3AZED

Crystal structure of human nucleosome core particle containing h3k64q mutation
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azeD00
5F99C 2YFWB 5GT0A 3W96A 4WU8C 5B1LD 5E5AB 4KHAB 3AZED 4XZQB 1M1AB 1P3FA 4KUDD 5AVBD 1HTAA 5AVCA 1M19D 2RVQD 3W99D 5BNVB 3AZJC 4WU9B 1P3ID 5AV8D 3C1CA 3X1VB 2NQBC 4CAYB 4JJND 3UT9B 3A6NC 3REID 1P3PA 2CV5A 5B0ZA 5GXQC 4DRBA 4Z5TB 1KX5D 1P3LA 3REHB 1P3AC 3KSYA 5B2JB 4AWLB 3AZMC 2PYOD 2YFWA 2YFVB 3R45B 5JRGD 5BT1D 5DNMA 5E5AA 3O62C 3AV2D 5CPKB 5B40C 5CPJC 1M1AA 1ZLAC 1U35D 2FJ7B 3MNNC 3W97B 2HUEB 3WTPB 3MGQD 4KGCB 5BNVA 4QLCA 3LZ1D 4WU9A 1HQ3A 5JA4A 5AV5B 4R8PC 4YM6D 1P34C 1M18C 4LD9A 3VH5T 5AV6D 4XUJC 3UT9A 4G91B 3KXBC 4ZUXD 3AZFB 3RELD 4H9SA 1F66D 1BH9B 4J8WB 3X1SB 3X1UD 3AN2D 3REHA 5B2JA 1P3KD 5DNND 3R45A 1P3OB 4J8XA 4J8VD 2NZDB 5AV9B 3REJB 1KX4B 3TU4B 5CPKA 2FJ7A 4X23D 3AZNA 5CPIC 3W97A 5BS7A 3WTPA 4KGCA 3B0CT 5B1LB 5BNXB 5B2IC 1S32D 3LJAD 5AV5A 3AZEB 4KUDB 3VH6A 5AVBB 3C1BD 3AZIC 3AZHC 3KWQC 1M19B 3W99B 3V9RA 3B6FA 5B24C 3WKJC 1BH9A 5B31A 5AV8B 1P3BC 5C3IB 3X1SA 5CP6A 5F99D 4JJNB 1KX3C 3REIB 4WU8D 3AZKB 5GT3B 1P3OA 3W98B 4Z66A 2NZDA 2JSSA 5AV9A 3REJA 3WA9B 1KX5B 4YS3B 4NFTA 3AZJD 2PYOB 1R4VA 5GT0C 4H9QB 5JRGB 5BNXA 3AV2B 2NQBD 3AZEA 3A6ND 4KUDA 1P3FC 1U35B 1WWSA 2BYMB 3MGQB 5AVCC 5B0YC 1TZYB 3W99A 1EQZB 3LZ1B 4YM6B 1TAFB 1AOIA 2F8NA 1P3AD 4G92C 5AV6B 4WNNB 4JJNA 3REKC 3REIA 3UTAC 3AZKA 4NE5A 4ZUXB 2F8NK 3RELB 5GT3A 5AY8C 3O62D 2L5AA 3W98A 5B32A 5G49A 5B40D 5CPJD 3X1TC 1ZLAD 3X1UB 3WA9A 3MNND 3B0DC 4YS3A 2IO5B 4Z2MH 1P3KB 5DNNB 4H9QA 3LZ0C 1P34D 4R8PD 1M18D 5JRGA 3AZLC 5DNMC 4HGAC 5E5AC 4XUJD 3AYWC 1U35A 5B1MC 3KXBD 2BYMA 2AROC 3MGQA 1H3OA 1TZYA 1ID3C 4WZSB 1EQZA 4QLCC 1S32B 3LJAB 1HQ3C 4WU9C 1TAFA 3MGPB 3MGSC 4LD9C 1Q9CA 3C1BB 5AV6A 4UUZB 3AFAB 3RELA 3B6GC 4M6BA 5CPID 4WU8B 3MVDC 5B2ID 1P3KA 4J8XC 3AZID 3AZHD 3KWQD 3AZNC 3AV1B 4KHAA 4XZQA 3AZJB 2HIOC 3NQUB 5BS7C 5B24D 3WTPC 3WKJD 1P3BD 3LJAA 2NQBB 1KX3D 3A6NB 3MGPA 2CWEA 4J8UB 3UTBC 3X1VA 4UUZA 5GXQB 4CAYA 3AFAA 3B6FC 3MGRB 5B31C 1P3AB 2F8NH 5CP6C 3AZMB 2LY8A 5GT0D 4Z5TA 5GSUC 4H9RB 3O62B 1ULYA 4Z66C 3AZGC 1ZLAB 5B40B 3LELB 5CPJB 2YFVA 1P3FD 2NZDC 3MNNB 5AVCD 5B0YD 5B33B 3AV1A 3AZJA 3NQUA 1P3GC 1P34B 4R8PB 1M18B 3KUYC 4XUJB 3REKD 3A6NA 3UTAD 4E45A 4EO5C 5AY8D 4J8UA 5GXQA 3X1TD 3WAAC 3MGRA 5KDMB 3AZFA 1AOIC 5B31G 1F1EA 1B67A 1P3IB 3AZMA 4J8WA 3LZ0D 3VH6T 3AZKC 3AZLD 5DNMD 1P3MC 4H9RA 5E5AD 5GT3C 5CHLB 3W98C 5B32C 1ZLAA 3LELA 3AYWD 3B0BA 5CPIB 5B1MD 3WA9C 2AROD 4YS3C 1BH8B 5B33A 1KX4A 1ID3D 3TU4A 5B2IB 4QLCD 3VH5W 1HQ3D 4E44A 4WU9D 1P34A 3MGSD 4LD9D 3W96C 2BYKB 5B1LA 3UT9D 3AZHB 3KWQB 5B24B 5AVBA 1P3BB 3B6GD 1M19A 1EQZC 2F8NG 3MVDD 1P3IA 5AV8A 3C1CC 4H9PB 4J8XD 1P3PC 5B32G 3B0CW 5B0ZC 3AZND 5CPIA 2CV5C 1F66B 2HIOD 5GT0B 1BH8A 3WTPD 1KX5A 3AN2B 1P3LC 2PYOA 1P3FB 4J8VB 2BYKA 5AVCB 5B0YB 3KWQA 3UTBD 3AV2A 4XZQC 5B24A 4X23B 1M1AC 3B6FD 1BFMA 5B31D 4G92B 4H9NB 5CP6D 5BO0B 3REKB 3LZ1A 5GSUD 3MGPC 4YM6A 3UTAB 4ZBJB 5AY8B 4H9PA 3X1VC 4Z66D 3AZGD 3X1TB 4WNNA 3AFAC 3UT9C 2NZDD 3B0DB 4ZUXA 4H9SC 1F66A 3X1UA 1P3GD 3LZ0B 5FUGB 4Z5TC 5F99B 3AN2A 3REHC 3AZLB 5DNMB 1KU5A 4HGAB 5B2JC 3KUYD 4AWLC 5DNNA 3AYWB 4DRAA 5B1MB 4J8VA 2AROB 4NE3A 5B0YA 3AV1C 1ID3B 5CPKC 2FJ7C 3WAAD 4X23A 4QLCB 1HQ3B 1N1JB 5JA4B 1AOID 3W97C 2HUEC 2F8ND 4KGCC 3MGSB 4H9NA 4LD9B 5BO0A 3REKA 3UTAA 1S32A 5AV5C 3AZKD 1P3MD 5AY8A 5GT3D 4J8UC 3C1BA 3W98D 5B32D 4WV4B 3X1TA 3B6GB 4G91C 3WTPE 3MGRC 3WA9D 4YS3D 3AZFC 3MVDB 4NE6A 4J8WC 3X1SC 3LZ0A 5FUGA 4J8XB 5F99A 4CSRB 3AZLA 4WU8A 3W96D 4Z2MG 3LELC 3AYWA 1P3OC 3AZNB 5B1MA 3VH5A 2AROA 2HIOB 5AV9C 3REJC 5B33C 1TZYD 1ID3A 1KX4C 3TU4C 1EQZD 1N1JA 3MGSA 3C1CD 5B1LC 3UTBB 3V9RB 2NQBA 3AZEC 3B6FB 4KUDC 3KXBB 5B31B 5AVBC 1P3PD 3B6GA 2CV5D 5B0ZD 1M19C 5CP6B 2RVQC 3W99C 4H9OB 5GSUB 3MVDA 1P3LD 1P3IC 5AV8C 1P3AA 5C3IC 4Z66B 3AZGB 1JFIB 4JJNC 4CSRA 3REIC 1WWIA 3O62A 5B40A 4XZQD 2HIOA 5CPJA 1M1AD 1P3GB 3MNNA 1KX5C 3KUYB 2PYOC 3MGPD 4R8PA 1M18A 5JRGC 3NQJB 4EO5B 5BT1C 3UTBA 3X1VD 3AV2C 4XUJA 3AFAD 3AZIB 3WAAB 1U35C 3KXBA 1AOIB 2F8NB 3MGQC 3WKJB 1TZYC 4H9OA 5GSUA 4Z5TD 5KDMA 4YM6C 3LZ1C 1KX3B 3REHD 1P3MB 5B2JD 3AZGA 5B32B 5G49B 5AV6C 1JFIA 4ZUXC 3RELC 3AV1D 1F66C 5CPKD 2FJ7D 3X1UC 1B6WA 1P3GA 3W97D 3AN2C 2IO5C 4KGCD 1A7WA 3W96B 3KUYA 5B2IA 1P3KC 5DNNC 5AV5D 4J8VC 3NQJA 4J8UD 1H3OB 5GXQD 3AZIA 3WAAA 3AZHA 4X23C 3MGRD 3AZFD 3WKJA 3VH6W 1P3BA 3C1CB 3AZMD 4J8WD 3X1SD 1S32C 3LJAC 1KX3A 1P3MA 4ZBJC 3C1BC 1P3PB 3LELD 1P3OD 2CV5B 5B0ZB 5AV9D 3REJD 5B33D 1P3LB 1KX4D 3TU4D
