8A 3AV1A 3AFAA 5GT3D 3AZHC 2HIOD 1H3OA 3MGSC 3LJAC 3AN2C 5AV5D 5B0YA 3KWQD 5B2IA 2YFVB 4YS3A 5B2JB 1P3PB 4J8UA 5JRGA 5B1LC 5AVBD 3RELA 1S32B 2F8NG 3UT9A 2BYMA 3W99B 3LZ0D 4XUJB 4UUZA 1P3BA 5B40A 5G49A 5CPJB 3REIC 4ZUXB 2HUEB 4XZQD 2CWEA 4J8WD 1KX5A 4YM6A 2PYOB 1M18A 1BH8B 4WU8B 3B6GD 5AV6C 3AZMC 4HGAC 5B31C 1P3FC 5GT0C 3AZHB 3AZFD 1TZYD 5B33A 4H9SA 3C1CC 3X1TA 4WU9A 5B32D 3LJAB 5AY8B 3TU4C 3AZGA 5AVCA 5CP6D 3UTBC 3A6NA 5CPIB 3NQUB 3MNNA 4H9RB 3W96D 3B0CW 5F99C 3AZNB 3AZLB 1ZLAC 5BT1D 1M1AA 4Z5TB 2RVQC 5DNND 3B0BA 3R45B 5B24A 2NZDC 4M6BA 3MGQA 2HIOC 3AZKA 1WWSA 4DRAA 3WAAA 1F66A 3WA9C 3WTPC 5JA4B 3C1BB 3MGRC 4R8PD 2CV5B 5B1MB 4KUDC 5AV9D 3LZ1B 4NE6A 3MVDB 3AZJB 1N1JB 1HQ3B 3O62D 4NFTA 5CPKD 5E5AA 1KX3D 4AWLB 2L5AA 5B0ZD 3W98A 4KGCC 3KXBD 3X1VA 3X1SD 1P3LD 5F99B 1P34C 1M19B 2PYOD 4QLCB 4G92C 4WNNA 5GSUC 5BO0A 3AZIB 5BNXA 1P3KA 5DNMB 3AZHD 2F8NH 3W97B 2IO5C 1P3GC 3MGSD 1P3IB 3LJAD 1BH9B 4J8XB 3REKB 2AROA 3LELA 3AN2D 3V9RA 3B6FC 3WKJB 4JJNB 3VH6T 4J8VC 4Z66C 5CP6C 1AOIA 3X1UA 3REJA 5B1LD 1U35C 2NQBA 2F8NK 3AZEA 3AV1C 3KUYB 1KX4A
chains in the Genus database with same CATH superfamily
4Z5TD 2FJ7B 1EQZB 4X23C 3VH5T 3REID 5KDMA 1P3OA 2BYKA 5GXQA 4LD9B 3UTAB 4H9NB 5AV6D 2Y2GA 1P3MA 3AZMD 1PZRA 5B31D 3AYWB 1P3FD 4H9QA 5GT0D 3F6TA 5B2JC 1P3AB 3C1CD 1P3PC 5FUGB 3AV2B 3TU4D 1S32C 5AV5A 3NQJA 1R4VA 3KWQA 3UTBD 2F8ND 3W99C 4XUJC 1ID3B 5F99D 5CPJC 4ZUXC 5AVBA 2HUEC 5AV8B 3AV1B 3AFAB 1ZLAD 2PYOC 3X1TC 3AZID 1H3OB 2RVQD 3LZ0A 4WU8C 1F1EA 2NZDD 5B0YB 2FFFB 3MGPA 5B2IB 5AY8C 4J8WA 4YS3B 3WKJD 5B31G 2DF4C 4J8UB 3WA9D 5JRGB 3WTPD 3RELB 3MGRD 3UT9B 2JE5A 4KUDD 5CPIC 3AZFA 1TZYA 2BYMB 2Y2LA 2VQRA 5B32A 3KUYD 3KSYA 4UUZB 3AZNC 1P3BB 3AZLC 5B40B 5G49B 4KGCD 4Z5TC 1KX5B 4YM6B 1M18B 3W96A 1P34D 4H9PA 3KFUG 3A1KA 3EPKA 5GSUD 3EPJA 5B33B 3AYWD 3X1TB 4WU9B 4WV4B 5DNNA 1P3AD 1P3GD 3C1BC 2CV5C 5B1MC 3AZGB 3EG5B 3LZ1C 3MVDC 5AVCB 3AZJC 1HQ3C 3A6NB 3B6FD 1A7WA 3X1VC 3MNNB 2NZDA 4J8VD 4Z66D 2F2AC 4R8PA 4AWLC 4G91B 5AV9A 1U35D 3VH5W 1M1AB 3AV1D 1M19C 4QLCC 3O62A 5B24B 5CPKA 2ZY2A 4KHAA 3MGQB 1KX3A 4X23D 3AZKB 5B0ZA 2ZY5A 5B0YD 3B0DB 3H0LC 5DNMC 3KXBA 4E44A 3AZIC 3W97C 3WAAB 3X1SA 1P3IC 1P3LA 5B2ID 1F66B 4J8XC 3REKC 1AOIC 3WKJC 2Y2OA 4JJNC 4WZSB 3RELD 2NQBC 5B2JD 1P3PD 3MGSA 2YFWA 1S32D 5E5AB 3AN2A 3W98B 3KUYC 3W99D 3X1VB 4XUJD 2FJ7C 3IP4C 1EQZC 5CPJD 4H9OA 5B1LA 4ZUXD 4WNNB 5BO0B 5BNXB 1P3KB 3X1TD 2Y2IA 4LD9C 3UTAC 4WU8D 3WTPE 2AROB 5BS7C 3LELB 3AYWC 2LY8A 3V9RB 5BNVA 3REIA 1P3AC 3AV2C 5AY8D 1Z2CB 1AOIB 3X1UB 5AV6A 3REJB 3AZMA 2NQBB 5B31A 3AZEB 5GT0A 2JSSA 4NE3A 5CPID 1P3FA 3C1CA 1KX4B 1ID3C 3H0MC 3TU4A 4Z2MG 3AZND 3REHA 5B24D 1TAFA 5AV8C 3AZLD 3AFAC 5KDMB 3UTBA 2F8NA 2ZM5A 1P3OB 3MGPC 2BYKB 5GXQB 5B0YC 1P3MB 2Y2QA 5B2IC 4H9QB 4YS3C 1ZLAA 4J8UC 4ZBJB 4DRBA 5JRGC 3C1BD 3RELC 2CV5D 3UT9C 5GT3A 5B1MD 5AV5B 3NQJB 3P5JB 3LZ1D 3MVDD 3KWQB 3AZJD 2HIOA 1HQ3D 3W98D 3X1VD 1P3BC 3WA9A 5B40C 4CAYA 4CSRA 3WTPA 5AVBB 3MGRA 4KUDA 2Y2PA 1KX5C 4YM6C 1M18C 1M19D 3LZ0B 3EPLA 4QLCD 5B33C 4H9SC 4WU9C 4EO5B 5DNMD 3MGPB 3W97D 4KGCA 4J8WB 2G5IC 1P3ID 1P34A 4J8XD 3REKD 3AZGC 5AVCC 1AOID 4XZQA 3A6NC 3X1UD 4WJ3C 5GSUA 3AZFB 2NQBD 1TZYB 4JJND 3MNNC 5B32B 1JFIA 3B6GA 1P3GA 4G91C 1Q9CA 3H0RC 3VH6A 1B67A 2BG1A 1M1AC 3B6FA 2J8PA 5B24C 2FJ7D 4J8VA 4Z66A 4H9PB 3W96B 5GXQD 1EQZD 3MGQC 5CP6A 2JCHA 3AZKC 3B0DC 2Y2HA 2ZY4A 3WAAC 1T3UA 1U35A 1P3MD 1F66C 5DNNB 3VH5A 4LD9D 3UTAD 4X23A 4Z2MH 3VH6W 3AV2D 5E5AC 4R8PB 3W98C 5AV9B 2YFVA 4E45A 5B2JA 1P3PA 3O62B 1ID3D 2Y2JA 5CPKB 1S32A 4KHAB 1KX3B 5AV8D 3AFAD 5B0ZB 1P3KC 2ZY3A 3KXBB 3W99A 3X1SB 3MGPD 1P3LB 4XUJA 2G5HC 2AROC 3LELC 5CPJA 5C3IB 4ZUXA 1ULYA 4YS3D 2PYOA 4J8UD 1BH8A 3MGSB 4WU8A 2YFWB 3X1UC 5JRGD 3REJC 3AN2B 3REHC 4DQYB 3UT9D 3AZEC 3AZHA 1KX4C 3LJAA 1W2EA 5AY8A 1P3BD 5B40D 4H9OB 5B1LB 1P3OC 5CPIA 3NQUA 1KX5D 5GXQC 4YM6D 4H9RA 1M18D 2XD5A 3AZNA 5CHLB 1P3MC 3AZLA 5GT3C 5BNVB 3REIB 5B33D 4WU9D 4Z5TA 4ZBJC 3R45A 3FDDA 5AV5C 3AZGD 5AV6B 5AVCD 3KWQC 3AZMB 4HGAB 3A6ND 5B31B 5B32G 1P3FB 5GT0B 1B6WA 3MNND 3C1CB 3TU4B 1HTAA 5AVBC 5JA4A 3C1BA 3REHB 1TAFB 2CV5A 5B1MA 3LZ1A 3MVDA 3AZJA 1N1JA 1HQ3A 3UTBB 1M1AD 2F8NB 3LZ0C 1WWIA 3MGQD 3AZKD 4EO5C 4XZQC 3WAAD 4J8WC 1ZLAB 5F99A 1F66D 1M19A 3B6GC 4QLCA 2NZDB 5GT3B 3AZFC 1TZYC 2HIOB 3AZIA 3W97A 5DNMA 5B32C 1P3IA 2Y2KA 1BH9A 4J8XA 3REKA 4CAYB 4CSRB 5E5AD 3WA9B 3WTPB 3MGRB 3WKJA 4KUDB 2W8SA 4JJNA 3W96C 3A1IA 1KU5A 5BT1C 1P3KD 3KUYA 4KGCB 5DNNC 3B0CT 2FJ7A 1P34B 1EQZA 2AROD 3LELD 4XZQB 4G92B 5GSUB 4NE5A 1JFIB 3B6GB 2IO5B 1P3GB 4LD9A 3UTAA 2RIQA 2UWXA 4H9NA 4R8PC 3REJD 5AV9C 5BS7A 3REHD 3AYWA 3AZED 1P3AA 3B6FB 1KX4D 5FUGA 3O62C 3AV2A 4J8VB 4Z66B 5CPKC 1KX3C 5CP6B 5B0ZC 1U35B 3KXBC 1P3OD 2Y2MA 3X1SC 1P3LC 1BFMA 1ID3A 5C3IC 4X23B 5AV8A 3AV1A 3AFAA 5GT3D 2XD1A 3AZHC 2HIOD 1H3OA 3MGSC 3LJAC 2Y2NA 3AN2C 5AV5D 5B0YA 3KWQD 5B2IA 2YFVB 4YS3A 5B2JB 1P3PB 4J8UA 5JRGA 5B1LC 5AVBD 3RELA 1S32B 2F8NG 3UT9A 2BYMA 3W99B 2DQNC 4XUJB 4UUZA 3LZ0D 1P3BA 5B40A 5G49A 5CPJB 3REIC 4ZUXB 2HUEB 4XZQD 2CWEA 4J8WD 1KX5A 4YM6A 2PYOB 1M18A 1BH8B 4WU8B 3B6GD 5AV6C 3AZMC 4HGAC 5B31C 1P3FC 5GT0C 3AZHB 3AZFD 1TZYD 5B33A 4H9SA 3C1CC 3X1TA 4WU9A 5B32D 3LJAB 5AY8B 3TU4C 3AZGA 5AVCA 5CP6D 3UTBC 3A6NA 5CPIB 3NQUB 3MNNA 4H9RB 3W96D 3B0CW 5F99C 3AZNB 3AZLB 1ZLAC 5BT1D 1M1AA 4Z5TB 2RVQC 5DNND 3B0BA 3R45B 5B24A 2NZDC 4M6BA 3MGQA 2HIOC 3AZKA 1WWSA 4DRAA 3WAAA 1F66A 3WA9C 3WTPC 5JA4B 3C1BB 3MGRC 4R8PD 2CV5B 5B1MB 4KUDC 5AV9D 3EPHA 3LZ1B 4NE6A 3MVDB 3AZJB 1N1JB 1HQ3B 3O62D 4NFTA 5CPKD 5E5AA 1KX3D 4AWLB 2L5AA 5B0ZD 3W98A 4KGCC 3KXBD 3X1VA 3X1SD 1P3LD 5F99B 1P34C 1M19B 3AL0C 2PYOD 4QLCB 4G92C 4WNNA 5GSUC 5BO0A 3AZIB 5BNXA 1P3KA 5DNMB 3AZHD 2F8NH 3W97B 2IO5C 1P3GC 3MGSD 1P3IB 3LJAD 1BH9B 4J8XB 3REKB 2AROA 3LELA 3AN2D 3V9RA 3B6FC 3WKJB 4JJNB 3VH6T 4J8VC 4Z66C 5CP6C 1AOIA 3X1UA 3REJA 5B1LD 1U35C 2NQBA 4UPKA 2F8NK 3AZEA 3AV1C 3KUYB 1KX4A
chains in the Genus database with same CATH topology
4Z5TD 2FJ7B 1EQZB 4X23C 3VH5T 3REID 5KDMA 1P3OA 2BYKA 5GXQA 4LD9B 3UTAB 4H9NB 5AV6D 2Y2GA 1P3MA 3AZMD 1PZRA 5B31D 3AYWB 1P3FD 4H9QA 5GT0D 3F6TA 5B2JC 1P3AB 3C1CD 1P3PC 5FUGB 3AV2B 3TU4D 1S32C 5AV5A 3NQJA 1R4VA 3KWQA 3UTBD 2F8ND 3W99C 4XUJC 1ID3B 5F99D 5CPJC 4ZUXC 5AVBA 2HUEC 5AV8B 3AV1B 3AFAB 1ZLAD 2PYOC 3X1TC 3AZID 1H3OB 2RVQD 3LZ0A 4WU8C 1F1EA 2NZDD 5B0YB 2FFFB 3MGPA 5B2IB 5AY8C 4J8WA 4YS3B 3WKJD 5B31G 2DF4C 4J8UB 3WA9D 5JRGB 3WTPD 3RELB 3MGRD 3UT9B 2JE5A 4KUDD 5CPIC 3AZFA 1TZYA 2BYMB 2Y2LA 2VQRA 5B32A 3KUYD 3KSYA 4UUZB 3AZNC 1P3BB 3AZLC 5B40B 5G49B 4KGCD 4Z5TC 1KX5B 4YM6B 1M18B 3W96A 1P34D 4H9PA 3KFUG 3A1KA 3EPKA 5GSUD 3EPJA 5B33B 3AYWD 3X1TB 4WU9B 4WV4B 5DNNA 1P3AD 1P3GD 3C1BC 2CV5C 5B1MC 3AZGB 3EG5B 3LZ1C 3MVDC 5AVCB 3AZJC 1HQ3C 3A6NB 3B6FD 1A7WA 3X1VC 3MNNB 2NZDA 4J8VD 4Z66D 2F2AC 4R8PA 4AWLC 4G91B 5AV9A 1U35D 3VH5W 1M1AB 3AV1D 1M19C 4QLCC 3O62A 5B24B 5CPKA 2ZY2A 4KHAA 3MGQB 1KX3A 4X23D 3AZKB 5B0ZA 2ZY5A 5B0YD 3B0DB 3H0LC 5DNMC 3KXBA 4E44A 3AZIC 3W97C 3WAAB 3X1SA 1P3IC 1P3LA 5B2ID 1F66B 4J8XC 3REKC 1AOIC 3WKJC 2Y2OA 4JJNC 4WZSB 3RELD 2NQBC 5B2JD 1P3PD 3MGSA 2YFWA 1S32D 5E5AB 3AN2A 3W98B 3KUYC 3W99D 3X1VB 4XUJD 2FJ7C 3IP4C 1EQZC 5CPJD 4H9OA 5B1LA 4ZUXD 4WNNB 5BO0B 5BNXB 1P3KB 3X1TD 2Y2IA 4LD9C 3UTAC 4WU8D 3WTPE 2AROB 5BS7C 3LELB 3AYWC 2LY8A 3V9RB 5BNVA 3REIA 1P3AC 3AV2C 5AY8D 1Z2CB 1AOIB 3X1UB 5AV6A 3REJB 3AZMA 2NQBB 5B31A 3AZEB 5GT0A 2JSSA 4NE3A 5CPID 1P3FA 3C1CA 1KX4B 1ID3C 3H0MC 3TU4A 4Z2MG 3AZND 3REHA 5B24D 1TAFA 5AV8C 3AZLD 3AFAC 5KDMB 3UTBA 2F8NA 2ZM5A 1P3OB 3MGPC 2BYKB 5GXQB 5B0YC 1P3MB 2Y2QA 5B2IC 4H9QB 4YS3C 1ZLAA 4J8UC 4ZBJB 4DRBA 5JRGC 3C1BD 3RELC 2CV5D 3UT9C 5GT3A 5B1MD 5AV5B 3NQJB 3P5JB 3LZ1D 3MVDD 3KWQB 3AZJD 2HIOA 1HQ3D 3W98D 3X1VD 1P3BC 3WA9A 5B40C 4CAYA 4CSRA 3WTPA 5AVBB 3MGRA 4KUDA 2Y2PA 1KX5C 4YM6C 1M18C 1M19D 3LZ0B 3EPLA 4QLCD 5B33C 4H9SC 4WU9C 4EO5B 5DNMD 3MGPB 3W97D 4KGCA 4J8WB 2G5IC 1P3ID 1P34A 4J8XD 3REKD 3AZGC 5AVCC 