chains in the Genus database with same CATH superfamily
5F99C 2YFWB 5GT0A 3W96A 4WU8C 5B1LD 5E5AB 4KHAB 2ZY3A 3AZED 4XZQB 1M1AB 1P3FA 4KUDD 5AVBD 1HTAA 5AVCA 1M19D 2RVQD 3W99D 5BNVB 3AZJC 4WU9B 1P3ID 5AV8D 3C1CA 3X1VB 3EPHA 2NQBC 4CAYB 4JJND 3UT9B 3A6NC 3REID 1P3PA 2CV5A 5B0ZA 5GXQC 4DRBA 4Z5TB 1KX5D 1P3LA 3REHB 1P3AC 3KSYA 5B2JB 4AWLB 3AZMC 2PYOD 2YFWA 2YFVB 3R45B 5JRGD 5BT1D 5DNMA 5E5AA 3O62C 3AV2D 5CPKB 5B40C 5CPJC 1M1AA 1ZLAC 1U35D 2FJ7B 3MNNC 2Y2JA 2HUEB 3W97B 3WTPB 3MGQD 4KGCB 2W8SA 5BNVA 4QLCA 3LZ1D 4WU9A 1HQ3A 5JA4A 5AV5B 4R8PC 4YM6D 1P34C 1M18C 4LD9A 3VH5T 5AV6D 4XUJC 3UT9A 4G91B 2UWXA 3KXBC 4ZUXD 3AZFB 3RELD 1W2EA 4H9SA 1F66D 1BH9B 4J8WB 3X1SB 3X1UD 3AN2D 3REHA 5B2JA 1P3KD 5DNND 3R45A 1P3OB 4J8XA 4J8VD 2NZDB 5AV9B 3REJB 1KX4B 3TU4B 5CPKA 2FJ7A 4X23D 3AZNA 5CPIC 3W97A 5BS7A 3WTPA 4KGCA 3B0CT 5B1LB 5BNXB 5B2IC 3IP4C 1S32D 3LJAD 5AV5A 3AZEB 4KUDB 3VH6A 5AVBB 3C1BD 3AZIC 3AZHC 3KWQC 1M19B 3W99B 3V9RA 3B6FA 2JE5A 5B24C 3WKJC 1BH9A 5B31A 5AV8B 1P3BC 5C3IB 3X1SA 5CP6A 5F99D 2XD1A 4JJNB 1KX3C 3REIB 4WU8D 3AZKB 5GT3B 1P3OA 3W98B 4Z66A 2NZDA 2JSSA 5AV9A 3REJA 3WA9B 1KX5B 4YS3B 3AL0C 4NFTA 3AZJD 2PYOB 1R4VA 5GT0C 4H9QB 5JRGB 5BNXA 3AV2B 2NQBD 3AZEA 3A6ND 4KUDA 1P3FC 1U35B 1WWSA 2BYMB 3MGQB 5AVCC 5B0YC 1TZYB 3W99A 1EQZB 3LZ1B 4YM6B 1TAFB 1AOIA 2F8NA 1P3AD 4G92C 5AV6B 4WNNB 2ZY5A 4JJNA 3REKC 3REIA 2Y2HA 3UTAC 3AZKA 4NE5A 4ZUXB 2F8NK 3RELB 5GT3A 5AY8C 3O62D 2L5AA 3W98A 5B32A 5G49A 5B40D 5CPJD 3X1TC 1ZLAD 3X1UB 3WA9A 3MNND 3B0DC 4YS3A 2IO5B 4Z2MH 1P3KB 5DNNB 3FDDA 4H9QA 3LZ0C 1P34D 4R8PD 1M18D 5JRGA 3AZLC 5DNMC 4HGAC 5E5AC 3KFUG 4XUJD 3AYWC 1U35A 5B1MC 3KXBD 2BYMA 2AROC 2Y2OA 3MGQA 1H3OA 1TZYA 1ID3C 4WZSB 1EQZA 4QLCC 1S32B 3LJAB 1HQ3C 4WU9C 1TAFA 2Y2GA 3MGPB 3MGSC 4LD9C 1Q9CA 3C1BB 5AV6A 4UUZB 3AFAB 3RELA 3B6GC 4M6BA 5CPID 4WU8B 3MVDC 5B2ID 1P3KA 4J8XC 3AZID 3AZHD 3KWQD 3AZNC 3AV1B 4KHAA 4XZQA 3AZJB 2HIOC 3NQUB 5BS7C 5B24D 3WTPC 3WKJD 1P3BD 3LJAA 2NQBB 1KX3D 3A6NB 2G5HC 3EPKA 3MGPA 2CWEA 4J8UB 3UTBC 3X1VA 4UUZA 5GXQB 4CAYA 3AFAA 2XD5A 3B6FC 3MGRB 5B31C 1P3AB 2F8NH 5CP6C 3AZMB 2LY8A 5GT0D 4Z5TA 5GSUC 4H9RB 3O62B 1ULYA 4Z66C 2RIQA 3AZGC 5B40B 3LELB 5CPJB 2YFVA 1P3FD 1ZLAB 2NZDC 3MNNB 3EPJA 5AVCD 5B0YD 5B33B 3AV1A 3AZJA 3NQUA 1P3GC 1P34B 4R8PB 1M18B 3KUYC 4XUJB 3REKD 3A6NA 3UTAD 4E45A 4EO5C 5AY8D 4J8UA 5GXQA 3X1TD 3WAAC 3EG5B 3MGRA 5KDMB 3AZFA 1AOIC 5B31G 1F1EA 1B67A 1P3IB 3AZMA 4J8WA 3LZ0D 3VH6T 3AZKC 3AZLD 5DNMD 1P3MC 4H9RA 5E5AD 5GT3C 5CHLB 3W98C 5B32C 1ZLAA 3LELA 3AYWD 2Y2PA 3B0BA 5B1MD 5CPIB 3WA9C 2AROD 4YS3C 1BH8B 5B33A 1KX4A 1ID3D 3TU4A 5B2IB 4QLCD 3VH5W 1HQ3D 4E44A 4WU9D 1P34A 3MGSD 4LD9D 3W96C 2BYKB 5B1LA 3UT9D 3AZHB 3KWQB 5B24B 5AVBA 1P3BB 3B6GD 1M19A 1T3UA 1EQZC 2Y2KA 2F8NG 3MVDD 1P3IA 5AV8A 3C1CC 4H9PB 4J8XD 1P3PC 5B32G 3B0CW 4UPKA 5B0ZC 3AZND 5CPIA 2CV5C 1F66B 2HIOD 5GT0B 1BH8A 3WTPD 1KX5A 3AN2B 1P3LC 2PYOA 1P3FB 4J8VB 2BYKA 5AVCB 5B0YB 3H0RC 3KWQA 3UTBD 3AV2A 2F2AC 4XZQC 5B24A 4X23B 1M1AC 3B6FD 1BFMA 5B31D 3F6TA 4H9NB 5CP6D 4G92B 5BO0B 2JCHA 3REKB 3LZ1A 5GSUD 3MGPC 4YM6A 3UTAB 4ZBJB 5AY8B 3EPLA 4H9PA 3X1VC 4Z66D 3AZGD 3X1TB 4WNNA 3AFAC 3UT9C 2NZDD 2G5IC 3B0DB 4ZUXA 4H9SC 1F66A 3X1UA 1P3GD 3LZ0B 5FUGB 4Z5TC 5F99B 3AN2A 3REHC 3AZLB 5DNMB 1KU5A 4HGAB 5B2JC 3KUYD 4AWLC 5DNNA 3AYWB 4DRAA 5B1MB 4J8VA 2AROB 4NE3A 5B0YA 3AV1C 1ID3B 1PZRA 3H0MC 5CPKC 2FJ7C 3WAAD 4X23A 3H0LC 4QLCB 1HQ3B 1N1JB 5JA4B 1AOID 3W97C 2HUEC 2F8ND 4KGCC 3MGSB 4H9NA 4LD9B 5BO0A 3REKA 2VQRA 3UTAA 1S32A 5AV5C 3AZKD 1P3MD 5AY8A 5GT3D 4J8UC 2ZY2A 3C1BA 3A1IA 3W98D 5B32D 4WV4B 3X1TA 3B6GB 4G91C 3WTPE 3MGRC 3WA9D 4YS3D 3AZFC 3MVDB 4NE6A 2DF4C 2Y2LA 4J8WC 3X1SC 3LZ0A 2BG1A 5FUGA 4J8XB 5F99A 4CSRB 3AZLA 4WU8A 3W96D 4Z2MG 3LELC 3AYWA 1P3OC 3AZNB 5B1MA 3VH5A 2AROA 2HIOB 5AV9C 3REJC 5B33C 1TZYD 1ID3A 1KX4C 3TU4C 1Z2CB 1EQZD 1N1JA 3MGSA 3P5JB 3C1CD 5B1LC 3UTBB 3V9RB 2NQBA 3AZEC 3B6FB 4KUDC 3KXBB 5B31B 5AVBC 1P3PD 3B6GA 2CV5D 5B0ZD 1M19C 5CP6B 2RVQC 3W99C 4H9OB 2DQNC 2FFFB 5GSUB 3MVDA 1P3LD 1P3IC 5AV8C 1P3AA 5C3IC 2Y2QA 4Z66B 3AZGB 1JFIB 4JJNC 4CSRA 3REIC 1WWIA 3O62A 5B40A 4XZQD 2HIOA 5CPJA 1M1AD 1P3GB 3MNNA 1KX5C 3KUYB 2Y2MA 2PYOC 3MGPD 4R8PA 1M18A 5JRGC 3NQJB 4EO5B 5BT1C 3UTBA 3X1VD 3AV2C 4XUJA 3AFAD 3AZIB 2ZY4A 3WAAB 1U35C 3KXBA 1AOIB 2F8NB 3MGQC 3WKJB 1TZYC 4H9OA 5GSUA 4Z5TD 5KDMA 4YM6C 3LZ1C 1KX3B 3REHD 1P3MB 5B2JD 2Y2NA 3AZGA 5B32B 5G49B 5AV6C 1JFIA 4ZUXC 3RELC 3AV1D 1F66C 5CPKD 2FJ7D 3X1UC 1B6WA 1P3GA 3W97D 3AN2C 2IO5C 4KGCD 1A7WA 3W96B 3KUYA 5B2IA 1P3KC 5DNNC 2Y2IA 5AV5D 4J8VC 3NQJA 4J8UD 1H3OB 4WJ3C 5GXQD 3AZIA 3WAAA 3AZHA 4X23C 3MGRD 2J8PA 3AZFD 3WKJA 3VH6W 3A1KA 1P3BA 3C1CB 3AZMD 4J8WD 3X1SD 1S32C 3LJAC 1KX3A 4DQYB 1P3MA 4ZBJC 3C1BC 1P3PB 3LELD 1P3OD 2CV5B 5B0ZB 2ZM5A 5AV9D 3REJD 5B33D 1P3LB 1KX4D 3TU4D