1AOID 4XZQA 3A6NC 3X1UD 4WJ3C 5GSUA 3AZFB 2NQBD 1TZYB 4JJND 3MNNC 5B32B 1JFIA 3B6GA 1P3GA 4G91C 1Q9CA 3H0RC 3VH6A 1B67A 2BG1A 1M1AC 3B6FA 2J8PA 5B24C 2FJ7D 4J8VA 4Z66A 4H9PB 3W96B 5GXQD 1EQZD 3MGQC 5CP6A 2JCHA 3AZKC 3B0DC 2Y2HA 2ZY4A 3WAAC 1T3UA 1U35A 1P3MD 1F66C 5DNNB 3VH5A 4LD9D 3UTAD 4X23A 4Z2MH 3VH6W 3AV2D 5E5AC 4R8PB 3W98C 5AV9B 2YFVA 4E45A 5B2JA 1P3PA 3O62B 1ID3D 2Y2JA 5CPKB 1S32A 4KHAB 1KX3B 5AV8D 3AFAD 5B0ZB 1P3KC 2ZY3A 3KXBB 3W99A 3X1SB 3MGPD 1P3LB 4XUJA 2G5HC 2AROC 3LELC 5CPJA 5C3IB 4ZUXA 1ULYA 4YS3D 2PYOA 4J8UD 1BH8A 3MGSB 4WU8A 2YFWB 3X1UC 5JRGD 3REJC 3AN2B 3REHC 4DQYB 3UT9D 3AZEC 3AZHA 1KX4C 3LJAA 1W2EA 5AY8A 1P3BD 5B40D 4H9OB 5B1LB 1P3OC 5CPIA 3NQUA 1KX5D 5GXQC 4YM6D 4H9RA 1M18D 2XD5A 3AZNA 5CHLB 1P3MC 3AZLA 5GT3C 5BNVB 3REIB 5B33D 4WU9D 4Z5TA 4ZBJC 3R45A 3FDDA 5AV5C 3AZGD 5AV6B 5AVCD 3KWQC 3AZMB 4HGAB 3A6ND 5B31B 5B32G 1P3FB 5GT0B 1B6WA 3MNND 3C1CB 3TU4B 1HTAA 5AVBC 5JA4A 3C1BA 3REHB 1TAFB 2CV5A 5B1MA 3LZ1A 3MVDA 3AZJA 1N1JA 1HQ3A 3UTBB 1M1AD 2F8NB 3LZ0C 1WWIA 3MGQD 3AZKD 4EO5C 4XZQC 3WAAD 4J8WC 1ZLAB 5F99A 1F66D 1M19A 3B6GC 4QLCA 2NZDB 5GT3B 3AZFC 1TZYC 2HIOB 3AZIA 3W97A 5DNMA 5B32C 1P3IA 2Y2KA 1BH9A 4J8XA 3REKA 4CAYB 4CSRB 5E5AD 3WA9B 3WTPB 3MGRB 3WKJA 4KUDB 2W8SA 4JJNA 3W96C 3A1IA 1KU5A 5BT1C 1P3KD 3KUYA 4KGCB 5DNNC 3B0CT 2FJ7A 1P34B 1EQZA 2AROD 3LELD 4XZQB 4G92B 5GSUB 4NE5A 1JFIB 3B6GB 2IO5B 1P3GB 4LD9A 3UTAA 2RIQA 2UWXA 4H9NA 4R8PC 3REJD 5AV9C 5BS7A 3REHD 3AYWA 3AZED 1P3AA 3B6FB 1KX4D 5FUGA 3O62C 3AV2A 4J8VB 4Z66B 5CPKC 1KX3C 5CP6B 5B0ZC 1U35B 3KXBC 1P3OD 2Y2MA 3X1SC 1P3LC 1BFMA 1ID3A 5C3IC 4X23B 5AV8A 3AV1A 3AFAA 5GT3D 2XD1A 3AZHC 2HIOD 1H3OA 3MGSC 3LJAC 2Y2NA 3AN2C 5AV5D 5B0YA 3KWQD 5B2IA 2YFVB 4YS3A 5B2JB 1P3PB 4J8UA 5JRGA 5B1LC 5AVBD 3RELA 1S32B 2F8NG 3UT9A 2BYMA 3W99B 2DQNC 4XUJB 4UUZA 3LZ0D 1P3BA 5B40A 5G49A 5CPJB 3REIC 4ZUXB 2HUEB 4XZQD 2CWEA 4J8WD 1KX5A 4YM6A 2PYOB 1M18A 1BH8B 4WU8B 3B6GD 5AV6C 3AZMC 4HGAC 5B31C 1P3FC 5GT0C 3AZHB 3AZFD 1TZYD 5B33A 4H9SA 3C1CC 3X1TA 4WU9A 5B32D 3LJAB 5AY8B 3TU4C 3AZGA 5AVCA 5CP6D 3UTBC 3A6NA 5CPIB 3NQUB 3MNNA 4H9RB 3W96D 3B0CW 5F99C 3AZNB 3AZLB 1ZLAC 5BT1D 1M1AA 4Z5TB 2RVQC 5DNND 3B0BA 3R45B 5B24A 2NZDC 4M6BA 3MGQA 2HIOC 3AZKA 1WWSA 4DRAA 3WAAA 1F66A 3WA9C 3WTPC 5JA4B 3C1BB 3MGRC 4R8PD 2CV5B 5B1MB 4KUDC 5AV9D 3EPHA 3LZ1B 4NE6A 3MVDB 3AZJB 1N1JB 1HQ3B 3O62D 4NFTA 5CPKD 5E5AA 1KX3D 4AWLB 2L5AA 5B0ZD 3W98A 4KGCC 3KXBD 3X1VA 3X1SD 1P3LD 5F99B 1P34C 1M19B 3AL0C 2PYOD 4QLCB 4G92C 4WNNA 5GSUC 5BO0A 3AZIB 5BNXA 1P3KA 5DNMB 3AZHD 2F8NH 3W97B 2IO5C 1P3GC 3MGSD 1P3IB 3LJAD 1BH9B 4J8XB 3REKB 2AROA 3LELA 3AN2D 3V9RA 3B6FC 3WKJB 4JJNB 3VH6T 4J8VC 4Z66C 5CP6C 1AOIA 3X1UA 3REJA 5B1LD 1U35C 2NQBA 4UPKA 2F8NK 3AZEA 3AV1C 3KUYB 1KX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5T D;  2FJ7 B;  1EQZ B;  4X23 C;  3VH5 T;  3REI D;  5KDM A;  1P3O A;  2BYK A;  5GXQ A;  4LD9 B;  3UTA B;  4H9N B;  5AV6 D;  1P3M A;  3AZM D;  5B31 D;  3AYW B;  1P3F D;  4H9Q A;  5GT0 D;  1P3A B;  5B2J C;  3C1C D;  1P3P C;  5FUG B;  3AV2 B;  3TU4 D;  1S32 C;  5AV5 A;  3NQJ A;  1R4V A;  3KWQ A;  3UTB D;  2F8N D;  3W99 C;  4XUJ C;  1ID3 B;  5F99 D;  5CPJ C;  4ZUX C;  5AVB A;  2HUE C;  5AV8 B;  3AV1 B;  3AFA B;  1ZLA D;  2PYO C;  3X1T C;  3AZI D;  1H3O B;  2RVQ D;  3LZ0 A;  4WU8 C;  1F1E A;  2NZD D;  5B0Y B;  3MGP A;  5B2I B;  5AY8 C;  4J8W A;  4YS3 B;  3WKJ D;  5B31 G;  4J8U B;  3WA9 D;  5JRG B;  3WTP D;  3REL B;  3MGR D;  3UT9 B;  4KUD D;  5CPI C;  3AZF A;  1TZY A;  2BYM B;  5B32 A;  3KUY D;  3KSY A;  4UUZ B;  3AZN C;  1P3B B;  3AZL C;  5B40 B;  5G49 B;  4KGC D;  4Z5T C;  1KX5 B;  4YM6 B;  1M18 B;  3W96 A;  1P34 D;  4H9P A;  5GSU D;  5B33 B;  3AYW D;  3X1T B;  4WU9 B;  4WV4 B;  5DNN A;  1P3A D;  1P3G D;  3C1B C;  2CV5 C;  5B1M C;  3AZG B;  3LZ1 C;  3MVD C;  5AVC B;  3AZJ C;  1HQ3 C;  3A6N B;  3B6F D;  1A7W A;  3X1V C;  3MNN B;  4J8V D;  4Z66 D;  4R8P A;  4AWL C;  4G91 B;  5AV9 A;  1U35 D;  3VH5 W;  1M1A B;  3AV1 D;  1M19 C;  4QLC C;  3O62 A;  5B24 B;  5CPK A;  4KHA A;  1KX3 A;  3MGQ B;  4X23 D;  3AZK B;  5B0Z A;  3B0D B;  5DNM C;  5B0Y D;  3AZI C;  3KXB A;  3W97 C;  4E44 A;  3WAA B;  3X1S A;  1P3I C;  1P3L A;  5B2I D;  1F66 B;  4J8X C;  3REK C;  1AOI C;  3WKJ C;  3REL D;  4JJN C;  4WZS B;  2NQB C;  5B2J D;  1P3P D;  3MGS A;  2YFW A;  1S32 D;  5E5A B;  3AN2 A;  3W98 B;  3KUY C;  3W99 D;  3X1V B;  4XUJ D;  2FJ7 C;  1EQZ C;  5CPJ D;  4H9O A;  5B1L A;  4ZUX D;  4WNN B;  5BO0 B;  5BNX B;  1P3K B;  3X1T D;  4LD9 C;  3UTA C;  4WU8 D;  3WTP E;  2ARO B;  5BS7 C;  3LEL B;  3AYW C;  2LY8 A;  3V9R B;  5BNV A;  3REI A;  1P3A C;  3AV2 C;  5AY8 D;  1AOI B;  3X1U B;  5AV6 A;  3REJ B;  3AZM A;  2NQB B;  5B31 A;  3AZE B;  5GT0 A;  2JSS A;  4NE3 A;  5CPI D;  1P3F A;  3C1C A;  1KX4 B;  1ID3 C;  3TU4 A;  4Z2M G;  3AZN D;  3REH A;  5B24 D;  1TAF A;  5AV8 C;  3AZL D;  3AFA C;  5KDM B;  3UTB A;  2F8N A;  1P3O B;  3MGP C;  2BYK B;  5GXQ B;  5B0Y C;  1P3M B;  5B2I C;  4H9Q B;  4YS3 C;  1ZLA A;  4J8U C;  4ZBJ B;  4DRB A;  5JRG C;  3C1B D;  3REL C;  2CV5 D;  3UT9 C;  5GT3 A;  5B1M D;  5AV5 B;  3NQJ B;  2NZD A;  3LZ1 D;  3MVD D;  3KWQ B;  3AZJ D;  2HIO A;  1HQ3 D;  3W98 D;  3X1V D;  1P3B C;  3WA9 A;  5B40 C;  4CAY A;  4CSR A;  3WTP A;  5AVB B;  3MGR A;  4KUD A;  1KX5 C;  4YM6 C;  1M18 C;  1M19 D;  3LZ0 B;  4QLC D;  5B33 C;  4H9S C;  4WU9 C;  4EO5 B;  5DNM D;  3MGP B;  3W97 D;  4KGC A;  4J8W B;  1P3I D;  1P34 A;  4J8X D;  3REK D;  3AZG C;  5AVC C;  1AOI D;  4XZQ A;  3A6N C;  3X1U D;  5GSU A;  3AZF B;  2NQB D;  1TZY B;  4JJN D;  3MNN C;  5B32 B;  1JFI A;  3B6G A;  1P3G A;  4G91 C;  1Q9C A;  3VH6 A;  1B67 A;  1M1A C;  3B6F A;  5B24 C;  2FJ7 D;  4J8V A;  4Z66 A;  4H9P B;  3W96 B;  5GXQ D;  1EQZ D;  3MGQ C;  5CP6 A;  3AZK C;  3B0D C;  1U35 A;  3WAA C;  1P3M D;  1F66 C;  5DNN B;  3VH5 A;  4LD9 D;  3UTA D;  4X23 A;  4Z2M H;  3VH6 W;  3AV2 D;  5E5A C;  4R8P B;  3W98 C;  5AV9 B;  2YFV A;  4E45 A;  5B2J A;  1P3P A;  3O62 B;  1ID3 D;  5CPK B;  1S32 A;  4KHA B;  1KX3 B;  5AV8 D;  3AFA D;  5B0Z B;  1P3K C;  3KXB B;  3W99 A;  3X1S B;  3MGP D;  1P3L B;  4XUJ A;  2ARO C;  3LEL C;  5CPJ A;  5C3I B;  4ZUX A;  1ULY A;  4YS3 D;  2PYO A;  4J8U D;  1BH8 A;  3MGS B;  4WU8 A;  2YFW B;  3X1U C;  5JRG D;  3REJ C;  3AN2 B;  3REH C;  3UT9 D;  3AZE C;  3AZH A;  1KX4 C;  3LJA A;  5AY8 A;  1P3B D;  5B40 D;  4H9O B;  5B1L B;  1P3O C;  5CPI A;  3NQU A;  1KX5 D;  5GXQ C;  4YM6 D;  4H9R A;  1M18 D;  3AZN A;  5CHL B;  1P3M C;  3AZL A;  5GT3 C;  5BNV B;  3REI B;  5B33 D;  4WU9 D;  4Z5T A;  4ZBJ C;  3R45 A;  5AV5 C;  3AZG D;  5AV6 B;  5AVC D;  3KWQ C;  3AZM B;  4HGA B;  3A6N D;  5B31 B;  5B32 G;  1P3F B;  5GT0 B;  1B6W A;  3MNN D;  3C1C B;  3TU4 B;  1HTA A;  5AVB C;  5JA4 A;  3C1B A;  3REH B;  1TAF B;  2CV5 A;  5B1M A;  3LZ1 A;  3MVD A;  3AZJ A;  1N1J A;  1HQ3 A;  3UTB B;  1M1A D;  2F8N B;  3LZ0 C;  1WWI A;  3MGQ D;  3AZK D;  4EO5 C;  4XZQ C;  3WAA D;  4J8W C;  1ZLA B;  5F99 A;  1F66 D;  1M19 A;  3B6G C;  4QLC A;  2NZD B;  5GT3 B;  3AZF C;  1TZY C;  2HIO B;  3AZI A;  3W97 A;  5DNM A;  5B32 C;  1P3I A;  1BH9 A;  4J8X A;  3REK A;  4CAY B;  4CSR B;  5E5A D;  3WA9 B;  3WTP B;  3MGR B;  3WKJ A;  4KUD B;  4JJN A;  3W96 C;  1KU5 A;  5BT1 C;  1P3K D;  3KUY A;  4KGC B;  5DNN C;  3B0C T;  2FJ7 A;  1P34 B;  1EQZ A;  2ARO D;  3LEL D;  4XZQ B;  4G92 B;  5GSU B;  4NE5 A;  1JFI B;  3B6G B;  2IO5 B;  1P3G B;  4LD9 A;  3UTA A;  4R8P C;  4H9N A;  3REJ D;  5AV9 C;  5BS7 A;  3REH D;  3AYW A;  3AZE D;  1P3A A;  3B6F B;  1KX4 D;  5FUG A;  3O62 C;  3AV2 A;  4J8V B;  4Z66 B;  5CPK C;  1KX3 C;  5CP6 B;  5B0Z C;  1U35 B;  3KXB C;  1P3O D;  3X1S C;  1P3L C;  1BFM A;  1ID3 A;  5C3I C;  4X23 B;  5AV8 A;  3AV1 A;  3AFA A;  5GT3 D;  3AZH C;  2HIO D;  1H3O A;  3MGS C;  3LJA C;  3AN2 C;  5AV5 D;  5B0Y A;  3KWQ D;  5B2I A;  2YFV B;  4YS3 A;  5B2J B;  1P3P B;  4J8U A;  