chains in the Genus database with same CATH topology
5F99C 2YFWB 5GT0A 3W96A 4WU8C 5B1LD 5E5AB 4KHAB 2ZY3A 3AZED 4XZQB 1M1AB 1P3FA 4KUDD 5AVBD 1HTAA 5AVCA 1M19D 2RVQD 3W99D 5BNVB 3AZJC 4WU9B 1P3ID 5AV8D 3C1CA 3X1VB 3EPHA 2NQBC 4CAYB 4JJND 3UT9B 3A6NC 3REID 1P3PA 2CV5A 5B0ZA 5GXQC 4DRBA 4Z5TB 1KX5D 1P3LA 3REHB 1P3AC 3KSYA 5B2JB 4AWLB 3AZMC 2PYOD 2YFWA 2YFVB 3R45B 5JRGD 5BT1D 5DNMA 5E5AA 3O62C 3AV2D 5CPKB 5B40C 5CPJC 1M1AA 1ZLAC 1U35D 2FJ7B 3MNNC 2Y2JA 2HUEB 3W97B 3WTPB 3MGQD 4KGCB 2W8SA 5BNVA 4QLCA 3LZ1D 4WU9A 1HQ3A 5JA4A 5AV5B 4R8PC 4YM6D 1P34C 1M18C 4LD9A 3VH5T 5AV6D 4XUJC 3UT9A 4G91B 2UWXA 3KXBC 4ZUXD 3AZFB 3RELD 1W2EA 4H9SA 1F66D 1BH9B 4J8WB 3X1SB 3X1UD 3AN2D 3REHA 5B2JA 1P3KD 5DNND 3R45A 1P3OB 4J8XA 4J8VD 2NZDB 5AV9B 3REJB 1KX4B 3TU4B 5CPKA 2FJ7A 4X23D 3AZNA 5CPIC 3W97A 5BS7A 3WTPA 4KGCA 3B0CT 5B1LB 5BNXB 5B2IC 3IP4C 1S32D 3LJAD 5AV5A 3AZEB 4KUDB 3VH6A 5AVBB 3C1BD 3AZIC 3AZHC 3KWQC 1M19B 3W99B 3V9RA 3B6FA 2JE5A 5B24C 3WKJC 1BH9A 5B31A 5AV8B 1P3BC 5C3IB 3X1SA 5CP6A 5F99D 2XD1A 4JJNB 1KX3C 3REIB 4WU8D 3AZKB 5GT3B 1P3OA 3W98B 4Z66A 2NZDA 2JSSA 5AV9A 3REJA 3WA9B 1KX5B 4YS3B 3AL0C 4NFTA 3AZJD 2PYOB 1R4VA 5GT0C 4H9QB 5JRGB 5BNXA 3AV2B 2NQBD 3AZEA 3A6ND 4KUDA 1P3FC 1U35B 1WWSA 2BYMB 3MGQB 5AVCC 5B0YC 1TZYB 3W99A 1EQZB 3LZ1B 4YM6B 1TAFB 1AOIA 2F8NA 1P3AD 4G92C 5AV6B 4WNNB 2ZY5A 4JJNA 3REKC 3REIA 2Y2HA 3UTAC 3AZKA 4NE5A 4ZUXB 2F8NK 3RELB 5GT3A 5AY8C 3O62D 2L5AA 3W98A 5B32A 5G49A 5B40D 5CPJD 3X1TC 1ZLAD 3X1UB 3WA9A 3MNND 3B0DC 4YS3A 2IO5B 4Z2MH 1P3KB 5DNNB 3FDDA 4H9QA 3LZ0C 1P34D 4R8PD 1M18D 5JRGA 3AZLC 5DNMC 4HGAC 5E5AC 3KFUG 4XUJD 3AYWC 1U35A 5B1MC 3KXBD 2BYMA 2AROC 2Y2OA 3MGQA 1H3OA 1TZYA 1ID3C 4WZSB 1EQZA 4QLCC 1S32B 3LJAB 1HQ3C 4WU9C 1TAFA 2Y2GA 3MGPB 3MGSC 4LD9C 1Q9CA 3C1BB 5AV6A 4UUZB 3AFAB 3RELA 3B6GC 4M6BA 5CPID 4WU8B 3MVDC 5B2ID 1P3KA 4J8XC 3AZID 3AZHD 3KWQD 3AZNC 3AV1B 4KHAA 4XZQA 3AZJB 2HIOC 3NQUB 5BS7C 5B24D 3WTPC 3WKJD 1P3BD 3LJAA 2NQBB 1KX3D 3A6NB 2G5HC 3EPKA 3MGPA 2CWEA 4J8UB 3UTBC 3X1VA 4UUZA 5GXQB 4CAYA 3AFAA 2XD5A 3B6FC 3MGRB 5B31C 1P3AB 2F8NH 5CP6C 3AZMB 2LY8A 5GT0D 4Z5TA 5GSUC 4H9RB 3O62B 1ULYA 4Z66C 2RIQA 3AZGC 5B40B 3LELB 5CPJB 2YFVA 1P3FD 1ZLAB 2NZDC 3MNNB 3EPJA 5AVCD 5B0YD 5B33B 3AV1A 3AZJA 3NQUA 1P3GC 1P34B 4R8PB 1M18B 3KUYC 4XUJB 3REKD 3A6NA 3UTAD 4E45A 4EO5C 5AY8D 4J8UA 5GXQA 3X1TD 3WAAC 3EG5B 3MGRA 5KDMB 3AZFA 1AOIC 5B31G 1F1EA 1B67A 1P3IB 3AZMA 4J8WA 3LZ0D 3VH6T 3AZKC 3AZLD 5DNMD 1P3MC 4H9RA 5E5AD 5GT3C 5CHLB 3W98C 5B32C 1ZLAA 3LELA 3AYWD 2Y2PA 3B0BA 5B1MD 5CPIB 3WA9C 2AROD 4YS3C 1BH8B 5B33A 1KX4A 1ID3D 3TU4A 5B2IB 4QLCD 3VH5W 1HQ3D 4E44A 4WU9D 1P34A 3MGSD 4LD9D 3W96C 2BYKB 5B1LA 3UT9D 3AZHB 3KWQB 5B24B 5AVBA 1P3BB 3B6GD 1M19A 1T3UA 1EQZC 2Y2KA 2F8NG 3MVDD 1P3IA 5AV8A 3C1CC 4H9PB 4J8XD 1P3PC 5B32G 3B0CW 4UPKA 5B0ZC 3AZND 5CPIA 2CV5C 1F66B 2HIOD 5GT0B 1BH8A 3WTPD 1KX5A 3AN2B 1P3LC 2PYOA 1P3FB 4J8VB 2BYKA 5AVCB 5B0YB 3H0RC 3KWQA 3UTBD 3AV2A 2F2AC 4XZQC 5B24A 4X23B 1M1AC 3B6FD 1BFMA 5B31D 3F6TA 4H9NB 5CP6D 4G92B 5BO0B 2JCHA 3REKB 3LZ1A 5GSUD 3MGPC 4YM6A 3UTAB 4ZBJB 5AY8B 3EPLA 4H9PA 3X1VC 4Z66D 3AZGD 3X1TB 4WNNA 3AFAC 3UT9C 2NZDD 2G5IC 3B0DB 4ZUXA 4H9SC 1F66A 3X1UA 1P3GD 3LZ0B 5FUGB 4Z5TC 5F99B 3AN2A 3REHC 3AZLB 5DNMB 1KU5A 4HGAB 5B2JC 3KUYD 4AWLC 5DNNA 3AYWB 4DRAA 5B1MB 4J8VA 2AROB 4NE3A 5B0YA 3AV1C 1ID3B 1PZRA 3H0MC 5CPKC 2FJ7C 3WAAD 4X23A 3H0LC 4QLCB 1HQ3B 1N1JB 5JA4B 1AOID 3W97C 2HUEC 2F8ND 4KGCC 3MGSB 4H9NA 4LD9B 5BO0A 3REKA 2VQRA 3UTAA 1S32A 5AV5C 3AZKD 1P3MD 5AY8A 5GT3D 4J8UC 2ZY2A 3C1BA 3A1IA 3W98D 5B32D 4WV4B 3X1TA 3B6GB 4G91C 3WTPE 3MGRC 3WA9D 4YS3D 3AZFC 3MVDB 4NE6A 2DF4C 2Y2LA 4J8WC 3X1SC 3LZ0A 2BG1A 5FUGA 4J8XB 5F99A 4CSRB 3AZLA 4WU8A 3W96D 4Z2MG 3LELC 3AYWA 1P3OC 3AZNB 5B1MA 3VH5A 2AROA 2HIOB 5AV9C 3REJC 5B33C 1TZYD 1ID3A 1KX4C 3TU4C 1Z2CB 1EQZD 