5JRG A;  5B1L C;  5AVB D;  3REL A;  1S32 B;  2F8N G;  3UT9 A;  2BYM A;  3W99 B;  3LZ0 D;  4XUJ B;  4UUZ A;  1P3B A;  5B40 A;  5G49 A;  5CPJ B;  3REI C;  4ZUX B;  2HUE B;  4XZQ D;  2CWE A;  4J8W D;  1KX5 A;  4YM6 A;  2PYO B;  1M18 A;  1BH8 B;  4WU8 B;  3B6G D;  5AV6 C;  3AZM C;  4HGA C;  5B31 C;  1P3F C;  5GT0 C;  3AZH B;  3AZF D;  1TZY D;  5B33 A;  4H9S A;  3C1C C;  3X1T A;  4WU9 A;  5B32 D;  3LJA B;  5AY8 B;  3TU4 C;  3AZG A;  5AVC A;  5CP6 D;  3UTB C;  3A6N A;  5CPI B;  3NQU B;  3MNN A;  4H9R B;  3W96 D;  3B0C W;  5F99 C;  3AZN B;  3AZL B;  1ZLA C;  5BT1 D;  1M1A A;  4Z5T B;  2RVQ C;  5DNN D;  3B0B A;  3R45 B;  5B24 A;  2NZD C;  4M6B A;  3MGQ A;  2HIO C;  3AZK A;  1WWS A;  4DRA A;  3WAA A;  1F66 A;  3WA9 C;  3WTP C;  5JA4 B;  3C1B B;  3MGR C;  4R8P D;  2CV5 B;  5B1M B;  4KUD C;  5AV9 D;  3LZ1 B;  4NE6 A;  3MVD B;  3AZJ B;  1N1J B;  1HQ3 B;  3O62 D;  4NFT A;  5CPK D;  5E5A A;  1KX3 D;  4AWL B;  2L5A A;  5B0Z D;  3W98 A;  4KGC C;  3KXB D;  3X1V A;  3X1S D;  1P3L D;  5F99 B;  1P34 C;  1M19 B;  2PYO D;  4QLC B;  4G92 C;  4WNN A;  5GSU C;  5BO0 A;  3AZI B;  5BNX A;  1P3K A;  5DNM B;  3AZH D;  2F8N H;  3W97 B;  2IO5 C;  1P3G C;  3MGS D;  1P3I B;  3LJA D;  1BH9 B;  4J8X B;  3REK B;  2ARO A;  3LEL A;  3AN2 D;  3V9R A;  3B6F C;  3WKJ B;  4JJN B;  3VH6 T;  4J8V C;  4Z66 C;  5CP6 C;  1AOI A;  3X1U A;  3REJ A;  5B1L D;  1U35 C;  2NQB A;  2F8N K;  3AZE A;  3AV1 C;  3KUY B;  1KX4 A; 
#chains in the Genus database with same CATH topology
 4Z5T D;  2FJ7 B;  1EQZ B;  4X23 C;  3VH5 T;  3REI D;  5KDM A;  1P3O A;  2BYK A;  5GXQ A;  4LD9 B;  3UTA B;  4H9N B;  5AV6 D;  2Y2G A;  1P3M A;  3AZM D;  1PZR A;  5B31 D;  3AYW B;  1P3F D;  4H9Q A;  5GT0 D;  3F6T A;  5B2J C;  1P3A B;  3C1C D;  1P3P C;  5FUG B;  3AV2 B;  3TU4 D;  1S32 C;  5AV5 A;  3NQJ A;  1R4V A;  3KWQ A;  3UTB D;  2F8N D;  3W99 C;  4XUJ C;  1ID3 B;  5F99 D;  5CPJ C;  4ZUX C;  5AVB A;  2HUE C;  5AV8 B;  3AV1 B;  3AFA B;  1ZLA D;  2PYO C;  3X1T C;  3AZI D;  1H3O B;  2RVQ D;  3LZ0 A;  4WU8 C;  1F1E A;  2NZD D;  5B0Y B;  2FFF B;  3MGP A;  5B2I B;  5AY8 C;  4J8W A;  4YS3 B;  3WKJ D;  5B31 G;  2DF4 C;  4J8U B;  3WA9 D;  5JRG B;  3WTP D;  3REL B;  3MGR D;  3UT9 B;  2JE5 A;  4KUD D;  5CPI C;  3AZF A;  1TZY A;  2BYM B;  2Y2L A;  2VQR A;  5B32 A;  3KUY D;  3KSY A;  4UUZ B;  3AZN C;  1P3B B;  3AZL C;  5B40 B;  5G49 B;  4KGC D;  4Z5T C;  1KX5 B;  4YM6 B;  1M18 B;  3W96 A;  1P34 D;  4H9P A;  3KFU G;  3A1K A;  3EPK A;  5GSU D;  3EPJ A;  5B33 B;  3AYW D;  3X1T B;  4WU9 B;  4WV4 B;  5DNN A;  1P3A D;  1P3G D;  3C1B C;  2CV5 C;  5B1M C;  3AZG B;  3EG5 B;  3LZ1 C;  3MVD C;  5AVC B;  3AZJ C;  1HQ3 C;  3A6N B;  3B6F D;  1A7W A;  3X1V C;  3MNN B;  2NZD A;  4J8V D;  4Z66 D;  2F2A C;  4R8P A;  4AWL C;  4G91 B;  5AV9 A;  1U35 D;  3VH5 W;  1M1A B;  3AV1 D;  1M19 C;  4QLC C;  3O62 A;  5B24 B;  5CPK A;  2ZY2 A;  4KHA A;  3MGQ B;  1KX3 A;  4X23 D;  3AZK B;  5B0Z A;  2ZY5 A;  5B0Y D;  3B0D B;  3H0L C;  5DNM C;  3KXB A;  4E44 A;  3AZI C;  3W97 C;  3WAA B;  3X1S A;  1P3I C;  1P3L A;  5B2I D;  1F66 B;  4J8X C;  3REK C;  1AOI C;  3WKJ C;  2Y2O A;  4JJN C;  4WZS B;  3REL D;  2NQB C;  5B2J D;  1P3P D;  3MGS A;  2YFW A;  1S32 D;  5E5A B;  3AN2 A;  3W98 B;  3KUY C;  3W99 D;  3X1V B;  4XUJ D;  2FJ7 C;  3IP4 C;  1EQZ C;  5CPJ D;  4H9O A;  5B1L A;  4ZUX D;  4WNN B;  5BO0 B;  5BNX B;  1P3K B;  3X1T D;  2Y2I A;  4LD9 C;  3UTA C;  4WU8 D;  3WTP E;  2ARO B;  5BS7 C;  3LEL B;  3AYW C;  2LY8 A;  3V9R B;  5BNV A;  3REI A;  1P3A C;  3AV2 C;  5AY8 D;  1Z2C B;  1AOI B;  3X1U B;  5AV6 A;  3REJ B;  3AZM A;  2NQB B;  5B31 A;  3AZE B;  5GT0 A;  2JSS A;  4NE3 A;  5CPI D;  1P3F A;  3C1C A;  1KX4 B;  1ID3 C;  3H0M C;  3TU4 A;  4Z2M G;  3AZN D;  3REH A;  5B24 D;  1TAF A;  5AV8 C;  3AZL D;  3AFA C;  5KDM B;  3UTB A;  2F8N A;  2ZM5 A;  1P3O B;  3MGP C;  2BYK B;  5GXQ B;  5B0Y C;  1P3M B;  2Y2Q A;  5B2I C;  4H9Q B;  4YS3 C;  1ZLA A;  4J8U C;  4ZBJ B;  4DRB A;  5JRG C;  3C1B D;  3REL C;  2CV5 D;  3UT9 C;  5GT3 A;  5B1M D;  5AV5 B;  3NQJ B;  3P5J B;  3LZ1 D;  3MVD D;  3KWQ B;  3AZJ D;  2HIO A;  1HQ3 D;  3W98 D;  3X1V D;  1P3B C;  3WA9 A;  5B40 C;  4CAY A;  4CSR A;  3WTP A;  5AVB B;  3MGR A;  4KUD A;  2Y2P A;  1KX5 C;  4YM6 C;  1M18 C;  1M19 D;  3LZ0 B;  3EPL A;  4QLC D;  5B33 C;  4H9S C;  4WU9 C;  4EO5 B;  5DNM D;  3MGP B;  3W97 D;  4KGC A;  4J8W B;  2G5I C;  1P3I D;  1P34 A;  4J8X D;  3REK D;  3AZG C;  5AVC C;  1AOI D;  4XZQ A;  3A6N C;  3X1U D;  4WJ3 C;  5GSU A;  3AZF B;  2NQB D;  1TZY B;  4JJN D;  3MNN C;  5B32 B;  1JFI A;  3B6G A;  1P3G A;  4G91 C;  1Q9C A;  3H0R C;  3VH6 A;  1B67 A;  2BG1 A;  1M1A C;  3B6F A;  2J8P A;  5B24 C;  2FJ7 D;  4J8V A;  4Z66 A;  4H9P B;  3W96 B;  5GXQ D;  1EQZ D;  3MGQ C;  5CP6 A;  2JCH A;  3AZK C;  3B0D C;  2Y2H A;  2ZY4 A;  3WAA C;  1T3U A;  1U35 A;  1P3M D;  1F66 C;  5DNN B;  3VH5 A;  4LD9 D;  3UTA D;  4X23 A;  4Z2M H;  3VH6 W;  3AV2 D;  5E5A C;  4R8P B;  3W98 C;  5AV9 B;  2YFV A;  4E45 A;  5B2J A;  1P3P A;  3O62 B;  1ID3 D;  2Y2J A;  5CPK B;  1S32 A;  4KHA B;  1KX3 B;  5AV8 D;  3AFA D;  5B0Z B;  1P3K C;  2ZY3 A;  3KXB B;  3W99 A;  3X1S B;  3MGP D;  1P3L B;  4XUJ A;  2G5H C;  2ARO C;  3LEL C;  5CPJ A;  5C3I B;  4ZUX A;  1ULY A;  4YS3 D;  2PYO A;  4J8U D;  1BH8 A;  3MGS B;  4WU8 A;  2YFW B;  3X1U C;  5JRG D;  3REJ C;  3AN2 B;  3REH C;  4DQY B;  3UT9 D;  3AZE C;  3AZH A;  1KX4 C;  3LJA A;  1W2E A;  5AY8 A;  1P3B D;  5B40 D;  4H9O B;  5B1L B;  1P3O C;  5CPI A;  3NQU A;  1KX5 D;  5GXQ C;  4YM6 D;  4H9R A;  1M18 D;  2XD5 A;  3AZN A;  5CHL B;  1P3M C;  3AZL A;  5GT3 C;  5BNV B;  3REI B;  5B33 D;  4WU9 D;  4Z5T A;  4ZBJ C;  3R45 A;  3FDD A;  5AV5 C;  3AZG D;  5AV6 B;  5AVC D;  3KWQ C;  3AZM B;  4HGA B;  3A6N D;  5B31 B;  5B32 G;  1P3F B;  5GT0 B;  1B6W A;  3MNN D;  3C1C B;  3TU4 B;  1HTA A;  5AVB C;  5JA4 A;  3C1B A;  3REH B;  1TAF B;  2CV5 A;  5B1M A;  3LZ1 A;  3MVD A;  3AZJ A;  1N1J A;  1HQ3 A;  3UTB B;  1M1A D;  2F8N B;  3LZ0 C;  1WWI A;  3MGQ D;  3AZK D;  4EO5 C;  4XZQ C;  3WAA D;  4J8W C;  1ZLA B;  5F99 A;  1F66 D;  1M19 A;  3B6G C;  4QLC A;  2NZD B;  5GT3 B;  3AZF C;  1TZY C;  2HIO B;  3AZI A;  3W97 A;  5DNM A;  5B32 C;  1P3I A;  2Y2K A;  1BH9 A;  4J8X A;  3REK A;  4CAY B;  4CSR B;  5E5A D;  3WA9 B;  3WTP B;  3MGR B;  3WKJ A;  4KUD B;  2W8S A;  4JJN A;  3W96 C;  3A1I A;  1KU5 A;  5BT1 C;  1P3K D;  3KUY A;  4KGC B;  5DNN C;  3B0C T;  2FJ7 A;  1P34 B;  1EQZ A;  2ARO D;  3LEL D;  4XZQ B;  4G92 B;  5GSU B;  4NE5 A;  1JFI B;  3B6G B;  2IO5 B;  1P3G B;  4LD9 A;  3UTA A;  2RIQ A;  2UWX A;  4H9N A;  4R8P C;  3REJ D;  5AV9 C;  5BS7 A;  3REH D;  3AYW A;  3AZE D;  1P3A A;  3B6F B;  1KX4 D;  5FUG A;  3O62 C;  3AV2 A;  4J8V B;  4Z66 B;  5CPK C;  1KX3 C;  5CP6 B;  5B0Z C;  1U35 B;  3KXB C;  1P3O D;  2Y2M A;  3X1S C;  1P3L C;  1BFM A;  1ID3 A;  5C3I C;  4X23 B;  5AV8 A;  3AV1 A;  3AFA A;  5GT3 D;  2XD1 A;  3AZH C;  2HIO D;  1H3O A;  3MGS C;  3LJA C;  2Y2N A;  3AN2 C;  5AV5 D;  5B0Y A;  3KWQ D;  5B2I A;  2YFV B;  4YS3 A;  5B2J B;  1P3P B;  4J8U A;  5JRG A;  5B1L C;  5AVB D;  3REL A;  1S32 B;  2F8N G;  3UT9 A;  2BYM A;  3W99 B;  2DQN C;  4XUJ B;  4UUZ A;  3LZ0 D;  1P3B A;  5B40 A;  5G49 A;  5CPJ B;  3REI C;  4ZUX B;  2HUE B;  4XZQ D;  2CWE A;  4J8W D;  1KX5 A;  4YM6 A;  2PYO B;  1M18 A;  1BH8 B;  4WU8 B;  3B6G D;  5AV6 C;  3AZM C;  4HGA C;  5B31 C;  1P3F C;  5GT0 C;  3AZH B;  3AZF D;  1TZY D;  5B33 A;  4H9S A;  3C1C C;  3X1T A;  4WU9 A;  5B32 D;  3LJA B;  5AY8 B;  3TU4 C;  3AZG A;  5AVC A;  5CP6 D;  3UTB C;  3A6N A;  5CPI B;  3NQU B;  3MNN A;  4H9R B;  3W96 D;  3B0C W;  5F99 C;  3AZN B;  3AZL B;  1ZLA C;  5BT1 D;  1M1A A;  4Z5T B;  2RVQ C;  5DNN D;  3B0B A;  3R45 B;  5B24 A;  2NZD C;  4M6B A;  3MGQ A;  2HIO C;  3AZK A;  1WWS A;  4DRA A;  3WAA A;  1F66 A;  3WA9 C;  3WTP C;  5JA4 B;  3C1B B;  