1N1JA 3MGSA 3P5JB 3C1CD 5B1LC 3UTBB 3V9RB 2NQBA 3AZEC 3B6FB 4KUDC 3KXBB 5B31B 5AVBC 1P3PD 3B6GA 2CV5D 5B0ZD 1M19C 5CP6B 2RVQC 3W99C 4H9OB 2DQNC 2FFFB 5GSUB 3MVDA 1P3LD 1P3IC 5AV8C 1P3AA 5C3IC 2Y2QA 4Z66B 3AZGB 1JFIB 4JJNC 4CSRA 3REIC 1WWIA 3O62A 5B40A 4XZQD 2HIOA 5CPJA 1M1AD 1P3GB 3MNNA 1KX5C 3KUYB 2Y2MA 2PYOC 3MGPD 4R8PA 1M18A 5JRGC 3NQJB 4EO5B 5BT1C 3UTBA 3X1VD 3AV2C 4XUJA 3AFAD 3AZIB 2ZY4A 3WAAB 1U35C 3KXBA 1AOIB 2F8NB 3MGQC 3WKJB 1TZYC 4H9OA 5GSUA 4Z5TD 5KDMA 4YM6C 3LZ1C 1KX3B 3REHD 1P3MB 5B2JD 2Y2NA 3AZGA 5B32B 5G49B 5AV6C 1JFIA 4ZUXC 3RELC 3AV1D 1F66C 5CPKD 2FJ7D 3X1UC 1B6WA 1P3GA 3W97D 3AN2C 2IO5C 4KGCD 1A7WA 3W96B 3KUYA 5B2IA 1P3KC 5DNNC 2Y2IA 5AV5D 4J8VC 3NQJA 4J8UD 1H3OB 4WJ3C 5GXQD 3AZIA 3WAAA 3AZHA 4X23C 3MGRD 2J8PA 3AZFD 3WKJA 3VH6W 3A1KA 1P3BA 3C1CB 3AZMD 4J8WD 3X1SD 1S32C 3LJAC 1KX3A 4DQYB 1P3MA 4ZBJC 3C1BC 1P3PB 3LELD 1P3OD 2CV5B 5B0ZB 2ZM5A 5AV9D 3REJD 5B33D 1P3LB 1KX4D 3TU4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F99 C;  2YFW B;  5GT0 A;  3W96 A;  4WU8 C;  5B1L D;  5E5A B;  4KHA B;  3AZE D;  4XZQ B;  1M1A B;  1P3F A;  4KUD D;  5AVB D;  1HTA A;  5AVC A;  1M19 D;  2RVQ D;  3W99 D;  5BNV B;  3AZJ C;  4WU9 B;  1P3I D;  5AV8 D;  3C1C A;  3X1V B;  2NQB C;  4CAY B;  4JJN D;  3UT9 B;  3A6N C;  3REI D;  1P3P A;  2CV5 A;  5B0Z A;  5GXQ C;  4DRB A;  4Z5T B;  1KX5 D;  1P3L A;  3REH B;  1P3A C;  3KSY A;  5B2J B;  4AWL B;  3AZM C;  2PYO D;  2YFW A;  2YFV B;  3R45 B;  5JRG D;  5BT1 D;  5DNM A;  5E5A A;  3O62 C;  3AV2 D;  5CPK B;  5B40 C;  5CPJ C;  1M1A A;  1ZLA C;  1U35 D;  2FJ7 B;  3MNN C;  3W97 B;  2HUE B;  3WTP B;  3MGQ D;  4KGC B;  5BNV A;  4QLC A;  3LZ1 D;  4WU9 A;  1HQ3 A;  5JA4 A;  5AV5 B;  4R8P C;  4YM6 D;  1P34 C;  1M18 C;  4LD9 A;  3VH5 T;  5AV6 D;  4XUJ C;  3UT9 A;  4G91 B;  3KXB C;  4ZUX D;  3AZF B;  3REL D;  4H9S A;  1F66 D;  1BH9 B;  4J8W B;  3X1S B;  3X1U D;  3AN2 D;  3REH A;  5B2J A;  1P3K D;  5DNN D;  3R45 A;  1P3O B;  4J8X A;  4J8V D;  2NZD B;  5AV9 B;  3REJ B;  1KX4 B;  3TU4 B;  5CPK A;  2FJ7 A;  4X23 D;  3AZN A;  5CPI C;  3W97 A;  5BS7 A;  3WTP A;  4KGC A;  3B0C T;  5B1L B;  5BNX B;  5B2I C;  1S32 D;  3LJA D;  5AV5 A;  3AZE B;  4KUD B;  3VH6 A;  5AVB B;  3C1B D;  3AZI C;  3AZH C;  3KWQ C;  1M19 B;  3W99 B;  3V9R A;  3B6F A;  5B24 C;  3WKJ C;  1BH9 A;  5B31 A;  5AV8 B;  1P3B C;  5C3I B;  3X1S A;  5CP6 A;  5F99 D;  4JJN B;  1KX3 C;  3REI B;  4WU8 D;  3AZK B;  5GT3 B;  1P3O A;  3W98 B;  4Z66 A;  2NZD A;  2JSS A;  5AV9 A;  3REJ A;  3WA9 B;  1KX5 B;  4YS3 B;  4NFT A;  3AZJ D;  2PYO B;  1R4V A;  5GT0 C;  4H9Q B;  5JRG B;  5BNX A;  3AV2 B;  2NQB D;  3AZE A;  3A6N D;  4KUD A;  1P3F C;  1U35 B;  1WWS A;  2BYM B;  3MGQ B;  5AVC C;  5B0Y C;  1TZY B;  3W99 A;  1EQZ B;  3LZ1 B;  4YM6 B;  1TAF B;  1AOI A;  2F8N A;  1P3A D;  4G92 C;  5AV6 B;  4WNN B;  4JJN A;  3REK C;  3REI A;  3UTA C;  3AZK A;  4NE5 A;  4ZUX B;  2F8N K;  3REL B;  5GT3 A;  5AY8 C;  3O62 D;  2L5A A;  3W98 A;  5B32 A;  5G49 A;  5B40 D;  5CPJ D;  3X1T C;  1ZLA D;  3X1U B;  3WA9 A;  3MNN D;  3B0D C;  4YS3 A;  2IO5 B;  4Z2M H;  1P3K B;  5DNN B;  4H9Q A;  3LZ0 C;  1P34 D;  4R8P D;  1M18 D;  5JRG A;  3AZL C;  5DNM C;  4HGA C;  5E5A C;  4XUJ D;  3AYW C;  1U35 A;  5B1M C;  3KXB D;  2BYM A;  2ARO C;  3MGQ A;  1H3O A;  1TZY A;  1ID3 C;  4WZS B;  1EQZ A;  4QLC C;  1S32 B;  3LJA B;  1HQ3 C;  4WU9 C;  1TAF A;  3MGP B;  3MGS C;  4LD9 C;  1Q9C A;  3C1B B;  5AV6 A;  4UUZ B;  3AFA B;  3REL A;  3B6G C;  4M6B A;  5CPI D;  4WU8 B;  3MVD C;  5B2I D;  1P3K A;  4J8X C;  3AZI D;  3AZH D;  3KWQ D;  3AZN C;  3AV1 B;  4KHA A;  4XZQ A;  3AZJ B;  2HIO C;  3NQU B;  5BS7 C;  5B24 D;  3WTP C;  3WKJ D;  1P3B D;  3LJA A;  2NQB B;  1KX3 D;  3A6N B;  3MGP A;  2CWE A;  4J8U B;  3UTB C;  3X1V A;  4UUZ A;  5GXQ B;  4CAY A;  3AFA A;  3B6F C;  3MGR B;  5B31 C;  1P3A B;  2F8N H;  5CP6 C;  3AZM B;  2LY8 A;  5GT0 D;  4Z5T A;  5GSU C;  4H9R B;  3O62 B;  1ULY A;  4Z66 C;  3AZG C;  1ZLA B;  5B40 B;  3LEL B;  5CPJ B;  2YFV A;  1P3F D;  2NZD C;  3MNN B;  5AVC D;  5B0Y D;  5B33 B;  3AV1 A;  3AZJ A;  3NQU A;  1P3G C;  1P34 B;  4R8P B;  1M18 B;  3KUY C;  4XUJ B;  3REK D;  3A6N A;  3UTA D;  4E45 A;  4EO5 C;  5AY8 D;  4J8U A;  5GXQ A;  3X1T D;  3WAA C;  3MGR A;  5KDM B;  3AZF A;  1AOI C;  5B31 G;  1F1E A;  1B67 A;  1P3I B;  3AZM A;  4J8W A;  3LZ0 D;  3VH6 T;  3AZK C;  