3MGR C;  4R8P D;  2CV5 B;  5B1M B;  4KUD C;  5AV9 D;  3EPH A;  3LZ1 B;  4NE6 A;  3MVD B;  3AZJ B;  1N1J B;  1HQ3 B;  3O62 D;  4NFT A;  5CPK D;  5E5A A;  1KX3 D;  4AWL B;  2L5A A;  5B0Z D;  3W98 A;  4KGC C;  3KXB D;  3X1V A;  3X1S D;  1P3L D;  5F99 B;  1P34 C;  1M19 B;  3AL0 C;  2PYO D;  4QLC B;  4G92 C;  4WNN A;  5GSU C;  5BO0 A;  3AZI B;  5BNX A;  1P3K A;  5DNM B;  3AZH D;  2F8N H;  3W97 B;  2IO5 C;  1P3G C;  3MGS D;  1P3I B;  3LJA D;  1BH9 B;  4J8X B;  3REK B;  2ARO A;  3LEL A;  3AN2 D;  3V9R A;  3B6F C;  3WKJ B;  4JJN B;  3VH6 T;  4J8V C;  4Z66 C;  5CP6 C;  1AOI A;  3X1U A;  3REJ A;  5B1L D;  1U35 C;  2NQB A;  4UPK A;  2F8N K;  3AZE A;  3AV1 C;  3KUY B;  1KX4 A; 
#chains in the Genus database with same CATH homology
 4Z5T D;  2FJ7 B;  1EQZ B;  4X23 C;  3VH5 T;  3REI D;  5KDM A;  1P3O A;  2BYK A;  5GXQ A;  4LD9 B;  3UTA B;  4H9N B;  5AV6 D;  2Y2G A;  1P3M A;  3AZM D;  1PZR A;  5B31 D;  3AYW B;  1P3F D;  4H9Q A;  5GT0 D;  3F6T A;  5B2J C;  1P3A B;  3C1C D;  1P3P C;  5FUG B;  3AV2 B;  3TU4 D;  1S32 C;  5AV5 A;  3NQJ A;  1R4V A;  3KWQ A;  3UTB D;  2F8N D;  3W99 C;  4XUJ C;  1ID3 B;  5F99 D;  5CPJ C;  4ZUX C;  5AVB A;  2HUE C;  5AV8 B;  3AV1 B;  3AFA B;  1ZLA D;  2PYO C;  3X1T C;  3AZI D;  1H3O B;  2RVQ D;  3LZ0 A;  4WU8 C;  1F1E A;  2NZD D;  5B0Y B;  2FFF B;  3MGP A;  5B2I B;  5AY8 C;  4J8W A;  4YS3 B;  3WKJ D;  5B31 G;  2DF4 C;  4J8U B;  3WA9 D;  5JRG B;  3WTP D;  3REL B;  3MGR D;  3UT9 B;  2JE5 A;  4KUD D;  5CPI C;  3AZF A;  1TZY A;  2BYM B;  2Y2L A;  2VQR A;  5B32 A;  3KUY D;  3KSY A;  4UUZ B;  3AZN C;  1P3B B;  3AZL C;  5B40 B;  5G49 B;  4KGC D;  4Z5T C;  1KX5 B;  4YM6 B;  1M18 B;  3W96 A;  1P34 D;  4H9P A;  3KFU G;  3A1K A;  3EPK A;  5GSU D;  3EPJ A;  5B33 B;  3AYW D;  3X1T B;  4WU9 B;  4WV4 B;  5DNN A;  1P3A D;  1P3G D;  3C1B C;  2CV5 C;  5B1M C;  3AZG B;  3EG5 B;  3LZ1 C;  3MVD C;  5AVC B;  3AZJ C;  1HQ3 C;  3A6N B;  3B6F D;  1A7W A;  3X1V C;  3MNN B;  2NZD A;  4J8V D;  4Z66 D;  2F2A C;  4R8P A;  4AWL C;  4G91 B;  5AV9 A;  1U35 D;  3VH5 W;  1M1A B;  3AV1 D;  1M19 C;  4QLC C;  3O62 A;  5B24 B;  5CPK A;  2ZY2 A;  4KHA A;  3MGQ B;  1KX3 A;  4X23 D;  3AZK B;  5B0Z A;  2ZY5 A;  5B0Y D;  3B0D B;  3H0L C;  5DNM C;  3KXB A;  4E44 A;  3AZI C;  3W97 C;  3WAA B;  3X1S A;  1P3I C;  1P3L A;  5B2I D;  1F66 B;  4J8X C;  3REK C;  1AOI C;  3WKJ C;  2Y2O A;  4JJN C;  4WZS B;  3REL D;  2NQB C;  5B2J D;  1P3P D;  3MGS A;  2YFW A;  1S32 D;  5E5A B;  3AN2 A;  3W98 B;  3KUY C;  3W99 D;  3X1V B;  4XUJ D;  2FJ7 C;  3IP4 C;  1EQZ C;  5CPJ D;  4H9O A;  5B1L A;  4ZUX D;  4WNN B;  5BO0 B;  5BNX B;  1P3K B;  3X1T D;  2Y2I A;  4LD9 C;  3UTA C;  4WU8 D;  3WTP E;  2ARO B;  5BS7 C;  3LEL B;  3AYW C;  2LY8 A;  3V9R B;  5BNV A;  3REI A;  1P3A C;  3AV2 C;  5AY8 D;  1Z2C B;  1AOI B;  3X1U B;  5AV6 A;  3REJ B;  3AZM A;  2NQB B;  5B31 A;  3AZE B;  5GT0 A;  2JSS A;  4NE3 A;  5CPI D;  1P3F A;  3C1C A;  1KX4 B;  1ID3 C;  3H0M C;  3TU4 A;  4Z2M G;  3AZN D;  3REH A;  5B24 D;  1TAF A;  5AV8 C;  3AZL D;  3AFA C;  5KDM B;  3UTB A;  2F8N A;  2ZM5 A;  1P3O B;  3MGP C;  2BYK B;  5GXQ B;  5B0Y C;  1P3M B;  2Y2Q A;  5B2I C;  4H9Q B;  4YS3 C;  1ZLA A;  4J8U C;  4ZBJ B;  4DRB A;  5JRG C;  3C1B D;  3REL C;  2CV5 D;  3UT9 C;  5GT3 A;  5B1M D;  5AV5 B;  3NQJ B;  3P5J B;  3LZ1 D;  3MVD D;  3KWQ B;  3AZJ D;  2HIO A;  1HQ3 D;  3W98 D;  3X1V D;  1P3B C;  3WA9 A;  5B40 C;  4CAY A;  4CSR A;  3WTP A;  5AVB B;  3MGR A;  4KUD A;  2Y2P A;  1KX5 C;  4YM6 C;  1M18 C;  1M19 D;  3LZ0 B;  3EPL A;  4QLC D;  5B33 C;  4H9S C;  4WU9 C;  4EO5 B;  5DNM D;  3MGP B;  3W97 D;  4KGC A;  4J8W B;  2G5I C;  1P3I D;  1P34 A;  4J8X D;  3REK D;  3AZG C;  5AVC C;  1AOI D;  4XZQ A;  3A6N C;  3X1U D;  4WJ3 C;  5GSU A;  3AZF B;  2NQB D;  1TZY B;  4JJN D;  3MNN C;  5B32 B;  1JFI A;  3B6G A;  1P3G A;  4G91 C;  1Q9C A;  3H0R C;  3VH6 A;  1B67 A;  2BG1 A;  1M1A C;  3B6F A;  2J8P A;  5B24 