3AZL D;  5DNM D;  1P3M C;  4H9R A;  5E5A D;  5GT3 C;  5CHL B;  3W98 C;  5B32 C;  1ZLA A;  3LEL A;  3AYW D;  3B0B A;  5CPI B;  5B1M D;  3WA9 C;  2ARO D;  4YS3 C;  1BH8 B;  5B33 A;  1KX4 A;  1ID3 D;  3TU4 A;  5B2I B;  4QLC D;  3VH5 W;  1HQ3 D;  4E44 A;  4WU9 D;  1P34 A;  3MGS D;  4LD9 D;  3W96 C;  2BYK B;  5B1L A;  3UT9 D;  3AZH B;  3KWQ B;  5B24 B;  5AVB A;  1P3B B;  3B6G D;  1M19 A;  1EQZ C;  2F8N G;  3MVD D;  1P3I A;  5AV8 A;  3C1C C;  4H9P B;  4J8X D;  1P3P C;  5B32 G;  3B0C W;  5B0Z C;  3AZN D;  5CPI A;  2CV5 C;  1F66 B;  2HIO D;  5GT0 B;  1BH8 A;  3WTP D;  1KX5 A;  3AN2 B;  1P3L C;  2PYO A;  1P3F B;  4J8V B;  2BYK A;  5AVC B;  5B0Y B;  3KWQ A;  3UTB D;  3AV2 A;  4XZQ C;  5B24 A;  4X23 B;  1M1A C;  3B6F D;  1BFM A;  5B31 D;  4G92 B;  4H9N B;  5CP6 D;  5BO0 B;  3REK B;  3LZ1 A;  5GSU D;  3MGP C;  4YM6 A;  3UTA B;  4ZBJ B;  5AY8 B;  4H9P A;  3X1V C;  4Z66 D;  3AZG D;  3X1T B;  4WNN A;  3AFA C;  3UT9 C;  2NZD D;  3B0D B;  4ZUX A;  4H9S C;  1F66 A;  3X1U A;  1P3G D;  3LZ0 B;  5FUG B;  4Z5T C;  5F99 B;  3AN2 A;  3REH C;  3AZL B;  5DNM B;  1KU5 A;  4HGA B;  5B2J C;  3KUY D;  4AWL C;  5DNN A;  3AYW B;  4DRA A;  5B1M B;  4J8V A;  2ARO B;  4NE3 A;  5B0Y A;  3AV1 C;  1ID3 B;  5CPK C;  2FJ7 C;  3WAA D;  4X23 A;  4QLC B;  1HQ3 B;  1N1J B;  5JA4 B;  1AOI D;  3W97 C;  2HUE C;  2F8N D;  4KGC C;  3MGS B;  4H9N A;  4LD9 B;  5BO0 A;  3REK A;  3UTA A;  1S32 A;  5AV5 C;  3AZK D;  1P3M D;  5AY8 A;  5GT3 D;  4J8U C;  3C1B A;  3W98 D;  5B32 D;  4WV4 B;  3X1T A;  3B6G B;  4G91 C;  3WTP E;  3MGR C;  3WA9 D;  4YS3 D;  3AZF C;  3MVD B;  4NE6 A;  4J8W C;  3X1S C;  3LZ0 A;  5FUG A;  4J8X B;  5F99 A;  4CSR B;  3AZL A;  4WU8 A;  3W96 D;  4Z2M G;  3LEL C;  3AYW A;  1P3O C;  3AZN B;  5B1M A;  3VH5 A;  2ARO A;  2HIO B;  5AV9 C;  3REJ C;  5B33 C;  1TZY D;  1ID3 A;  1KX4 C;  3TU4 C;  1EQZ D;  1N1J A;  3MGS A;  3C1C D;  5B1L C;  3UTB B;  3V9R B;  2NQB A;  3AZE C;  3B6F B;  4KUD C;  3KXB B;  5B31 B;  5AVB C;  1P3P D;  3B6G A;  2CV5 D;  5B0Z D;  1M19 C;  5CP6 B;  2RVQ C;  3W99 C;  4H9O B;  5GSU B;  3MVD A;  1P3L D;  1P3I C;  5AV8 C;  1P3A A;  5C3I C;  4Z66 B;  3AZG B;  1JFI B;  4JJN C;  4CSR A;  3REI C;  1WWI A;  3O62 A;  5B40 A;  4XZQ D;  2HIO A;  5CPJ A;  1M1A D;  1P3G B;  3MNN A;  1KX5 C;  3KUY B;  2PYO C;  3MGP D;  4R8P A;  1M18 A;  5JRG C;  3NQJ B;  4EO5 B;  5BT1 C;  3UTB A;  3X1V D;  3AV2 C;  4XUJ A;  3AFA D;  3AZI B;  3WAA B;  1U35 C;  3KXB A;  1AOI B;  2F8N B;  3MGQ C;  3WKJ B;  1TZY C;  4H9O A;  5GSU A;  4Z5T D;  5KDM A;  4YM6 C;  3LZ1 C;  1KX3 B;  3REH D;  1P3M B;  5B2J D;  3AZG A;  5B32 B;  5G49 B;  5AV6 C;  1JFI A;  4ZUX C;  3REL C;  3AV1 D;  1F66 C;  5CPK D;  2FJ7 D;  3X1U C;  1B6W A;  1P3G A;  3W97 D;  3AN2 C;  2IO5 C;  4KGC D;  1A7W A;  3W96 B;  3KUY A;  5B2I A;  1P3K C;  5DNN C;  5AV5 D;  4J8V C;  3NQJ A;  4J8U D;  1H3O B;  5GXQ D;  3AZI A;  3WAA A;  3AZH A;  4X23 C;  3MGR D;  3AZF D;  3WKJ A;  3VH6 W;  1P3B A;  3C1C B;  3AZM D;  4J8W D;  3X1S D;  1S32 C;  3LJA C;  1KX3 A;  1P3M A;  4ZBJ C;  3C1B C;  1P3P B;  3LEL D;  1P3O D;  2CV5 B;  5B0Z B;  5AV9 D;  3REJ D;  5B33 D;  1P3L B;  1KX4 D;  3TU4 D; 
#chains in the Genus database with same CATH topology
 5F99 C;  2YFW B;  5GT0 A;  3W96 A;  4WU8 C;  5B1L D;  5E5A B;  4KHA B;  2ZY3 A;  3AZE D;  4XZQ B;  1M1A B;  1P3F A;  4KUD D;  5AVB D;  1HTA A;  5AVC A;  1M19 D;  2RVQ D;  3W99 D;  5BNV B;  3AZJ C;  4WU9 B;  1P3I D;  5AV8 D;  3C1C A;  3X1V B;  3EPH A;  2NQB C;  4CAY B;  4JJN D;  3UT9 B;  3A6N C;  3REI D;  1P3P A;  2CV5 A;  5B0Z A;  5GXQ C;  4DRB A;  4Z5T B;  1KX5 D;  1P3L A;  3REH B;  1P3A C;  3KSY A;  5B2J B;  4AWL B;  3AZM C;  2PYO D;  2YFW A;  2YFV B;  3R45 B;  5JRG D;  5BT1 D;  5DNM A;  5E5A A;  3O62 C;  3AV2 D;  5CPK B;  5B40 C;  5CPJ C;  1M1A A;  1ZLA C;  1U35 D;  2FJ7 B;  3MNN C;  2Y2J A;  2HUE B;  3W97 B;  3WTP B;  3MGQ D;  4KGC B;  2W8S A;  5BNV A;  4QLC A;  3LZ1 D;  4WU9 A;  1HQ3 A;  5JA4 A;  5AV5 B;  4R8P C;  4YM6 D;  1P34 C;  1M18 C;  4LD9 A;  3VH5 T;  5AV6 D;  4XUJ C;  3UT9 A;  4G91 B;  2UWX A;  3KXB C;  4ZUX D;  3AZF B;  3REL D;  1W2E A;  4H9S A;  1F66 D;  1BH9 B;  4J8W B;  3X1S B;  3X1U D;  3AN2 D;  3REH A;  5B2J A;  1P3K D;  5DNN D;  3R45 A;  1P3O B;  4J8X A;  4J8V D;  2NZD B;  5AV9 B;  3REJ B;  1KX4 B;  3TU4 B;  5CPK A;  2FJ7 A;  4X23 D;  3AZN A;  5CPI C;  3W97 A;  5BS7 A;  3WTP A;  4KGC A;  3B0C T;  5B1L B;  5BNX B;  5B2I C;  3IP4 C;  1S32 D;  3LJA D;  5AV5 A;  3AZE B;  4KUD B;  3VH6 A;  5AVB B;  3C1B D;  3AZI C;  3AZH C;  3KWQ C;  1M19 B;  3W99 B;  3V9R A;  3B6F A;  2JE5 A;  5B24 C;  3WKJ C;  1BH9 A;  5B31 A;  5AV8 B;  1P3B C;  5C3I B;  3X1S A;  5CP6 A;  5F99 D;  2XD1 A;  4JJN B;  1KX3 C;  3REI B;  4WU8 D;  3AZK B;  5GT3 B;  1P3O A;  3W98 B;  4Z66 A;  2NZD A;  2JSS A;  5AV9 A;  3REJ A;  3WA9 B;  1KX5 B;  4YS3 B;  3AL0 C;  4NFT A;  3AZJ D;  2PYO B;  1R4V A;  5GT0 C;  4H9Q B;  5JRG B;  5BNX A;  3AV2 B;  2NQB D;  3AZE A;  3A6N D;  4KUD A;  1P3F C;  1U35 B;  1WWS A;  2BYM B;  3MGQ B;  5AVC C;  5B0Y C;  1TZY B;  3W99 A;  1EQZ B;  3LZ1 B;  4YM6 B;  1TAF B;  1AOI A;  2F8N A;  1P3A D;  4G92 C;  5AV6 B;  4WNN B;  2ZY5 A;  4JJN A;  3REK C;  3REI A;  2Y2H A;  3UTA C;  3AZK A;  4NE5 A;  4ZUX B;  2F8N K;  3REL B;  5GT3 A;  5AY8 C;  3O62 D;  2L5A A;  3W98 A;  5B32 A;  5G49 A;  5B40 D;  5CPJ D;  3X1T C;  1ZLA D;  3X1U B;  3WA9 A;  3MNN D;  3B0D C;  4YS3 A;  2IO5 B;  4Z2M H;  1P3K B;  5DNN B;  3FDD A;  4H9Q A;  3LZ0 C;  1P34 D;  4R8P D;  1M18 D;  5JRG A;  3AZL C;  5DNM C;  4HGA C;  5E5A C;  3KFU G;  4XUJ D;  3AYW C;  1U35 A;  5B1M C;  3KXB D;  2BYM A;  2ARO C;  2Y2O A;  3MGQ A;  1H3O A;  1TZY A;  1ID3 C;  4WZS B;  1EQZ A;  4QLC C;  1S32 B;  3LJA B;  1HQ3 C;  4WU9 C;  1TAF A;  2Y2G A;  3MGP B;  3MGS C;  4LD9 C;  1Q9C A;  3C1B B;  5AV6 A;  4UUZ B;  3AFA B;  3REL A;  3B6G C;  4M6B A;  5CPI D;  4WU8 B;  3MVD C;  5B2I D;  1P3K A;  4J8X C;  3AZI D;  3AZH D;  3KWQ D;  3AZN C;  3AV1 B;  4KHA A;  4XZQ A;  3AZJ B;  2HIO C;  3NQU B;  5BS7 C;  5B24 D;  3WTP C;  3WKJ D;  1P3B D;  3LJA A;  2NQB B;  1KX3 D;  3A6N B;  2G5H C;  3EPK A;  3MGP A;  2CWE A;  4J8U B;  3UTB C;  3X1V A;  4UUZ A;  5GXQ B;  4CAY A;  3AFA A;  2XD5 A;  3B6F C;  3MGR B;  5B31 C;  1P3A B;  2F8N H;  5CP6 C;  3AZM B;  2LY8 A;  5GT0 D;  4Z5T A;  5GSU C;  4H9R B;  3O62 B;  1ULY A;  4Z66 C;  2RIQ A;  3AZG C;  5B40 B;  3LEL B;  5CPJ B;  2YFV A;  1P3F D;  1ZLA B;  2NZD C;  3MNN B;  3EPJ A;  5AVC D;  5B0Y D;  5B33 B;  3AV1 A;  3AZJ A;  3NQU A;  1P3G C;  1P34 B;  4R8P B;  1M18 B;  3KUY C;  4XUJ B;  3REK D;  3A6N A;  3UTA D;  4E45 A;  4EO5 C;  5AY8 D;  4J8U A;  5GXQ A;  3X1T D;  3WAA C;  3EG5 B;  3MGR A;  5KDM B;  3AZF A;  1AOI C;  5B31 G;  1F1E A;  1B67 A;  1P3I B;  3AZM A;  4J8W A;  3LZ0 D;  3VH6 T;  3AZK C;  3AZL D;  5DNM D;  1P3M C;  4H9R A;  5E5A D;  5GT3 C;  5CHL B;  3W98 C;  5B32 C;  1ZLA A;  3LEL A;  3AYW D;  2Y2P A;  3B0B A;  5B1M D;  5CPI B;  3WA9 C;  2ARO D;  4YS3 C;  1BH8 B;  5B33 A;  1KX4 A;  1ID3 D;  3TU4 A;  5B2I B;  4QLC D;  3VH5 W;  1HQ3 D;  4E44 A;  4WU9 D;  1P34 A;  3MGS D;  4LD9 D;  3W96 C;  2BYK B;  5B1L A;  3UT9 D;  3AZH B;  3KWQ B;  5B24 B;  5AVB A;  1P3B B;  3B6G D;  1M19 A;  1T3U A;  1EQZ C;  2Y2K A;  2F8N G;  3MVD D;  1P3I A;  5AV8 A;  3C1C C;  4H9P B;  4J8X D;  1P3P C;  5B32 G;  3B0C W;  4UPK A;  5B0Z C;  3AZN D;  5CPI A;  2CV5 C;  1F66 B;  2HIO D;  5GT0 B;  1BH8 A;  3WTP D;  1KX5 A;  3AN2 B;  1P3L C;  2PYO A;  1P3F B;  4J8V B;  2BYK A;  5AVC B;  5B0Y B;  3H0R C;  3KWQ A;  3UTB D;  3AV2 A;  2F2A C;  4XZQ C;  5B24 A;  4X23 B;  1M1A C;  3B6F D;  1BFM A;  5B31 D;  3F6T A;  4H9N B;  5CP6 D;  4G92 B;  5BO0 B;  2JCH A;  3REK B;  3LZ1 A;  5GSU D;  3MGP C;  4YM6 A;  3UTA B;  4ZBJ B;  5AY8 B;  3EPL A;  4H9P A;  3X1V C;  4Z66 D;  3AZG D;  3X1T B;  4WNN A;  3AFA C;  3UT9 C;  2NZD D;  2G5I C;  3B0D B;  4ZUX A;  4H9S C;  1F66 A;  3X1U A;  1P3G D;  3LZ0 B;  5FUG B;  4Z5T C;  5F99 B;  3AN2 A;  3REH C;  3AZL B;  5DNM B;  1KU5 A;  4HGA B;  5B2J C;  3KUY D;  4AWL C;  5DNN A;  3AYW B;  4DRA A;  5B1M B;  4J8V A;  2ARO B;  4NE3 A;  5B0Y A;  3AV1 C;  1ID3 B;  1PZR A;  3H0M C;  5CPK C;  2FJ7 C;  3WAA D;  4X23 A;  3H0L C;  4QLC B;  1HQ3 B;  1N1J B;  5JA4 B;  1AOI D;  3W97 C;  2HUE C;  2F8N D;  4KGC C;  3MGS B;  4H9N A;  4LD9 B;  5BO0 A;  3REK A;  2VQR A;  3UTA A;  1S32 A;  5AV5 C;  3AZK D;  1P3M D;  5AY8 A;  5GT3 D;  4J8U C;  2ZY2 A;  3C1B A;  3A1I A;  3W98 D;  5B32 D;  4WV4 B;  3X1T A;  3B6G B;  4G91 C;  3WTP E;  3MGR C;  3WA9 D;  4YS3 D;  3AZF C;  3MVD B;  4NE6 A;  2DF4 C;  2Y2L A;  4J8W C;  3X1S C;  3LZ0 A;  2BG1 A;  5FUG A;  4J8X B;  5F99 A;  4CSR B;  3AZL A;  4WU8 A;  3W96 D;  4Z2M G;  3LEL C;  3AYW A;  