C;  2FJ7 D;  4J8V A;  4Z66 A;  4H9P B;  3W96 B;  5GXQ D;  1EQZ D;  3MGQ C;  5CP6 A;  2JCH A;  3AZK C;  3B0D C;  2Y2H A;  2ZY4 A;  3WAA C;  1T3U A;  1U35 A;  1P3M D;  1F66 C;  5DNN B;  3VH5 A;  4LD9 D;  3UTA D;  4X23 A;  4Z2M H;  3VH6 W;  3AV2 D;  5E5A C;  4R8P B;  3W98 C;  5AV9 B;  2YFV A;  4E45 A;  5B2J A;  1P3P A;  3O62 B;  1ID3 D;  2Y2J A;  5CPK B;  1S32 A;  4KHA B;  1KX3 B;  5AV8 D;  3AFA D;  5B0Z B;  1P3K C;  2ZY3 A;  3KXB B;  3W99 A;  3X1S B;  3MGP D;  1P3L B;  4XUJ A;  2G5H C;  2ARO C;  3LEL C;  5CPJ A;  5C3I B;  4ZUX A;  1ULY A;  4YS3 D;  2PYO A;  4J8U D;  1BH8 A;  3MGS B;  4WU8 A;  2YFW B;  3X1U C;  5JRG D;  3REJ C;  3AN2 B;  3REH C;  4DQY B;  3UT9 D;  3AZE C;  3AZH A;  1KX4 C;  3LJA A;  1W2E A;  5AY8 A;  1P3B D;  5B40 D;  4H9O B;  5B1L B;  1P3O C;  5CPI A;  3NQU A;  1KX5 D;  5GXQ C;  4YM6 D;  4H9R A;  1M18 D;  2XD5 A;  3AZN A;  5CHL B;  1P3M C;  3AZL A;  5GT3 C;  5BNV B;  3REI B;  5B33 D;  4WU9 D;  4Z5T A;  4ZBJ C;  3R45 A;  3FDD A;  5AV5 C;  3AZG D;  5AV6 B;  5AVC D;  3KWQ C;  3AZM B;  4HGA B;  3A6N D;  5B31 B;  5B32 G;  1P3F B;  5GT0 B;  1B6W A;  3MNN D;  3C1C B;  3TU4 B;  1HTA A;  5AVB C;  5JA4 A;  3C1B A;  3REH B;  1TAF B;  2CV5 A;  5B1M A;  3LZ1 A;  3MVD A;  3AZJ A;  1N1J A;  1HQ3 A;  3UTB B;  1M1A D;  2F8N B;  3LZ0 C;  1WWI A;  3MGQ D;  3AZK D;  4EO5 C;  4XZQ C;  3WAA D;  4J8W C;  1ZLA B;  5F99 A;  1F66 D;  1M19 A;  3B6G C;  4QLC A;  2NZD B;  5GT3 B;  3AZF C;  1TZY C;  2HIO B;  3AZI A;  3W97 A;  5DNM A;  5B32 C;  1P3I A;  2Y2K A;  1BH9 A;  4J8X A;  3REK A;  4CAY B;  4CSR B;  5E5A D;  3WA9 B;  3WTP B;  3MGR B;  3WKJ A;  4KUD B;  2W8S A;  4JJN A;  3W96 C;  3A1I A;  1KU5 A;  5BT1 C;  1P3K D;  3KUY A;  4KGC B;  5DNN C;  3B0C T;  2FJ7 A;  1P34 B;  1EQZ A;  2ARO D;  3LEL D;  4XZQ B;  4G92 B;  5GSU B;  4NE5 A;  1JFI B;  3B6G B;  2IO5 B;  1P3G B;  4LD9 A;  3UTA A;  2RIQ A;  2UWX A;  4H9N A;  4R8P C;  3REJ D;  5AV9 C;  5BS7 A;  3REH D;  3AYW A;  3AZE D;  1P3A A;  3B6F B;  1KX4 D;  5FUG A;  3O62 C;  3AV2 A;  4J8V B;  4Z66 B;  5CPK C;  1KX3 C;  5CP6 B;  5B0Z C;  1U35 B;  3KXB C;  1P3O D;  2Y2M A;  3X1S C;  1P3L C;  1BFM A;  1ID3 A;  5C3I C;  4X23 B;  5AV8 A;  3AV1 A;  3AFA A;  5GT3 D;  2XD1 A;  3AZH C;  2HIO D;  1H3O A;  3MGS C;  3LJA C;  2Y2N A;  3AN2 C;  5AV5 D;  5B0Y A;  3KWQ D;  5B2I A;  2YFV B;  4YS3 A;  5B2J B;  1P3P B;  4J8U A;  5JRG A;  5B1L C;  5AVB D;  3REL A;  1S32 B;  2F8N G;  3UT9 A;  2BYM A;  3W99 B;  2DQN C;  4XUJ B;  4UUZ A;  3LZ0 D;  1P3B A;  5B40 A;  5G49 A;  5CPJ B;  3REI C;  4ZUX B;  2HUE B;  4XZQ D;  2CWE A;  4J8W D;  1KX5 A;  4YM6 A;  2PYO B;  1M18 A;  1BH8 B;  4WU8 B;  3B6G D;  5AV6 C;  3AZM C;  4HGA C;  5B31 C;  1P3F C;  5GT0 C;  3AZH B;  3AZF D;  1TZY D;  5B33 A;  4H9S A;  3C1C C;  3X1T A;  4WU9 A;  5B32 D;  3LJA B;  5AY8 B;  3TU4 C;  3AZG A;  5AVC A;  5CP6 D;  3UTB C;  3A6N A;  5CPI B;  3NQU B;  3MNN A;  4H9R B;  3W96 D;  3B0C W;  5F99 C;  3AZN B;  3AZL B;  1ZLA C;  5BT1 D;  1M1A A;  4Z5T B;  2RVQ C;  5DNN D;  3B0B A;  3R45 B;  5B24 A;  2NZD C;  4M6B A;  3MGQ A;  2HIO C;  3AZK A;  1WWS A;  4DRA A;  3WAA A;  1F66 A;  3WA9 C;  3WTP C;  5JA4 B;  3C1B B;  3MGR C;  4R8P D;  2CV5 B;  5B1M B;  4KUD C;  5AV9 D;  3EPH A;  3LZ1 B;  4NE6 A;  3MVD B;  3AZJ B;  1N1J B;  1HQ3 B;  3O62 D;  4NFT A;  5CPK D;  5E5A A;  1KX3 D;  4AWL B;  2L5A A;  5B0Z D;  3W98 A;  4KGC C;  3KXB D;  3X1V A;  3X1S D;  1P3L D;  5F99 B;  1P34 C;  1M19 B;  3AL0 C;  2PYO D;  4QLC B;  4G92 C;  4WNN A;  5GSU C;  5BO0 A;  3AZI B;  5BNX A;  1P3K A;  5DNM B;  3AZH D;  2F8N H;  3W97 B;  2IO5 C;  1P3G C;  3MGS D;  1P3I B;  3LJA D;  1BH9 B;  4J8X B;  3REK B;  2ARO A;  3LEL A;  3AN2 D;  3V9R A;  3B6F C;  3WKJ B;  4JJN B;  3VH6 T;  4J8V C;  4Z66 C;  5CP6 C;  1AOI A;  3X1U A;  3REJ A;  5B1L D;  1U35 C;  2NQB A;  4UPK A;  2F8N K;  3AZE A;  3AV1 C;  3KUY B;  1KX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...