1P3O C;  3AZN B;  5B1M A;  3VH5 A;  2ARO A;  2HIO B;  5AV9 C;  3REJ C;  5B33 C;  1TZY D;  1ID3 A;  1KX4 C;  3TU4 C;  1Z2C B;  1EQZ D;  1N1J A;  3MGS A;  3P5J B;  3C1C D;  5B1L C;  3UTB B;  3V9R B;  2NQB A;  3AZE C;  3B6F B;  4KUD C;  3KXB B;  5B31 B;  5AVB C;  1P3P D;  3B6G A;  2CV5 D;  5B0Z D;  1M19 C;  5CP6 B;  2RVQ C;  3W99 C;  4H9O B;  2DQN C;  2FFF B;  5GSU B;  3MVD A;  1P3L D;  1P3I C;  5AV8 C;  1P3A A;  5C3I C;  2Y2Q A;  4Z66 B;  3AZG B;  1JFI B;  4JJN C;  4CSR A;  3REI C;  1WWI A;  3O62 A;  5B40 A;  4XZQ D;  2HIO A;  5CPJ A;  1M1A D;  1P3G B;  3MNN A;  1KX5 C;  3KUY B;  2Y2M A;  2PYO C;  3MGP D;  4R8P A;  1M18 A;  5JRG C;  3NQJ B;  4EO5 B;  5BT1 C;  3UTB A;  3X1V D;  3AV2 C;  4XUJ A;  3AFA D;  3AZI B;  2ZY4 A;  3WAA B;  1U35 C;  3KXB A;  1AOI B;  2F8N B;  3MGQ C;  3WKJ B;  1TZY C;  4H9O A;  5GSU A;  4Z5T D;  5KDM A;  4YM6 C;  3LZ1 C;  1KX3 B;  3REH D;  1P3M B;  5B2J D;  2Y2N A;  3AZG A;  5B32 B;  5G49 B;  5AV6 C;  1JFI A;  4ZUX C;  3REL C;  3AV1 D;  1F66 C;  5CPK D;  2FJ7 D;  3X1U C;  1B6W A;  1P3G A;  3W97 D;  3AN2 C;  2IO5 C;  4KGC D;  1A7W A;  3W96 B;  3KUY A;  5B2I A;  1P3K C;  5DNN C;  2Y2I A;  5AV5 D;  4J8V C;  3NQJ A;  4J8U D;  1H3O B;  4WJ3 C;  5GXQ D;  3AZI A;  3WAA A;  3AZH A;  4X23 C;  3MGR D;  2J8P A;  3AZF D;  3WKJ A;  3VH6 W;  3A1K A;  1P3B A;  3C1C B;  3AZM D;  4J8W D;  3X1S D;  1S32 C;  3LJA C;  1KX3 A;  4DQY B;  1P3M A;  4ZBJ C;  3C1B C;  1P3P B;  3LEL D;  1P3O D;  2CV5 B;  5B0Z B;  2ZM5 A;  5AV9 D;  3REJ D;  5B33 D;  1P3L B;  1KX4 D;  3TU4 D; 
#chains in the Genus database with same CATH homology
 5F99 C;  2YFW B;  5GT0 A;  3W96 A;  4WU8 C;  5B1L D;  5E5A B;  4KHA B;  2ZY3 A;  3AZE D;  4XZQ B;  1M1A B;  1P3F A;  4KUD D;  5AVB D;  1HTA A;  5AVC A;  1M19 D;  2RVQ D;  3W99 D;  5BNV B;  3AZJ C;  4WU9 B;  1P3I D;  5AV8 D;  3C1C A;  3X1V B;  3EPH A;  2NQB C;  4CAY B;  4JJN D;  3UT9 B;  3A6N C;  3REI D;  1P3P A;  2CV5 A;  5B0Z A;  5GXQ C;  4DRB A;  4Z5T B;  1KX5 D;  1P3L A;  3REH B;  1P3A C;  3KSY A;  5B2J B;  4AWL B;  3AZM C;  2PYO D;  2YFW A;  2YFV B;  3R45 B;  5JRG D;  5BT1 D;  5DNM A;  5E5A A;  3O62 C;  3AV2 D;  5CPK B;  5B40 C;  5CPJ C;  1M1A A;  1ZLA C;  1U35 D;  2FJ7 B;  3MNN C;  2Y2J A;  2HUE B;  3W97 B;  3WTP B;  3MGQ D;  4KGC B;  2W8S A;  5BNV A;  4QLC A;  3LZ1 D;  4WU9 A;  1HQ3 A;  5JA4 A;  5AV5 B;  4R8P C;  4YM6 D;  1P34 C;  1M18 C;  4LD9 A;  3VH5 T;  5AV6 D;  4XUJ C;  3UT9 A;  4G91 B;  2UWX A;  3KXB C;  4ZUX D;  3AZF B;  3REL D;  1W2E A;  4H9S A;  1F66 D;  1BH9 B;  4J8W B;  3X1S B;  3X1U D;  3AN2 D;  3REH A;  5B2J A;  1P3K D;  5DNN D;  3R45 A;  1P3O B;  4J8X A;  4J8V D;  2NZD B;  5AV9 B;  3REJ B;  1KX4 B;  3TU4 B;  5CPK A;  2FJ7 A;  4X23 D;  3AZN A;  5CPI C;  3W97 A;  5BS7 A;  3WTP A;  4KGC A;  3B0C T;  5B1L B;  5BNX B;  5B2I C;  3IP4 C;  1S32 D;  3LJA D;  5AV5 A;  3AZE B;  4KUD B;  3VH6 A;  5AVB B;  3C1B D;  3AZI C;  3AZH C;  3KWQ C;  1M19 B;  3W99 B;  3V9R A;  3B6F A;  2JE5 A;  5B24 C;  3WKJ C;  1BH9 A;  5B31 A;  5AV8 B;  1P3B C;  5C3I B;  3X1S A;  5CP6 A;  5F99 D;  2XD1 A;  4JJN B;  1KX3 C;  3REI B;  4WU8 D;  3AZK B;  5GT3 B;  1P3O A;  3W98 B;  4Z66 A;  2NZD A;  2JSS A;  5AV9 A;  3REJ A;  3WA9 B;  1KX5 B;  4YS3 B;  3AL0 C;  4NFT A;  3AZJ D;  2PYO B;  1R4V A;  5GT0 C;  4H9Q B;  5JRG B;  5BNX A;  3AV2 B;  2NQB D;  3AZE A;  3A6N D;  4KUD A;  1P3F C;  1U35 B;  1WWS A;  2BYM B;  3MGQ B;  5AVC C;  5B0Y C;  1TZY B;  3W99 A;  1EQZ B;  3LZ1 B;  4YM6 B;  1TAF B;  1AOI A;  2F8N A;  1P3A D;  4G92 C;  5AV6 B;  4WNN B;  2ZY5 A;  4JJN A;  3REK C;  3REI A;  2Y2H A;  3UTA C;  3AZK A;  4NE5 A;  4ZUX B;  2F8N K;  3REL B;  5GT3 A;  5AY8 C;  3O62 D;  2L5A A;  3W98 A;  5B32 A;  5G49 A;  5B40 D;  5CPJ D;  3X1T C;  1ZLA D;  3X1U B;  3WA9 A;  3MNN D;  3B0D C;  4YS3 A;  2IO5 B;  4Z2M H;  1P3K B;  5DNN B;  3FDD A;  4H9Q A;  3LZ0 C;  1P34 D;  4R8P D;  1M18 D;  5JRG A;  3AZL C;  5DNM C;  4HGA C;  5E5A C;  3KFU G;  4XUJ D;  3AYW C;  1U35 A;  5B1M C;  3KXB D;  2BYM A;  2ARO C;  2Y2O A;  3MGQ A;  1H3O A;  1TZY A;  1ID3 C;  4WZS B;  1EQZ A;  4QLC C;  1S32 B;  3LJA B;  1HQ3 C;  4WU9 C;  1TAF A;  2Y2G A;  3MGP B;  3MGS C;  4LD9 C;  1Q9C A;  3C1B B;  5AV6 A;  4UUZ B;  3AFA B;  3REL A;  3B6G C;  4M6B A;  5CPI D;  4WU8 B;  3MVD C;  5B2I D;  1P3K A;  4J8X C;  3AZI D;  3AZH D;  3KWQ D;  3AZN C;  3AV1 B;  4KHA A;  4XZQ A;  3AZJ B;  2HIO C;  3NQU B;  5BS7 C;  5B24 D;  3WTP C;  3WKJ D;  1P3B D;  3LJA A;  2NQB B;  1KX3 D;  3A6N B;  2G5H C;  3EPK A;  3MGP A;  2CWE A;  4J8U B;  3UTB C;  3X1V A;  4UUZ A;  5GXQ B;  4CAY A;  3AFA A;  2XD5 A;  3B6F C;  3MGR B;  5B31 C;  1P3A B;  2F8N H;  5CP6 C;  3AZM B;  2LY8 A;  5GT0 D;  4Z5T A;  5GSU C;  4H9R B;  3O62 B;  1ULY A;  4Z66 C;  2RIQ A;  3AZG C;  5B40 B;  3LEL B;  5CPJ B;  2YFV A;  1P3F D;  1ZLA B;  2NZD C;  3MNN B;  3EPJ A;  5AVC D;  5B0Y D;  5B33 B;  3AV1 A;  3AZJ A;  3NQU A;  1P3G C;  1P34 B;  4R8P B;  1M18 B;  3KUY C;  4XUJ B;  3REK D;  3A6N A;  3UTA D;  4E45 A;  4EO5 C;  5AY8 D;  4J8U A;  5GXQ A;  3X1T D;  3WAA C;  3EG5 B;  3MGR A;  5KDM B;  3AZF A;  1AOI C;  5B31 G;  1F1E A;  1B67 A;  1P3I B;  3AZM A;  4J8W A;  3LZ0 D;  3VH6 T;  3AZK C;  3AZL D;  5DNM D;  1P3M C;  4H9R A;  5E5A D;  5GT3 C;  5CHL B;  3W98 C;  5B32 C;  1ZLA A;  3LEL A;  3AYW D;  2Y2P A;  3B0B A;  5B1M D;  5CPI B;  3WA9 C;  2ARO D;  4YS3 C;  1BH8 B;  5B33 A;  1KX4 A;  1ID3 D;  3TU4 A;  5B2I B;  4QLC D;  3VH5 W;  1HQ3 D;  4E44 A;  4WU9 D;  1P34 A;  3MGS D;  4LD9 D;  3W96 C;  2BYK B;  5B1L A;  3UT9 D;  3AZH B;  3KWQ B;  5B24 B;  5AVB A;  1P3B B;  3B6G D;  1M19 A;  1T3U A;  1EQZ C;  2Y2K A;  2F8N G;  3MVD D;  1P3I A;  5AV8 A;  3C1C C;  4H9P B;  4J8X D;  1P3P C;  5B32 G;  3B0C W;  4UPK A;  5B0Z C;  3AZN D;  5CPI A;  2CV5 C;  1F66 B;  2HIO D;  5GT0 B;  1BH8 A;  3WTP D;  1KX5 A;  3AN2 B;  1P3L C;  2PYO A;  1P3F B;  4J8V B;  2BYK A;  5AVC B;  5B0Y B;  3H0R C;  3KWQ A;  3UTB D;  3AV2 A;  2F2A C;  4XZQ C;  5B24 A;  4X23 B;  1M1A C;  3B6F D;  1BFM A;  5B31 D;  3F6T A;  4H9N B;  5CP6 D;  4G92 B;  5BO0 B;  2JCH A;  3REK B;  3LZ1 A;  5GSU D;  3MGP C;  4YM6 A;  3UTA B;  4ZBJ B;  5AY8 B;  3EPL A;  4H9P A;  3X1V C;  4Z66 D;  3AZG D;  3X1T B;  4WNN A;  3AFA C;  3UT9 C;  2NZD D;  2G5I C;  3B0D B;  4ZUX A;  4H9S C;  1F66 A;  3X1U A;  1P3G D;  3LZ0 B;  5FUG B;  4Z5T C;  5F99 B;  3AN2 A;  3REH C;  3AZL B;  5DNM B;  1KU5 A;  4HGA B;  5B2J C;  3KUY D;  4AWL C;  5DNN A;  3AYW B;  4DRA A;  5B1M B;  4J8V A;  2ARO B;  4NE3 A;  5B0Y A;  3AV1 C;  1ID3 B;  1PZR A;  3H0M C;  5CPK C;  2FJ7 C;  3WAA D;  4X23 A;  3H0L C;  4QLC B;  1HQ3 B;  1N1J B;  5JA4 B;  1AOI D;  3W97 C;  2HUE C;  2F8N D;  4KGC C;  3MGS B;  4H9N A;  4LD9 B;  5BO0 A;  3REK A;  2VQR A;  3UTA A;  1S32 A;  5AV5 C;  3AZK D;  1P3M D;  5AY8 A;  5GT3 D;  4J8U C;  2ZY2 A;  3C1B A;  3A1I A;  3W98 D;  5B32 D;  4WV4 B;  3X1T A;  3B6G B;  4G91 C;  3WTP E;  3MGR C;  3WA9 D;  4YS3 D;  3AZF C;  3MVD B;  4NE6 A;  2DF4 C;  2Y2L A;  4J8W C;  3X1S C;  3LZ0 A;  2BG1 A;  5FUG A;  4J8X B;  5F99 A;  4CSR B;  3AZL A;  4WU8 A;  3W96 D;  4Z2M G;  3LEL C;  3AYW A;  1P3O C;  3AZN B;  5B1M A;  3VH5 A;  2ARO A;  2HIO B;  5AV9 C;  3REJ C;  5B33 C;  1TZY D;  1ID3 A;  1KX4 C;  3TU4 C;  1Z2C B;  1EQZ D;  1N1J A;  3MGS A;  3P5J B;  3C1C D;  5B1L C;  3UTB B;  3V9R B;  2NQB A;  3AZE C;  3B6F B;  4KUD C;  3KXB B;  5B31 B;  5AVB C;  1P3P D;  3B6G A;  2CV5 D;  5B0Z D;  1M19 C;  5CP6 B;  2RVQ C;  3W99 C;  4H9O B;  2DQN C;  2FFF B;  5GSU B;  3MVD A;  1P3L D;  1P3I C;  5AV8 C;  1P3A A;  5C3I C;  2Y2Q A;  4Z66 B;  3AZG B;  1JFI B;  4JJN C;  4CSR A;  3REI C;  1WWI A;  3O62 A;  5B40 A;  4XZQ D;  2HIO A;  5CPJ A;  1M1A D;  1P3G B;  3MNN A;  1KX5 C;  3KUY B;  2Y2M A;  2PYO C;  3MGP D;  4R8P A;  1M18 A;  5JRG C;  3NQJ B;  4EO5 B;  5BT1 C;  3UTB A;  3X1V D;  3AV2 C;  4XUJ A;  3AFA D;  3AZI B;  2ZY4 A;  3WAA B;  1U35 C;  3KXB A;  1AOI B;  2F8N B;  3MGQ C;  3WKJ B;  1TZY C;  4H9O A;  5GSU A;  4Z5T D;  5KDM A;  4YM6 C;  3LZ1 C;  1KX3 B;  3REH D;  1P3M B;  5B2J D;  2Y2N A;  3AZG A;  5B32 B;  5G49 B;  5AV6 C;  1JFI A;  4ZUX C;  3REL C;  3AV1 D;  1F66 C;  5CPK D;  2FJ7 D;  3X1U C;  1B6W A;  1P3G A;  3W97 D;  3AN2 C;  2IO5 C;  4KGC D;  1A7W A;  3W96 B;  3KUY A;  5B2I A;  1P3K C;  5DNN C;  2Y2I A;  5AV5 D;  4J8V C;  3NQJ A;  4J8U D;  1H3O B;  4WJ3 C;  5GXQ D;  3AZI A;  3WAA A;  3AZH A;  4X23 C;  3MGR D;  2J8P A;  3AZF D;  3WKJ A;  3VH6 W;  3A1K A;  1P3B A;  3C1C B;  3AZM D;  4J8W D;  3X1S D;  1S32 C;  3LJA C;  1KX3 A;  4DQY B;  1P3M A;  4ZBJ C;  3C1B C;  1P3P B;  3LEL D;  1P3O D;  2CV5 B;  5B0Z B;  2ZM5 A;  5AV9 D;  3REJ D;  5B33 D;  1P3L B;  1KX4 D;  3TU4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...